BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1194_g1_i1 len=2316 path=[2:0-55 58:56-2315]

Length=2316
                                                                      Score     E

ref|XP_009789586.1|  PREDICTED: pentatricopeptide repeat-containi...    849   0.0      
ref|XP_009603085.1|  PREDICTED: pentatricopeptide repeat-containi...    843   0.0      
ref|XP_006340477.1|  PREDICTED: pentatricopeptide repeat-containi...    838   0.0      
ref|XP_010319820.1|  PREDICTED: pentatricopeptide repeat-containi...    837   0.0      
ref|XP_011099085.1|  PREDICTED: pentatricopeptide repeat-containi...    824   0.0      
emb|CDP02378.1|  unnamed protein product                                805   0.0      
ref|XP_010660523.1|  PREDICTED: pentatricopeptide repeat-containi...    785   0.0      
emb|CAN75614.1|  hypothetical protein VITISV_022293                     782   0.0      Vitis vinifera
ref|XP_011021152.1|  PREDICTED: pentatricopeptide repeat-containi...    780   0.0      
ref|XP_006373499.1|  hypothetical protein POPTR_0017s14300g             779   0.0      
ref|XP_011013222.1|  PREDICTED: pentatricopeptide repeat-containi...    775   0.0      
ref|XP_006430873.1|  hypothetical protein CICLE_v10011342mg             774   0.0      
ref|XP_002532893.1|  pentatricopeptide repeat-containing protein,...    773   0.0      Ricinus communis
ref|XP_006482334.1|  PREDICTED: pentatricopeptide repeat-containi...    770   0.0      
gb|KDO58883.1|  hypothetical protein CISIN_1g048533mg                   770   0.0      
ref|XP_007208255.1|  hypothetical protein PRUPE_ppa016546mg             769   0.0      
ref|XP_008233899.1|  PREDICTED: pentatricopeptide repeat-containi...    768   0.0      
ref|XP_004288209.1|  PREDICTED: pentatricopeptide repeat-containi...    758   0.0      
ref|XP_007033427.1|  Tetratricopeptide repeat (TPR)-like superfam...    748   0.0      
ref|XP_010029448.1|  PREDICTED: pentatricopeptide repeat-containi...    745   0.0      
ref|XP_008338591.1|  PREDICTED: pentatricopeptide repeat-containi...    744   0.0      
ref|XP_009340504.1|  PREDICTED: pentatricopeptide repeat-containi...    744   0.0      
ref|XP_009338086.1|  PREDICTED: pentatricopeptide repeat-containi...    741   0.0      
ref|XP_004140465.1|  PREDICTED: pentatricopeptide repeat-containi...    739   0.0      
ref|XP_008465224.1|  PREDICTED: pentatricopeptide repeat-containi...    738   0.0      
ref|XP_010675446.1|  PREDICTED: pentatricopeptide repeat-containi...    738   0.0      
ref|XP_010100903.1|  hypothetical protein L484_009673                   736   0.0      
ref|XP_006594395.1|  PREDICTED: pentatricopeptide repeat-containi...    731   0.0      
ref|XP_003545840.1|  PREDICTED: pentatricopeptide repeat-containi...    728   0.0      
ref|XP_010248801.1|  PREDICTED: pentatricopeptide repeat-containi...    728   0.0      
ref|XP_004511038.1|  PREDICTED: pentatricopeptide repeat-containi...    717   0.0      
gb|EPS67755.1|  hypothetical protein M569_07017                         712   0.0      
ref|XP_007133767.1|  hypothetical protein PHAVU_011G207300g             710   0.0      
ref|XP_010528449.1|  PREDICTED: pentatricopeptide repeat-containi...    706   0.0      
ref|XP_006594401.1|  PREDICTED: pentatricopeptide repeat-containi...    702   0.0      
ref|XP_003627859.1|  Pentatricopeptide repeat-containing protein        704   0.0      
ref|XP_010450873.1|  PREDICTED: pentatricopeptide repeat-containi...    694   0.0      
ref|XP_008802748.1|  PREDICTED: pentatricopeptide repeat-containi...    692   0.0      
ref|XP_010440983.1|  PREDICTED: pentatricopeptide repeat-containi...    691   0.0      
ref|NP_198689.1|  pentatricopeptide repeat-containing protein           684   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282941.1|  hypothetical protein CARUB_v10007510mg             681   0.0      
ref|XP_006405706.1|  hypothetical protein EUTSA_v10028323mg             681   0.0      
ref|XP_002870827.1|  pentatricopeptide repeat-containing protein        677   0.0      
ref|XP_010935587.1|  PREDICTED: pentatricopeptide repeat-containi...    673   0.0      
ref|XP_009139805.1|  PREDICTED: pentatricopeptide repeat-containi...    669   0.0      
emb|CDY67116.1|  BnaCnng53650D                                          665   0.0      
gb|KHN37665.1|  Pentatricopeptide repeat-containing protein             641   0.0      
ref|XP_009398337.1|  PREDICTED: pentatricopeptide repeat-containi...    645   0.0      
emb|CBI16890.3|  unnamed protein product                                594   0.0      
ref|XP_010248809.1|  PREDICTED: pentatricopeptide repeat-containi...    562   0.0      
gb|KHN27334.1|  Pentatricopeptide repeat-containing protein             511   2e-171   
ref|XP_008646443.1|  PREDICTED: pentatricopeptide repeat-containi...    489   6e-160   
dbj|BAK03031.1|  predicted protein                                      474   5e-154   
ref|XP_002454820.1|  hypothetical protein SORBIDRAFT_04g038070          473   1e-153   Sorghum bicolor [broomcorn]
dbj|BAD23061.1|  UDP-glucoronosyl/UDP-glucosyl transferase family...    466   4e-151   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573143.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    464   4e-150   
gb|EMT10404.1|  hypothetical protein F775_08842                         450   9e-147   
ref|XP_006649194.1|  PREDICTED: pentatricopeptide repeat-containi...    441   2e-143   
gb|EEC74287.1|  hypothetical protein OsI_09537                          446   7e-142   Oryza sativa Indica Group [Indian rice]
gb|EMS68666.1|  hypothetical protein TRIUR3_04820                       411   2e-129   
gb|EAZ25167.1|  hypothetical protein OsJ_08968                          400   3e-126   Oryza sativa Japonica Group [Japonica rice]
gb|KDP24342.1|  hypothetical protein JCGZ_25638                         309   1e-95    
ref|XP_006848652.1|  hypothetical protein AMTR_s00171p00059700          306   1e-93    
ref|XP_006482079.1|  PREDICTED: putative pentatricopeptide repeat...    286   1e-82    
ref|XP_006430553.1|  hypothetical protein CICLE_v10011347mg             285   5e-82    
ref|XP_008229438.1|  PREDICTED: putative pentatricopeptide repeat...    284   1e-81    
ref|XP_007217406.1|  hypothetical protein PRUPE_ppa024153mg             282   7e-81    
gb|EPS72925.1|  hypothetical protein M569_01830                         280   3e-80    
ref|XP_009370553.1|  PREDICTED: putative pentatricopeptide repeat...    279   9e-80    
ref|XP_006854103.1|  hypothetical protein AMTR_s00048p00141020          277   5e-79    
gb|EYU42661.1|  hypothetical protein MIMGU_mgv1a020055mg                280   6e-79    
ref|XP_008457121.1|  PREDICTED: putative pentatricopeptide repeat...    276   6e-79    
ref|XP_002263590.1|  PREDICTED: putative pentatricopeptide repeat...    276   9e-79    Vitis vinifera
ref|XP_008362531.1|  PREDICTED: putative pentatricopeptide repeat...    276   1e-78    
ref|XP_004140820.1|  PREDICTED: putative pentatricopeptide repeat...    275   1e-78    
ref|XP_003518371.1|  PREDICTED: putative pentatricopeptide repeat...    276   2e-78    
ref|XP_006828912.1|  hypothetical protein AMTR_s00001p00203780          274   4e-78    
ref|XP_010276630.1|  PREDICTED: pentatricopeptide repeat-containi...    277   7e-78    
ref|XP_010062285.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    273   1e-77    
ref|XP_009345567.1|  PREDICTED: pentatricopeptide repeat-containi...    276   3e-77    
emb|CAN83994.1|  hypothetical protein VITISV_031191                     271   4e-77    Vitis vinifera
ref|XP_006849567.1|  hypothetical protein AMTR_s00024p00183850          271   1e-76    
ref|XP_004168332.1|  PREDICTED: putative pentatricopeptide repeat...    270   1e-76    
ref|XP_006338777.1|  PREDICTED: pentatricopeptide repeat-containi...    273   1e-76    
ref|XP_009361375.1|  PREDICTED: pentatricopeptide repeat-containi...    273   2e-76    
gb|KDP46186.1|  hypothetical protein JCGZ_10026                         270   7e-76    
gb|EYU45778.1|  hypothetical protein MIMGU_mgv1a023474mg                267   1e-75    
ref|XP_007141926.1|  hypothetical protein PHAVU_008G237700g             268   1e-75    
ref|XP_009412297.1|  PREDICTED: putative pentatricopeptide repeat...    275   2e-75    
emb|CDP08449.1|  unnamed protein product                                269   4e-75    
ref|XP_010907418.1|  PREDICTED: pentatricopeptide repeat-containi...    268   7e-75    
ref|XP_002275790.2|  PREDICTED: pentatricopeptide repeat-containi...    269   8e-75    Vitis vinifera
ref|XP_008375656.1|  PREDICTED: pentatricopeptide repeat-containi...    268   1e-74    
ref|XP_007032116.1|  Pentatricopeptide repeat superfamily protein       266   2e-74    
ref|XP_003616261.1|  Pentatricopeptide repeat-containing protein        269   2e-74    
ref|XP_004237581.1|  PREDICTED: pentatricopeptide repeat-containi...    267   3e-74    
ref|XP_007201524.1|  hypothetical protein PRUPE_ppa015625mg             262   3e-74    
ref|XP_010673744.1|  PREDICTED: pentatricopeptide repeat-containi...    266   6e-74    
ref|XP_009625742.1|  PREDICTED: pentatricopeptide repeat-containi...    266   8e-74    
emb|CAN63985.1|  hypothetical protein VITISV_001389                     268   8e-74    Vitis vinifera
ref|XP_006417549.1|  hypothetical protein EUTSA_v10007116mg             262   1e-73    
emb|CDP06762.1|  unnamed protein product                                262   2e-73    
gb|EPS66849.1|  hypothetical protein M569_07924                         264   3e-73    
ref|XP_009781997.1|  PREDICTED: pentatricopeptide repeat-containi...    263   7e-73    
ref|XP_008232168.1|  PREDICTED: pentatricopeptide repeat-containi...    263   7e-73    
ref|XP_009413406.1|  PREDICTED: pentatricopeptide repeat-containi...    261   7e-73    
ref|XP_010528566.1|  PREDICTED: putative pentatricopeptide repeat...    260   7e-73    
ref|XP_010253962.1|  PREDICTED: pentatricopeptide repeat-containi...    260   1e-72    
ref|XP_011085872.1|  PREDICTED: putative pentatricopeptide repeat...    259   1e-72    
ref|XP_009406650.1|  PREDICTED: putative pentatricopeptide repeat...    259   1e-72    
ref|XP_008790931.1|  PREDICTED: pentatricopeptide repeat-containi...    263   2e-72    
ref|XP_004490829.1|  PREDICTED: putative pentatricopeptide repeat...    259   2e-72    
ref|XP_008797845.1|  PREDICTED: pentatricopeptide repeat-containi...    260   2e-72    
ref|XP_009596549.1|  PREDICTED: pentatricopeptide repeat-containi...    263   2e-72    
ref|XP_008237676.1|  PREDICTED: pentatricopeptide repeat-containi...    259   3e-72    
ref|XP_007042371.1|  Tetratricopeptide repeat (TPR)-like superfam...    261   4e-72    
emb|CDX94959.1|  BnaC05g07120D                                          257   8e-72    
ref|XP_011092729.1|  PREDICTED: pentatricopeptide repeat-containi...    261   9e-72    
ref|XP_010452022.1|  PREDICTED: pentatricopeptide repeat-containi...    260   1e-71    
ref|XP_006372553.1|  pentatricopeptide repeat-containing family p...    257   1e-71    
ref|XP_010490605.1|  PREDICTED: pentatricopeptide repeat-containi...    260   1e-71    
ref|XP_010452023.1|  PREDICTED: pentatricopeptide repeat-containi...    260   1e-71    
ref|XP_002281859.2|  PREDICTED: putative pentatricopeptide repeat...    263   2e-71    Vitis vinifera
ref|XP_006303935.1|  hypothetical protein CARUB_v10008618mg             256   2e-71    
emb|CAN66818.1|  hypothetical protein VITISV_004776                     263   2e-71    Vitis vinifera
ref|XP_007015298.1|  Tetratricopeptide repeat (TPR)-like superfam...    259   3e-71    
emb|CBI19634.3|  unnamed protein product                                261   3e-71    
ref|XP_010423914.1|  PREDICTED: pentatricopeptide repeat-containi...    259   3e-71    
ref|XP_009385400.1|  PREDICTED: pentatricopeptide repeat-containi...    258   3e-71    
ref|XP_009148267.1|  PREDICTED: putative pentatricopeptide repeat...    255   4e-71    
ref|XP_007161634.1|  hypothetical protein PHAVU_001G085800g             256   4e-71    
emb|CDX93490.1|  BnaA06g05580D                                          255   4e-71    
ref|XP_006446275.1|  hypothetical protein CICLE_v10017597mg             258   5e-71    
ref|XP_011001554.1|  PREDICTED: putative pentatricopeptide repeat...    255   6e-71    
gb|KDO54845.1|  hypothetical protein CISIN_1g004758mg                   258   7e-71    
ref|XP_009801387.1|  PREDICTED: pentatricopeptide repeat-containi...    258   7e-71    
gb|KHG06670.1|  hypothetical protein F383_33889                         255   7e-71    
ref|XP_006423135.1|  hypothetical protein CICLE_v10030406mg             256   8e-71    
ref|NP_172439.1|  pentatricopeptide repeat-containing protein           254   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006470579.1|  PREDICTED: pentatricopeptide repeat-containi...    258   1e-70    
ref|XP_002519129.1|  pentatricopeptide repeat-containing protein,...    255   2e-70    Ricinus communis
ref|XP_002870941.1|  pentatricopeptide repeat-containing protein        256   2e-70    
ref|XP_010936986.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-70    
gb|KCW69399.1|  hypothetical protein EUGRSUZ_F02875                     253   2e-70    
ref|XP_006856131.1|  hypothetical protein AMTR_s00059p00156460          259   2e-70    
ref|XP_009614927.1|  PREDICTED: pentatricopeptide repeat-containi...    253   4e-70    
ref|XP_004491249.1|  PREDICTED: pentatricopeptide repeat-containi...    255   4e-70    
ref|XP_006287148.1|  hypothetical protein CARUB_v10000318mg             255   4e-70    
ref|XP_008776298.1|  PREDICTED: pentatricopeptide repeat-containi...    253   5e-70    
gb|KCW55237.1|  hypothetical protein EUGRSUZ_I01171                     251   7e-70    
ref|NP_195731.1|  pentatricopeptide repeat-containing protein           255   7e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010272059.1|  PREDICTED: pentatricopeptide repeat-containi...    255   7e-70    
ref|XP_008790235.1|  PREDICTED: putative pentatricopeptide repeat...    258   1e-69    
gb|KEH30569.1|  PPR containing plant-like protein                       251   1e-69    
ref|XP_004159923.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    254   2e-69    
gb|EYU35942.1|  hypothetical protein MIMGU_mgv1a002651mg                252   2e-69    
emb|CDO97115.1|  unnamed protein product                                252   2e-69    
ref|XP_007219118.1|  hypothetical protein PRUPE_ppa015795mg             248   2e-69    
ref|XP_004288599.1|  PREDICTED: putative pentatricopeptide repeat...    250   2e-69    
ref|XP_010028496.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-69    
ref|XP_010099493.1|  hypothetical protein L484_000446                   254   2e-69    
gb|KDP23384.1|  hypothetical protein JCGZ_23217                         251   2e-69    
ref|XP_010031042.1|  PREDICTED: pentatricopeptide repeat-containi...    251   2e-69    
ref|XP_010108616.1|  hypothetical protein L484_000854                   254   3e-69    
ref|XP_010939783.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-69    
ref|XP_004137116.1|  PREDICTED: pentatricopeptide repeat-containi...    253   3e-69    
ref|XP_010673746.1|  PREDICTED: pentatricopeptide repeat-containi...    252   4e-69    
ref|XP_009625746.1|  PREDICTED: pentatricopeptide repeat-containi...    250   4e-69    
gb|ACU25588.1|  pentatricopeptide repeat-containing protein             244   6e-69    Neosparton ephedroides
ref|XP_003540687.1|  PREDICTED: pentatricopeptide repeat-containi...    249   7e-69    
emb|CBI20053.3|  unnamed protein product                                250   8e-69    
gb|ACU25590.1|  pentatricopeptide repeat-containing protein             244   9e-69    Priva cordifolia
ref|XP_011092144.1|  PREDICTED: pentatricopeptide repeat-containi...    249   9e-69    
ref|XP_010665243.1|  PREDICTED: pentatricopeptide repeat-containi...    256   1e-68    
ref|XP_006848653.1|  hypothetical protein AMTR_s00171p00059960          238   1e-68    
ref|XP_008454928.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    252   1e-68    
ref|XP_009782000.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-68    
ref|XP_010056850.1|  PREDICTED: pentatricopeptide repeat-containi...    250   1e-68    
ref|XP_008368150.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-68    
gb|AET00269.2|  PPR containing plant-like protein                       251   1e-68    
ref|XP_010103460.1|  hypothetical protein L484_004954                   249   1e-68    
ref|XP_003617310.1|  Pentatricopeptide repeat-containing protein        251   1e-68    
ref|XP_002269015.2|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-68    Vitis vinifera
ref|XP_008454893.1|  PREDICTED: pentatricopeptide repeat-containi...    248   2e-68    
emb|CBI39592.3|  unnamed protein product                                247   2e-68    
ref|XP_006384483.1|  hypothetical protein POPTR_0004s15480g             246   3e-68    
ref|XP_010105594.1|  hypothetical protein L484_003967                   248   3e-68    
ref|XP_008454892.1|  PREDICTED: pentatricopeptide repeat-containi...    248   3e-68    
gb|KGN57460.1|  hypothetical protein Csa_3G188330                       246   3e-68    
ref|XP_010475809.1|  PREDICTED: putative pentatricopeptide repeat...    247   3e-68    
ref|XP_010936130.1|  PREDICTED: putative pentatricopeptide repeat...    253   3e-68    
ref|XP_004293147.1|  PREDICTED: pentatricopeptide repeat-containi...    250   4e-68    
ref|XP_006346504.1|  PREDICTED: pentatricopeptide repeat-containi...    248   4e-68    
ref|XP_010690978.1|  PREDICTED: pentatricopeptide repeat-containi...    248   4e-68    
ref|XP_006858479.1|  hypothetical protein AMTR_s00071p00119440          247   5e-68    
ref|XP_006423060.1|  hypothetical protein CICLE_v10028118mg             246   5e-68    
emb|CAN75473.1|  hypothetical protein VITISV_002797                     255   5e-68    Vitis vinifera
ref|XP_006398651.1|  hypothetical protein EUTSA_v10012778mg             249   6e-68    
ref|XP_010048714.1|  PREDICTED: pentatricopeptide repeat-containi...    249   6e-68    
gb|EYU39304.1|  hypothetical protein MIMGU_mgv1a003134mg                247   6e-68    
ref|XP_006480134.1|  PREDICTED: pentatricopeptide repeat-containi...    250   6e-68    
ref|XP_004230838.1|  PREDICTED: pentatricopeptide repeat-containi...    247   7e-68    
ref|XP_004292451.1|  PREDICTED: pentatricopeptide repeat-containi...    249   7e-68    
ref|XP_003609027.1|  Pentatricopeptide repeat-containing protein        246   8e-68    
ref|XP_009347418.1|  PREDICTED: pentatricopeptide repeat-containi...    249   8e-68    
ref|XP_008343256.1|  PREDICTED: putative pentatricopeptide repeat...    245   9e-68    
gb|ACU25587.1|  pentatricopeptide repeat-containing protein             241   9e-68    Lampayo castellani
ref|XP_006398652.1|  hypothetical protein EUTSA_v10012778mg             249   9e-68    
ref|XP_008392303.1|  PREDICTED: pentatricopeptide repeat-containi...    249   9e-68    
ref|XP_009358064.1|  PREDICTED: pentatricopeptide repeat-containi...    249   1e-67    
gb|AFV61023.1|  pentatricopeptide repeat-containing protein 11          241   1e-67    
gb|ACU25586.1|  pentatricopeptide repeat-containing protein             240   2e-67    Dipyrena glaberrima
gb|ACU25599.1|  pentatricopeptide repeat-containing protein             240   2e-67    Petrea racemosa
ref|XP_010312688.1|  PREDICTED: putative pentatricopeptide repeat...    246   2e-67    
gb|KDO49128.1|  hypothetical protein CISIN_1g004231mg                   249   2e-67    
emb|CDX74435.1|  BnaA04g09540D                                          248   2e-67    
ref|XP_002892516.1|  pentatricopeptide repeat-containing protein        245   2e-67    
ref|XP_003631674.1|  PREDICTED: pentatricopeptide repeat-containi...    248   2e-67    
gb|KDO53595.1|  hypothetical protein CISIN_1g047873mg                   241   2e-67    
ref|XP_008802693.1|  PREDICTED: pentatricopeptide repeat-containi...    240   3e-67    
ref|XP_004293229.1|  PREDICTED: putative pentatricopeptide repeat...    249   3e-67    
ref|XP_008806452.1|  PREDICTED: pentatricopeptide repeat-containi...    240   4e-67    
ref|XP_010908081.1|  PREDICTED: pentatricopeptide repeat-containi...    240   4e-67    
ref|XP_009139915.1|  PREDICTED: pentatricopeptide repeat-containi...    248   4e-67    
ref|XP_011005660.1|  PREDICTED: pentatricopeptide repeat-containi...    245   4e-67    
gb|AFV61040.1|  pentatricopeptide repeat-containing protein 11          239   4e-67    
ref|XP_004512317.1|  PREDICTED: pentatricopeptide repeat-containi...    247   5e-67    
ref|XP_010246577.1|  PREDICTED: pentatricopeptide repeat-containi...    246   6e-67    
gb|AFV61053.1|  pentatricopeptide repeat-containing protein 11          239   6e-67    
gb|ACU25593.1|  pentatricopeptide repeat-containing protein             239   6e-67    Citharexylum ligustrinum
ref|XP_011090170.1|  PREDICTED: pentatricopeptide repeat-containi...    246   7e-67    
gb|ACU25592.1|  pentatricopeptide repeat-containing protein             239   7e-67    Tamonea boxiana
gb|EEE65102.1|  hypothetical protein OsJ_20158                          242   8e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130669.1|  PREDICTED: pentatricopeptide repeat-containi...    246   8e-67    
emb|CDP13708.1|  unnamed protein product                                250   8e-67    
gb|KDP31281.1|  hypothetical protein JCGZ_11657                         244   9e-67    
ref|XP_010107974.1|  hypothetical protein L484_027566                   246   9e-67    
ref|XP_010673748.1|  PREDICTED: pentatricopeptide repeat-containi...    242   9e-67    
ref|XP_010257551.1|  PREDICTED: pentatricopeptide repeat-containi...    244   1e-66    
ref|XP_008351720.1|  PREDICTED: pentatricopeptide repeat-containi...    246   1e-66    
ref|XP_010490244.1|  PREDICTED: putative pentatricopeptide repeat...    243   2e-66    
ref|NP_198787.1|  pentatricopeptide repeat-containing protein EMB...    246   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362682.1|  PREDICTED: pentatricopeptide repeat-containi...    246   2e-66    
gb|AFV61048.1|  pentatricopeptide repeat-containing protein 11          238   2e-66    
ref|XP_009342418.1|  PREDICTED: pentatricopeptide repeat-containi...    243   2e-66    
ref|XP_008389961.1|  PREDICTED: putative pentatricopeptide repeat...    246   2e-66    
ref|XP_006474877.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-66    
gb|AFV61030.1|  pentatricopeptide repeat-containing protein 11          238   2e-66    
ref|XP_010526942.1|  PREDICTED: pentatricopeptide repeat-containi...    245   2e-66    
gb|KEH40736.1|  PPR containing plant-like protein                       245   2e-66    
ref|XP_006838109.1|  hypothetical protein AMTR_s00106p00049030          246   3e-66    
emb|CBI24234.3|  unnamed protein product                                242   3e-66    
gb|ACU25578.1|  pentatricopeptide repeat-containing protein             237   3e-66    Junellia uniflora
emb|CDY30265.1|  BnaC04g31760D                                          244   3e-66    
ref|XP_009362443.1|  PREDICTED: pentatricopeptide repeat-containi...    244   3e-66    
ref|XP_004168722.1|  PREDICTED: pentatricopeptide repeat-containi...    243   3e-66    
ref|XP_004509935.1|  PREDICTED: pentatricopeptide repeat-containi...    248   3e-66    
gb|ACU25591.1|  pentatricopeptide repeat-containing protein             237   4e-66    Rhaphithamnus venustus
gb|EPS66302.1|  hypothetical protein M569_08472                         239   4e-66    
ref|XP_004137128.1|  PREDICTED: pentatricopeptide repeat-containi...    242   4e-66    
gb|AFV61022.1|  pentatricopeptide repeat-containing protein 11          237   4e-66    
ref|XP_002530223.1|  pentatricopeptide repeat-containing protein,...    239   5e-66    Ricinus communis
gb|EEC80027.1|  hypothetical protein OsI_21710                          243   5e-66    Oryza sativa Indica Group [Indian rice]
ref|NP_001056837.2|  Os06g0152500                                       244   5e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004507375.1|  PREDICTED: pentatricopeptide repeat-containi...    243   6e-66    
ref|XP_009771216.1|  PREDICTED: pentatricopeptide repeat-containi...    241   8e-66    
ref|XP_010450780.1|  PREDICTED: pentatricopeptide repeat-containi...    244   9e-66    
gb|AFV61057.1|  pentatricopeptide repeat-containing protein 11          236   9e-66    
gb|ACU25577.1|  pentatricopeptide repeat-containing protein             235   1e-65    Junellia seriphioides
ref|XP_002277942.2|  PREDICTED: pentatricopeptide repeat-containi...    240   1e-65    Vitis vinifera
ref|XP_003556634.2|  PREDICTED: pentatricopeptide repeat-containi...    244   1e-65    
ref|XP_002320514.2|  hypothetical protein POPTR_0014s16390g             238   1e-65    Populus trichocarpa [western balsam poplar]
gb|AFV61029.1|  pentatricopeptide repeat-containing protein 11          235   1e-65    
ref|XP_007201996.1|  hypothetical protein PRUPE_ppa024918mg             240   1e-65    
emb|CDY11211.1|  BnaA03g00470D                                          243   1e-65    
gb|AFV61024.1|  pentatricopeptide repeat-containing protein 11          235   2e-65    
ref|XP_009391120.1|  PREDICTED: pentatricopeptide repeat-containi...    243   2e-65    
ref|XP_003537787.1|  PREDICTED: pentatricopeptide repeat-containi...    239   2e-65    
ref|XP_004505735.1|  PREDICTED: pentatricopeptide repeat-containi...    239   2e-65    
gb|KDP20745.1|  hypothetical protein JCGZ_21216                         241   2e-65    
gb|KDO84425.1|  hypothetical protein CISIN_1g037510mg                   244   2e-65    
ref|XP_010278102.1|  PREDICTED: pentatricopeptide repeat-containi...    242   2e-65    
gb|EEC74319.1|  hypothetical protein OsI_09597                          246   2e-65    
ref|XP_003561096.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    242   2e-65    
gb|AFV61036.1|  pentatricopeptide repeat-containing protein 11          235   2e-65    
gb|KDO54847.1|  hypothetical protein CISIN_1g004758mg                   236   2e-65    
ref|XP_004985596.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-65    
gb|KCW88422.1|  hypothetical protein EUGRSUZ_A00809                     239   3e-65    
gb|KDO59135.1|  hypothetical protein CISIN_1g000951mg                   246   3e-65    
ref|XP_002465809.1|  hypothetical protein SORBIDRAFT_01g046200          240   3e-65    
gb|AFV61031.1|  pentatricopeptide repeat-containing protein 11          234   3e-65    
gb|AFV61056.1|  pentatricopeptide repeat-containing protein 11          234   3e-65    
gb|EMT33585.1|  hypothetical protein F775_11798                         239   3e-65    
emb|CDY36644.1|  BnaA07g04130D                                          240   3e-65    
ref|XP_006290625.1|  hypothetical protein CARUB_v10016716mg             243   3e-65    
gb|KHN45826.1|  Pentatricopeptide repeat-containing protein             238   3e-65    
ref|XP_006846521.1|  hypothetical protein AMTR_s00018p00185360          242   3e-65    
ref|XP_010066267.1|  PREDICTED: pentatricopeptide repeat-containi...    237   4e-65    
ref|NP_001059422.1|  Os07g0300200                                       244   4e-65    
ref|XP_010501396.1|  PREDICTED: putative pentatricopeptide repeat...    237   4e-65    
ref|XP_010248027.1|  PREDICTED: pentatricopeptide repeat-containi...    239   4e-65    
gb|KCW64115.1|  hypothetical protein EUGRSUZ_G01771                     236   4e-65    
ref|XP_010435859.1|  PREDICTED: pentatricopeptide repeat-containi...    241   5e-65    
ref|XP_010673747.1|  PREDICTED: pentatricopeptide repeat-containi...    239   5e-65    
ref|XP_004252127.1|  PREDICTED: pentatricopeptide repeat-containi...    245   5e-65    
gb|EMT09365.1|  hypothetical protein F775_23264                         235   5e-65    
ref|XP_010445660.1|  PREDICTED: pentatricopeptide repeat-containi...    241   5e-65    
ref|XP_008466646.1|  PREDICTED: putative pentatricopeptide repeat...    242   5e-65    
gb|ACU25568.1|  pentatricopeptide repeat-containing protein             233   6e-65    
gb|AFV61046.1|  pentatricopeptide repeat-containing protein 11          234   6e-65    
ref|XP_008790694.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    243   6e-65    
ref|XP_010315244.1|  PREDICTED: pentatricopeptide repeat-containi...    241   7e-65    
ref|XP_006452610.1|  hypothetical protein CICLE_v10007298mg             244   7e-65    
ref|XP_010257564.1|  PREDICTED: pentatricopeptide repeat-containi...    238   7e-65    
gb|AFV61021.1|  pentatricopeptide repeat-containing protein 11          233   8e-65    
gb|ACU25564.1|  pentatricopeptide repeat-containing protein             233   8e-65    
gb|ACU25581.1|  pentatricopeptide repeat-containing protein             233   8e-65    
emb|CBI18516.3|  unnamed protein product                                243   8e-65    
gb|EYU24850.1|  hypothetical protein MIMGU_mgv11b017118mg               227   8e-65    
ref|XP_006395805.1|  hypothetical protein EUTSA_v10003688mg             241   9e-65    
ref|XP_006434922.1|  hypothetical protein CICLE_v10003562mg             243   9e-65    
ref|XP_010044040.1|  PREDICTED: pentatricopeptide repeat-containi...    239   1e-64    
ref|XP_008651384.1|  PREDICTED: pentatricopeptide repeat-containi...    239   1e-64    
ref|XP_010558352.1|  PREDICTED: pentatricopeptide repeat-containi...    240   1e-64    
ref|XP_010942864.1|  PREDICTED: pentatricopeptide repeat-containi...    243   1e-64    
ref|XP_006344193.1|  PREDICTED: pentatricopeptide repeat-containi...    241   1e-64    
ref|XP_002299984.2|  hypothetical protein POPTR_0001s28320g             235   1e-64    
gb|ACU25582.1|  pentatricopeptide repeat-containing protein             232   1e-64    
ref|XP_009789084.1|  PREDICTED: putative pentatricopeptide repeat...    236   2e-64    
ref|XP_006473439.1|  PREDICTED: putative pentatricopeptide repeat...    242   2e-64    
gb|AFV61045.1|  pentatricopeptide repeat-containing protein 11          232   2e-64    
emb|CDX71231.1|  BnaC07g05100D                                          238   2e-64    
gb|AAT85126.1|  hypothetical protein                                    242   2e-64    
gb|KDO58403.1|  hypothetical protein CISIN_1g008454mg                   236   2e-64    
gb|ACU25569.1|  pentatricopeptide repeat-containing protein             232   2e-64    
ref|XP_011024963.1|  PREDICTED: pentatricopeptide repeat-containi...    239   3e-64    
ref|XP_010276099.1|  PREDICTED: pentatricopeptide repeat-containi...    238   3e-64    
gb|EEC78894.1|  hypothetical protein OsI_19266                          242   3e-64    
ref|XP_009119402.1|  PREDICTED: pentatricopeptide repeat-containi...    237   3e-64    
ref|XP_011047990.1|  PREDICTED: pentatricopeptide repeat-containi...    238   3e-64    
gb|ACU25562.1|  pentatricopeptide repeat-containing protein             231   3e-64    
ref|XP_007041360.1|  Pentatricopeptide repeat (PPR) superfamily p...    238   3e-64    
ref|XP_011015136.1|  PREDICTED: pentatricopeptide repeat-containi...    239   3e-64    
ref|XP_006469492.1|  PREDICTED: pentatricopeptide repeat-containi...    235   3e-64    
gb|ACU25574.1|  pentatricopeptide repeat-containing protein             231   3e-64    
ref|XP_006447772.1|  hypothetical protein CICLE_v10018243mg             235   3e-64    
ref|XP_002994672.1|  hypothetical protein SELMODRAFT_432576             240   3e-64    
ref|XP_002870767.1|  EMB2745                                            239   3e-64    
ref|XP_007213619.1|  hypothetical protein PRUPE_ppa002121mg             238   3e-64    
ref|XP_009333737.1|  PREDICTED: pentatricopeptide repeat-containi...    239   4e-64    
ref|XP_009355021.1|  PREDICTED: pentatricopeptide repeat-containi...    237   4e-64    
ref|XP_002276762.2|  PREDICTED: pentatricopeptide repeat-containi...    236   4e-64    
gb|ACU25561.1|  pentatricopeptide repeat-containing protein             231   4e-64    
ref|XP_008218639.1|  PREDICTED: putative pentatricopeptide repeat...    241   4e-64    
ref|XP_010320717.1|  PREDICTED: pentatricopeptide repeat-containi...    239   4e-64    
ref|XP_010539933.1|  PREDICTED: putative pentatricopeptide repeat...    241   5e-64    
gb|KCW88461.1|  hypothetical protein EUGRSUZ_A00848                     234   5e-64    
ref|XP_009598901.1|  PREDICTED: pentatricopeptide repeat-containi...    234   5e-64    
gb|ACU25558.1|  pentatricopeptide repeat-containing protein             231   5e-64    
ref|XP_002309701.2|  hypothetical protein POPTR_0006s28610g             236   5e-64    
ref|XP_006449728.1|  hypothetical protein CICLE_v10014539mg             237   5e-64    
ref|XP_009350612.1|  PREDICTED: pentatricopeptide repeat-containi...    241   5e-64    
gb|ACU25584.1|  pentatricopeptide repeat-containing protein             231   5e-64    
ref|XP_002436496.1|  hypothetical protein SORBIDRAFT_10g003720          238   5e-64    
ref|XP_006282494.1|  hypothetical protein CARUB_v10006484mg             238   5e-64    
gb|ACU25565.1|  pentatricopeptide repeat-containing protein             231   5e-64    
ref|XP_008339434.1|  PREDICTED: putative pentatricopeptide repeat...    240   6e-64    
ref|NP_172058.2|  pentatricopeptide repeat-containing protein           238   6e-64    
gb|ACU25572.1|  pentatricopeptide repeat-containing protein             231   6e-64    
ref|XP_009373634.1|  PREDICTED: pentatricopeptide repeat-containi...    241   6e-64    
ref|XP_011010473.1|  PREDICTED: pentatricopeptide repeat-containi...    233   6e-64    
ref|XP_009362435.1|  PREDICTED: pentatricopeptide repeat-containi...    238   6e-64    
ref|XP_009396283.1|  PREDICTED: pentatricopeptide repeat-containi...    241   6e-64    
ref|XP_010044295.1|  PREDICTED: pentatricopeptide repeat-containi...    235   6e-64    
emb|CBI32450.3|  unnamed protein product                                240   6e-64    
ref|XP_011010472.1|  PREDICTED: pentatricopeptide repeat-containi...    233   6e-64    
gb|KFK26916.1|  hypothetical protein AALP_AA8G310300                    238   6e-64    
emb|CBI32762.3|  unnamed protein product                                236   6e-64    
gb|ACU25570.1|  pentatricopeptide repeat-containing protein             230   7e-64    
gb|AFV61051.1|  pentatricopeptide repeat-containing protein 11          231   7e-64    
gb|ACU25597.1|  pentatricopeptide repeat-containing protein             230   7e-64    
gb|ACU25579.1|  pentatricopeptide repeat-containing protein             230   7e-64    
gb|ACU25563.1|  pentatricopeptide repeat-containing protein             230   7e-64    
ref|XP_002527053.1|  pentatricopeptide repeat-containing protein,...    237   7e-64    
ref|XP_009337506.1|  PREDICTED: pentatricopeptide repeat-containi...    241   8e-64    
ref|XP_007045328.1|  Pentatricopeptide repeat-containing protein,...    238   8e-64    
ref|XP_009622189.1|  PREDICTED: pentatricopeptide repeat-containi...    238   8e-64    
ref|XP_010259774.1|  PREDICTED: pentatricopeptide repeat-containi...    236   9e-64    
gb|ACU25580.1|  pentatricopeptide repeat-containing protein             230   9e-64    
ref|XP_002280156.1|  PREDICTED: pentatricopeptide repeat-containi...    237   9e-64    
ref|XP_006658491.1|  PREDICTED: pentatricopeptide repeat-containi...    240   9e-64    
ref|XP_004149490.1|  PREDICTED: putative pentatricopeptide repeat...    238   1e-63    
gb|ACU25596.1|  pentatricopeptide repeat-containing protein             230   1e-63    
gb|KGN66536.1|  hypothetical protein Csa_1G627440                       231   1e-63    
ref|XP_006467434.1|  PREDICTED: pentatricopeptide repeat-containi...    236   1e-63    
ref|XP_008450352.1|  PREDICTED: pentatricopeptide repeat-containi...    238   1e-63    
ref|XP_010520854.1|  PREDICTED: pentatricopeptide repeat-containi...    236   1e-63    
ref|XP_008221377.1|  PREDICTED: putative pentatricopeptide repeat...    238   1e-63    
gb|ACU25576.1|  pentatricopeptide repeat-containing protein             229   1e-63    
ref|XP_006405601.1|  hypothetical protein EUTSA_v10027654mg             238   1e-63    
gb|ACU25573.1|  pentatricopeptide repeat-containing protein             229   1e-63    
gb|AFV61050.1|  pentatricopeptide repeat-containing protein 11          230   1e-63    
ref|XP_010910591.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    239   2e-63    
gb|AFV61047.1|  pentatricopeptide repeat-containing protein 11          230   2e-63    
ref|XP_006346446.1|  PREDICTED: pentatricopeptide repeat-containi...    238   2e-63    
ref|XP_004144813.1|  PREDICTED: pentatricopeptide repeat-containi...    234   2e-63    
gb|ACU25575.1|  pentatricopeptide repeat-containing protein             229   2e-63    
ref|XP_006382123.1|  hypothetical protein POPTR_0006s28580g             233   2e-63    
ref|NP_179165.1|  pentatricopeptide repeat-containing protein           235   2e-63    
ref|XP_004154653.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    237   2e-63    
ref|XP_010674664.1|  PREDICTED: pentatricopeptide repeat-containi...    234   2e-63    
ref|XP_008344500.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    237   2e-63    
ref|XP_006470947.1|  PREDICTED: putative pentatricopeptide repeat...    241   2e-63    
gb|KFK40027.1|  hypothetical protein AALP_AA3G320600                    235   2e-63    
ref|XP_010043917.1|  PREDICTED: pentatricopeptide repeat-containi...    235   2e-63    
ref|XP_006655158.1|  PREDICTED: putative pentatricopeptide repeat...    239   2e-63    
ref|XP_002883912.1|  pentatricopeptide repeat-containing protein        234   2e-63    
gb|KHN25331.1|  Pentatricopeptide repeat-containing protein, mito...    229   2e-63    
ref|XP_008243127.1|  PREDICTED: pentatricopeptide repeat-containi...    237   2e-63    
ref|XP_010462657.1|  PREDICTED: pentatricopeptide repeat-containi...    232   2e-63    
ref|XP_010106047.1|  hypothetical protein L484_021225                   239   2e-63    
ref|XP_006375054.1|  hypothetical protein POPTR_0014s03970g             239   2e-63    
gb|ACU25598.1|  pentatricopeptide repeat-containing protein             229   3e-63    
ref|XP_008789302.1|  PREDICTED: putative pentatricopeptide repeat...    231   3e-63    
ref|XP_004139059.1|  PREDICTED: pentatricopeptide repeat-containi...    236   3e-63    
ref|XP_011036957.1|  PREDICTED: pentatricopeptide repeat-containi...    236   3e-63    
ref|XP_010273033.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    231   3e-63    
ref|XP_011032541.1|  PREDICTED: putative pentatricopeptide repeat...    234   3e-63    
ref|XP_011031483.1|  PREDICTED: putative pentatricopeptide repeat...    233   3e-63    
ref|XP_007026082.1|  Pentatricopeptide repeat superfamily protein...    236   3e-63    
emb|CDP00705.1|  unnamed protein product                                236   3e-63    
ref|XP_006339300.1|  PREDICTED: pentatricopeptide repeat-containi...    239   4e-63    
ref|XP_006409538.1|  hypothetical protein EUTSA_v10022592mg             234   4e-63    
gb|AFV61019.1|  pentatricopeptide repeat-containing protein 11          228   4e-63    
gb|ACU25559.1|  pentatricopeptide repeat-containing protein             228   4e-63    
ref|XP_006440635.1|  hypothetical protein CICLE_v10024595mg             235   5e-63    
gb|ACU25595.1|  pentatricopeptide repeat-containing protein             228   5e-63    
ref|XP_003606846.1|  Pentatricopeptide repeat-containing protein        233   5e-63    
ref|XP_002314524.2|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    229   5e-63    
ref|XP_008376295.1|  PREDICTED: pentatricopeptide repeat-containi...    236   5e-63    
ref|XP_010502229.1|  PREDICTED: putative pentatricopeptide repeat...    236   5e-63    
gb|ACU25557.1|  pentatricopeptide repeat-containing protein             228   6e-63    
emb|CAN61637.1|  hypothetical protein VITISV_008458                     235   6e-63    
ref|XP_010680169.1|  PREDICTED: pentatricopeptide repeat-containi...    230   6e-63    
ref|XP_003631192.1|  PREDICTED: pentatricopeptide repeat-containi...    235   6e-63    
gb|AFV61037.1|  pentatricopeptide repeat-containing protein 11          228   7e-63    
ref|XP_004156125.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    236   7e-63    
ref|XP_007017448.1|  Pentatricopeptide repeat superfamily protein       237   7e-63    
ref|XP_010689231.1|  PREDICTED: putative pentatricopeptide repeat...    232   7e-63    
ref|XP_009760018.1|  PREDICTED: pentatricopeptide repeat-containi...    235   8e-63    
gb|ACU25556.1|  pentatricopeptide repeat-containing protein             228   8e-63    
ref|XP_011031385.1|  PREDICTED: putative pentatricopeptide repeat...    232   8e-63    
ref|XP_009601602.1|  PREDICTED: pentatricopeptide repeat-containi...    238   9e-63    
ref|XP_008792260.1|  PREDICTED: pentatricopeptide repeat-containi...    228   1e-62    
ref|XP_003558747.1|  PREDICTED: pentatricopeptide repeat-containi...    233   1e-62    
ref|XP_009356190.1|  PREDICTED: pentatricopeptide repeat-containi...    234   1e-62    
ref|XP_009601596.1|  PREDICTED: pentatricopeptide repeat-containi...    238   1e-62    
gb|AAM15782.1|AC104428_3  Putative indole-3-acetate beta-glucosyl...    233   1e-62    
ref|XP_008356302.1|  PREDICTED: pentatricopeptide repeat-containi...    232   1e-62    
ref|XP_006344896.1|  PREDICTED: pentatricopeptide repeat-containi...    238   1e-62    
ref|XP_004510327.1|  PREDICTED: pentatricopeptide repeat-containi...    230   1e-62    
gb|KDO55502.1|  hypothetical protein CISIN_1g036303mg                   232   1e-62    
ref|NP_001049065.1|  Os03g0165100                                       234   1e-62    
ref|XP_004292464.1|  PREDICTED: pentatricopeptide repeat-containi...    232   1e-62    
ref|XP_009631600.1|  PREDICTED: putative pentatricopeptide repeat...    229   1e-62    
ref|XP_002313097.2|  hypothetical protein POPTR_0009s10870g             234   1e-62    
ref|XP_006843235.1|  hypothetical protein AMTR_s00080p00074320          229   1e-62    
ref|NP_178323.3|  putative pentatricopeptide repeat-containing pr...    234   1e-62    
ref|XP_007141491.1|  hypothetical protein PHAVU_008G200500g             230   1e-62    
gb|AAD30619.1|AC007153_11  similar to indole-3-acetate beta-gluco...    238   2e-62    
emb|CBI26947.3|  unnamed protein product                                237   2e-62    
ref|XP_006838107.1|  hypothetical protein AMTR_s00106p00044940          237   2e-62    
ref|XP_010905662.1|  PREDICTED: pentatricopeptide repeat-containi...    229   2e-62    
ref|XP_009412775.1|  PREDICTED: pentatricopeptide repeat-containi...    237   2e-62    
ref|XP_007044407.1|  Pentatricopeptide repeat (PPR-like) superfam...    234   2e-62    
ref|XP_011038920.1|  PREDICTED: pentatricopeptide repeat-containi...    234   2e-62    
gb|KHG19113.1|  hypothetical protein F383_25961                         231   2e-62    
gb|AET05409.2|  PPR containing plant-like protein                       237   2e-62    
ref|XP_004300944.1|  PREDICTED: pentatricopeptide repeat-containi...    233   2e-62    
ref|XP_011036344.1|  PREDICTED: putative pentatricopeptide repeat...    229   3e-62    
ref|XP_007157301.1|  hypothetical protein PHAVU_002G058500g             230   3e-62    
gb|ACU25567.1|  pentatricopeptide repeat-containing protein             226   3e-62    
gb|ADN34051.1|  pentatricopeptide repeat-containing protein             232   3e-62    
ref|XP_009404129.1|  PREDICTED: pentatricopeptide repeat-containi...    229   3e-62    
gb|AFV61043.1|  pentatricopeptide repeat-containing protein 11          226   3e-62    
ref|XP_010476184.1|  PREDICTED: pentatricopeptide repeat-containi...    232   3e-62    
emb|CDY28636.1|  BnaC09g32390D                                          236   3e-62    
ref|XP_004487917.1|  PREDICTED: pentatricopeptide repeat-containi...    236   3e-62    
ref|XP_011003821.1|  PREDICTED: putative pentatricopeptide repeat...    228   3e-62    
ref|XP_008441068.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    232   3e-62    
gb|ACU25566.1|  pentatricopeptide repeat-containing protein             226   4e-62    
gb|AFV61013.1|  pentatricopeptide repeat-containing protein 11          225   4e-62    
ref|XP_008808854.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    234   4e-62    
ref|XP_010276196.1|  PREDICTED: pentatricopeptide repeat-containi...    236   4e-62    
ref|XP_002319601.2|  hypothetical protein POPTR_0013s03290g             228   4e-62    
emb|CDX94941.1|  BnaC05g07300D                                          231   4e-62    
ref|XP_011003803.1|  PREDICTED: putative pentatricopeptide repeat...    230   4e-62    
ref|XP_010931310.1|  PREDICTED: pentatricopeptide repeat-containi...    234   5e-62    
ref|XP_006382709.1|  hypothetical protein POPTR_0005s04650g             228   5e-62    
ref|XP_009779556.1|  PREDICTED: putative pentatricopeptide repeat...    230   5e-62    



>ref|XP_009789586.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Nicotiana sylvestris]
Length=590

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/578 (70%), Positives = 481/578 (83%), Gaps = 1/578 (0%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE  1722
             AN ES++VK +   VLKG+W+NLLKPKIG  VTST I+  LL +S   F  SWSFFKW E
Sbjct  7     ANVESEMVKAVAAAVLKGNWDNLLKPKIGSFVTSTTISQALLDISQYCFSRSWSFFKWAE  66

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             ++PNY+HSLQSSW+MIYILTK KHFK+A+DML ++A KDFLSSP VLNALV S+ D DVN
Sbjct  67    SVPNYKHSLQSSWTMIYILTKQKHFKTAQDMLQKVARKDFLSSPTVLNALVSSNQDKDVN  126

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             S + SWL+IFYANSK   DAIQVFEH+R+C++    HACT LLNSLVK+GLTDT+WKTYK
Sbjct  127   SHLLSWLVIFYANSKLPHDAIQVFEHMRVCKLMLHTHACTTLLNSLVKDGLTDTLWKTYK  186

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM K+GV+PNI+IYNVL+HACCKSG+VE+A++ L EMEFK   PDLYT+NTLISLYCR+G
Sbjct  187   KMQKMGVVPNIYIYNVLMHACCKSGDVERAEDLLREMEFKATLPDLYTYNTLISLYCRKG  246

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEAL VQDRMER GV PDI+TYNSLI+S+CREGRMREAMRLFK+IK+  T N VTYTT
Sbjct  247   MHYEALCVQDRMERAGVSPDIVTYNSLIYSYCREGRMREAMRLFKEIKD-ATANLVTYTT  305

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYCR   + EALRL  AME KGL P V TYNSILRK CEEG+MK++  LLN+M EKK
Sbjct  306   LIDGYCRANSVTEALRLRDAMEAKGLYPGVVTYNSILRKLCEEGQMKDANILLNEMNEKK  365

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + PDNVTCNTLINGYCKIGD+ SALKVKNKMLEAGL+PD FTY A+I+GFCKAKD + A+
Sbjct  366   VVPDNVTCNTLINGYCKIGDMRSALKVKNKMLEAGLKPDRFTYNAMINGFCKAKDIDGAR  425

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             E++FDM++ G SPSY +YSWLVD YC QNN+ A++ L DEF  RGY VD+SFYRAI+RRL
Sbjct  426   EILFDMVSVGLSPSYYSYSWLVDVYCHQNNDIAVLSLIDEFIRRGYLVDLSFYRAIVRRL  485

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CKRG++D AE+ F +MQ + +LGDS+VY +LAYAYFK G   AAS L DEMY+RRLM+TL
Sbjct  486   CKRGRIDSAEKVFHIMQTKGVLGDSLVYATLAYAYFKVGKLDAASYLLDEMYRRRLMITL  545

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             K+YKS +A   DENSLLD+FW+NV+QRGLIS  V+N I
Sbjct  546   KIYKSFNAFYSDENSLLDMFWSNVVQRGLISRTVYNDI  583



>ref|XP_009603085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Nicotiana tomentosiformis]
Length=590

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/578 (70%), Positives = 480/578 (83%), Gaps = 1/578 (0%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE  1722
             AN ES++VK +   VLKG+W+NLLKPKIG  VTST I+  LL +S   F  SWSFFKW E
Sbjct  7     ANVESEMVKAVAAAVLKGNWDNLLKPKIGSFVTSTTISQALLDISQYCFSRSWSFFKWAE  66

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             ++PNY HSLQSSW+MIYILTK KHFK+A+DML ++A KDFLSSP VLNALV S+ D DVN
Sbjct  67    SVPNYNHSLQSSWTMIYILTKQKHFKTAQDMLQKVARKDFLSSPTVLNALVSSNQDKDVN  126

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             S + SWL+IFYANSK   DAIQVFEH+R+C++    HACT LLNSLVK+GLTDT+WKTYK
Sbjct  127   SHLLSWLVIFYANSKLPHDAIQVFEHMRVCKLMLHTHACTTLLNSLVKDGLTDTLWKTYK  186

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM K+G +PNI+IYNVL+HACCKSG+VE+A++ L EMEFK   PDLYT+NTLISLYCR+G
Sbjct  187   KMQKMGAVPNIYIYNVLMHACCKSGDVEQAEDLLREMEFKATLPDLYTYNTLISLYCRKG  246

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEAL VQDRMER GV PDI+TYNSLI+S+CREGRMREA+RLFK+IK+  T N VTYTT
Sbjct  247   MHYEALCVQDRMERAGVCPDIVTYNSLIYSYCREGRMREALRLFKEIKD-ATANLVTYTT  305

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYCR   + EALRL  AME KGL P V TYNSILRK CEEG+MK++  LLN+M EKK
Sbjct  306   LIDGYCRANSVTEALRLRDAMEAKGLYPGVVTYNSILRKLCEEGQMKDANILLNEMNEKK  365

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + PDNVTCNTLINGYCKIGD+ SALKVKNKMLEAGL+PD FTY A+I+GFCKAKD + AK
Sbjct  366   VVPDNVTCNTLINGYCKIGDMRSALKVKNKMLEAGLKPDRFTYNAMINGFCKAKDMDGAK  425

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             E++F+M++ G SPSY +YSWLVD YC QNN+ A++ L DEF  RGY VD+SFYRAI+RRL
Sbjct  426   EILFNMVSVGLSPSYYSYSWLVDVYCHQNNDIAVLSLIDEFIRRGYLVDLSFYRAIVRRL  485

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CKRG++D AE+ F +MQ + +LGDS+VY +LAYAYFK G   AAS L DEMY+RRLM+TL
Sbjct  486   CKRGRIDSAEKVFHIMQTKGVLGDSLVYATLAYAYFKVGKLDAASYLLDEMYRRRLMITL  545

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             K+YKS +AS  DENSLLD+FW+NV+QRGLIS  V+N I
Sbjct  546   KIYKSFNASYSDENSLLDMFWSNVVQRGLISRTVYNDI  583



>ref|XP_006340477.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Solanum tuberosum]
Length=588

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/578 (69%), Positives = 479/578 (83%), Gaps = 1/578 (0%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE  1722
             AN ++++VK +  +V KGHW+NLLKPKIG  VTST I+  LL +S  +F LSWSFF+W E
Sbjct  7     ANVDNEMVKAVAAVVFKGHWDNLLKPKIGSFVTSTTISQALLHISQYYFSLSWSFFQWAE  66

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             ++PNY+HSLQSSW+MIYILTK KHFK+A+DML ++A K+FLSSP VLNA VRS+ ++DVN
Sbjct  67    SVPNYKHSLQSSWTMIYILTKQKHFKTAQDMLQKVAVKNFLSSPTVLNAFVRSNMNNDVN  126

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             S + SWL+IFYANSK   DAIQVFEH+R+C++ P  HACT LLNSLVK+GLTDT+WK YK
Sbjct  127   SHLLSWLVIFYANSKLPHDAIQVFEHMRVCKLMPHTHACTTLLNSLVKDGLTDTLWKIYK  186

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM K+GVLPNI+IYNVL+HACCKSG+VE+AD+ L EMEFK   PDLYT+NTLISLYC++G
Sbjct  187   KMQKIGVLPNIYIYNVLMHACCKSGDVERADDLLREMEFKATLPDLYTYNTLISLYCKKG  246

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEAL VQDRMER GV PDI+TYNSLI+S+CREGRMREA+RLFK+IK   T N VTYTT
Sbjct  247   MHYEALCVQDRMERAGVCPDIVTYNSLIYSYCREGRMREALRLFKEIKGSTT-NLVTYTT  305

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYCR  ++ EALRL  AME KGL P V TYNSILRK CE+G+MK++  LLN+M EKK
Sbjct  306   LIDGYCRANNVAEALRLKDAMEAKGLYPGVVTYNSILRKLCEQGQMKDANILLNEMNEKK  365

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + PDNVTCNTLINGYCKIGD+ SALKVKNKMLE GL+PD FTY A+IHGFCK KDT+ AK
Sbjct  366   VIPDNVTCNTLINGYCKIGDMKSALKVKNKMLEGGLKPDRFTYNAMIHGFCKVKDTDGAK  425

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             EV+FDM+  G SPSYC+YSWLVD YC  NN  A+V L DEF+  G+ VD+SFYRAIIRRL
Sbjct  426   EVLFDMVRVGLSPSYCSYSWLVDAYCHLNNEVAVVSLPDEFARGGHLVDVSFYRAIIRRL  485

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             C+RGK+D AE+ F +MQ   +LGDS++Y +LAYAYF  G   AAS L D+MYKRR M+TL
Sbjct  486   CRRGKIDGAEKVFHIMQTNGVLGDSLIYATLAYAYFMVGKVDAASYLLDDMYKRRQMITL  545

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             K+YKS +AS  DEN+LLD+FW+NV+QRGLIS  V++ I
Sbjct  546   KMYKSFNASYSDENTLLDMFWSNVVQRGLISRTVYDEI  583



>ref|XP_010319820.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Solanum lycopersicum]
Length=588

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/578 (68%), Positives = 482/578 (83%), Gaps = 1/578 (0%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE  1722
             AN ++++VK +  +V KGHW+NLLKPKIG SVTST I   LL +S  +F LSWSFF+W E
Sbjct  7     ANLDNEMVKAVAAVVFKGHWDNLLKPKIGSSVTSTTIRQALLHISQYYFSLSWSFFQWAE  66

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             ++P+++HSLQSSW+M+YILTK KHFK+A+DML ++A K+FLSSP VLNALVRS+ ++DVN
Sbjct  67    SVPSHKHSLQSSWTMMYILTKQKHFKTAQDMLQKVAVKNFLSSPTVLNALVRSNMNNDVN  126

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             S + SWL+IFYANSK   DAIQVFEH+R+C++ P  HAC+ LLNSLVK+GLTDT+WK YK
Sbjct  127   SHLLSWLVIFYANSKLPHDAIQVFEHMRVCKLMPHTHACSTLLNSLVKDGLTDTLWKIYK  186

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM K+GVLPNI+IYNVL+HACCKSG+VE+AD+ L EMEFK   PDLYT+NTLISLYC++G
Sbjct  187   KMQKIGVLPNIYIYNVLMHACCKSGDVERADDLLREMEFKATLPDLYTYNTLISLYCKKG  246

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEAL VQDRMER GV PDI+TYNSLI+S+CREGRMREAMRLFK+IK   T N VTYTT
Sbjct  247   MHYEALCVQDRMERAGVCPDIVTYNSLIYSYCREGRMREAMRLFKEIKGSTT-NLVTYTT  305

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYCR  ++ EALRL  AME KGL P V TYNSILRK CE+G+MK++  LLN+M EKK
Sbjct  306   LIDGYCRANNVAEALRLKGAMETKGLYPGVVTYNSILRKLCEQGQMKDANILLNEMNEKK  365

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + PDNVTCNTLINGYCKIGD+ SALKVKNKMLE GL+PD FTY A+IHGFCK KDT+ AK
Sbjct  366   VIPDNVTCNTLINGYCKIGDMESALKVKNKMLEGGLKPDRFTYNAMIHGFCKVKDTDGAK  425

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             EV+FDM+  G SPSYC+YSWLVD YC  NN  A+V L DEF+  G+ VD+SFYRAIIRRL
Sbjct  426   EVLFDMVRVGLSPSYCSYSWLVDAYCHLNNEVAVVSLPDEFAKGGHLVDVSFYRAIIRRL  485

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             C+RGK+D AE+ F +MQ + +LGDS++Y +LAYA+F  G   AAS L D+MYKRRLM+TL
Sbjct  486   CRRGKIDGAEKVFHIMQTKGVLGDSLIYATLAYAFFMAGKVDAASYLLDDMYKRRLMITL  545

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             K+YKS +AS  DEN+LL++FW+NV+QRGLIS  V++ I
Sbjct  546   KMYKSFNASYSDENTLLNMFWSNVVQRGLISRTVYDEI  583



>ref|XP_011099085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Sesamum indicum]
 ref|XP_011099086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Sesamum indicum]
Length=588

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/578 (68%), Positives = 482/578 (83%), Gaps = 1/578 (0%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE  1722
             A++E QLV+T+C IV+KG+W  LLKPKIG  VTS+++N  LL LSP  F +S SFFKWVE
Sbjct  7     ASSERQLVRTVCAIVVKGYWVKLLKPKIGSLVTSSVMNQALLNLSPYEFSISLSFFKWVE  66

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             TIP+Y+HSLQSSW+MI ILTK +H+++A+D+L +IA KDFLSSP VLNALV S  D DVN
Sbjct  67    TIPHYKHSLQSSWTMICILTKQRHYRAAQDLLQKIARKDFLSSPTVLNALVNSYSDLDVN  126

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             S V SWL+IFYANSK   DAIQVFEH+R+C  KP  HACTVLLNSLVKE LTDTVWK YK
Sbjct  127   SHVLSWLVIFYANSKMNPDAIQVFEHMRLCGCKPHLHACTVLLNSLVKERLTDTVWKIYK  186

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KMIK+GVLPN+H+YNVLIHACCKSG+V+KA+E LSEME K IFPDL+T+NTLISLYC++G
Sbjct  187   KMIKVGVLPNLHVYNVLIHACCKSGDVKKAEELLSEMELKNIFPDLFTYNTLISLYCKKG  246

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEALSV D+MERGGV PDIIT+NSLI+S+CREGRMREA+RLFK+I+   +PN VTYTT
Sbjct  247   MHYEALSVLDKMERGGVCPDIITHNSLIYSYCREGRMREALRLFKEIR-GASPNHVTYTT  305

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYCRVGDIDEAL+L   M  K L P V TYN ILRK CEEGR++++ KLLN+M E+K
Sbjct  306   LIDGYCRVGDIDEALQLRDIMVAKELYPGVVTYNVILRKLCEEGRIQDANKLLNEMSERK  365

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             IEPD VTCNTLIN YCKIGD+ SALKVK+KMLEAGLRPD FTYKALIHGFCKA++ + AK
Sbjct  366   IEPDIVTCNTLINAYCKIGDMRSALKVKSKMLEAGLRPDQFTYKALIHGFCKAQEVKSAK  425

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             E++FDM+ AGFSPSYC Y+W VD YC +N++EA++   DE   +  C DI+ YRAIIRRL
Sbjct  426   EMLFDMLRAGFSPSYCTYTWFVDFYCSRNDDEAIMTFPDEIMQQDLCADITVYRAIIRRL  485

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CK+ ++DCA+R F +MQ R ILGD+++Y SLAYAY + G+  AA  LFDEMYKRRLM+TL
Sbjct  486   CKKERIDCAQRVFKIMQTRGILGDTIIYASLAYAYSRAGDVVAALALFDEMYKRRLMITL  545

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             K+++S++AS  ++ S LD+FWN +++RGL+S  ++N I
Sbjct  546   KIFRSINASYANDGSYLDIFWNILVERGLMSKTMYNQI  583



>emb|CDP02378.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/571 (68%), Positives = 469/571 (82%), Gaps = 1/571 (0%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE  1722
              ++ES  VKT+C IV+KGHW+++LKPKIG  V+S+ IN  L++LS   F LSWSF+KWVE
Sbjct  7     VSSESLFVKTVCAIVVKGHWDDILKPKIGSFVSSSTINQALISLSSYGFSLSWSFYKWVE  66

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             TIP+Y HSLQS W+MI +LTK KHFK+A  ML +IA KDFLSSP VLNALV   D  DVN
Sbjct  67    TIPDYNHSLQSCWTMICVLTKQKHFKTAHAMLEKIALKDFLSSPTVLNALVSGCDSPDVN  126

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             S V SWL+IFYANSK+T DA+QVFEH+R+C  KP  HACTVLLNSLVK+ L DTVWK Y+
Sbjct  127   SHVLSWLVIFYANSKKTQDAVQVFEHMRLCGFKPHLHACTVLLNSLVKDRLCDTVWKLYR  186

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             K+IK GV+PN+HIYNVLIHACCKSG+VEKA+E L EMEFK +FPDL T+NTLISLYC++G
Sbjct  187   KIIKAGVVPNLHIYNVLIHACCKSGDVEKAEELLREMEFKAVFPDLITYNTLISLYCKKG  246

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MH+EAL VQDRM+ GGV PDI TYNSLI+S+CRE RMREA RLFK+IK  VTPN+VTYTT
Sbjct  247   MHHEALCVQDRMKSGGVCPDIFTYNSLIYSYCRESRMREAHRLFKEIK-GVTPNQVTYTT  305

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LI+GYCRV D+D+AL+L  AME KGL P V TYNSILRK CE+ R+K++ +LLN+M  KK
Sbjct  306   LINGYCRVNDLDQALQLRDAMEAKGLYPGVVTYNSILRKLCEDSRIKDANRLLNEMNGKK  365

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             +EPDN+TCNTLIN YCKIGD+ SAL V++KML AGL+PDSFT+KALIHG+CK KD   AK
Sbjct  366   VEPDNITCNTLINAYCKIGDMRSALMVRSKMLGAGLKPDSFTFKALIHGYCKVKDVNGAK  425

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             +++F+M+AAG SPSYC +SWLVD YC Q++ +A++KL DE S RG CVDIS YRA+IRRL
Sbjct  426   DILFEMLAAGLSPSYCMFSWLVDFYCNQDDEKAIIKLPDELSERGLCVDISVYRALIRRL  485

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CKR K+DCAE+ F  M E+ I GDSVVYTSLAYAY KEGN  A S L  EMY+RRLMVTL
Sbjct  486   CKREKVDCAEKVFITMNEKGISGDSVVYTSLAYAYLKEGNMVAFSSLSHEMYRRRLMVTL  545

Query  281   klykslsassKDENSLLDLFWNNVMQRGLIS  189
             K+YKS SAS  ++ S L+ FW N++ RGLIS
Sbjct  546   KIYKSFSASFANDGSCLNTFWENLVHRGLIS  576



>ref|XP_010660523.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Vitis vinifera]
 ref|XP_010660524.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Vitis vinifera]
Length=590

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/571 (65%), Positives = 467/571 (82%), Gaps = 1/571 (0%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIP  1713
             E+QL K +C IV+KGHWN+LLKP +G ++TSTI+N  LL LS     +SW+FFKWVE+  
Sbjct  10    ETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWAFFKWVESNL  69

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             N++HSLQSSW+MI+ L KHK FK+A+++L +IA +D+LSSP+VLNA+VR  DD D NSQ+
Sbjct  70    NHKHSLQSSWTMIHTLAKHKQFKTAQNLLERIAVRDYLSSPSVLNAVVRIHDDPDSNSQI  129

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
              SWL+IFYANS+ T DAIQVFEH+R+   KP  HACTVLLNSL K  LT+ VWK YKKM+
Sbjct  130   LSWLVIFYANSRMTQDAIQVFEHMRVHGFKPHLHACTVLLNSLAKARLTNMVWKVYKKMV  189

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             ++GV+PNIHI+NVLIHACCKSG+VEKA++ L+EME + IFPDL+T+NTLISLYC++GMHY
Sbjct  190   RVGVVPNIHIFNVLIHACCKSGDVEKAEQLLNEMESRFIFPDLFTYNTLISLYCKKGMHY  249

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLID  993
             EAL +QDRMERGGV PDI+TYNSLI+  CREGRMREA+RLF++I    TPN VTYTTLID
Sbjct  250   EALGIQDRMERGGVSPDIVTYNSLIYGFCREGRMREALRLFREI-NGATPNHVTYTTLID  308

Query  992   GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEP  813
             GYCRV D++EALRL   ME +GL P V TYNSILRK CEEG++K++ +LLN+M E+K+EP
Sbjct  309   GYCRVNDLEEALRLREVMEVEGLHPGVVTYNSILRKLCEEGKIKDANRLLNEMSERKVEP  368

Query  812   DNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
             DNVTCNTLIN YCKIGD+ SA+KVK KMLEAGL+PD FT+KALIHGFCK  + + AKE +
Sbjct  369   DNVTCNTLINAYCKIGDMGSAMKVKKKMLEAGLKPDQFTFKALIHGFCKLHEVDSAKEFL  428

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
             F+M+ AGFSPSY  YSWLVD+Y  Q+N EA+++L DE S +G  VDIS YRA+IRRLCK 
Sbjct  429   FEMLDAGFSPSYSTYSWLVDSYYDQDNKEAVIRLPDELSRKGLFVDISVYRALIRRLCKI  488

Query  452   GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlkly  273
              K++ AER F +MQ + + GDSVVYTSLAYAYFK G   AASD+ DEM KRRLM+TLK+Y
Sbjct  489   DKIESAERIFTLMQGKGMKGDSVVYTSLAYAYFKAGKAIAASDMLDEMDKRRLMITLKIY  548

Query  272   kslsassKDENSLLDLFWNNVMQRGLISHNV  180
             +  SAS   + S+L LFW++V++R LIS N+
Sbjct  549   RCFSASYAGDGSILGLFWDHVIERRLISKNI  579



>emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera]
Length=590

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/571 (65%), Positives = 466/571 (82%), Gaps = 1/571 (0%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIP  1713
             E+QL K +C IV+KGHWN+LLKP +G ++TSTI+N  LL LS     +SW+FFKWVE+  
Sbjct  10    ETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWAFFKWVESNL  69

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             N+ HSLQSSW+MI+ L KHK FK+A+++L +IA +D+LSSP+VLNA+VR  DD D NSQ+
Sbjct  70    NHXHSLQSSWTMIHTLAKHKQFKTAQNLLERIAVRDYLSSPSVLNAVVRIHDDPDSNSQI  129

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
              SWL+IFYANS+ T DAIQVFEH+R+   KP  HACTVLLNSL K  LT+ VWK YKKM+
Sbjct  130   LSWLVIFYANSRMTQDAIQVFEHMRVHGFKPHLHACTVLLNSLAKARLTNMVWKVYKKMV  189

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             ++GV+PNIHI+NVLIHACCKSG+VEKA++ L+EME + IFPDL+T+NTLISLYC++GMHY
Sbjct  190   RVGVVPNIHIFNVLIHACCKSGDVEKAEQLLNEMESRFIFPDLFTYNTLISLYCKKGMHY  249

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLID  993
             EAL +QDRMERGGV PDI+TYNSLI+  CREGRMREA+RLF++I    TPN VTYTTLID
Sbjct  250   EALGIQDRMERGGVSPDIVTYNSLIYGFCREGRMREALRLFREI-NGATPNHVTYTTLID  308

Query  992   GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEP  813
             GYCRV D++EALRL   ME +GL P V TYNSILRK CEEG++K++ +LLN+M E+K+EP
Sbjct  309   GYCRVNDLEEALRLREVMEVEGLHPGVVTYNSILRKLCEEGKIKDANRLLNEMSERKVEP  368

Query  812   DNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
             DNVTCNTLIN YCKIGD+ SA+KVK KMLEAGL+PD FT+KALIHGFCK  + + AKE +
Sbjct  369   DNVTCNTLINAYCKIGDMGSAMKVKKKMLEAGLKPDQFTFKALIHGFCKLHEVDSAKEFL  428

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
             F+M+ AGFSPSY  YSWLVD+Y  Q+N EA+++L DE S +G  VDIS YRA+IRRLCK 
Sbjct  429   FEMLDAGFSPSYSTYSWLVDSYYDQDNKEAVIRLPDELSRKGLFVDISVYRALIRRLCKI  488

Query  452   GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlkly  273
              K++ AER F +MQ + + GDSVVYTSLAYAYFK G   AASD+ DEM KRRLM+TLK+Y
Sbjct  489   DKIESAERIFTLMQGKGMKGDSVVYTSLAYAYFKAGKAIAASDMLDEMDKRRLMITLKIY  548

Query  272   kslsassKDENSLLDLFWNNVMQRGLISHNV  180
             +  SAS   + S+L LFW++V++R LIS N+
Sbjct  549   RCFSASYAGDGSILGLFWDHVIERRLISKNI  579



>ref|XP_011021152.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Populus euphratica]
Length=593

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/585 (64%), Positives = 465/585 (79%), Gaps = 15/585 (3%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIG-----LSVTSTIINHTLLTLS-----PCWFW  1752
             +N    L++++C  V+KG WNNLL+PK G     L  T+  +   LL LS     PC   
Sbjct  8     SNETQLLIQSICASVIKGSWNNLLRPKFGSNDYHLITTTATVGQVLLQLSLYDQSPC---  64

Query  1751  LSWSFFKWVET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNA  1575
             LSW+FFKW+E+ +PNY+HSLQSSW+M+Y+LTKHKHFK+A D L  IA KDFLS+ +VL++
Sbjct  65    LSWAFFKWIESSVPNYKHSLQSSWTMLYVLTKHKHFKTAHDFLENIAFKDFLSTQSVLSS  124

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE  1395
             LV+  DD DVNS V SWL+I Y NSK T +AIQVFEH+R+   +P  HACTVLLNSL K+
Sbjct  125   LVKIHDDPDVNSHVLSWLVIVYGNSKMTHEAIQVFEHMRVNGFRPHLHACTVLLNSLAKD  184

Query  1394  GLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTF  1215
              LTDTVWK YKKM+KLGV+ NIH+YNVL+HACCKSG+VEKA++ LSEME K +FPDL+T+
Sbjct  185   RLTDTVWKIYKKMVKLGVVSNIHVYNVLLHACCKSGDVEKAEKVLSEMELKCVFPDLFTY  244

Query  1214  NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             NTLISLYC++GMHYEAL  QDRME  G+ PDI+TYN+LI+  CREGRMREA++LF+DIK+
Sbjct  245   NTLISLYCKKGMHYEALCAQDRMEMAGISPDIVTYNALIYGFCREGRMREAVQLFRDIKD  304

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
              VTPN VTYT+LIDGYCRV D+DEALRL   M EKGL P + TYNSILRK CE GR++++
Sbjct  305   -VTPNHVTYTSLIDGYCRVNDLDEALRLKEVMSEKGLYPNIITYNSILRKLCEGGRLRDA  363

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
               +LN+M E+KIEPDNVTCNTLIN YCKIGD+ SALKVK+KM+ AGL+ D FTYKALIHG
Sbjct  364   NIMLNEMSERKIEPDNVTCNTLINAYCKIGDMRSALKVKDKMVGAGLKLDQFTYKALIHG  423

Query  674   FCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVD  495
             FCKAK+  +AKE++F M+ AGFSPSYC YSWLVD+YC Q N EA++KL DE   RG CVD
Sbjct  424   FCKAKEIVKAKELLFGMMDAGFSPSYCTYSWLVDSYCKQQNEEAVIKLPDELVRRGLCVD  483

Query  494   ISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFD  315
             +S YRA+IRR CK  K+DCA+R  G+M+++ I GDSVVYTSLAY Y+K G     SD+ D
Sbjct  484   VSVYRALIRRFCKIEKIDCAQRVLGLMKDKGIFGDSVVYTSLAYGYWKVGKVNVTSDILD  543

Query  314   EMYKRRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             EMYKRRLM+TLK+Y+S +AS   ++S+L LFWN+V++R L+S N+
Sbjct  544   EMYKRRLMITLKIYRSFNASYASDSSILSLFWNHVLERRLMSKNI  588



>ref|XP_006373499.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa]
 gb|ERP51296.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa]
Length=593

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/585 (64%), Positives = 464/585 (79%), Gaps = 15/585 (3%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIG-----LSVTSTIINHTLLTLS-----PCWFW  1752
             +N    L++++C  V+KG W NLL+PK G     L  T+  +   LL LS     PC   
Sbjct  8     SNETQLLIQSICASVIKGSWKNLLRPKFGSNDYHLITTTATVRQVLLHLSLYDQSPC---  64

Query  1751  LSWSFFKWVET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNA  1575
             LSW+ FKW+E+ +PNY+HSLQSSW+M+YILTKHKHFK+A   L  IA KDFLS+ +VL++
Sbjct  65    LSWALFKWIESSVPNYKHSLQSSWTMLYILTKHKHFKTAHAFLENIAFKDFLSTQSVLSS  124

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE  1395
             LV+  DD DVNS V SWL+I Y NSK T +AIQVFEH+R+   +P  HACTVLLNSL K+
Sbjct  125   LVKIHDDPDVNSHVLSWLVIVYGNSKMTHEAIQVFEHMRVNGFRPHLHACTVLLNSLAKD  184

Query  1394  GLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTF  1215
              LTDTVWK YKKM+KLGV+ NIH+YNVL+HACCKSG+VEKA++ LSEME K +FPDL+T+
Sbjct  185   RLTDTVWKIYKKMVKLGVVANIHVYNVLLHACCKSGDVEKAEKVLSEMELKCVFPDLFTY  244

Query  1214  NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             NTLISLYC++GMHYEALSVQDRME  G+ PDI TYNSLI+  CREGRMREA++LF+DIK+
Sbjct  245   NTLISLYCKKGMHYEALSVQDRMEMAGISPDIFTYNSLIYGFCREGRMREAVQLFRDIKD  304

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
              VTPN VTYT+LIDGYCRV D+DEALRL   M EKGL P V TYNSILRK CE GR++++
Sbjct  305   -VTPNHVTYTSLIDGYCRVNDLDEALRLKEVMSEKGLYPTVITYNSILRKLCEGGRLRDA  363

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
               LLN+M E+KIEPDNVTCNTLIN YCKIGD+ SALKVK+KM+ AGL+ D FTYKALIHG
Sbjct  364   NILLNEMSERKIEPDNVTCNTLINAYCKIGDMRSALKVKDKMVGAGLKLDQFTYKALIHG  423

Query  674   FCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVD  495
             FCKAK+ ++AKE++F M+ AGFSPSYC YSWLVD+YC Q N EA++KL DE   RG CVD
Sbjct  424   FCKAKEIDKAKELLFGMMDAGFSPSYCTYSWLVDSYCKQQNEEAVIKLPDELVRRGLCVD  483

Query  494   ISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFD  315
             +S YRA+IRR CK  K+DCA+R  G+M+++ I GDSVVYTSLAY Y+K G     SD+ D
Sbjct  484   VSVYRALIRRFCKIEKIDCAQRVLGLMKDKGIFGDSVVYTSLAYGYWKVGKVNVTSDILD  543

Query  314   EMYKRRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             EMYK+RLM+TLK+Y+S +AS   +NS+L LFWN+V++R L+S N+
Sbjct  544   EMYKKRLMITLKIYRSFNASYASDNSILSLFWNHVLERRLMSKNI  588



>ref|XP_011013222.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Populus euphratica]
Length=593

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/585 (63%), Positives = 464/585 (79%), Gaps = 15/585 (3%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIG-----LSVTSTIINHTLLTLS-----PCWFW  1752
             +N    L++++C  V+KG WNNLL+PK G     L  T+  +   LL LS     PC   
Sbjct  8     SNETQLLIQSICASVIKGSWNNLLRPKFGSNDYHLITTTATVGQVLLQLSLYDQSPC---  64

Query  1751  LSWSFFKWVET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNA  1575
             LSW+FFKW+E+ +PNY+HSLQSSW+M+YILTKHKHFK+A   L  IA KDFLS+ +VL++
Sbjct  65    LSWAFFKWIESSVPNYKHSLQSSWTMLYILTKHKHFKTAHAFLENIAFKDFLSTQSVLSS  124

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE  1395
             LV+  DD DVNS V SWL+I Y NSK T +AIQVFEH+R+   +P  HACTVLLNSL K+
Sbjct  125   LVKIHDDPDVNSHVLSWLVIVYGNSKMTHEAIQVFEHMRVNGFRPHLHACTVLLNSLAKD  184

Query  1394  GLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTF  1215
              LTDTVWK YKKM+KLGV+ NIH+YNVL+HACCKSG+VEKA++ LSEME K +FPDL+T+
Sbjct  185   RLTDTVWKIYKKMVKLGVVSNIHVYNVLLHACCKSGDVEKAEKVLSEMELKCVFPDLFTY  244

Query  1214  NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             NTLISLYC++GMHYEAL  QDRME  G+ PDI+TYN+LI+  CREGRMREA++LF+DIK+
Sbjct  245   NTLISLYCKKGMHYEALCAQDRMEMAGISPDIVTYNALIYGFCREGRMREAVQLFRDIKD  304

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
              VTPN VTYT+LIDGYCRV D+DEALRL   M EKGL P + TYNSILRK CE GR++++
Sbjct  305   -VTPNHVTYTSLIDGYCRVNDLDEALRLKEVMSEKGLYPNIITYNSILRKLCEGGRLRDA  363

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
               +LN+M E+KIEPDNVTCNTLIN YCKIGD+ SALKVK+KM+ AGL+ D FTYKALIHG
Sbjct  364   NVMLNEMSERKIEPDNVTCNTLINAYCKIGDMRSALKVKDKMVGAGLKLDQFTYKALIHG  423

Query  674   FCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVD  495
             FCKAK+ ++ KE++F M+ AGFSPSYC YSWLVD+YC Q N EA++KL DE   RG CVD
Sbjct  424   FCKAKEIDKGKELLFGMMDAGFSPSYCTYSWLVDSYCKQQNEEAVIKLPDELVRRGLCVD  483

Query  494   ISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFD  315
             +S YRA+IRR CK  K+DCA+R  G+M+++ I GDSVVY+SLAY Y+K G     SD+ D
Sbjct  484   VSVYRALIRRFCKIEKIDCAQRVLGLMKDKGIFGDSVVYSSLAYGYWKVGKFNVTSDILD  543

Query  314   EMYKRRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             EMYKRRLM+TLK+Y+S +AS   ++S+L LFWN+V++R L+S N+
Sbjct  544   EMYKRRLMITLKIYRSFNASYASDSSILSLFWNHVLERRLMSKNI  588



>ref|XP_006430873.1| hypothetical protein CICLE_v10011342mg [Citrus clementina]
 gb|ESR44113.1| hypothetical protein CICLE_v10011342mg [Citrus clementina]
Length=592

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/583 (64%), Positives = 464/583 (80%), Gaps = 4/583 (1%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFW--LSWSFFKWV  1725
             N++++ +KT+  IVLKGHW  LL P I  S+TST I+  LL L  C     LS +FFKW 
Sbjct  9     NSDTKFIKTISAIVLKGHWAKLLNPNIASSLTSTAIHKVLLNLYNCCHIPSLSCAFFKWA  68

Query  1724  ET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSD  1548
             E+ +PNY+HSLQS W+MI+ILTK+KHFKSA++ML +IA +DFLS+P+VLNALV+  DD D
Sbjct  69    ESAVPNYKHSLQSHWTMIHILTKNKHFKSAQNMLEKIALRDFLSTPSVLNALVKIHDDPD  128

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
              NS V SWL+IFYAN K T DA+QVF+ +R+  + P  HACTVLLNSL K+ LTD VWK 
Sbjct  129   GNSHVLSWLVIFYANLKMTQDALQVFDQMRVHNLMPHLHACTVLLNSLAKDRLTDMVWKV  188

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
             YKKM+KLGV+ NIH+YNVLIHACCKS +V+K ++ L EMEFK +  DL+T+NTLI+LYC+
Sbjct  189   YKKMVKLGVVANIHLYNVLIHACCKSSDVDKVEKLLCEMEFKDVRADLFTYNTLIALYCK  248

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTY  1008
             +GMHYEAL+VQDRMER G+ PDI+TYNSLIH  CREGRMREA RLF+DIK   TPN VTY
Sbjct  249   KGMHYEALAVQDRMEREGISPDIVTYNSLIHGFCREGRMREARRLFRDIK-GATPNHVTY  307

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTLIDGYCR  D++EALRL   M  KGL P V TYNSILRK CE+GR++++ +LLN+M E
Sbjct  308   TTLIDGYCRANDLEEALRLREVMAAKGLYPGVVTYNSILRKLCEQGRIRDANRLLNEMNE  367

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             KKI PDNVTCNTLIN YCKIGD  SA+KVKN+MLEAGL  D FTYKALIHGFCKAK+ + 
Sbjct  368   KKIAPDNVTCNTLINAYCKIGDTASAMKVKNRMLEAGLMLDQFTYKALIHGFCKAKEMDI  427

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             AKE++F M+ AGFSPSYC+YSWLVD YC +NN EAL+KL DEF  RG CVD+S YRA+IR
Sbjct  428   AKELLFGMLDAGFSPSYCSYSWLVDGYCNKNNEEALLKLLDEFVSRGLCVDVSVYRALIR  487

Query  467   RLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMV  288
             R CK+ K+D A+R F +MQ   I GDSV+YTSLAYAY++ G  +A SD+ D+MY+RRLM+
Sbjct  488   RFCKKEKVDYAQRLFNLMQGNGISGDSVIYTSLAYAYWRAGEPKACSDILDDMYRRRLMI  547

Query  287   TlklykslsassKDENSLLDLFWNNVMQRGLISHNVHNSIFLK  159
             TLK+Y+S SAS   +N +LDLFW++V+ RGL+S ++   + L+
Sbjct  548   TLKIYRSFSASYAKDNEILDLFWSHVVDRGLMSKHIFKEMQLR  590



>ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=625

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/569 (65%), Positives = 461/569 (81%), Gaps = 10/569 (2%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS-----PCWFWLSWSFFK  1731
             +E+QLV+ +C  V+KG WNNLL+PKI   +T++ ++  L  LS     PC   LSW+ FK
Sbjct  9     SETQLVQNICATVIKGGWNNLLRPKICSILTASTLHQVLYQLSLHSQGPC---LSWALFK  65

Query  1730  WVET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDD  1554
             W+E+ IPNY+HSLQSSW+MI+ILTK KH K+A+ +L +IA +DFLS+ +VL+ALVR  DD
Sbjct  66    WIESSIPNYKHSLQSSWTMIHILTKFKHLKTAQSLLEKIAYRDFLSTQSVLSALVRLHDD  125

Query  1553  SDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVW  1374
              D+NS VFSWL+I YAN+K   +AIQVFEH+ +   +P  HACTVLLNSL K+ LTD VW
Sbjct  126   PDINSHVFSWLVIVYANTKMKQEAIQVFEHMMVNGFRPHLHACTVLLNSLAKDRLTDMVW  185

Query  1373  KTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY  1194
             K YKKM ++GV  NIH+YNVLIHACCKSG+VEKAD  LSEME K +FPDL+T+NTLISLY
Sbjct  186   KVYKKMARIGVEANIHVYNVLIHACCKSGDVEKADNLLSEMESKCVFPDLFTYNTLISLY  245

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEV  1014
             C++GMHYEALSVQDRMER G++PDI+TYNSLIH  C+EGRMREAMRLFK+I++  TPN V
Sbjct  246   CKKGMHYEALSVQDRMEREGIKPDIVTYNSLIHGFCKEGRMREAMRLFKEIRD-ATPNHV  304

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             TYTTLIDGYCR+ D+D+ALRL   ME +GL P V TYNSILRK CE GR++++ KLLN+M
Sbjct  305   TYTTLIDGYCRLNDLDQALRLREEMEAQGLYPTVVTYNSILRKLCEIGRIRDANKLLNEM  364

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
              EKKIEPDNVTCNTLIN YCKIGD+ SALKVKN+M+EAGL+ D FTYKALIHGFCK ++ 
Sbjct  365   SEKKIEPDNVTCNTLINAYCKIGDMKSALKVKNRMVEAGLKLDQFTYKALIHGFCKIREM  424

Query  653   ERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAI  474
             + AKE++  M+ AGFSPSYC YSWLVD YC Q N EA++KL DEF  +G CVD S YRA+
Sbjct  425   DGAKELLLSMLDAGFSPSYCTYSWLVDGYCNQQNEEAVLKLPDEFVRKGLCVDKSLYRAL  484

Query  473   IRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             IRR CKR ++D A++ F +MQE+  LGDSV+YTSLAYAY+K G   AASDL DEMYKRRL
Sbjct  485   IRRFCKREQVDYAKKIFSLMQEKGTLGDSVIYTSLAYAYWKLGKANAASDLLDEMYKRRL  544

Query  293   MVTlklykslsassKDENSLLDLFWNNVM  207
             M+TLK+Y++L+AS   +NS+L LFWN+V+
Sbjct  545   MITLKIYRALNASYAGDNSILSLFWNHVV  573



>ref|XP_006482334.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Citrus sinensis]
Length=592

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/583 (63%), Positives = 464/583 (80%), Gaps = 4/583 (1%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFW--LSWSFFKWV  1725
             N++++ +KT+  IVLKGHW  LL P I  S+TST I+  LL L  C     LS +FFKW 
Sbjct  9     NSDTKFIKTISAIVLKGHWAKLLYPNIASSLTSTAIHKVLLNLYNCCHIPSLSCAFFKWA  68

Query  1724  ET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSD  1548
             E+ +PNY+HSLQS W+MI+ILTK+KHFKSA++ML +IA +DFLS+P+VLNALV+  DD D
Sbjct  69    ESAVPNYKHSLQSHWTMIHILTKNKHFKSAQNMLEKIALRDFLSTPSVLNALVKIHDDPD  128

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
              NS V SWL+IFYAN K T D +QVF+ +R+  + P  HACTVLLNSL K+ LTD VWK 
Sbjct  129   GNSHVLSWLVIFYANLKMTQDGLQVFDQMRVHNLMPHLHACTVLLNSLAKDRLTDMVWKV  188

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
             YKKM++LGV+ NIH+YNVLIHACCKS +V+K ++ L EMEFK +  DL+T+NTLI+LYC+
Sbjct  189   YKKMVQLGVVANIHLYNVLIHACCKSSDVDKVEKLLCEMEFKDVRADLFTYNTLIALYCK  248

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTY  1008
             +GMHYEAL+VQDRMER G+ PDI+TYNSLIH  CREGRMREA RLF+DIK   TPN VTY
Sbjct  249   KGMHYEALAVQDRMEREGISPDIVTYNSLIHGFCREGRMREARRLFRDIK-GATPNHVTY  307

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTLIDGYCR  D++EALRL   M  KG+ P V TYNSILRK C+EGR++++ +LLN+M E
Sbjct  308   TTLIDGYCRANDLEEALRLREVMAAKGVYPGVVTYNSILRKLCKEGRIRDANRLLNEMNE  367

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             KKI PDNVTCNTLIN YCKIGD  SA+KVKN+MLEAGL  D FTYKALIHGFCKA++ + 
Sbjct  368   KKIAPDNVTCNTLINAYCKIGDTASAMKVKNRMLEAGLMLDQFTYKALIHGFCKAREMDI  427

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             AKE++F M+ AGFSPSYC+YSWLVD YC +NN EAL+KL DEF  RG CVD+S YRA+IR
Sbjct  428   AKEILFGMLDAGFSPSYCSYSWLVDGYCNKNNEEALLKLLDEFVSRGLCVDVSVYRALIR  487

Query  467   RLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMV  288
             R CK+ K+D A+R F +MQ   ILGDSV+YTSLAYAY++ G  +A SD+ D+MY+RRLM+
Sbjct  488   RFCKKEKVDYAQRLFNLMQGNGILGDSVIYTSLAYAYWRAGEPKACSDILDDMYRRRLMI  547

Query  287   TlklykslsassKDENSLLDLFWNNVMQRGLISHNVHNSIFLK  159
             TLK+Y+S SAS   +N +LDLFW++V+ RGL+S ++   + L+
Sbjct  548   TLKIYRSFSASYAKDNEILDLFWSHVVDRGLMSKHIFKEMQLR  590



>gb|KDO58883.1| hypothetical protein CISIN_1g048533mg [Citrus sinensis]
Length=591

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/583 (63%), Positives = 464/583 (80%), Gaps = 4/583 (1%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFW--LSWSFFKWV  1725
             N++++ +KT+  I+LKGHW  LL P I  S+TST I+  LL L  C     LS +FFKW 
Sbjct  8     NSDTKFIKTISAIMLKGHWAKLLNPNIASSLTSTAIHKVLLNLYNCCHIPSLSCAFFKWA  67

Query  1724  ET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSD  1548
             E+ +PNY+HSLQS W+MI+ILTK+KHFKSA++ML +IA +DFLS+P+VLNALV+  DD D
Sbjct  68    ESAVPNYKHSLQSHWTMIHILTKNKHFKSAQNMLEKIALRDFLSTPSVLNALVKIHDDPD  127

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
              NS V SWL+IFYAN K T D +QVF+ +R+  + P  HACTVLLNSL K+ LTD VWK 
Sbjct  128   GNSHVLSWLVIFYANLKMTQDGLQVFDQMRVHNLMPHLHACTVLLNSLAKDRLTDMVWKV  187

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
             YKKM++LGV+ NIH+YNVLIHACCKS +V+K ++ L EMEFK +  DL+T+NTLI+LYC+
Sbjct  188   YKKMVQLGVVANIHLYNVLIHACCKSSDVDKVEKLLCEMEFKDVRADLFTYNTLIALYCK  247

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTY  1008
             +GMHYEAL+VQDRMER G+ PDI+TYNSLIH  CREGRMREA RLF+DIK   TPN VTY
Sbjct  248   KGMHYEALAVQDRMEREGISPDIVTYNSLIHGFCREGRMREARRLFRDIK-GATPNHVTY  306

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTLIDGYCR  D++EALRL   M  KG+ P V TYNSILRK C+EGR++++ +LLN+M E
Sbjct  307   TTLIDGYCRANDLEEALRLREVMAAKGVYPGVVTYNSILRKLCKEGRIRDANRLLNEMNE  366

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             KKI PDNVTCNTLIN YCKIGD  SA+KVKN+MLEAGL  D FTYKALIHGFCKAK+ + 
Sbjct  367   KKIAPDNVTCNTLINAYCKIGDTASAMKVKNRMLEAGLMLDQFTYKALIHGFCKAKEMDI  426

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             AKE++F M+ AGFSPSYC+YSWLVD YC +NN EAL+KL DEF  RG CVD+S YRA+IR
Sbjct  427   AKELLFGMLDAGFSPSYCSYSWLVDGYCNKNNEEALLKLLDEFVSRGLCVDVSVYRALIR  486

Query  467   RLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMV  288
             R CK+ K+D A+R F +MQ   ILGDSV+YTSLAYAY++ G  +A SD+ D+MY+RRLM+
Sbjct  487   RFCKKEKVDYAQRLFNLMQGNGILGDSVIYTSLAYAYWRAGEPKACSDILDDMYRRRLMI  546

Query  287   TlklykslsassKDENSLLDLFWNNVMQRGLISHNVHNSIFLK  159
             TLK+Y+S SAS   +N +LDLFW++V+ RGL+S ++   + L+
Sbjct  547   TLKIYRSFSASYAKDNEILDLFWSHVVDRGLMSKHIFKEMQLR  589



>ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica]
 gb|EMJ09454.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica]
Length=589

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/575 (63%), Positives = 457/575 (79%), Gaps = 3/575 (1%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLS--WSFFKWVET  1719
             E+Q + +LC +V+KGHWNN+LKPKIG S++S  I+  LL LS   +  S  W+FFKWV++
Sbjct  10    ETQFIHSLCAVVVKGHWNNILKPKIGSSLSSANIHQVLLQLSLHGYGPSPSWAFFKWVQS  69

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
             IP Y+HSLQ  W+MI+ILT+HKHFK A+ +L +IA KDFLSSP VLNALV   DD +VNS
Sbjct  70    IPTYKHSLQCCWTMIHILTEHKHFKPAQQLLEKIAFKDFLSSPMVLNALVPIQDDPEVNS  129

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              V SWL+IFYANSK   DAIQVFEH+R+   KP  HAC+ LLNSLVK+ LT+ VWK YK 
Sbjct  130   HVLSWLVIFYANSKMNQDAIQVFEHMRVHGFKPHLHACSALLNSLVKDRLTNMVWKVYKN  189

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MI+ GV+PN+HIYNVLIHACCKSG+ EKAD  + EME K IFPDL+T+NTLISLY +RGM
Sbjct  190   MIQAGVVPNVHIYNVLIHACCKSGDTEKADSLVGEMELKCIFPDLFTYNTLISLYSKRGM  249

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEALSVQDRMER GV PD++TYNSLI++ CREGRMREA++LF++IK   TPN VTYTTL
Sbjct  250   HYEALSVQDRMERAGVSPDMVTYNSLIYAFCREGRMREAVKLFREIK-GATPNHVTYTTL  308

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCRV D++EALRL   M+ KGL P V TYNSILRK CE+GRM+++ KLLN+M E+K+
Sbjct  309   IDGYCRVHDLEEALRLCEVMKAKGLYPGVVTYNSILRKLCEDGRMRDANKLLNEMSERKV  368

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             +PDNVTCNTL+N Y KIGD+ SA+KVK +ML AGL+ D FTYKALIHGFCK  + E A++
Sbjct  369   KPDNVTCNTLVNAYSKIGDMRSAVKVKERMLAAGLKLDEFTYKALIHGFCKVLEMESARD  428

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+ AGFSPSYC Y+W+VD YC + N EA+++L DEF  +G  VD+S YRA+IRRLC
Sbjct  429   LLFSMLDAGFSPSYCTYTWIVDGYCNKGNEEAVIRLPDEFVKKGIYVDVSLYRALIRRLC  488

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             KR ++D AE+ F  M+E+ I GDSV+YTSLAYAY K G +   S L DEMYKRRLMVT K
Sbjct  489   KRERVDSAEKIFSFMEEKSISGDSVIYTSLAYAYLKAGKSSVVSVLLDEMYKRRLMVTRK  548

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNVHN  174
             +Y+  +AS   +N ++ LFW+++++RGL+S NV N
Sbjct  549   IYRCFNASYASDNDIIRLFWDHMVERGLMSKNVIN  583



>ref|XP_008233899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Prunus mume]
Length=589

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/573 (63%), Positives = 457/573 (80%), Gaps = 3/573 (1%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLS--WSFFKWVET  1719
             E+Q +++LC +V+KG WNN+LKPKIG S++S  I+  LL LS   +  S  W+FFKWVE+
Sbjct  10    ETQFIQSLCAVVVKGQWNNILKPKIGSSLSSANIHQVLLQLSLHGYGPSPSWAFFKWVES  69

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
             IP Y+HSLQ  W+MI+ILT+HKHFK A+ +L +IA KDFLSSP VLNALV   DD +VNS
Sbjct  70    IPTYKHSLQCCWTMIHILTEHKHFKPAQQLLEKIALKDFLSSPMVLNALVPIQDDPEVNS  129

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              V SWL+IF+ANSK   DAIQVFEH+R+   KP  HAC+ LLNSLVK+ LT+ VWK YK 
Sbjct  130   HVLSWLVIFFANSKMNQDAIQVFEHMRVHGFKPHLHACSALLNSLVKDRLTNMVWKVYKN  189

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MI+ GV+PN+HIYNVLIHACCKSG+ +KAD  + EME K IFPDL+T+NTLISLY +RGM
Sbjct  190   MIQAGVVPNVHIYNVLIHACCKSGDTDKADSLVGEMELKCIFPDLFTYNTLISLYSKRGM  249

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEALSVQDRMER GV PD++TYNSLI++ CREGRM EA++LF++IK   TPN VTYTTL
Sbjct  250   HYEALSVQDRMERAGVSPDMVTYNSLIYAFCREGRMGEAVKLFREIK-GATPNHVTYTTL  308

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCRV D++EALRL   M+ KGL P V TYNSILRK CE+GRM+++ KLLN+M E+K+
Sbjct  309   IDGYCRVHDLEEALRLCEVMKAKGLYPGVVTYNSILRKLCEDGRMRDANKLLNEMSERKV  368

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             EPDNVTCNTL+N Y KIGD+ SA+KVK++ML AGL+ D FTYKALIHGFCK  + E AK+
Sbjct  369   EPDNVTCNTLVNAYSKIGDMRSAVKVKDRMLAAGLKLDEFTYKALIHGFCKVLEMESAKD  428

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+ AGFSPSYC Y+W+VD YC + N EA+++L DEF  +G CVD+S YRA+IRRLC
Sbjct  429   LLFSMLDAGFSPSYCTYTWIVDGYCNKGNEEAVIRLPDEFVKKGICVDVSLYRALIRRLC  488

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             KR ++D AE+ F  M+E+ I GDSV+YTSLAYAY K G +   S + DEMYKRRLMVT K
Sbjct  489   KRERVDSAEKIFSFMEEKGISGDSVIYTSLAYAYLKAGKSSVVSVMLDEMYKRRLMVTRK  548

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             +Y+  +AS   +N ++ LFW+++++RGL+S NV
Sbjct  549   IYRCFNASYASDNDIIRLFWDHMVERGLVSKNV  581



>ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Fragaria vesca subsp. vesca]
Length=589

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/575 (62%), Positives = 455/575 (79%), Gaps = 3/575 (1%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFW--LSWSFFKWV  1725
               E+QL+++L  IVLKGHW++LL PK+G  +TS+ I+  LL LS   +   LS SFFKW 
Sbjct  8     TVETQLIQSLFAIVLKGHWSHLLNPKLGSCLTSSAIHQVLLQLSLYGYTPSLSLSFFKWA  67

Query  1724  ETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDV  1545
             E++PNY+HSLQ SW+M++ILTKH+HFK+A   L +IA +DFLSSP+VLNAL+ + DD DV
Sbjct  68    ESLPNYKHSLQCSWTMVHILTKHRHFKTAHQFLEKIAFRDFLSSPSVLNALIPTQDDPDV  127

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             NS V SWL+I YANSK T DAIQV EH+R+   KP  HACTVLLNSLVK+ L   VWK Y
Sbjct  128   NSHVLSWLVITYANSKMTQDAIQVLEHMRVHGFKPHLHACTVLLNSLVKDRLISMVWKVY  187

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             KKMIK GV+PNIH YNVLIHACCKSG++EKA+  +SEME + +FPDL+TFNTLISLY + 
Sbjct  188   KKMIKGGVVPNIHTYNVLIHACCKSGDIEKAEGLVSEMELRCVFPDLFTFNTLISLYSKT  247

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYT  1005
             GMHYEAL VQ RME  GV PD++TYNSL++  CREGRM EA++LF+DIK  V PN +TYT
Sbjct  248   GMHYEALCVQSRMELAGVSPDMVTYNSLMYGFCREGRMTEAVKLFRDIKGCV-PNHITYT  306

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEK  825
             TLIDGYCRV D++EALRL   M+ KGL P V TYNSILRK C+EGRM+++ KLLN+M EK
Sbjct  307   TLIDGYCRVNDLEEALRLCEVMKSKGLYPGVVTYNSILRKLCQEGRMRDANKLLNEMSEK  366

Query  824   KIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERA  645
              +EPDNVTCNTLIN YCKIGD++SA+KVKN+ML +GL+ D+FTYKALIHGFC   + + A
Sbjct  367   NVEPDNVTCNTLINAYCKIGDMMSAVKVKNRMLASGLKLDAFTYKALIHGFCMVPEMDSA  426

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRR  465
             K+++F+M+ AGF PSYC Y+W++D YC + N EA++KL DEF  +G  VD+S YRA+IRR
Sbjct  427   KDLLFNMLDAGFCPSYCTYTWIIDAYCNRGNEEAVIKLPDEFVSKGIIVDVSLYRALIRR  486

Query  464   LCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             LCKR +LDCAE+ + +MQE+ IL DSVV+TSL YAY K G +   S + DEM+KRRLMVT
Sbjct  487   LCKRERLDCAEKVYSLMQEKGILADSVVFTSLTYAYLKAGKSSVVSRMLDEMFKRRLMVT  546

Query  284   lklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
              K+Y+S +AS   E+ +L LFWN++++RGL+S  V
Sbjct  547   RKIYRSFNASYASESDILCLFWNHMVERGLMSKTV  581



>ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY04353.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=593

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/583 (62%), Positives = 456/583 (78%), Gaps = 10/583 (2%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS-----PCWFWLSWSFF  1734
             N  ++   T+  I+LKGHWN LLKPKI   +TST IN+ L  LS     P    LSWSFF
Sbjct  8     NNSARFSHTIFTIILKGHWNTLLKPKICTQLTSTTINYLLYKLSLFCSSPS---LSWSFF  64

Query  1733  KWVE-TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDD  1557
             KW+E +IPNY HSLQS+W+M++ILTKHKHFK+A ++L +I+ KDFLSS +VLNALV +  
Sbjct  65    KWIEISIPNYDHSLQSTWAMVHILTKHKHFKTAHNLLGKISNKDFLSSNSVLNALVSTHS  124

Query  1556  DSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTV  1377
             D +VNS V SWL+I Y   + T DA+QVFE +R+  +KP  HACTVLLN LVKE L D V
Sbjct  125   DFEVNSHVLSWLVISYGKLRMTQDALQVFEAMRLHGLKPHLHACTVLLNCLVKEKLIDNV  184

Query  1376  WKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL  1197
             WK YKKM++LGV+ N+H+YNVL+HACCK G+VEKA++ LSEME K +FPD +T+NTLI+L
Sbjct  185   WKVYKKMVRLGVVGNLHVYNVLVHACCKGGDVEKAEKVLSEMELKSVFPDRFTYNTLIAL  244

Query  1196  YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNE  1017
             YC++GMHYEAL VQDRMER G+ PDIITYNSLI+  CREGRMREA+RLFK+IK  V+PN 
Sbjct  245   YCKKGMHYEALCVQDRMERAGISPDIITYNSLIYGFCREGRMREAVRLFKEIK-GVSPNH  303

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
             VTYTTLIDGYCRV D+ EALR+   ME KG+ P V TYNSI+RK CEEG+++E+ ++LN+
Sbjct  304   VTYTTLIDGYCRVNDLGEALRVREMMEAKGIYPGVVTYNSIIRKLCEEGKIREANRVLNE  363

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             M EKK+EPDNVTCNTLIN YCKIGD+ SA+KVKNKM+EAGL+ D FT+KALIHGFC+ ++
Sbjct  364   MSEKKVEPDNVTCNTLINAYCKIGDMGSAMKVKNKMVEAGLKLDQFTFKALIHGFCRVRE  423

Query  656   TERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRA  477
              + A E + +M+ AG SPSY  YSWLVD YC Q N E ++KL DE   RG C+D+S YRA
Sbjct  424   MDSAIEFLINMLDAGISPSYSTYSWLVDGYCNQGNEEKVMKLPDELLKRGLCIDVSVYRA  483

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRR  297
             +IRR CK  ++DCA+R F +M  + I GDSV+YTSLAYAY+K G   AASD+ +EMYKRR
Sbjct  484   LIRRFCKLERVDCAQRIFTLMLGKGISGDSVIYTSLAYAYWKMGKVNAASDVLNEMYKRR  543

Query  296   LMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             LM+TLK+Y+  +AS  D+NS+L  FWN+V++RGL+S ++   I
Sbjct  544   LMITLKIYRCFNASYADDNSILGFFWNHVVERGLMSKSILKDI  586



>ref|XP_010029448.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Eucalyptus grandis]
 ref|XP_010029449.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Eucalyptus grandis]
 gb|KCW56372.1| hypothetical protein EUGRSUZ_I02100 [Eucalyptus grandis]
Length=593

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/569 (63%), Positives = 451/569 (79%), Gaps = 5/569 (1%)
 Frame = -2

Query  1886  QLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS---PCWFWLSWSFFKWVETI  1716
              L +++C +++KG WN     K    +TS++++  LL  S   P    L  +FFK VE++
Sbjct  13    HLAQSICGLIVKGQWNYPFHSKFSSVLTSSVVHQVLLNFSLRGPNPSHL-LAFFKNVESM  71

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             P Y+HSLQSSW+MI+ILT+H HFKSA+D+L +IA +DFLSSP+VL AL R+ DD D NSQ
Sbjct  72    PRYKHSLQSSWTMIHILTRHGHFKSAQDLLEKIALRDFLSSPSVLGALARAHDDPDANSQ  131

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VFSWL+IFYANS+ T DA+QVFEH+R+C +KP   ACTVLL+SL KE LTD VWK YKKM
Sbjct  132   VFSWLVIFYANSRMTQDAVQVFEHMRVCGLKPHLPACTVLLSSLAKERLTDMVWKLYKKM  191

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             ++LGV+PNIHIYNVLIHACCKS + EKA+  L EME K + PDL+TFNTLI+LYC++GMH
Sbjct  192   VRLGVVPNIHIYNVLIHACCKSADAEKAENILIEMESKCVHPDLFTFNTLIALYCKKGMH  251

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLI  996
             YEAL VQDRMERGGV PDI+TYNSLI+  CREGRMREA+RLF++IK  VTPN VTYTTLI
Sbjct  252   YEALCVQDRMERGGVSPDIVTYNSLIYGLCREGRMREAVRLFREIK-GVTPNHVTYTTLI  310

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             DGYCR+ D++EALRL   M  KGL   VATYNSILRK CEEGRM+++ KLLN+M E+K+E
Sbjct  311   DGYCRINDLEEALRLREVMVAKGLYHGVATYNSILRKLCEEGRMRDANKLLNEMSEQKVE  370

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PDN+TCNTLIN YCKI D+ SALKV+N+MLEAGL+ D FT+KALIHGFCK +D   AK+ 
Sbjct  371   PDNITCNTLINAYCKIRDMRSALKVRNRMLEAGLKLDQFTHKALIHGFCKVQDMHNAKDF  430

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCK  456
             +  M+ AGFSPSYC YSWL+D YC  N  E ++ L DE + +G C+++S YRA+IRR CK
Sbjct  431   LISMLNAGFSPSYCTYSWLIDGYCDLNEEEVILGLPDELAKKGLCINVSLYRALIRRFCK  490

Query  455   RGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlkl  276
             R ++D AER F +M+E+ +LGDSV+Y+SLAYAY K GNT A+S + D+MY+RRLM+TLK+
Sbjct  491   RERIDYAERVFSIMKEKGMLGDSVIYSSLAYAYMKAGNTAASSAMLDDMYQRRLMITLKI  550

Query  275   ykslsassKDENSLLDLFWNNVMQRGLIS  189
             Y+SL+AS   + ++L  FWN V+ RGL+S
Sbjct  551   YRSLNASCVGDENILRFFWNEVVNRGLMS  579



>ref|XP_008338591.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Malus domestica]
Length=585

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/573 (62%), Positives = 453/573 (79%), Gaps = 7/573 (1%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLS--WSFFKWVET  1719
             E+Q + ++C IV+KG W+NLLKP     ++S  I+  LL LS   + LS  W+FFKWVE+
Sbjct  10    ETQFIHSVCAIVVKGQWSNLLKPNNDFLLSSATIHQVLLQLSFHGYGLSPSWAFFKWVES  69

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
             +P  +HSLQ SW+MI+ILTKH HFK A  +L +IA KDFLSSP+VLNALVR++DD DVNS
Sbjct  70    LPTCKHSLQCSWTMIHILTKHTHFKPAHQLLEKIALKDFLSSPSVLNALVRTNDDRDVNS  129

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              V SWL+IFYANSK T DAIQV E +RI   KP  HACT LL+SLVK+ +T+ VWK YK 
Sbjct  130   HVLSWLVIFYANSKMTQDAIQVLELMRIHGFKPHLHACTALLSSLVKDRMTNMVWKVYKN  189

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MIK GV+PN+H+YNVLIHACCKSG+VEKA+  LSEMEFK +FPDL+T+NTLISLY +RGM
Sbjct  190   MIKAGVVPNVHLYNVLIHACCKSGDVEKAESLLSEMEFKCVFPDLFTYNTLISLYSKRGM  249

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEALSVQDRMER GV PD++TYNSL+++ CREGRMREA+RLF++IK   TPN ++YTTL
Sbjct  250   HYEALSVQDRMERAGVSPDMVTYNSLMYAFCREGRMREAVRLFREIK-GATPNHISYTTL  308

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCRV D++EALRL   M+ KGL P V TYNSILRK CE+GRM+++ KLLN+M ++ +
Sbjct  309   IDGYCRVNDLEEALRLCEVMKAKGLYPGVVTYNSILRKLCEQGRMRDANKLLNEMSDRNV  368

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             EPDNVTCNTLIN YCKIGD+ SA+ VK++ML AGL+ D FT+KALIHGFC+  + + AK+
Sbjct  369   EPDNVTCNTLINAYCKIGDMRSAVNVKDRMLAAGLKLDEFTHKALIHGFCQVLEMDSAKD  428

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+ AG SPSYC Y+W++D YC Q N  A+++L +    +G C D+S YRA+IRRLC
Sbjct  429   ILFSMLGAGISPSYCTYTWIIDGYCNQGNEAAVIRLXE----KGLCADVSMYRALIRRLC  484

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             KR ++D AE+ F +M+E+ I GDSV+YTSLAYAY K G +   S + DEMYKRRLMVT K
Sbjct  485   KRERVDEAEKVFNLMREKGISGDSVIYTSLAYAYLKAGKSCVVSAMLDEMYKRRLMVTRK  544

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             +Y+S SAS   +N  + LFW+++++RGL+S NV
Sbjct  545   IYRSFSASYARDNDSIRLFWDHMVKRGLMSKNV  577



>ref|XP_009340504.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Pyrus x bretschneideri]
Length=585

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/573 (62%), Positives = 453/573 (79%), Gaps = 7/573 (1%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLS--WSFFKWVET  1719
             E+Q + ++C IV+KG W+NLLKP     ++S  I+  LL LS   + LS  W+FFKWVE+
Sbjct  10    ETQFIHSVCAIVVKGQWSNLLKPNNDSLLSSATIHQVLLQLSFHGYGLSPSWAFFKWVES  69

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
             +P+ +HSLQ SW+MI+ILTKH HFK A  +L +IA KDFLSSP+VLNALVR++DD DVNS
Sbjct  70    LPSCKHSLQCSWTMIHILTKHTHFKPAHQLLEKIALKDFLSSPSVLNALVRTNDDRDVNS  129

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              V SWL+IFYANSK T DAIQV E +RI   KP  HACT LL+SLVK  +T+ VWK YK 
Sbjct  130   HVLSWLVIFYANSKMTQDAIQVLELMRIHGFKPHLHACTALLSSLVKGRMTNMVWKVYKN  189

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MIK GV+PN+H+YNVLIHACCKSG+VEKA+  LSEMEFK +FPDL+T+NTLISLY +RGM
Sbjct  190   MIKAGVVPNVHLYNVLIHACCKSGDVEKAESLLSEMEFKCVFPDLFTYNTLISLYSKRGM  249

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEALSVQDRMER GV PD++TYNSL+++ CREGRMREA+RLF++IK   TPN ++YTTL
Sbjct  250   HYEALSVQDRMERAGVSPDMVTYNSLMYAFCREGRMREAVRLFREIK-GATPNHISYTTL  308

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCRV D++EALRL   M+ KGL P V TYNSILRK CE+GRM+++ KLLN+M ++ +
Sbjct  309   IDGYCRVNDLEEALRLCEVMKAKGLYPGVVTYNSILRKLCEQGRMRDANKLLNEMSDRNV  368

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             EPDNVTCNTLIN YCKIGD+ SA+ VK++ML AGL+ D FTYKALIHGFC+  + + AK+
Sbjct  369   EPDNVTCNTLINAYCKIGDMRSAVNVKDRMLAAGLKLDEFTYKALIHGFCQVLEMDSAKD  428

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+ AG SPSYC Y+W++D YC Q N  A+++L +    +G C D+S YRA+IRRLC
Sbjct  429   ILFSMLGAGISPSYCTYTWIIDGYCNQGNEAAVIRLPE----KGLCADVSMYRALIRRLC  484

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             KR ++D AE+ F +M+E+ I GDSV+YTSL YAY K G +   S + DEMYK+RLMVT K
Sbjct  485   KRERVDEAEKVFNLMREKGISGDSVIYTSLTYAYLKAGKSCVVSAMLDEMYKKRLMVTRK  544

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             +Y+S SAS   +N ++ LFW+++++RGL+S NV
Sbjct  545   IYRSFSASYASDNDIIRLFWDHMVKRGLMSKNV  577



>ref|XP_009338086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Pyrus x bretschneideri]
Length=585

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/573 (61%), Positives = 453/573 (79%), Gaps = 7/573 (1%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLS--WSFFKWVET  1719
             E+Q + ++C IV+KG W+ LLKP     ++S  I+  LL LS   + LS  W+FFKWVE+
Sbjct  10    ETQFIHSVCAIVVKGQWSKLLKPNNHSLLSSATIHQVLLQLSFHGYGLSPSWAFFKWVES  69

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
             +P+ +HSLQ SW+MI+ILTKH HFK A  +L +IA KDFLSS +VLNALVR++DD DVNS
Sbjct  70    LPSCKHSLQCSWTMIHILTKHTHFKPAHQLLEKIALKDFLSSRSVLNALVRTNDDRDVNS  129

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              V SWL+IFYANSK T DAIQV E +RI   KP  HACT LL+SLVK+ +T+ VWK YK 
Sbjct  130   HVLSWLVIFYANSKMTQDAIQVLELIRIHGFKPHLHACTALLSSLVKDRMTNMVWKVYKN  189

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MIK GV+PN+H+YNVLIHACCKSG+VEKA+  LSEMEFK +FPDL+T+NTLISLY +RGM
Sbjct  190   MIKAGVVPNVHLYNVLIHACCKSGDVEKAESLLSEMEFKCVFPDLFTYNTLISLYSKRGM  249

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEALS+QDRMER GV PD++TYNSL+++ CREGRMREA+RLF++IK   TPN ++YTTL
Sbjct  250   HYEALSIQDRMERAGVSPDMVTYNSLMYAFCREGRMREAVRLFREIK-GATPNHISYTTL  308

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCRV D++EALRL   M+ KGL P V TYNSILRK CE+GRM+++ KLLN+M ++ +
Sbjct  309   IDGYCRVNDLEEALRLCEVMKAKGLYPGVVTYNSILRKLCEQGRMRDANKLLNEMSDRNV  368

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             EPDNVTCNTLIN YCKIGD+ SA+ VK++ML +GL+ D FTYKALIHGFC+  + + AK+
Sbjct  369   EPDNVTCNTLINAYCKIGDMRSAVNVKDRMLASGLKLDEFTYKALIHGFCQVLEMDSAKD  428

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+ AG SPSYC Y+W++D YC Q N  A+++L +    +G C D+S YRAIIRRLC
Sbjct  429   ILFSMLGAGISPSYCTYTWIIDGYCNQGNEAAVIRLPE----KGLCADVSMYRAIIRRLC  484

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             KR ++D AE+ F +M+E+ I GDSV+YTSLAYAY K G +   S + DEMYKRRLMVT K
Sbjct  485   KRERVDEAEKVFNLMREKGISGDSVIYTSLAYAYLKAGKSCVVSAMLDEMYKRRLMVTRK  544

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             +Y+S SAS   +N ++ LFW+++++RGL+S NV
Sbjct  545   IYRSFSASYASDNDIIRLFWDHMVKRGLMSKNV  577



>ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Cucumis sativus]
 ref|XP_004166085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Cucumis sativus]
 gb|KGN50851.1| hypothetical protein Csa_5G289620 [Cucumis sativus]
Length=578

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/577 (62%), Positives = 456/577 (79%), Gaps = 9/577 (2%)
 Frame = -2

Query  1883  LVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFW-----LSWSFFKWVET  1719
             LV+++  +V+KGHWN+LLKPKI  S+TS  I+  LL LS   F+     LSW+FFKWVE 
Sbjct  4     LVQSMFAVVVKGHWNHLLKPKISSSLTSKSIHQILLRLS---FYCSGPSLSWAFFKWVEL  60

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
             IP+Y+HSLQSSW+MI+ILT+HKHFK+A+ +L +IA KDF+SSP VLNALV S D+ DVN+
Sbjct  61    IPDYKHSLQSSWAMIFILTEHKHFKTAQGLLEKIAHKDFISSPLVLNALVTSYDNPDVNA  120

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              + SWL+I Y N K   DAIQV E++R+   KP+ HACTVLLNSL K+ LTDTVWK+YKK
Sbjct  121   HILSWLMIIYVNCKMPQDAIQVLEYMRLHGFKPNLHACTVLLNSLAKDRLTDTVWKSYKK  180

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MI++GV+PNIHIYNVLIHACCKSG+VEKA++ + EME K +FPDLYT+NTLISLY R+ +
Sbjct  181   MIRVGVVPNIHIYNVLIHACCKSGDVEKAEQLVCEMELKSVFPDLYTYNTLISLYSRKSL  240

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEAL VQDRMER GV PDI+TYNSLI+  C+EG+MREA++LF++IK+ V+PN VTYTTL
Sbjct  241   HYEALCVQDRMERAGVSPDIVTYNSLIYGFCKEGKMREAVKLFREIKD-VSPNHVTYTTL  299

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCRV D +EALRL   ME KGL   VATYNS+LRK CEEGR++++ KLLN+MGE+K+
Sbjct  300   IDGYCRVNDFEEALRLCKVMEAKGLHLGVATYNSVLRKLCEEGRIRDANKLLNEMGERKV  359

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             EPDNVTCNTLIN YCKIGD+ SALKVK+KML+AGL+ DSFTYKALIHGFC  +D E AKE
Sbjct  360   EPDNVTCNTLINAYCKIGDMKSALKVKSKMLDAGLQLDSFTYKALIHGFCWVRDMESAKE  419

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+  G SP YC YSWLVD YC   N  A++ L DEF  +GYCVD+S  RA+IRRLC
Sbjct  420   LLFCMLDVGLSPGYCTYSWLVDGYCELGNEGAIISLLDEFLTKGYCVDLSVCRALIRRLC  479

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
              + ++  AE+ +  M  R + GDSV+YTSLAYAY+K+G +   S++  EM KR L++ LK
Sbjct  480   HQERVGFAEKIYSTMHLRGVSGDSVIYTSLAYAYWKDGKSNLVSEMLSEMTKRSLLINLK  539

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             LY+  +AS    NS+L LFW++V +RGL+S ++   I
Sbjct  540   LYRCFNASYGPHNSILHLFWDHVAERGLLSKSITKEI  576



>ref|XP_008465224.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Cucumis melo]
Length=578

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/577 (62%), Positives = 454/577 (79%), Gaps = 9/577 (2%)
 Frame = -2

Query  1883  LVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFW-----LSWSFFKWVET  1719
             L++++  +V+KGHWN+LLKPKI  S+TS  I+  L  LS   F+     LSW+FFKWVE 
Sbjct  4     LLQSMFAVVVKGHWNHLLKPKISSSLTSKSIHQILFRLS---FYCSGPSLSWAFFKWVEL  60

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
             IP+Y+HSLQSSW+MI+ILT+HKHFK+A+ +L +IA KDF+SSP VLNALV S D+ DVN+
Sbjct  61    IPDYKHSLQSSWAMIFILTEHKHFKTAQGLLEKIAHKDFISSPLVLNALVTSYDNPDVNA  120

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              + SWL+I Y N K   DAIQVFE++R+   KP  HACTVLLNSL K+ LTDTVWK YKK
Sbjct  121   HILSWLMIIYVNCKMPQDAIQVFEYMRLHGFKPHLHACTVLLNSLAKDRLTDTVWKIYKK  180

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MI++GV+PNIHIYNVLIHACCKSG+VEKA++ + EME K +FPDLYT+NTLISLY R+ +
Sbjct  181   MIRVGVVPNIHIYNVLIHACCKSGDVEKAEQLVCEMELKSVFPDLYTYNTLISLYSRKSL  240

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEAL VQDRMER GV PDI+TYNSLI+  C+EG+MREA++LF++IK+ V+PN VTYTTL
Sbjct  241   HYEALCVQDRMERAGVSPDIVTYNSLIYGFCKEGKMREAVKLFREIKD-VSPNHVTYTTL  299

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCRV D +EALRL   ME KGL   VATYNS+LRK C+EGR++++ KLLN+MGE+K+
Sbjct  300   IDGYCRVNDFEEALRLCKVMEVKGLHLGVATYNSVLRKLCKEGRIRDANKLLNEMGERKV  359

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             EPDNVTCNTLIN YCKIGD+ SALKVK+KML+AGL+ DSFTYKALIHGFC  +D E AKE
Sbjct  360   EPDNVTCNTLINAYCKIGDMKSALKVKSKMLDAGLQLDSFTYKALIHGFCWVRDMESAKE  419

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+  G SP YC YSWLVD YC   N  A++ L DEF  RGYCVD+S  RA+IRRLC
Sbjct  420   LLFCMLDVGLSPGYCTYSWLVDGYCELGNEGAIISLLDEFLTRGYCVDLSVCRALIRRLC  479

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
              R ++  AE+ +  M  R + GDSV+YTSLAYAY+K+G +   S++  EM KR L++ LK
Sbjct  480   HRERVGFAEKIYSAMHLRGVSGDSVIYTSLAYAYWKDGKSNLVSEMLSEMTKRSLLINLK  539

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             LY+  +AS    NS+L LFW++V +RGL+S ++   I
Sbjct  540   LYRCFNASYGPHNSILHLFWDHVAERGLLSRSITKEI  576



>ref|XP_010675446.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Beta vulgaris subsp. vulgaris]
Length=586

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/575 (61%), Positives = 454/575 (79%), Gaps = 2/575 (0%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIP  1713
             E++ +KTLC IVLKG+WN LLKP+IG  ++S  +   L  LS   F+ SW F++WVE IP
Sbjct  10    ENKSIKTLCAIVLKGNWNQLLKPQIGSHLSSVTVEKVLSQLS-LDFYNSWVFYEWVEKIP  68

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
              Y+HSL+ +WSMI++LTKH HF+ A+ +L +IA KD+LSS  VLNALV +  D  +NSQ+
Sbjct  69    GYKHSLEFNWSMIHMLTKHNHFRIAQKVLEKIALKDYLSSSTVLNALVGAHPDPGLNSQI  128

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
              SWL+I+YA+SK T DAIQVFE+++I RIKP  HACTVLLNSLVK G T ++WK YKKM+
Sbjct  129   LSWLVIYYADSKMTHDAIQVFEYMKINRIKPHLHACTVLLNSLVKAGFTSSMWKMYKKML  188

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             KLGV PN+H+YNVLIH CCKSG+VEKA+E L+E+EFK I PD  T+NTLISLY ++  HY
Sbjct  189   KLGVEPNLHVYNVLIHGCCKSGDVEKAEELLNELEFKCILPDRVTYNTLISLYMKKSKHY  248

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLID  993
             EALSVQDRME+  V PDI+TYN L+   C+EGRM+EA+RLF +IK    PN VTYTTL+D
Sbjct  249   EALSVQDRMEKASVAPDIVTYNCLLFGFCQEGRMKEALRLFDEIK-GANPNLVTYTTLVD  307

Query  992   GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEP  813
             GYCR  D++EALRL   ME KG+ P VATYNSILRK CE+GR++++ KLLN+M EKK+EP
Sbjct  308   GYCRANDVEEALRLCQVMEVKGIYPSVATYNSILRKLCEQGRIRDANKLLNEMNEKKVEP  367

Query  812   DNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
             DN+TCNTLIN YCKIGD+ SALKVKNKMLE GL+ D +T+KALIHGFCK K+ +R KE +
Sbjct  368   DNITCNTLINAYCKIGDLQSALKVKNKMLEGGLKLDQYTFKALIHGFCKTKEMDRGKEHL  427

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
             F+M+ AGF PS+  YSW+VD YC Q+N EA+  L +E +GRG CVDIS YRA+IR LCK+
Sbjct  428   FEMLDAGFPPSFYTYSWIVDGYCCQDNVEAVAGLPNELTGRGICVDISVYRALIRSLCKK  487

Query  452   GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlkly  273
             G ++ A++ F  M+E+ I GDS+VYTSLA+ YFKEG  R AS+L DEMYKRRL VTLK+Y
Sbjct  488   GMIEWAKKIFDCMEEKGIKGDSLVYTSLAFGYFKEGKQRMASELLDEMYKRRLSVTLKIY  547

Query  272   kslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             +  S+S+  +N+LL +FW++++QR L+S NV+  +
Sbjct  548   RCFSSSNTSDNNLLGVFWDHLVQRKLLSKNVYKQM  582



>ref|XP_010100903.1| hypothetical protein L484_009673 [Morus notabilis]
 gb|EXB85827.1| hypothetical protein L484_009673 [Morus notabilis]
Length=584

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/575 (60%), Positives = 452/575 (79%), Gaps = 5/575 (1%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLS--WSFFKWVE-  1722
             E+Q ++++C +V+KG W+NL  PK+G+ ++ST I+  L  LS   +  S  W+FF W+E 
Sbjct  4     ETQFIQSVCAVVIKGQWSNLFNPKVGVCLSSTTIHQVLQQLSLHGYGPSPSWAFFNWLEL  63

Query  1721  -TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDV  1545
              T  NY+HSLQ +W+MI+ILTK++HF+ A+ +L +I+ +DF+SSP+VLNALV + +D DV
Sbjct  64    GTNFNYKHSLQCTWTMIHILTKYRHFRPAQQLLARISHRDFISSPSVLNALVTTHNDRDV  123

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             NS V SWL+IFYANSK T DAIQVF+H+R+  +KP  HACTVLLNSLVK+ LTD VWK Y
Sbjct  124   NSHVLSWLVIFYANSKMTQDAIQVFDHMRVRGLKPHLHACTVLLNSLVKDRLTDMVWKVY  183

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             KKMI++GV+PNIH+YNVLIHACC SG+VEKA+  +SEME K +FPDL T+NTLISLYC+R
Sbjct  184   KKMIRVGVVPNIHVYNVLIHACCNSGDVEKAESLVSEMELKCVFPDLVTYNTLISLYCKR  243

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYT  1005
              MHYEALSVQ RME  GV PDI+TYNSLI+  CREGR REA++LF++IK    PN VTYT
Sbjct  244   SMHYEALSVQHRMESAGVSPDIVTYNSLIYGFCREGRTREAVKLFREIK-GANPNHVTYT  302

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEK  825
             TLIDGYCRV D++E+LRL   M+ KGL P V  YNSILR  C+EGR++E  KLL +M E+
Sbjct  303   TLIDGYCRVNDLEESLRLLEVMKAKGLYPGVVAYNSILRMLCKEGRIREGNKLLVEMNER  362

Query  824   KIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERA  645
             K+EPDN+TCNTLIN YCKIGD+ SAL+VK++MLEAGL+ DSFTYKALIHGFCKA+D E A
Sbjct  363   KVEPDNITCNTLINAYCKIGDMRSALRVKDRMLEAGLKLDSFTYKALIHGFCKAQDMENA  422

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRR  465
             KE++F M+ AGFSPSYC YSW+VD +C Q N +++ +L DEF  RG CVD+S YRA+IRR
Sbjct  423   KELLFSMLDAGFSPSYCTYSWIVDGFCNQQNEDSITRLPDEFVKRGLCVDLSLYRALIRR  482

Query  464   LCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
              CKR +LD AER F  MQ + + GD +VY SLAYAY K G    A  + DEMYKRRLM+T
Sbjct  483   FCKRERLDSAERVFTFMQGKNLSGDCIVYASLAYAYMKAGKLGDAEAMLDEMYKRRLMIT  542

Query  284   lklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
              K+Y+S + S   +++++ +FW+++++R L+S ++
Sbjct  543   RKIYRSFNDSYATDDNIMRMFWDHMVERRLMSRSL  577



>ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
isoform X1 [Glycine max]
 ref|XP_006594396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
isoform X2 [Glycine max]
 ref|XP_006594397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
isoform X3 [Glycine max]
 ref|XP_006594398.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
isoform X4 [Glycine max]
 ref|XP_006594399.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
isoform X5 [Glycine max]
 ref|XP_006594400.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
isoform X6 [Glycine max]
Length=587

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/580 (59%), Positives = 456/580 (79%), Gaps = 3/580 (1%)
 Frame = -2

Query  1889  SQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSF--FKWVETI  1716
             +Q V +LC  V+KGHW +L K K   ++TS+ I+  LL LS   + LS+SF  FKW+++I
Sbjct  8     NQFVDSLCAFVVKGHWGDLSKVKNVSALTSSTIHQVLLQLSLYGYGLSYSFPFFKWLDSI  67

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             P+Y HSLQ SW+MI+ILT+HKHFK+A+ ML +IA KDFLSSP+VL  LVR+ D+ +VNSQ
Sbjct  68    PHYSHSLQCSWAMIHILTEHKHFKTAQHMLEKIAHKDFLSSPSVLTTLVRTHDNQEVNSQ  127

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             V SWL+I YA SK T DAIQVFE +R+  +KP  HACTVLLNSL+K+G+T  VWK YKKM
Sbjct  128   VLSWLVIHYAKSKMTQDAIQVFEQMRLHEVKPHLHACTVLLNSLLKDGVTHMVWKIYKKM  187

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             +++GV+PN +IYN L HAC K+G+VE+A++ L+EM+ KG+ PD++T+NTLISLYC++GMH
Sbjct  188   VQVGVVPNTYIYNCLFHACSKAGDVERAEQLLNEMDVKGLLPDIFTYNTLISLYCKKGMH  247

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLI  996
             YEALS+Q+RMER G+  DI++YNSLI+  C+EGRMREAMR+F +IK   TPN VTYTTLI
Sbjct  248   YEALSIQNRMEREGINLDIVSYNSLIYRFCKEGRMREAMRMFSEIKN-ATPNHVTYTTLI  306

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             DGYC+  +++EAL++   ME KGL P V T+NSILRK C++GR++++ KLLN+M E+KI+
Sbjct  307   DGYCKTNELEEALKMREMMEAKGLYPGVVTFNSILRKLCQDGRIRDANKLLNEMSERKIQ  366

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
              DN+TCNTLIN YCKIGD+ SALK KNK+LEAGL+PD FTYKALIHGFCK  + ERAKE+
Sbjct  367   ADNITCNTLINAYCKIGDLKSALKFKNKLLEAGLKPDPFTYKALIHGFCKTNELERAKEL  426

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCK  456
             +F M+ AGF+PSYC YSW+VD Y  ++N ++++ L DEF  RG C+D+S YRA+IRR CK
Sbjct  427   MFSMLDAGFTPSYCTYSWIVDGYNKKDNMDSVLALPDEFLSRGLCLDVSVYRALIRRSCK  486

Query  455   RGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlkl  276
               +++CAER F  M+ + I G+SV+YTSLAYAY+K GN RAAS + +EM +RRLM+T+KL
Sbjct  487   VERVECAERLFNHMEGKGISGESVIYTSLAYAYWKAGNVRAASSMLEEMARRRLMITVKL  546

Query  275   ykslsassKDENSLLDLFWNNVMQRGLISHNVHNSIFLKL  156
             Y+  S S   EN +   FWN+V+ RGL+S N    I  KL
Sbjct  547   YRCFSTSDAHENKVSQFFWNHVVDRGLMSRNTMYKIQQKL  586



>ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Glycine max]
Length=587

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/582 (59%), Positives = 457/582 (79%), Gaps = 3/582 (1%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSF--FKWVE  1722
             + +Q V ++C IV+KGHW NLLK K   ++TS+ I+  LL LS   + LS SF  FKW++
Sbjct  6     SHNQFVDSVCSIVVKGHWGNLLKVKNASALTSSTIHKVLLQLSLYGYGLSHSFPFFKWLD  65

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             +IP+Y HSLQ SW+MI+ILT+HKHFK+A+ +L +IA KDFLSSP+VL+ LVR+ D+ +VN
Sbjct  66    SIPHYSHSLQCSWAMIHILTEHKHFKTAQHVLEKIAHKDFLSSPSVLSTLVRTHDNQEVN  125

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             SQV SWL+I YA SK T DAIQVFE +R+  +KP  HACTVLLNSL+K+G+T  VWK YK
Sbjct  126   SQVLSWLVIHYAKSKMTQDAIQVFEQMRLHEVKPHLHACTVLLNSLLKDGVTHMVWKIYK  185

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             +M+++GV+PNI+IYN L HAC KSG+VE+A++ L+EM+ KG+  D++T+NTL+SLYC++G
Sbjct  186   RMVQVGVVPNIYIYNCLFHACSKSGDVERAEQLLNEMDVKGVLQDIFTYNTLLSLYCKKG  245

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEALS+Q+RMER G+  DI++YNSLI+  C+EGRMREAMR+F +IK   TPN VTYTT
Sbjct  246   MHYEALSIQNRMEREGINLDIVSYNSLIYGFCKEGRMREAMRMFSEIKN-ATPNHVTYTT  304

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYC+  +++EAL++   ME KGL P V TYNSILRK C++GR++++ KLLN+M E+K
Sbjct  305   LIDGYCKTNELEEALKMCKLMEAKGLYPGVVTYNSILRKLCQDGRIRDANKLLNEMSERK  364

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             ++ DN+TCNTLIN YCKIGD+ SALK KNKMLEAGL+PD FTYKALIHGFCK  + E AK
Sbjct  365   LQADNITCNTLINAYCKIGDLKSALKFKNKMLEAGLKPDPFTYKALIHGFCKTNELESAK  424

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             E++F M+ AGF+PSYC YSW+VD Y  ++N +A++ L DEF  RG C+D+S YRA+IR  
Sbjct  425   ELMFSMLDAGFTPSYCTYSWIVDGYNKKDNMDAVLALPDEFLSRGICLDVSVYRALIRSS  484

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CK  ++ CAER F  M+ + I G+SV+YTS+AYAY+  GN  AAS + +EM +RRLM+T+
Sbjct  485   CKVERIQCAERLFYHMEGKGISGESVIYTSIAYAYWNVGNVSAASSMLEEMARRRLMITV  544

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNVHNSIFLKL  156
             KLY+  S S  +EN +  +FWN+VM RGL+S N  N I  KL
Sbjct  545   KLYRCFSTSDANENKVSQIFWNHVMDRGLMSRNTMNKIQQKL  586



>ref|XP_010248801.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
isoform X1 [Nelumbo nucifera]
Length=583

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/574 (60%), Positives = 452/574 (79%), Gaps = 8/574 (1%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS---PCWFWLSWSFFKWVE  1722
             E++  +++C +++KG+W NLLKPK+    T +++N  LL LS   P    L W+FFKWVE
Sbjct  10    ENKFAQSVCAVLMKGNWLNLLKPKMSHCFTPSLVNRILLYLSLDGP----LCWAFFKWVE  65

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             ++P+Y+ SLQ +W+M++ILT+ K + +A+++L +IA +DFLSSP VL+AL+ S  D + N
Sbjct  66    SLPHYKQSLQPNWTMVHILTEQKQYTTAQELLKRIAFRDFLSSPLVLSALISSQSDPNSN  125

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             SQ+ SWL+IFYA SK T DA+QVFE ++    +P  HAC+ +L++LVK GLTD  WKTYK
Sbjct  126   SQILSWLVIFYAQSKMTQDALQVFEQMKTNGFRPHLHACSAILSALVKAGLTDKAWKTYK  185

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM+++G++PNIHIYNVLIHACCKSG+VEKA+  L+EME KGIFPDL+T+NTLISL+C+ G
Sbjct  186   KMLRIGIVPNIHIYNVLIHACCKSGDVEKAEILLNEMESKGIFPDLFTYNTLISLFCKNG  245

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEALS Q+RMER G+ PDI+TYNSLI+  CREGRMREA R F++IK   TPN++TYTT
Sbjct  246   MHYEALSAQERMEREGIHPDIVTYNSLIYGFCREGRMREASRNFREIK-GATPNQITYTT  304

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYCRV D++ ALRL   ME KGL P V TYNSILRK CEEG+M+ +  LL++M  +K
Sbjct  305   LIDGYCRVNDVEAALRLREEMEAKGLHPGVITYNSILRKLCEEGKMRAANNLLSEMSGRK  364

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             +EPDN+TCNTLIN YCKIGD+ SA +VK KMLEAGL  D FTYKALIHGFCK  + ++AK
Sbjct  365   VEPDNITCNTLINAYCKIGDMDSACRVKIKMLEAGLSLDQFTYKALIHGFCKVLEMDKAK  424

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             E++F M+ AG+ PSY  YSW+VD YC Q N EA+VKL DE   RG CVD+S YRA+IR+L
Sbjct  425   ELLFGMLDAGYCPSYYTYSWIVDGYCNQGNEEAVVKLPDELVKRGLCVDVSVYRALIRKL  484

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CKR  +DCA++ F +MQ + I GDSVVYTS+A+AY K G + AAS++FD+M KR+LM+TL
Sbjct  485   CKRENIDCAQKVFHLMQGKGISGDSVVYTSMAFAYMKAGKSIAASEMFDDMAKRKLMITL  544

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             K+YKS +A    ++S+L LFW+++++RGLIS  V
Sbjct  545   KIYKSFTAFYVSDSSILGLFWDHMVERGLISKKV  578



>ref|XP_004511038.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Cicer arietinum]
Length=588

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/574 (59%), Positives = 449/574 (78%), Gaps = 3/574 (1%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWF--WLSWSFFKWV  1725
             N    L+ ++C IV+KG+WNNLLK KI  ++TST I+  +L L    +  +  + FFKWV
Sbjct  6     NHNKHLIDSVCAIVVKGNWNNLLKLKIASTLTSTTIHQVILHLRQHGYGPFFIFQFFKWV  65

Query  1724  ETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDV  1545
              +IP+Y HSLQ SWSMI++LTKH HFK+A+ +L ++A K+ LSSP+VL +LVR  DD +V
Sbjct  66    HSIPHYTHSLQCSWSMIHMLTKHSHFKTAQQVLDKMAQKEMLSSPSVLTSLVRIHDDPEV  125

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             NS V SW++I YA SK T DAIQVFE + + + KP  HACTVLLNSL+K+G+T+ VWK +
Sbjct  126   NSHVLSWVVIHYAKSKMTHDAIQVFEQMSLFKFKPHLHACTVLLNSLLKDGITNVVWKVH  185

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             KKM++ GV+PNI++YN LIHAC KS +V+KA++ L+EME KG+ PD++T+NTLI+LYC++
Sbjct  186   KKMVQDGVVPNIYVYNCLIHACSKSRDVDKAEKLLNEMEGKGVVPDIFTYNTLIALYCKK  245

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYT  1005
             GMHYEALSVQD+MER G+  DI++YNSLI+  C+EGRMREAMR+F +IK   TPN VTYT
Sbjct  246   GMHYEALSVQDKMEREGINLDIVSYNSLIYGFCKEGRMREAMRMFGEIKS-ATPNHVTYT  304

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEK  825
             TLIDGYC+  +++EALRL   ME KGL P V TYNSILRK C +GR++++ KLLN+M E+
Sbjct  305   TLIDGYCKTDELEEALRLRETMEAKGLYPGVVTYNSILRKLCSDGRIRDANKLLNEMSER  364

Query  824   KIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERA  645
             KI+ DN+TCNTLIN YCKIGD+ SALK KNKMLEAGL+PD FTYKALIHGFCK  + E A
Sbjct  365   KIQADNITCNTLINAYCKIGDLNSALKFKNKMLEAGLKPDPFTYKALIHGFCKTSELESA  424

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRR  465
             KE++F M+ AGFSPSYC YSW+VD YC ++N +A++ L DEF  +G+C+D+S YRA+IRR
Sbjct  425   KELLFVMLDAGFSPSYCTYSWIVDCYCKKDNTDAVLALPDEFLSKGFCLDVSVYRALIRR  484

Query  464   LCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             LCK  +++CAE+    M+ + I GDS++YTSLAYAY+K GNT AAS++ +EM +R LM+ 
Sbjct  485   LCKIERIECAEKLLYHMEGKGISGDSIIYTSLAYAYWKSGNTNAASNMLEEMARRMLMIN  544

Query  284   lklykslsassKDENSLLDLFWNNVMQRGLISHN  183
              K+Y+  SA    E  +  +FW++V++RGL+S N
Sbjct  545   AKIYRCFSAPDGSETKVSQMFWDHVVERGLMSRN  578



>gb|EPS67755.1| hypothetical protein M569_07017, partial [Genlisea aurea]
Length=567

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/571 (58%), Positives = 444/571 (78%), Gaps = 5/571 (1%)
 Frame = -2

Query  1877  KTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHS  1698
             K+LC +VLKGHW+ +LKP+IG S++S+ ++  LL L P  FW+SWSFFKW+ET+P Y+ S
Sbjct  1     KSLCAVVLKGHWDTILKPRIGTSLSSSFLSQALLVLLPSQFWISWSFFKWIETVPRYKLS  60

Query  1697  LQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLL  1518
             LQS W ++ +L + + F++A+D+LH++A ++FLSSP VLNA+V +  D  + + V SWL+
Sbjct  61    LQSYWVVVCVLAQRRRFETARDILHKLAVREFLSSPPVLNAVVDTYHDPYIMAHVLSWLV  120

Query  1517  IFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVL  1338
             IFYANSK   D++QVFEH+ +C  KP  HACTVLLNSLVKE LTDTVWKTYKKM+++GV+
Sbjct  121   IFYANSKMNPDSLQVFEHMIVCGYKPHLHACTVLLNSLVKERLTDTVWKTYKKMLRVGVV  180

Query  1337  PNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSV  1158
             PN++IYNVLIHACCKSG+V++A+E  SE+E   I PDL+T+NTLISLYC+RGMHYEAL V
Sbjct  181   PNLYIYNVLIHACCKSGDVKRAEELFSELELHRISPDLFTYNTLISLYCKRGMHYEALCV  240

Query  1157  QDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLIDGYCRV  978
             QDRMERGGV PDI+T+NS+I+S+C+ GRMREA+R+F +IK   +PN VTYTTLIDGYCRV
Sbjct  241   QDRMERGGVSPDIVTWNSIIYSYCKGGRMREALRIFNEIKGVASPNHVTYTTLIDGYCRV  300

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
              D+D AL+L   ME K L P V TYN+I+RK C++GRM+E+ +LL  M + ++EPD VTC
Sbjct  301   DDLDAALQLLDTMEAKQLYPGVVTYNAIIRKLCQDGRMREANRLLTTMSDNRVEPDLVTC  360

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             NTLIN YCKIGD+ SALKVK KM EAGL+PD +TY ALIHGF ++ D + AK  +F+M++
Sbjct  361   NTLINAYCKIGDMTSALKVKGKMSEAGLKPDQYTYNALIHGFSRSMDIDSAKATLFNMLS  420

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCV-DISFYRAIIRRLCKRGKLD  441
              G++PS+C YSW+VD YC +N+  A++ L  E + +G CV D S YRA IRRLCK+G++ 
Sbjct  421   DGYTPSHCTYSWIVDFYCTRNDANAILNLPGELTEKGLCVNDNSVYRAFIRRLCKKGEVV  480

Query  440   CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklyksls  261
              A R F  M+ REI+GDSV++T+LAYA+++ G+ R AS  FDEM++RRLMVT+K+++S+ 
Sbjct  481   SAVRVFRDMKRREIVGDSVIFTNLAYAFWRNGDARGASSFFDEMHERRLMVTVKIFRSME  540

Query  260   assKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             AS       L  FW  ++ RGLIS      I
Sbjct  541   ASYGS----LPSFWEALVGRGLISKATQKQI  567



>ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris]
 ref|XP_007133768.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris]
 ref|XP_007133769.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris]
 gb|ESW05761.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris]
 gb|ESW05762.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris]
 gb|ESW05763.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris]
Length=587

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/578 (57%), Positives = 450/578 (78%), Gaps = 3/578 (1%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS--PCWFWLSWSFFKWVE  1722
             +  Q + ++C +V+KG+W NLLK K   + TS+ I+  LL LS      + S+ FFKW++
Sbjct  6     SHRQFIDSVCTVVIKGNWGNLLKVKNASAFTSSTIHQVLLQLSLYDSGIFHSFPFFKWLD  65

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             +IP+Y HSLQ SW+MI+ILT+HKHFK+A++ML +IA +DFL SP+VL+ LVR+ D+ +VN
Sbjct  66    SIPHYSHSLQCSWAMIHILTEHKHFKTAQNMLEKIANRDFLPSPSVLSTLVRTHDNPEVN  125

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             SQV SWL+I YA SK T DAIQVFE + +  +KP  HACTVLLNSL+K+G+T  VWK Y+
Sbjct  126   SQVLSWLVIHYAKSKMTHDAIQVFEQMMLHEVKPHLHACTVLLNSLLKDGVTHMVWKIYR  185

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             +M+K+GV+PN++IYN L HAC K+ +VE+A++ L+E++ KG+ PD++T+NTLISLYC++G
Sbjct  186   RMVKVGVVPNMYIYNCLFHACSKARDVERAEQLLNELDLKGMLPDIFTYNTLISLYCKKG  245

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEALS+Q RMER G+  DI++YNSLI+  C+EGR+REAMR+F +IK   TPN+VTYTT
Sbjct  246   MHYEALSIQSRMEREGINLDIVSYNSLIYGFCKEGRLREAMRMFSEIKN-ATPNQVTYTT  304

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYC+  +++EAL++   ME KGL P V TYNSILRK C++GR+K++ KLL++M E+K
Sbjct  305   LIDGYCKTNELEEALKIQGLMESKGLYPGVVTYNSILRKLCQDGRIKDANKLLSEMSERK  364

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             ++ DN+TCNTLIN YCKIGD+ SALK KNKMLE GL+PD FTYKALIHGFCK  + E AK
Sbjct  365   VQADNITCNTLINAYCKIGDMKSALKFKNKMLEYGLKPDPFTYKALIHGFCKTNELESAK  424

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             EV+F M+ AGF+ SYC Y+W+VD YC ++N +A++ L +EF  RG C+D+S YRA+IRR 
Sbjct  425   EVLFSMLDAGFTLSYCTYTWIVDCYCKKDNMDAVLALPNEFMSRGLCLDVSVYRALIRRS  484

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CK  +++CAE+ F  M+ + I  DSV+YTSLAYAY+K GN  AA  + +EM +RRLM+T+
Sbjct  485   CKLERVECAEKLFNQMEGKGISADSVIYTSLAYAYWKAGNASAALGVLEEMTRRRLMITV  544

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHNVHNSI  168
             KLY+  S S   EN +  LFWN+V+ RGL+S N  N I
Sbjct  545   KLYRCFSTSDASENKVSLLFWNHVVDRGLMSRNSMNKI  582



>ref|XP_010528449.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Tarenaya hassleriana]
Length=604

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/581 (59%), Positives = 447/581 (77%), Gaps = 9/581 (2%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLSPCWFW----LSWS  1740
             AN E+ +V+++C  VLKG+W+ +LKPK   GL +TSTIIN  L  +  C  +    LSW 
Sbjct  7     ANRETLIVQSVCAAVLKGNWSKILKPKFDSGL-LTSTIINRVLSEVFLCAGYGGLPLSWG  65

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVR-S  1563
             FFKWV ++  Y+HSLQSSW M+ +LTKHKHFK+A  +L +I+ ++ LSSP VL +L   +
Sbjct  66    FFKWVGSLSGYKHSLQSSWKMVLVLTKHKHFKTAHQLLDRISKRELLSSPLVLRSLAGGA  125

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
             ++D +V S VFSW++IFYA S  T D+I+VFE +R C + P   ACTVLLNSLVKE  TD
Sbjct  126   NEDPEVLSHVFSWIMIFYAKSGMTRDSIEVFEQIRSCGLMPHLQACTVLLNSLVKERSTD  185

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             TVWK +KKM+K GV+ NIH+YNVL+HAC ++G+VEKA++ LSEME KG+FPDL+T+NTLI
Sbjct  186   TVWKIFKKMVKSGVVANIHLYNVLVHACAEAGDVEKAEKLLSEMEEKGVFPDLFTYNTLI  245

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
              LYC++GMHYEALSVQDRMER G+ PDI+TYNSLIH  CREGRMREA+RLF++IK  + P
Sbjct  246   VLYCKKGMHYEALSVQDRMERSGIAPDIVTYNSLIHGFCREGRMREAVRLFREIK-GIVP  304

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCRV D+DEALRLH  ME KG  P + +YNSILRK CE+GR++E+ +LL
Sbjct  305   NHVTYTTLIDGYCRVNDMDEALRLHEVMEGKGFSPGIVSYNSILRKLCEDGRIREANRLL  364

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
             N M  K+IEPDNVTCNTLIN YCKIGD+ SA+KVK+KML+AGL+ D F+YKALIHGFCK 
Sbjct  365   NDMSGKRIEPDNVTCNTLINAYCKIGDMKSAVKVKDKMLDAGLKLDLFSYKALIHGFCKV  424

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + + AKE +F M+  G SP Y  YSWLVD +C Q+  E ++KL  EF  RG   D+S Y
Sbjct  425   LELDSAKEQLFSMVGKGLSPGYSTYSWLVDGFCNQHKQEEIMKLPKEFEERGLFPDVSLY  484

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             RA+IRRLC+  ++D A+  +  M+++ I GDSV+YTS+AYAY++ G    AS LFD MYK
Sbjct  485   RALIRRLCRLQQVDYAKGLYESMKQKGIAGDSVIYTSIAYAYWRTGKVNEASVLFDIMYK  544

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             RRLM+ L+LY+SLSAS+  +N +L LFW++V  RGL+S ++
Sbjct  545   RRLMINLQLYRSLSASNAGDNDILSLFWSHVADRGLMSKSI  585



>ref|XP_006594401.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
isoform X7 [Glycine max]
Length=542

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/535 (60%), Positives = 428/535 (80%), Gaps = 3/535 (1%)
 Frame = -2

Query  1889  SQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSF--FKWVETI  1716
             +Q V +LC  V+KGHW +L K K   ++TS+ I+  LL LS   + LS+SF  FKW+++I
Sbjct  8     NQFVDSLCAFVVKGHWGDLSKVKNVSALTSSTIHQVLLQLSLYGYGLSYSFPFFKWLDSI  67

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             P+Y HSLQ SW+MI+ILT+HKHFK+A+ ML +IA KDFLSSP+VL  LVR+ D+ +VNSQ
Sbjct  68    PHYSHSLQCSWAMIHILTEHKHFKTAQHMLEKIAHKDFLSSPSVLTTLVRTHDNQEVNSQ  127

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             V SWL+I YA SK T DAIQVFE +R+  +KP  HACTVLLNSL+K+G+T  VWK YKKM
Sbjct  128   VLSWLVIHYAKSKMTQDAIQVFEQMRLHEVKPHLHACTVLLNSLLKDGVTHMVWKIYKKM  187

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             +++GV+PN +IYN L HAC K+G+VE+A++ L+EM+ KG+ PD++T+NTLISLYC++GMH
Sbjct  188   VQVGVVPNTYIYNCLFHACSKAGDVERAEQLLNEMDVKGLLPDIFTYNTLISLYCKKGMH  247

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLI  996
             YEALS+Q+RMER G+  DI++YNSLI+  C+EGRMREAMR+F +IK   TPN VTYTTLI
Sbjct  248   YEALSIQNRMEREGINLDIVSYNSLIYRFCKEGRMREAMRMFSEIK-NATPNHVTYTTLI  306

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             DGYC+  +++EAL++   ME KGL P V T+NSILRK C++GR++++ KLLN+M E+KI+
Sbjct  307   DGYCKTNELEEALKMREMMEAKGLYPGVVTFNSILRKLCQDGRIRDANKLLNEMSERKIQ  366

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
              DN+TCNTLIN YCKIGD+ SALK KNK+LEAGL+PD FTYKALIHGFCK  + ERAKE+
Sbjct  367   ADNITCNTLINAYCKIGDLKSALKFKNKLLEAGLKPDPFTYKALIHGFCKTNELERAKEL  426

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCK  456
             +F M+ AGF+PSYC YSW+VD Y  ++N ++++ L DEF  RG C+D+S YRA+IRR CK
Sbjct  427   MFSMLDAGFTPSYCTYSWIVDGYNKKDNMDSVLALPDEFLSRGLCLDVSVYRALIRRSCK  486

Query  455   RGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
               +++CAER F  M+ + I G+SV+YTSLAYAY+K GN RAAS + +EM +R ++
Sbjct  487   VERVECAERLFNHMEGKGISGESVIYTSLAYAYWKAGNVRAASSMLEEMARRSIL  541



>ref|XP_003627859.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AET02335.1| PPR containing plant-like protein [Medicago truncatula]
Length=731

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/573 (57%), Positives = 451/573 (79%), Gaps = 3/573 (1%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWF--WLSWSFFKWVE  1722
             +   L++++C I++KG WNNLLKPK   ++TST I+  +L L    +  +  + FFKW +
Sbjct  10    SNKHLIESVCAIIVKGDWNNLLKPKTASTLTSTTIHQVILHLKQHRYEPFFIFHFFKWAQ  69

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             +IP+Y HSL SSWSMI++LTKH+HFK+A+ +L ++A ++ LSSP+VL +LVR  DD +VN
Sbjct  70    SIPHYTHSLHSSWSMIHMLTKHRHFKTAQQVLDKMAQREILSSPSVLTSLVRIHDDPEVN  129

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             S V SW++I YA SK T DA+QVFE + +C +KP  HACTVL+NSL+K+G+T  VWK YK
Sbjct  130   SHVLSWIVIHYAKSKMTHDAVQVFEQMSLCNLKPHLHACTVLMNSLLKDGITSMVWKVYK  189

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             +M++ GV+PNI++YN LIHAC KS +VE+A+  L+EME KG+ PD++T+NTLI+LYC++G
Sbjct  190   RMVQDGVVPNIYVYNCLIHACSKSRDVERAEFILNEMEVKGVVPDIFTYNTLIALYCKKG  249

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             +HYEALSVQD+MER G+  DI++YNSLI+  C+EG+MREAMR+F +IK+ + PN VTYTT
Sbjct  250   LHYEALSVQDKMEREGINLDIVSYNSLIYGFCKEGKMREAMRMFGEIKDAI-PNHVTYTT  308

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYC+  + +EALRL   M  KGL P V TYNSILRK C +GR++++ KLL++M E+K
Sbjct  309   LIDGYCKANEFEEALRLREMMVAKGLYPGVVTYNSILRKLCSDGRIRDANKLLHEMSERK  368

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             ++ D+VTCNTLIN YCKIGD+ SALK K KMLEAGL P+SFTYKALIHGFCK  + E AK
Sbjct  369   VQADSVTCNTLINAYCKIGDLNSALKFKTKMLEAGLTPNSFTYKALIHGFCKTSELESAK  428

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             E++F M+ AGFSP+Y  YSW+VD+YC ++N +A++ L DEF  +G+C++IS YRA+IRRL
Sbjct  429   ELLFGMLDAGFSPNYRTYSWIVDSYCKKDNTDAVLALPDEFLSKGFCLNISLYRALIRRL  488

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTl  282
             CK  +++CAE+    M+ + I GDSV+YTSLA++Y+K GNT AASD+ +EM +RRLM+T+
Sbjct  489   CKIERIECAEKLLYHMEGKGISGDSVIYTSLAFSYWKSGNTNAASDMLEEMARRRLMITV  548

Query  281   klykslsassKDENSLLDLFWNNVMQRGLISHN  183
             K+Y+  SA    +N +  +FW++V++RGL+S N
Sbjct  549   KIYRCFSALDASQNKVSQMFWDHVVERGLMSRN  581



>ref|XP_010450873.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Camelina sativa]
Length=596

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/581 (59%), Positives = 439/581 (76%), Gaps = 8/581 (1%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLSPCWFW----LSWS  1740
             AN E+ + +++C  VLKG+W N+LK K+  GL + S II   +  LS    +    LSWS
Sbjct  7     ANGEALIAQSICGAVLKGNWKNVLKHKVDSGL-LKSAIITQVISELSLYSGYGGPSLSWS  65

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS-  1563
             F+ W +++P+ +HSLQSSW MI ILTKHKHFK+A  +L +++ ++ LSSP VL +L+   
Sbjct  66    FYTWTDSLPSCKHSLQSSWRMILILTKHKHFKTAHQLLDKLSQRELLSSPLVLRSLLGGV  125

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
              +D +V S VFSWL+I+YA S    D+I+VFE +R C +KP   ACTVLLNSLVKE LTD
Sbjct  126   SEDPEVLSHVFSWLIIYYAKSGMVSDSIEVFEQIRSCGLKPHLQACTVLLNSLVKERLTD  185

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             TVWK +KKM+KLGV+ NIH+YNVL+HAC KSG+ EKA++FLSEME KG+FPDL+T+NTLI
Sbjct  186   TVWKVFKKMVKLGVVANIHVYNVLVHACSKSGDPEKAEKFLSEMEEKGVFPDLFTYNTLI  245

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
             S+YC++GMHYEALSVQDRMER GV PDI+TYNSLIH   REGRMREA RLF++IK  VT 
Sbjct  246   SVYCKKGMHYEALSVQDRMERSGVAPDIVTYNSLIHGFSREGRMREATRLFREIKGVVTA  305

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCR+ DIDEALRL   ME +G  P V TYNSILRK CE+GR++ES + L
Sbjct  306   NHVTYTTLIDGYCRMNDIDEALRLREVMESRGFTPGVVTYNSILRKLCEDGRIRESNRFL  365

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
             ++M  KKIEPDN+TCNTLIN YCKIGD+VSA+KVK KM+E+GLR D ++YKAL+HGFCK 
Sbjct  366   SEMSGKKIEPDNITCNTLINAYCKIGDMVSAVKVKKKMIESGLRLDMYSYKALVHGFCKV  425

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + + AKE +F M+  G SP Y AYSWLVD +  QN  E  VK  +EF  RG C D++ Y
Sbjct  426   LELDNAKEELFSMLEKGLSPGYSAYSWLVDGFYNQNKQEETVKFPEEFEKRGLCPDVALY  485

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             R +IRRLCK  +++ A+  F  M+++ ++GDSV+YTS+AYAY++ GN   AS LFD MY 
Sbjct  486   RGLIRRLCKLEQVNYAKVLFESMEKKGLVGDSVIYTSMAYAYWRTGNVTEASALFDTMYN  545

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             RRLMV LKLYKS+SAS   +  +L  FW++V  R LIS ++
Sbjct  546   RRLMVNLKLYKSISASYAGDEDVLKFFWSHVGDRCLISKSI  586



>ref|XP_008802748.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Phoenix dactylifera]
Length=589

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/572 (57%), Positives = 438/572 (77%), Gaps = 2/572 (0%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIP  1713
             E   ++ +C IV KG+W+NL    +    T++ +N  LL LS     LSW FFKW++++P
Sbjct  10    EVAFIQGVCAIVSKGNWSNLSNTNVSHGFTTSNVNQILLQLSADTS-LSWGFFKWLQSLP  68

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             +Y HSLQ +W+M+++LTK++ FK+A+++L + A KDFLSSP+VLNAL+ S +D+D NSQ+
Sbjct  69    HYHHSLQPNWTMVHLLTKNRQFKAARELLERFAFKDFLSSPSVLNALLSSYEDADSNSQI  128

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
              SWL+I Y+ SK T DA+Q+FE ++   ++PDPHAC+ LL++L K  LT T WK Y +MI
Sbjct  129   LSWLVIIYSQSKMTQDAVQIFEQMKSNGLRPDPHACSALLSALAKARLTATAWKVYNEMI  188

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
              +GV+PN+HI+NV+IHAC KSG+VEKA   ++EME  GI PDL+++NTLISL+C++GMHY
Sbjct  189   WMGVVPNVHIFNVMIHACYKSGDVEKAQNLVNEMERSGIRPDLFSYNTLISLFCKKGMHY  248

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLID  993
             EAL+VQ+RM R G+ PDI+TYNSLI+  C+EGRMREA RLFK+IK  V PN VTYTTLID
Sbjct  249   EALAVQERMVREGIHPDIVTYNSLIYGFCKEGRMREASRLFKEIK-GVIPNLVTYTTLID  307

Query  992   GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEP  813
             GYCRV ++DEALRL   ME KGL P VATYNSI+RK CEEG+MK    LLN+M E+K++P
Sbjct  308   GYCRVNNLDEALRLRDEMEAKGLYPGVATYNSIIRKLCEEGKMKTVNDLLNEMDERKVQP  367

Query  812   DNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
             DN+TCNTLIN YCK G++  A K+++KMLE+GL  D FTYKALIHGFCK ++ + AK V+
Sbjct  368   DNITCNTLINAYCKRGNMAFAWKLRSKMLESGLALDQFTYKALIHGFCKVQELDEAKVVL  427

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
             FDM+ AG SP+Y  YSWLVD YC QNN EA++++ DE + RG  VD S YRA+IRR CKR
Sbjct  428   FDMLDAGLSPNYSTYSWLVDGYCNQNNAEAVLRIPDELAKRGLSVDKSVYRALIRRFCKR  487

Query  452   GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlkly  273
             G +D AE+ F  MQ +   GDS+VYT+LAYAY   G   AAS++ ++M K++L++T+++Y
Sbjct  488   GLVDFAEKVFIQMQGKGFSGDSLVYTTLAYAYLSAGKPIAASEMINDMAKKQLVITVEIY  547

Query  272   kslsassKDENSLLDLFWNNVMQRGLISHNVH  177
               L+AS  DEN +L+L WN+  +RGLI+ NV+
Sbjct  548   NCLNASYADENGILELLWNHASERGLIAKNVY  579



>ref|XP_010440983.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Camelina sativa]
Length=596

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/581 (59%), Positives = 438/581 (75%), Gaps = 8/581 (1%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLSPCWFW----LSWS  1740
             AN E+ + +++C  VLKG+W N+LK K   GL + S II   +  LS    +    LSWS
Sbjct  7     ANGEALIAQSICGAVLKGNWKNILKHKADSGL-LKSAIITQVISELSLYSGYGGPSLSWS  65

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS-  1563
             F+ W +++P  +HSLQSSW MI ILTK+KHFK+A  +L +++ ++ LSSP VL +L+   
Sbjct  66    FYTWTDSLPGCKHSLQSSWKMILILTKYKHFKTAHQLLDKLSQRELLSSPLVLRSLLGGV  125

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
              +D +V S VFSWL+I+YA S+   D+I+VFE +R C +KP   ACTVLLNSLVKE LTD
Sbjct  126   SEDPEVLSHVFSWLIIYYAKSRMVSDSIEVFEQIRSCGLKPHLQACTVLLNSLVKERLTD  185

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             TVWK +KKM+KLGV+ NIH+YNVL+HAC KSG+ EKA++ LSEME KG+FPDL+T+NTLI
Sbjct  186   TVWKVFKKMVKLGVVANIHVYNVLVHACSKSGDPEKAEKLLSEMEEKGVFPDLFTYNTLI  245

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
             S+YC++GMHYEALSVQDRMER GV PDI+TYNSLIH   REGRMREA RLF++IK  VT 
Sbjct  246   SVYCKKGMHYEALSVQDRMERSGVAPDIVTYNSLIHGFSREGRMREATRLFREIKGVVTA  305

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCR+ DIDEALRL   ME +G  P V TYNSILRK CE+GR++ES +LL
Sbjct  306   NHVTYTTLIDGYCRMNDIDEALRLREVMESRGFTPGVVTYNSILRKLCEDGRIRESNRLL  365

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +M  KKIEPDN+TCNTLIN Y KIGD+VSA+KVK KM+E+GL+ D ++YKALIHGFCK 
Sbjct  366   TEMSGKKIEPDNITCNTLINAYSKIGDMVSAVKVKKKMIESGLKLDMYSYKALIHGFCKV  425

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + + AKE +F M+  G SP Y AYSWLVD +  QN  E +VKL +EF  RG C D++ Y
Sbjct  426   LELDNAKEEMFSMLEKGLSPGYSAYSWLVDGFYYQNKQEEIVKLPEEFEKRGLCPDVALY  485

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             R +IRR+CK  +++ A+  F  M+++ ++GDSV+YTS+AYAY++ GN   AS LFD MY 
Sbjct  486   RGLIRRICKLEQVNDAKVLFESMEKKGLVGDSVIYTSMAYAYWRTGNVTEASALFDTMYN  545

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             RRLMV LKLYKS+SAS   +  +L  FW++V  R LIS ++
Sbjct  546   RRLMVNLKLYKSISASYAGDKDVLKFFWSHVGDRSLISKSI  586



>ref|NP_198689.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9FKR3.1|PP404_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g38730 
[Arabidopsis thaliana]
 dbj|BAB10131.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94354.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=596

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/581 (58%), Positives = 437/581 (75%), Gaps = 8/581 (1%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GL---SVTSTIINHTLLTLSPCWFWLSWSF  1737
             AN E+ + +++C  VLKG+W N+LK K+  GL   ++T+ +I+   L        LSWSF
Sbjct  7     ANREALIAQSICATVLKGNWKNILKHKVDSGLLKSAITTQVISELSLFSGYGGPSLSWSF  66

Query  1736  FKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVR--S  1563
             F W +++P+ +HSLQSSW MI ILTKHKHFK+A  +L ++A ++ LSSP VL +LV   S
Sbjct  67    FIWTDSLPSSKHSLQSSWKMILILTKHKHFKTAHQLLDKLAQRELLSSPLVLRSLVGGVS  126

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
             +D  DV S VFSWL+I+YA +    D+I VFE +R C +KP   ACTVLLNSLVK+ LTD
Sbjct  127   EDPEDV-SHVFSWLMIYYAKAGMINDSIVVFEQIRSCGLKPHLQACTVLLNSLVKQRLTD  185

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             TVWK +KKM+KLGV+ NIH+YNVL+HAC KSG+ EKA++ LSEME KG+FPD++T+NTLI
Sbjct  186   TVWKIFKKMVKLGVVANIHVYNVLVHACSKSGDPEKAEKLLSEMEEKGVFPDIFTYNTLI  245

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
             S+YC++ MH+EALSVQDRMER GV P+I+TYNS IH   REGRMREA RLF++IK+ VT 
Sbjct  246   SVYCKKSMHFEALSVQDRMERSGVAPNIVTYNSFIHGFSREGRMREATRLFREIKDDVTA  305

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCR+ DIDEALRL   ME +G  P V TYNSILRK CE+GR++E+ +LL
Sbjct  306   NHVTYTTLIDGYCRMNDIDEALRLREVMESRGFSPGVVTYNSILRKLCEDGRIREANRLL  365

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +M  KKIEPDN+TCNTLIN YCKI D+VSA+KVK KM+E+GL+ D ++YKALIHGFCK 
Sbjct  366   TEMSGKKIEPDNITCNTLINAYCKIEDMVSAVKVKKKMIESGLKLDMYSYKALIHGFCKV  425

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + E AKE +F MI  GFSP Y  YSWLVD +  QN  + + KL +EF  RG C D++ Y
Sbjct  426   LELENAKEELFSMIEKGFSPGYATYSWLVDGFYNQNKQDEITKLLEEFEKRGLCADVALY  485

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             R +IRR+CK  ++D A+  F  M+++ ++GDSV++T++AYAY++ G    AS LFD MY 
Sbjct  486   RGLIRRICKLEQVDYAKVLFESMEKKGLVGDSVIFTTMAYAYWRTGKVTEASALFDVMYN  545

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             RRLMV LKLYKS+SAS   +N +L  FW++V  R LIS ++
Sbjct  546   RRLMVNLKLYKSISASYAGDNDVLRFFWSHVGDRCLISKSI  586



>ref|XP_006282941.1| hypothetical protein CARUB_v10007510mg [Capsella rubella]
 gb|EOA15839.1| hypothetical protein CARUB_v10007510mg [Capsella rubella]
Length=606

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/580 (58%), Positives = 434/580 (75%), Gaps = 8/580 (1%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLSPCWFW----LSWSF  1737
             N E+ + +++C  VLKG+W N+LK K   GL + S II   +  LS    +    LSWSF
Sbjct  8     NREALIAQSICGAVLKGNWKNILKHKADSGL-LKSAIITQVISELSSYSGYGGASLSWSF  66

Query  1736  FKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS-D  1560
             + W +++P+ +HSLQSSW MI ILTKHKHFK+A  +L +++ ++ LSSP VL +LV    
Sbjct  67    YSWTDSLPSCKHSLQSSWEMILILTKHKHFKTAHQLLDKLSQRELLSSPLVLRSLVGGVS  126

Query  1559  DDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDT  1380
             +D +V S VFSWL+IFYA S    ++I VFE +R C +KP   ACTVLL+SLVKE LTDT
Sbjct  127   EDPEVLSHVFSWLMIFYAKSGMVNNSIAVFEQIRSCGLKPHLQACTVLLSSLVKERLTDT  186

Query  1379  VWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLIS  1200
             VWK +KKM+KLGV+ NIH+YNVL+HAC KSG+ EKA++ L EME KG+FPDL+T+NTLIS
Sbjct  187   VWKVFKKMVKLGVVANIHVYNVLVHACSKSGDFEKAEKLLGEMEEKGVFPDLFTYNTLIS  246

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPN  1020
             +YC++GMHYEALSVQDRMER GV PDI+TYNSLIH   REGRMREA RLF++IK  VT N
Sbjct  247   VYCKKGMHYEALSVQDRMERSGVAPDIVTYNSLIHGFSREGRMREATRLFREIKGVVTAN  306

Query  1019  EVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLN  840
              VTYTTLIDGYCR+ DIDEALRL   ME +G  P V TYNSIL K C +GR++E+ +LL 
Sbjct  307   HVTYTTLIDGYCRMNDIDEALRLREVMESRGFSPGVVTYNSILHKLCFDGRIREANRLLT  366

Query  839   QMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAK  660
             +M  KKIEPDN+TCNTLIN YCKIGD+VSA+KVK KM+E+GL+ D ++YKALIHGFCK  
Sbjct  367   EMSGKKIEPDNITCNTLINAYCKIGDMVSAVKVKKKMIESGLKLDIYSYKALIHGFCKVL  426

Query  659   DTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYR  480
             + + AKE +F M+  G SP Y +YSWLVD +  QN  E + KL +EF  RG C DI+ YR
Sbjct  427   ELDNAKEELFSMLEKGLSPGYSSYSWLVDGFYNQNKQEEIAKLPEEFEKRGLCPDIALYR  486

Query  479   AIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
              +IRR+CK  +++ A+  F  M+++ ++GDSV+YTS+AYAY++ GN   AS LFD+MY R
Sbjct  487   GLIRRICKLEQVNNAKVLFESMEKKGLMGDSVIYTSMAYAYWRTGNVTEASALFDKMYNR  546

Query  299   RLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             R+MV LKLYKS+SAS   +  +L  FW++V  R LIS ++
Sbjct  547   RIMVNLKLYKSISASYAGDKDVLRFFWSHVGDRSLISKSI  586



>ref|XP_006405706.1| hypothetical protein EUTSA_v10028323mg [Eutrema salsugineum]
 gb|ESQ47159.1| hypothetical protein EUTSA_v10028323mg [Eutrema salsugineum]
Length=619

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/581 (58%), Positives = 434/581 (75%), Gaps = 8/581 (1%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLSPCWFW----LSWS  1740
             AN E+ + +++C  VLKG+W N+LK K+  GL +TS I    +  LS C  +    LSWS
Sbjct  30    ANREALIAQSICGAVLKGNWRNILKHKVDSGL-LTSAITTQVISDLSSCSGYGGPSLSWS  88

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS-  1563
             FF W ++ P+ +HSLQ SW M+ ILTKHKHFK+A  +L +++ ++ LSSP VL +L+   
Sbjct  89    FFSWTDSFPSCKHSLQCSWKMVLILTKHKHFKTAHHLLDKLSQRELLSSPLVLRSLLGGV  148

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
               D +V S VFSWL+IFYA S    D+I+VFE +R C +KP   ACTVLLNSLVKE LTD
Sbjct  149   SQDPEVISHVFSWLIIFYAKSGMINDSIEVFEQIRHCGLKPHLQACTVLLNSLVKERLTD  208

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             TVWK +KKM+KLGV+ NIH+YNVL+HAC KSG+ E+A++ LSEME KG+FPDL+T+NTLI
Sbjct  209   TVWKIFKKMVKLGVVANIHLYNVLVHACSKSGDHERAEKLLSEMEEKGVFPDLFTYNTLI  268

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
             S YCR+GMHYEALSVQDRM+R GV PDI+TYNSLIH  CREGRM+EA RLF++IK  VT 
Sbjct  269   SAYCRKGMHYEALSVQDRMQRSGVGPDIVTYNSLIHGFCREGRMKEATRLFREIKGVVTA  328

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCR+ DIDEALRL   ME +G  P V TYNSILRK CE+GR++E+ +LL
Sbjct  329   NHVTYTTLIDGYCRMNDIDEALRLREVMEARGFSPGVVTYNSILRKLCEDGRIREANRLL  388

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              ++  K+IEPDN+TCNTLIN YCK GD+VSA+KVK KM+++GL+ D ++Y+ALIHGFCK 
Sbjct  389   TEISGKRIEPDNITCNTLINAYCKNGDMVSAVKVKKKMIDSGLKLDMYSYRALIHGFCKV  448

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + E AKE +F M+  G  P Y  YSWLVD Y  QN  + +VKL +EF  RG C D++ Y
Sbjct  449   LELENAKEELFSMVEKGLPPGYSTYSWLVDGYNNQNKQDEIVKLPEEFEKRGLCPDVALY  508

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             R +IRR+CK  ++D A+     M+++ ++GDSV+YTS+AYAY++ G    AS LFD MY 
Sbjct  509   RGLIRRICKLEQVDYAKVLCESMEKKGLMGDSVIYTSMAYAYWRTGKVTEASALFDIMYN  568

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             RRLMV LKLYKSLSAS   +N +L  FW++V  R LIS ++
Sbjct  569   RRLMVNLKLYKSLSASYAGDNEVLRFFWSHVGDRCLISKSI  609



>ref|XP_002870827.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47086.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=582

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/572 (58%), Positives = 429/572 (75%), Gaps = 8/572 (1%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLSPCWFW----LSWS  1740
             AN E+ + +++C  VLKG+W N+LK K+  GL + S+II   +  LS    +    LSWS
Sbjct  7     ANREALIAQSICATVLKGNWKNILKHKVDSGL-LKSSIITQVISELSLYSGYGGPSLSWS  65

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS-  1563
             F+ W +++P+ +HSLQSSW MI ILTKH HFK+A  +L +++ ++ LSSP VL +LV   
Sbjct  66    FYSWTDSLPSCKHSLQSSWKMILILTKHNHFKTAHQLLDKLSQRELLSSPLVLRSLVGGV  125

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
              +D +V S VFSWL+IFYA S    D+I VFE +  C +KP   ACTVLLNSLVKE LTD
Sbjct  126   SEDPEVLSHVFSWLMIFYAKSGMINDSIAVFEQIMSCGLKPHLQACTVLLNSLVKERLTD  185

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             TVWK +KKM+KLGV+ NIH+YNVL+HAC KSG+ EKA++ LSEME KG+FPD++T+NTLI
Sbjct  186   TVWKIFKKMVKLGVVANIHVYNVLVHACSKSGDSEKAEKLLSEMEEKGVFPDIFTYNTLI  245

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
             S+YC++ MH+EALSVQDRMER GV PDI+TYNSLIH   REGRMREA RLF+ IK  V  
Sbjct  246   SVYCKKSMHFEALSVQDRMERSGVAPDIVTYNSLIHGFSREGRMREATRLFRKIKGVVMA  305

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCR+ DIDEALRL   ME +G CP V TYNSILRK CE+GR++E+ +LL
Sbjct  306   NHVTYTTLIDGYCRMNDIDEALRLREVMESRGFCPGVVTYNSILRKLCEDGRIREANRLL  365

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +M  KKIEPDN+TCNTLIN YCKI D+VSA+KVK KM+E+GL+ D ++YKALIHGFCK 
Sbjct  366   TEMSVKKIEPDNITCNTLINAYCKIEDMVSAVKVKKKMIESGLKLDMYSYKALIHGFCKV  425

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + + AKE +F MI  G SP Y AYSWLVD +  QN  + + KL +EF  RG C D++ Y
Sbjct  426   LELDNAKEELFSMIEKGLSPGYSAYSWLVDGFYNQNKQDEITKLPEEFEKRGLCPDVALY  485

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             R +IRR+CK  ++D A+  F  M+++ ++GDSV+YT++AYAY++ G    AS LFD MY 
Sbjct  486   RGLIRRICKLEQVDYAKVLFESMEKKGLMGDSVIYTTMAYAYWRTGKVTDASALFDVMYN  545

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVM  207
             RRLMV LKLYKSLSAS   +N +L  FW+++M
Sbjct  546   RRLMVNLKLYKSLSASYAGDNDVLRFFWSHLM  577



>ref|XP_010935587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Elaeis guineensis]
Length=589

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/576 (55%), Positives = 434/576 (75%), Gaps = 8/576 (1%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS---PCWFWLSWSFFKWV  1725
              E   ++ +C IVLKG W+NL    I   +T++ +N  LL LS   P    LSW+FF+W+
Sbjct  9     NEVGFIQGVCAIVLKGSWSNLSNTHISHCLTTSNVNQILLQLSADTP----LSWAFFRWM  64

Query  1724  ETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDV  1545
             +++P Y HSLQ +W+M+++LTK++ FK+A+++L + A KDFLSSP+VLNAL+ S +D+D+
Sbjct  65    QSLPYYHHSLQPNWTMVHLLTKNRQFKAARELLEKFAFKDFLSSPSVLNALLSSYEDADL  124

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             NSQ+ SWL+I Y+ SK T DA+QVFE ++   ++PDPHAC  LL++L K  LT T WK Y
Sbjct  125   NSQILSWLVIIYSQSKMTQDAVQVFEQMKSNGLRPDPHACNALLSALAKARLTATAWKVY  184

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M  +GV+ NIHI+NV+IH C KSG+VEKA+  +++ME +GI PDL+++NTLISL+C++
Sbjct  185   DEMTWMGVVLNIHIFNVMIHVCYKSGDVEKAENLVNKMERRGIRPDLFSYNTLISLFCKK  244

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYT  1005
             GMHYEAL+V++RM+R G  PDI+TYNSLI+  C+EGR+REA RLFK+IK    PN VTYT
Sbjct  245   GMHYEALAVRERMDREGTHPDIVTYNSLIYGFCKEGRLREASRLFKEIK-GAGPNHVTYT  303

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEK  825
             TLIDGYCRV ++DEAL L   ME KGL P VATYNSI+RK CEEG+MK    LLN+M E+
Sbjct  304   TLIDGYCRVNNLDEALCLRQEMEAKGLYPGVATYNSIIRKLCEEGKMKAVNDLLNEMDER  363

Query  824   KIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERA  645
             K++PDN+TCNTLIN YCK G++  A K++NKMLE+GL  D FTYKALIHGFCK ++ + A
Sbjct  364   KVQPDNITCNTLINAYCKRGNMAFAWKLRNKMLESGLALDQFTYKALIHGFCKVQELDEA  423

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRR  465
             KEV+FDM+ AG SP+Y  YSWLVD YC QNN EA++++ DE + RG  VD S YRA+IRR
Sbjct  424   KEVLFDMLDAGLSPNYSTYSWLVDAYCNQNNAEAVLRIPDELAKRGLSVDKSVYRALIRR  483

Query  464   LCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
              CK G +D AE+ F  MQ +   GDS+VY +LAYAY   G    AS++ ++M K +L++T
Sbjct  484   FCKLGLVDFAEKVFIQMQGKGFSGDSLVYITLAYAYLSAGKPITASEMLNDMAKNQLVIT  543

Query  284   lklykslsassKDENSLLDLFWNNVMQRGLISHNVH  177
             +++Y  L+AS  +EN +L+L WN+  +RGLI+ NV+
Sbjct  544   VQIYNCLNASCANENDILELLWNHASERGLIAKNVY  579



>ref|XP_009139805.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Brassica rapa]
 emb|CDX74507.1| BnaA04g08820D [Brassica napus]
Length=593

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/581 (57%), Positives = 434/581 (75%), Gaps = 11/581 (2%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLS----PCWFWLSWS  1740
             AN E+ + +++C  +LKG+W N+LK K+  GL +TS+I    L  LS    P    L+ S
Sbjct  7     ANREALIAQSICGTILKGNWKNILKHKLDSGL-LTSSITTQVLSELSSYGGPS---LALS  62

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS-  1563
             FF W ++IP+ +H+LQSSW MI ILTKH +FK+A  +L +++ ++ LSSP VL +L+   
Sbjct  63    FFTWSDSIPSCKHTLQSSWKMILILTKHNYFKTAHQLLDKLSQRELLSSPLVLRSLLNGV  122

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
              +D +V S VFSW++I+YA S    D+I+VFE +R C ++P   ACTVLLNSLVKE LTD
Sbjct  123   SEDPEVLSHVFSWMIIYYAKSGMIRDSIEVFEQIRSCGLRPHLQACTVLLNSLVKERLTD  182

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             +VWK +KKM KLGV+ NIH+YNVL+HAC KSG+ E+A++ LSEME +G+FPDL T+NTLI
Sbjct  183   SVWKVFKKMGKLGVVANIHLYNVLVHACSKSGDPERAEKLLSEMEERGVFPDLCTYNTLI  242

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
             S+YCR+GMHYEALSVQDRM+R G+ PDI+TYNSLIH  CREGRMREA RLF++IK  VT 
Sbjct  243   SVYCRKGMHYEALSVQDRMQRSGIGPDIVTYNSLIHGFCREGRMREATRLFREIKGVVTA  302

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCR  DIDEALRL   ME +G  P V TYNSIL K CE+GR++E+ +LL
Sbjct  303   NHVTYTTLIDGYCRTNDIDEALRLREVMEARGFSPGVVTYNSILHKLCEDGRIREANRLL  362

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +M  KKIEPDN+TCNTLIN YCKIGD+VSA+KVK KM+++GL+ D ++YKALIHGFCKA
Sbjct  363   TEMSGKKIEPDNITCNTLINAYCKIGDMVSAVKVKKKMVDSGLKLDMYSYKALIHGFCKA  422

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + + AKE +F M+  G SP Y  YSWLVD +  QN  + + KL +EF  RG C D++ Y
Sbjct  423   LEMDNAKEELFSMLEKGLSPGYSTYSWLVDGFYDQNKQDEISKLPEEFEKRGLCPDVALY  482

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             R +IRR+CK  ++D A+     M+++ ++GDSV+YT++AYAY++ G    AS LFD MY 
Sbjct  483   RGLIRRICKLEQVDHAKVLLDSMEKKGLMGDSVIYTTMAYAYWRTGKVTEASALFDIMYN  542

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             RRLMV LKLYKSLSAS   +N +L  FW++V  R LIS ++
Sbjct  543   RRLMVNLKLYKSLSASYAGDNEVLIFFWSHVRDRSLISKSI  583



>emb|CDY67116.1| BnaCnng53650D [Brassica napus]
Length=593

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/581 (56%), Positives = 430/581 (74%), Gaps = 11/581 (2%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKI--GLSVTSTIINHTLLTLS----PCWFWLSWS  1740
             AN E+ + +++C  +LKG+W N+LK K+  GL +TS+I    L  LS    P    L+ S
Sbjct  7     ANREALIAQSICGTILKGNWKNILKHKLDSGL-LTSSITTQVLSELSSYGGPS---LALS  62

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS-  1563
             FF W  +IP+ +H+LQ SW MI ILTKH HFK+A  +L +++ ++ LSSP VL +L+   
Sbjct  63    FFTWTNSIPSCKHTLQYSWKMILILTKHNHFKTAHQLLDKLSQRELLSSPLVLRSLLNGV  122

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
              +D +V S VFSW++I+YA S    D+I+VFE +R C ++P   ACTVLLNSLVKE LTD
Sbjct  123   SEDPEVLSHVFSWMIIYYAKSGMIRDSIEVFEQIRSCGLRPHLQACTVLLNSLVKERLTD  182

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             +VWK +KKM KLGV+ NIH+YNVL HAC KSG+ ++A++ LSEME +G+FPDL+T+NTLI
Sbjct  183   SVWKVFKKMGKLGVVANIHLYNVLFHACSKSGDPKRAEKLLSEMEERGVFPDLFTYNTLI  242

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTP  1023
             S YCR+GMHYEALSVQDRM+R G+ PDI+TYNSLIH  CREGRMREA RLF++IK  VT 
Sbjct  243   SAYCRKGMHYEALSVQDRMQRSGIGPDIVTYNSLIHGFCREGRMREATRLFREIKGVVTA  302

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDGYCR  DIDEA RL   ME +G  P V TYNSILRK CE+GR++E+ +LL
Sbjct  303   NHVTYTTLIDGYCRTNDIDEASRLREVMEARGFSPGVVTYNSILRKLCEDGRIREANRLL  362

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +M  KKIEPDN+TCNTLIN YCKIGD+VSA+KVK KM+++GL+ D ++YKALIHGFCK 
Sbjct  363   TEMSGKKIEPDNITCNTLINAYCKIGDMVSAVKVKKKMVDSGLKLDIYSYKALIHGFCKV  422

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              + + AKE +F M+  G SP Y  YSWLVD +  QN  + + KL +EF  RG C D++ Y
Sbjct  423   LEMDNAKEELFSMLEKGLSPGYSTYSWLVDGFYDQNKQDEISKLPEEFEKRGLCPDVALY  482

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             R +IRR+CK  ++D A+     M+++ ++GDSV+YT++AYAY++ G    AS LFD MY 
Sbjct  483   RGLIRRICKLEQVDLAKVLLDSMEKKGLMGDSVIYTTMAYAYWRTGKVTEASALFDIMYN  542

Query  302   RRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             RRLMV LKLYKSLSAS   +N +L  FW++V  + LIS ++
Sbjct  543   RRLMVNLKLYKSLSASYAGDNEVLRFFWSHVGDKSLISKSI  583



>gb|KHN37665.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=492

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/492 (61%), Positives = 391/492 (79%), Gaps = 1/492 (0%)
 Frame = -2

Query  1631  MLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRIC  1452
             ML +IA KDFLSSP+VL  LVR+ D+ +VNSQV SWL+I YA SK T DAIQVFE +R+ 
Sbjct  1     MLEKIAHKDFLSSPSVLTTLVRTHDNQEVNSQVLSWLVIHYAKSKMTQDAIQVFEQMRLH  60

Query  1451  RIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKA  1272
              +KP  HACTVLLNSL+K+G+T  VWK YKKM+++GV+PN +IYN L HAC K+G+VE+A
Sbjct  61    EVKPHLHACTVLLNSLLKDGVTHMVWKIYKKMVQVGVVPNTYIYNCLFHACSKAGDVERA  120

Query  1271  DEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHS  1092
             ++ L+EM+ KG+ PD++T+NTLISLYC++GMHYEALS+Q+RMER G+  DI++YNSLI+ 
Sbjct  121   EQLLNEMDVKGLLPDIFTYNTLISLYCKKGMHYEALSIQNRMEREGINLDIVSYNSLIYR  180

Query  1091  HCREGRMREAMRLFKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
              C+EGRMREAMR+F +IK   TPN VTYTTLIDGYC+  +++EAL++   ME KGL P V
Sbjct  181   FCKEGRMREAMRMFSEIKN-ATPNHVTYTTLIDGYCKTNELEEALKMREMMEAKGLYPGV  239

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              T+NSILRK C++GR++++ KLLN+M E+KI+ DN+TCNTLIN YCKIGD+ SALK KNK
Sbjct  240   VTFNSILRKLCQDGRIRDANKLLNEMSERKIQADNITCNTLINAYCKIGDLKSALKFKNK  299

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             +LEAGL+PD FTYKALIHGFCK  + ERAKE++F M+ AGF+PSYC YSW+VD Y  ++N
Sbjct  300   LLEAGLKPDPFTYKALIHGFCKTNELERAKELMFSMLDAGFTPSYCTYSWIVDGYNKKDN  359

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
              +A++ L DEF  RG C+D+S YRA+IRR CK  +++CAER F  M+ + I G+SV+YTS
Sbjct  360   MDAVLALPDEFLSRGLCLDVSVYRALIRRSCKVERVECAERLFNHMEGKGISGESVIYTS  419

Query  371   LAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSLLDLFWNNVMQRGLI  192
             LAYAY+K GN RAAS + +EM +RRLM+T+KLY+  S S   EN +   FWN+V+ RGL+
Sbjct  420   LAYAYWKAGNVRAASSMLEEMARRRLMITVKLYRCFSTSDAHENKVSQFFWNHVVDRGLM  479

Query  191   SHNVHNSIFLKL  156
             S N    I  KL
Sbjct  480   SRNTMYKIQQKL  491



>ref|XP_009398337.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Musa acuminata subsp. malaccensis]
Length=600

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/572 (53%), Positives = 427/572 (75%), Gaps = 2/572 (0%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIP  1713
             E+  ++ +C IV KG+W  L  P++    T++ ++  LL LS     LSW+FFKW ++IP
Sbjct  10    EAAFIQGVCAIVSKGNWCTLWLPRVSDRFTTSNVHQILLQLSADTA-LSWNFFKWAQSIP  68

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             +Y HSL ++++M+++LT+ + F+ A+++L + A K FLSSP VL+AL+    D D NSQ+
Sbjct  69    HYHHSLPTNFTMVHLLTRSRRFQEARNLLQKFAFKGFLSSPTVLSALLSDHGDQDSNSQI  128

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
              SWL+  Y+ S +T DAIQ+ E ++   ++ DPHAC+ LL++L K  LT T W  Y  ++
Sbjct  129   LSWLVFIYSRSNKTHDAIQILELMKSRGLRLDPHACSALLSALAKARLTATAWNVYDDIL  188

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             ++GV+ N+HI NV+IH C KSG+ EKA++ +SEM+ K + PDL+T+NTLISLYC++GMHY
Sbjct  189   RMGVVANVHILNVMIHVCFKSGDTEKAEKLVSEMDGKVVRPDLFTYNTLISLYCKKGMHY  248

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLID  993
             EAL+VQ+RME+ G+ PDI+TYNSLI+  C++GRMREA RLFK+IK    PN+VTYTTLID
Sbjct  249   EALAVQERMEKEGIHPDIVTYNSLIYGFCKDGRMREASRLFKEIK-GAAPNQVTYTTLID  307

Query  992   GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEP  813
             GYCRV D+DE LRL   ME KG+ P VATYN+I+RK CEEG+M+    LLN+M +++++P
Sbjct  308   GYCRVNDLDEGLRLREEMEAKGMYPGVATYNAIIRKLCEEGKMRAVNDLLNEMDDRRVQP  367

Query  812   DNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
             DNVTCNTLIN YCK G++  A K++NKMLE+G   D FTYKALIHGFCK ++ + AKEV+
Sbjct  368   DNVTCNTLINAYCKRGNMDFAWKLRNKMLESGQVLDQFTYKALIHGFCKVQELDEAKEVL  427

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
              DM+ AGF+P+Y  YSWLVD+YC  NN EA++ + DE + RG  VD S YRA+IRRLCKR
Sbjct  428   LDMLDAGFAPNYSTYSWLVDSYCSLNNVEAVLSIPDEIAHRGLSVDKSLYRALIRRLCKR  487

Query  452   GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlkly  273
             G +D A++ F  M E+ +LGDS+VY SLAYAY   G   AA ++ +EM K++L++T K+Y
Sbjct  488   GLVDFAQKAFNKMLEKGLLGDSLVYASLAYAYLSTGKRIAACEILNEMVKKQLIITAKIY  547

Query  272   kslsassKDENSLLDLFWNNVMQRGLISHNVH  177
             KSL AS  +++ +LDL W++ ++RGLI+ NV+
Sbjct  548   KSLCASLANDSGILDLLWSHAIERGLIARNVY  579



>emb|CBI16890.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/573 (53%), Positives = 406/573 (71%), Gaps = 37/573 (6%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIP  1713
             E+QL K +C IV+KGHWN+LLKP +G ++TSTI+N  LL LS     +SW+FFKWVE+  
Sbjct  35    ETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWAFFKWVESNL  94

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             N++HSLQSSW+MI+ L KHK FK+A+++L +IA +D+LSSP+VLNA+VR  DD D NSQ+
Sbjct  95    NHKHSLQSSWTMIHTLAKHKQFKTAQNLLERIAVRDYLSSPSVLNAVVRIHDDPDSNSQI  154

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
              SWL+IFYANS+ T DAIQVFEH+R+   KP  HACTVLLNSL K  LT+ VWK YKKM+
Sbjct  155   LSWLVIFYANSRMTQDAIQVFEHMRVHGFKPHLHACTVLLNSLAKARLTNMVWKVYKKMV  214

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             ++GV+PNIHI+NVLIHACCKSG+VEKA++ L+EME + IFPDL+T+NTLISLYC++GMHY
Sbjct  215   RVGVVPNIHIFNVLIHACCKSGDVEKAEQLLNEMESRFIFPDLFTYNTLISLYCKKGMHY  274

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCRE-GRMREAMRLFKDIK-EKVTPNEVTYTTL  999
             EAL +QDRMERGGV PDI+TYNSLI+  CRE   + EA+RL + ++ E + P  VTY ++
Sbjct  275   EALGIQDRMERGGVSPDIVTYNSLIYGFCREVNDLEEALRLREVMEVEGLHPGVVTYNSI  334

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             +   C  G I +A RL + M E+ + P   T N+++  +C+ G M  + K+  +M E  +
Sbjct  335   LRKLCEEGKIKDANRLLNEMSERKVEPDNVTCNTLINAYCKIGDMGSAMKVKKKMLEAGL  394

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             +PD  T   LI+G+CK+ ++ SA +   +ML+AG  P                       
Sbjct  395   KPDQFTFKALIHGFCKLHEVDSAKEFLFEMLDAGFSP-----------------------  431

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
                         SY  YSWLVD+Y  Q+N EA+++L DE S +G  VDIS YRA+IRRLC
Sbjct  432   ------------SYSTYSWLVDSYYDQDNKEAVIRLPDELSRKGLFVDISVYRALIRRLC  479

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             K  K++ AER F +MQ + + GDSVVYTSLAYAYFK G   AASD+ DEM KRRLM+TLK
Sbjct  480   KIDKIESAERIFTLMQGKGMKGDSVVYTSLAYAYFKAGKAIAASDMLDEMDKRRLMITLK  539

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             +Y+  SAS   + S+L LFW++V++R LIS N+
Sbjct  540   IYRCFSASYAGDGSILGLFWDHVIERRLISKNI  572



>ref|XP_010248809.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
isoform X2 [Nelumbo nucifera]
Length=455

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/429 (60%), Positives = 340/429 (79%), Gaps = 8/429 (2%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLS---PCWFWLSWSFFKWVE  1722
             E++  +++C +++KG+W NLLKPK+    T +++N  LL LS   P    L W+FFKWVE
Sbjct  10    ENKFAQSVCAVLMKGNWLNLLKPKMSHCFTPSLVNRILLYLSLDGP----LCWAFFKWVE  65

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVN  1542
             ++P+Y+ SLQ +W+M++ILT+ K + +A+++L +IA +DFLSSP VL+AL+ S  D + N
Sbjct  66    SLPHYKQSLQPNWTMVHILTEQKQYTTAQELLKRIAFRDFLSSPLVLSALISSQSDPNSN  125

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             SQ+ SWL+IFYA SK T DA+QVFE ++    +P  HAC+ +L++LVK GLTD  WKTYK
Sbjct  126   SQILSWLVIFYAQSKMTQDALQVFEQMKTNGFRPHLHACSAILSALVKAGLTDKAWKTYK  185

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM+++G++PNIHIYNVLIHACCKSG+VEKA+  L+EME KGIFPDL+T+NTLISL+C+ G
Sbjct  186   KMLRIGIVPNIHIYNVLIHACCKSGDVEKAEILLNEMESKGIFPDLFTYNTLISLFCKNG  245

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT  1002
             MHYEALS Q+RMER G+ PDI+TYNSLI+  CREGRMREA R F++IK   TPN++TYTT
Sbjct  246   MHYEALSAQERMEREGIHPDIVTYNSLIYGFCREGRMREASRNFREIK-GATPNQITYTT  304

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDGYCRV D++ ALRL   ME KGL P V TYNSILRK CEEG+M+ +  LL++M  +K
Sbjct  305   LIDGYCRVNDVEAALRLREEMEAKGLHPGVITYNSILRKLCEEGKMRAANNLLSEMSGRK  364

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             +EPDN+TCNTLIN YCKIGD+ SA +VK KMLEAGL  D FTYKALIHGFCK  + ++AK
Sbjct  365   VEPDNITCNTLINAYCKIGDMDSACRVKIKMLEAGLSLDQFTYKALIHGFCKVLEMDKAK  424

Query  641   EVIFDMIAA  615
             E++F M+ A
Sbjct  425   ELLFGMLDA  433


 Score =   166 bits (419),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/321 (30%), Positives = 169/321 (53%), Gaps = 7/321 (2%)
 Frame = -2

Query  1334  NIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQ  1155
             N  I + L+    +S   + A +   +M+  G  P L+  + ++S   + G+  +A    
Sbjct  125   NSQILSWLVIFYAQSKMTQDALQVFEQMKTNGFRPHLHACSAILSALVKAGLTDKAWKTY  184

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRV  978
              +M R G+ P+I  YN LIH+ C+ G + +A  L  +++ K + P+  TY TLI  +C+ 
Sbjct  185   KKMLRIGIVPNIHIYNVLIHACCKSGDVEKAEILLNEMESKGIFPDLFTYNTLISLFCKN  244

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G   EAL     ME +G+ P + TYNS++  FC EGRM+E+++   ++  K   P+ +T 
Sbjct  245   GMHYEALSAQERMEREGIHPDIVTYNSLIYGFCREGRMREASRNFREI--KGATPNQITY  302

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
              TLI+GYC++ D+ +AL+++ +M   GL P   TY +++   C+      A  ++ +M  
Sbjct  303   TTLIDGYCRVNDVEAALRLREEMEAKGLHPGVITYNSILRKLCEEGKMRAANNLLSEMSG  362

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
                 P     + L++ YC   + ++  ++  +    G  +D   Y+A+I   CK  ++D 
Sbjct  363   RKVEPDNITCNTLINAYCKIGDMDSACRVKIKMLEAGLSLDQFTYKALIHGFCKVLEMDK  422

Query  437   A-ERFFGMMQ---EREILGDS  387
             A E  FGM+    ERE+  DS
Sbjct  423   AKELLFGMLDAEVEREVWEDS  443


 Score =   135 bits (340),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/330 (26%), Positives = 154/330 (47%), Gaps = 21/330 (6%)
 Frame = -2

Query  1316  VLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERG  1137
              ++H   +  +   A E L  + F+         + LIS       + + LS        
Sbjct  79    TMVHILTEQKQYTTAQELLKRIAFRDFLSSPLVLSALISSQSDPNSNSQILSW-------  131

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEA  960
                        L+  + +    ++A+++F+ +K     P+    + ++    + G  D+A
Sbjct  132   -----------LVIFYAQSKMTQDALQVFEQMKTNGFRPHLHACSAILSALVKAGLTDKA  180

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              + +  M   G+ P +  YN ++   C+ G ++++  LLN+M  K I PD  T NTLI+ 
Sbjct  181   WKTYKKMLRIGIVPNIHIYNVLIHACCKSGDVEKAEILLNEMESKGIFPDLFTYNTLISL  240

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
             +CK G    AL  + +M   G+ PD  TY +LI+GFC+      A     ++   G +P+
Sbjct  241   FCKNGMHYEALSAQERMEREGIHPDIVTYNSLIYGFCREGRMREASRNFREI--KGATPN  298

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                Y+ L+D YC  N+ EA ++L +E   +G    +  Y +I+R+LC+ GK+  A     
Sbjct  299   QITYTTLIDGYCRVNDVEAALRLREEMEAKGLHPGVITYNSILRKLCEEGKMRAANNLLS  358

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAA  330
              M  R++  D++   +L  AY K G+  +A
Sbjct  359   EMSGRKVEPDNITCNTLINAYCKIGDMDSA  388


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 69/143 (48%), Gaps = 0/143 (0%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             P+    T L++   +    +   +  ++M   G+ P +  YN ++   C+ G++  A+  
Sbjct  297   PNQITYTTLIDGYCRVNDVEAALRLREEMEAKGLHPGVITYNSILRKLCEEGKMRAANNL  356

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
             LSEM  + + PD  T NTLI+ YC+ G    A  V+ +M   G+  D  TY +LIH  C+
Sbjct  357   LSEMSGRKVEPDNITCNTLINAYCKIGDMDSACRVKIKMLEAGLSLDQFTYKALIHGFCK  416

Query  1082  EGRMREAMRLFKDIKEKVTPNEV  1014
                M +A  L   + +     EV
Sbjct  417   VLEMDKAKELLFGMLDAEVEREV  439



>gb|KHN27334.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=401

 Score =   511 bits (1317),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 316/401 (79%), Gaps = 1/401 (0%)
 Frame = -2

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             M+++GV+PNI+IYN L HAC KSG+VE+A++ L+EM+ KG+  D++T+NTL+SLYC++GM
Sbjct  1     MVQVGVVPNIYIYNCLFHACSKSGDVERAEQLLNEMDVKGVLQDIFTYNTLLSLYCKKGM  60

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTL  999
             HYEALS+Q+RMER G+  DI++YNSLI+  C+EGRMREAMR+F +IK   TPN VTYTTL
Sbjct  61    HYEALSIQNRMEREGINLDIVSYNSLIYRFCKEGRMREAMRMFSEIK-NATPNHVTYTTL  119

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYC+  +++EAL++   ME KGL P V TYNSILRK C +GR++++ KLLN+M E+K+
Sbjct  120   IDGYCKTNELEEALKMCKLMEAKGLYPGVVTYNSILRKLCRDGRIRDANKLLNEMSERKL  179

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             + DN+TCNTLIN YCKIGD+ SALK KNKMLEAGL+PD FTYKALIHGFCK  + E A E
Sbjct  180   QADNITCNTLINAYCKIGDLKSALKFKNKMLEAGLKPDPFTYKALIHGFCKTNELESATE  239

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++F M+ AGF+PSYC YSW+VD Y  ++N +A++ L DEF  RG C+D+S YRA+IRR C
Sbjct  240   LMFSMLDAGFTPSYCTYSWIVDGYNKKDNMDAVLALPDEFLSRGICLDVSVYRALIRRSC  299

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             K  ++ CAER F  M+ + I G+SV+YTS+AYAY+  GN  AAS + +EM +RRLM+T+K
Sbjct  300   KVERIQCAERLFYHMEGKGISGESVIYTSIAYAYWNVGNVSAASSMLEEMARRRLMITVK  359

Query  278   lykslsassKDENSLLDLFWNNVMQRGLISHNVHNSIFLKL  156
             LY+  S S  +EN +  +FWN+VM RGL+S N  N I  KL
Sbjct  360   LYRCFSTSDANENKVSQIFWNHVMDRGLMSRNTMNKIQQKL  400


 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 180/359 (50%), Gaps = 5/359 (1%)
 Frame = -2

Query  1547  VNSQVFSWLLIFYANSKR--TWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVW  1374
             V   ++ +  +F+A SK      A Q+   + +  +  D      LL+   K+G+     
Sbjct  6     VVPNIYIYNCLFHACSKSGDVERAEQLLNEMDVKGVLQDIFTYNTLLSLYCKKGMHYEAL  65

Query  1373  KTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY  1194
                 +M + G+  +I  YN LI+  CK G + +A    SE+  K   P+  T+ TLI  Y
Sbjct  66    SIQNRMEREGINLDIVSYNSLIYRFCKEGRMREAMRMFSEI--KNATPNHVTYTTLIDGY  123

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNE  1017
             C+     EAL +   ME  G+ P ++TYNS++   CR+GR+R+A +L  ++ E K+  + 
Sbjct  124   CKTNELEEALKMCKLMEAKGLYPGVVTYNSILRKLCRDGRIRDANKLLNEMSERKLQADN  183

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
             +T  TLI+ YC++GD+  AL+  + M E GL P   TY +++  FC+   ++ +T+L+  
Sbjct  184   ITCNTLINAYCKIGDLKSALKFKNKMLEAGLKPDPFTYKALIHGFCKTNELESATELMFS  243

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             M +    P   T + +++GY K  ++ + L + ++ L  G+  D   Y+ALI   CK + 
Sbjct  244   MLDAGFTPSYCTYSWIVDGYNKKDNMDAVLALPDEFLSRGICLDVSVYRALIRRSCKVER  303

Query  656   TERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYR  480
              + A+ + + M   G S     Y+ +   Y    N  A   + +E + R   + +  YR
Sbjct  304   IQCAERLFYHMEGKGISGESVIYTSIAYAYWNVGNVSAASSMLEEMARRRLMITVKLYR  362


 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/321 (26%), Positives = 153/321 (48%), Gaps = 9/321 (3%)
 Frame = -2

Query  1589  AVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLN  1410
             ++ N + R   + D+ S  ++ L+  +    R  +A+++F  ++     P+    T L++
Sbjct  66    SIQNRMEREGINLDIVS--YNSLIYRFCKEGRMREAMRMFSEIK--NATPNHVTYTTLID  121

Query  1409  SLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFP  1230
                K    +   K  K M   G+ P +  YN ++   C+ G +  A++ L+EM  + +  
Sbjct  122   GYCKTNELEEALKMCKLMEAKGLYPGVVTYNSILRKLCRDGRIRDANKLLNEMSERKLQA  181

Query  1229  DLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL-  1053
             D  T NTLI+ YC+ G    AL  +++M   G++PD  TY +LIH  C+   +  A  L 
Sbjct  182   DNITCNTLINAYCKIGDLKSALKFKNKMLEAGLKPDPFTYKALIHGFCKTNELESATELM  241

Query  1052  FKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEE  873
             F  +    TP+  TY+ ++DGY +  ++D  L L      +G+C  V+ Y +++R+ C+ 
Sbjct  242   FSMLDAGFTPSYCTYSWIVDGYNKKDNMDAVLALPDEFLSRGICLDVSVYRALIRRSCKV  301

Query  872   GRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTY  693
              R++ + +L   M  K I  ++V   ++   Y  +G++ +A    + MLE   R      
Sbjct  302   ERIQCAERLFYHMEGKGISGESVIYTSIAYAYWNVGNVSAA----SSMLEEMARRRLMIT  357

Query  692   KALIHGFCKAKDTERAKEVIF  630
               L   F  +   E     IF
Sbjct  358   VKLYRCFSTSDANENKVSQIF  378



>ref|XP_008646443.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 
[Zea mays]
 gb|AFW74127.1| hypothetical protein ZEAMMB73_460696 [Zea mays]
Length=581

 Score =   489 bits (1258),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 240/578 (42%), Positives = 370/578 (64%), Gaps = 19/578 (3%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNLLKPKIGL-SVTSTIINHTLLTLSPCWFWLSWSFFKWV  1725
             A + + L + LC  V+K  +    +P + L + + +++   L  LSP    L  +   + 
Sbjct  2     APSLADLSRELCAAVVKSTF----RPHLSLLAASPSLLTAVLHRLSP----LPSAALAFF  53

Query  1724  ETIPNYRHSLQSSWSMIYILTKH-KHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSD  1548
               +P   H L +S +++ +L  H +H  +A+ +L  ++ +  LSS               
Sbjct  54    RALPP-PHPLDASLAVLRLLAPHPRHHTAARALLRDLSLRHPLSS-------PLLLPSLL  105

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
                 V SWL++  A S R  DA++VF+H+R   + PD HACT LL +L +  +T T  + 
Sbjct  106   AGPHVPSWLVLVLAQSARPHDAVRVFDHMRARGLAPDAHACTALLTALARARMTATARRV  165

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
             + +M + G+    H+YN ++H C K+G+  +A+  ++ M+  G+  D +++NT+I+LYCR
Sbjct  166   FDEMARAGLAATTHVYNAMLHVCLKAGDAAQAEAIVTRMDAAGVTLDRFSYNTVIALYCR  225

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVT  1011
             +GM YEA+  +DRM++ G+ PD +T+NS IH  C+EGR++EA +LF + +  + TP+ VT
Sbjct  226   KGMGYEAMCARDRMDKEGIRPDTVTWNSSIHGLCKEGRVKEAAQLFTEMVAAQATPDNVT  285

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             YTTLIDGYCR G+++EA++L   ME  G+ P VATYN+ILRK CE+G MKE  +LL++M 
Sbjct  286   YTTLIDGYCRAGNVEEAVKLRGRMEAAGMLPGVATYNAILRKLCEDGNMKEVHRLLHEMD  345

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
              +K++ D+VTCNTLIN YCK GD+ SA KVK KM+E+GL+ + FTYKALIHGFCKA++ +
Sbjct  346   GRKVQADHVTCNTLINAYCKRGDMTSACKVKKKMMESGLQLNHFTYKALIHGFCKARELD  405

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAII  471
              AKE  F M+ AGFSP+Y  +SWLVD +C +NN +A++ + DE   RG   D + YR++I
Sbjct  406   GAKEAFFQMVDAGFSPNYSVFSWLVDGFCKKNNADAVLAIPDELMKRGLPPDKAVYRSLI  465

Query  470   RRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
             RRLC++G +D A+R F  MQ + ++GDS+VY +LAY Y  +GN  AA +  D M K +L 
Sbjct  466   RRLCRKGLVDQAQRVFDQMQSKGLVGDSLVYATLAYTYLTKGNPTAALNTLDGMTKNQLY  525

Query  290   VTlklykslsassKDENSLLDLFWNNVMQRGLISHNVH  177
             +T ++Y  L  S  DE   L++ W   ++RGLI  +V+
Sbjct  526   ITPQIYNCLCTSYADEKETLNMLWVRAIERGLIKKSVY  563



>dbj|BAK03031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score =   474 bits (1220),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 241/571 (42%), Positives = 359/571 (63%), Gaps = 17/571 (3%)
 Frame = -2

Query  1883  LVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYR  1704
             L + +C  V+K  +    +    L+    ++   L  LSP    ++ SFF+ +       
Sbjct  9     LPRAICAAVIKCSYR---RHAHLLAADPNLLAAVLGRLSP-LPSVALSFFRALPP----P  60

Query  1703  HSLQSSWSMIYILTKH-KHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFS  1527
             H L +S +++ +L  H +H   A+ +L  ++ +  LSS                   + S
Sbjct  61    HPLDASLALVRLLAAHPRHHPVARTLLRDLSLRHPLSS-------PLLLPSLLAEPHLPS  113

Query  1526  WLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKL  1347
             WLL+  A   R  DA++VF+H+R   + PD HACT LL SL +  +T T  + +  M + 
Sbjct  114   WLLLALAQGGRAGDAVRVFDHMRAEGLAPDAHACTALLTSLARARMTATARRVFDGMGRA  173

Query  1346  GVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEA  1167
             GV  N H+YN ++H C K+G+  +A+  ++ M+  G+  DL++FNT I+LY R+GM YEA
Sbjct  174   GVAMNTHVYNAMLHVCLKAGDAARAEALMTRMDATGVPLDLFSFNTAIALYVRKGMQYEA  233

Query  1166  LSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDG  990
             + V+DRM   GVE DI+T+N++IH  C+EGRM+EA +L +D +   + P+ VTYTTL+DG
Sbjct  234   MCVRDRMANDGVEADIVTWNTVIHGMCKEGRMKEASQLHRDMVAAGIEPDTVTYTTLVDG  293

Query  989   YCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPD  810
             YCR GD+ EA+ L + ME +G+ P VATYN+I+RK CE+G+MKE   LL++M E+K++ D
Sbjct  294   YCRAGDVGEAMNLRAVMEARGMLPGVATYNAIIRKLCEDGKMKEVNGLLSEMDERKVQAD  353

Query  809   NVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF  630
             +VTCNTLIN Y K GD+ SA KVK +M+E+GL+ D FTYKALIHGF KAK  + AKE +F
Sbjct  354   HVTCNTLINSYSKKGDMPSACKVKTRMMESGLQLDQFTYKALIHGFSKAKQLDEAKEALF  413

Query  629   DMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRG  450
             +M+ AGFSP+Y  +SWLVD +  +NN +A++ + DE   RG   D S YR++IRRLCK+ 
Sbjct  414   EMMGAGFSPNYSVFSWLVDGFYKRNNADAVLLIPDELMKRGLPPDKSVYRSLIRRLCKKR  473

Query  449   KLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklyk  270
              +D A++    MQ + +  D +VY SLAYA    G   AASD  ++M K++L VT ++Y 
Sbjct  474   LVDLAQKVLHQMQGKGLEADCLVYASLAYAQLTAGKLAAASDTLNDMAKKQLSVTPQIYN  533

Query  269   slsassKDENSLLDLFWNNVMQRGLISHNVH  177
              L  S  DE   L++FW + ++RGLI  +V+
Sbjct  534   CLCTSYGDEKQTLNMFWVHAIERGLIGKSVY  564



>ref|XP_002454820.1| hypothetical protein SORBIDRAFT_04g038070 [Sorghum bicolor]
 gb|EES07796.1| hypothetical protein SORBIDRAFT_04g038070 [Sorghum bicolor]
Length=600

 Score =   473 bits (1217),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 321/457 (70%), Gaps = 1/457 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             + +V SWL++  A S R  DA++VF+ +R   + PD HACT LL +L +  +T T  + +
Sbjct  113   DPRVPSWLVLVLAQSARPHDALRVFDQMRARGLAPDAHACTALLTALARARMTATARRVF  172

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M + G+  + H+YN ++H C K+G+  +A+  ++ M+  G+  D +++NT+I+LYC++
Sbjct  173   DEMARAGLAVSTHVYNAMLHVCLKAGDAARAEALVTRMDAAGVPLDRFSYNTVIALYCKK  232

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTY  1008
             GM YEA+ V+DRM++ G+  D +T+NSLIH  C+ GR++EA +LF ++   + TP+ VTY
Sbjct  233   GMRYEAMCVRDRMDKEGIRADTVTWNSLIHGLCKYGRVKEAAQLFTEMAAAQATPDNVTY  292

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTLIDGYCR G+I+EA++L   ME  G+ P VATYN+ILRK CE+G+MKE  +LLN+M E
Sbjct  293   TTLIDGYCRAGNIEEAVKLRGEMEATGMLPGVATYNAILRKLCEDGKMKEVNQLLNEMDE  352

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             +K++ D+VTCNTLIN YCK G + SA KVK KM+E+GL+ + FTYKALIHGFCKAK+ + 
Sbjct  353   RKVQADHVTCNTLINAYCKRGHMTSACKVKKKMMESGLQLNQFTYKALIHGFCKAKELDE  412

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             AKE  F M+ AGFSP+Y  +SWLVD +C +NN +A++ + DE   RG   D + YR++IR
Sbjct  413   AKEAFFQMVDAGFSPNYSVFSWLVDGFCKKNNADAVLLIPDELMKRGLPPDKAVYRSLIR  472

Query  467   RLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMV  288
             RLC++G +D A++ F  MQ + ++GDS+VY +LAY Y  EG   AAS+  D M K +L +
Sbjct  473   RLCRKGLVDQAQKVFDQMQSKGLVGDSLVYATLAYTYLTEGKPVAASNTLDGMAKNQLYI  532

Query  287   TlklykslsassKDENSLLDLFWNNVMQRGLISHNVH  177
             T ++Y  L  S  DE   L++ W   ++RGLI  +V+
Sbjct  533   TPQIYNCLCTSYADEKETLNILWVRAIERGLIKKSVY  569



>dbj|BAD23061.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein-like 
[Oryza sativa Japonica Group]
Length=580

 Score =   466 bits (1198),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 234/569 (41%), Positives = 357/569 (63%), Gaps = 12/569 (2%)
 Frame = -2

Query  1880  VKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRH  1701
             V+ +C  V+K            L+ + +++   L  LSP    L  +   +  ++P    
Sbjct  8     VEAVCAAVIKSTLTQPHNHHHLLAASPSLLAAVLHRLSP----LPSTALAFFRSLPPPHP  63

Query  1700  SLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWL  1521
                S   +  +    +H  +A+ +L  ++ +  LSS                +  + SWL
Sbjct  64    LDASLALLRLLAPHPRHHPTARSLLRDLSLRHPLSS-------PLLLPSLLADPHLPSWL  116

Query  1520  LIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGV  1341
             L+  + S R  DA++VF+H+R   + PD HA + LL +L K  +T T  K + +M + GV
Sbjct  117   LLLLSQSARPHDALRVFDHMRAREVVPDAHASSALLTALAKSRMTATARKVFDQMTRAGV  176

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS  1161
               N H+YN ++H C K+G+   A+  ++ M+  G+  D ++FNT+I+LYCR+GM YEA+ 
Sbjct  177   AMNTHVYNAMLHVCLKAGDAALAESLMTRMDAAGVPLDRFSFNTVIALYCRKGMQYEAMC  236

Query  1160  VQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTYTTLIDGYC  984
             V++RME  GV+ D++T+NSLIH  C+E R++EA +L +++    V P+ VTYTTL+DGYC
Sbjct  237   VRERMENQGVKADVVTWNSLIHGLCKERRVKEASQLLREMAMAGVAPDHVTYTTLVDGYC  296

Query  983   RVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNV  804
             R GD++EA++L   ME  G+ P VATYN+ILRK CE+G+MKE   LLN+M E+K++ D+V
Sbjct  297   RAGDLEEAVKLRGEMEAMGMLPGVATYNAILRKLCEDGKMKEVNVLLNEMDERKVQADHV  356

Query  803   TCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDM  624
             TCNTLIN YCK GD+ SALKVK +M+E+GL+ D FTYKAL+HGFCKAK+ + AKE +F+M
Sbjct  357   TCNTLINAYCKRGDMTSALKVKRRMMESGLQLDQFTYKALVHGFCKAKELDEAKEALFEM  416

Query  623   IAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKL  444
             + AGFSP+Y   SW+VD  C +NN  A++ + DE   RG+  D + YR++IRRLCK+G +
Sbjct  417   MGAGFSPNYSVLSWIVDGLCNKNNAVAVLAIPDELMKRGFPPDKAVYRSLIRRLCKKGFI  476

Query  443   DCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklyksl  264
             D A   F  MQ + +  D +VY +LA AY   G   AA D+ +EM K++L +T ++Y  +
Sbjct  477   DLAGNVFNEMQGKGLEADCLVYATLACAYLTAGKPVAALDILNEMAKKQLYITPQIYNCM  536

Query  263   sassKDENSLLDLFWNNVMQRGLISHNVH  177
               S  DE   L++ W + ++RGLI+ +V+
Sbjct  537   CTSYADEKGSLNMLWVHAIERGLITKSVY  565



>ref|XP_003573143.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g38730 [Brachypodium distachyon]
Length=599

 Score =   464 bits (1193),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 321/457 (70%), Gaps = 3/457 (1%)
 Frame = -2

Query  1538  QVFSWLLIF--YANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
              V SWLL+   +++S R  DA +VF+ +R   + PD HACT LL +L +  +T T  K +
Sbjct  110   HVPSWLLLALSHSHSARPHDAARVFDQMRARGLAPDAHACTALLTALARARMTATAHKVF  169

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M + GV  N H+YN ++H C K+ +  +A+  ++ M+  G+  D ++FNT+I+LY R+
Sbjct  170   NEMGRAGVAMNTHVYNAMLHVCLKARDALRAEGLMTRMDAAGVPLDRFSFNTVIALYVRK  229

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTY  1008
             GM YEA+ V++RM+  GVEPDI+T+N++IH  C+EGRM+EA +L  D I   V P+ VTY
Sbjct  230   GMQYEAMCVRERMQDEGVEPDIVTWNTVIHGLCKEGRMKEAAQLRTDMIAAAVEPDTVTY  289

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTL+DGYCR+GD+ EA++L   ME  G+ P VATYN+I+RK CE+G+MKE   LL++M  
Sbjct  290   TTLVDGYCRIGDVGEAVKLREEMEAGGMVPGVATYNAIIRKLCEDGKMKEVNGLLSEMDG  349

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             +K++ D+VTCNTLIN Y K GD+ SA KVK +M+E+GL+ D FTYKALIHGFCKAK+ + 
Sbjct  350   RKVQADHVTCNTLINSYAKRGDMTSACKVKKRMMESGLQLDQFTYKALIHGFCKAKELDE  409

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             AKE +F+M+  GFSP+Y  +SWLVD +C +NN +A++ + DE   RG   D S YR++IR
Sbjct  410   AKEALFEMMGRGFSPNYSVFSWLVDGFCKKNNTDAVLLIPDELIKRGLPPDKSVYRSLIR  469

Query  467   RLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMV  288
             RLCK+G +D A++    MQ + +  D +VY +LAYA+   G   AASD+ +EM ++++ V
Sbjct  470   RLCKKGLVDLAQKVLHQMQGKGLEVDCLVYATLAYAHLTAGKVAAASDILNEMARKQMSV  529

Query  287   TlklykslsassKDENSLLDLFWNNVMQRGLISHNVH  177
             T ++Y  L  S  DE + L++FW + ++RGLI+ +V+
Sbjct  530   TPQIYNCLCTSYGDEKATLNMFWVHTIERGLIAKSVY  566



>gb|EMT10404.1| hypothetical protein F775_08842 [Aegilops tauschii]
Length=463

 Score =   450 bits (1158),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 211/430 (49%), Positives = 300/430 (70%), Gaps = 1/430 (0%)
 Frame = -2

Query  1463  LRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGE  1284
             +R  R+ PD HACT LL SL +  +T T  + + +M   GV  N H+YN ++H C K+G+
Sbjct  1     MRAARLAPDAHACTALLTSLARARMTATARRVFDEMGLAGVAMNTHVYNAMLHVCLKAGD  60

Query  1283  VEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNS  1104
               +A+  +++M+  G+  DL++FNT I+LY R+GM YEA+ V+DRM   GVE DI+T+N+
Sbjct  61    ALRAEALMTKMDAAGVPLDLFSFNTAIALYVRKGMQYEAMCVRDRMANDGVEADIVTWNT  120

Query  1103  LIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKG  927
             +IH  C+EGRM+EA +L +D +   V P+ VTYTTL+DGYCR GD+ EA++L  AME +G
Sbjct  121   MIHGMCKEGRMKEAAQLHRDMVASGVEPDMVTYTTLVDGYCRAGDVGEAMKLRGAMEARG  180

Query  926   LCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSAL  747
             + P VA YN+I+RK CE+G+MKE   LL++M E+K++ D+VTCNTLIN Y K GD+ SA 
Sbjct  181   MLPGVAMYNAIIRKLCEDGKMKEVNGLLSEMDERKVQADHVTCNTLINSYSKKGDMPSAC  240

Query  746   KVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTY  567
             KVK +M+E+GL+ D FTYKALIHGF KAK  + AKE +F+M+ AGFSP+Y  +SWLVD +
Sbjct  241   KVKTRMMESGLQLDQFTYKALIHGFSKAKQLDEAKEALFEMMGAGFSPNYSVFSWLVDAF  300

Query  566   CLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDS  387
               +NN +A++ + DE   RG   D S YR++IRRLCK+G +D A++ F  MQ + +  D 
Sbjct  301   YNKNNADAVLLIPDELMKRGLPPDKSVYRSLIRRLCKKGLVDLAQKVFHQMQGKGLEADC  360

Query  386   VVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSLLDLFWNNVM  207
             +VY +LAYA    G   AASD  DEM KR+L +T ++Y  L  S  DE   L++FW + +
Sbjct  361   LVYATLAYAQLSTGKLAAASDTLDEMAKRQLSMTPQIYNCLCTSYGDEKETLNMFWVHAI  420

Query  206   QRGLISHNVH  177
             +R LI  +V+
Sbjct  421   ERALIGKSVY  430


 Score =   124 bits (311),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/301 (26%), Positives = 145/301 (48%), Gaps = 3/301 (1%)
 Frame = -2

Query  1547  VNSQVFSWLLIFYANSK--RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVW  1374
             V + + +W  + +   K  R  +A Q+   +    ++PD    T L++   + G      
Sbjct  111   VEADIVTWNTMIHGMCKEGRMKEAAQLHRDMVASGVEPDMVTYTTLVDGYCRAGDVGEAM  170

Query  1373  KTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY  1194
             K    M   G+LP + +YN +I   C+ G++++ +  LSEM+ + +  D  T NTLI+ Y
Sbjct  171   KLRGAMEARGMLPGVAMYNAIIRKLCEDGKMKEVNGLLSEMDERKVQADHVTCNTLINSY  230

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR-LFKDIKEKVTPNE  1017
              ++G    A  V+ RM   G++ D  TY +LIH   +  ++ EA   LF+ +    +PN 
Sbjct  231   SKKGDMPSACKVKTRMMESGLQLDQFTYKALIHGFSKAKQLDEAKEALFEMMGAGFSPNY  290

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
               ++ L+D +    + D  L +   + ++GL P  + Y S++R+ C++G +  + K+ +Q
Sbjct  291   SVFSWLVDAFYNKNNADAVLLIPDELMKRGLPPDKSVYRSLIRRLCKKGLVDLAQKVFHQ  350

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             M  K +E D +   TL       G + +A    ++M +  L      Y  L   +   K+
Sbjct  351   MQGKGLEADCLVYATLAYAQLSTGKLAAASDTLDEMAKRQLSMTPQIYNCLCTSYGDEKE  410

Query  656   T  654
             T
Sbjct  411   T  411


 Score =   110 bits (274),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/340 (23%), Positives = 153/340 (45%), Gaps = 3/340 (1%)
 Frame = -2

Query  1577  ALVRSDDDSDVNSQVFSW--LLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSL  1404
             AL+   D + V   +FS+   +  Y      ++A+ V + +    ++ D      +++ +
Sbjct  66    ALMTKMDAAGVPLDLFSFNTAIALYVRKGMQYEAMCVRDRMANDGVEADIVTWNTMIHGM  125

Query  1403  VKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDL  1224
              KEG      + ++ M+  GV P++  Y  L+   C++G+V +A +    ME +G+ P +
Sbjct  126   CKEGRMKEAAQLHRDMVASGVEPDMVTYTTLVDGYCRAGDVGEAMKLRGAMEARGMLPGV  185

Query  1223  YTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD  1044
               +N +I   C  G   E   +   M+   V+ D +T N+LI+S+ ++G M  A ++   
Sbjct  186   AMYNAIIRKLCEDGKMKEVNGLLSEMDERKVQADHVTCNTLINSYSKKGDMPSACKVKTR  245

Query  1043  IKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGR  867
             + E  +  ++ TY  LI G+ +   +DEA      M   G  P  + ++ ++  F  +  
Sbjct  246   MMESGLQLDQFTYKALIHGFSKAKQLDEAKEALFEMMGAGFSPNYSVFSWLVDAFYNKNN  305

Query  866   MKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKA  687
                   + +++ ++ + PD     +LI   CK G +  A KV ++M   GL  D   Y  
Sbjct  306   ADAVLLIPDELMKRGLPPDKSVYRSLIRRLCKKGLVDLAQKVFHQMQGKGLEADCLVYAT  365

Query  686   LIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTY  567
             L +          A + + +M     S +   Y+ L  +Y
Sbjct  366   LAYAQLSTGKLAAASDTLDEMAKRQLSMTPQIYNCLCTSY  405



>ref|XP_006649194.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like 
[Oryza brachyantha]
Length=445

 Score =   441 bits (1135),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/433 (47%), Positives = 299/433 (69%), Gaps = 1/433 (0%)
 Frame = -2

Query  1463  LRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGE  1284
             +R   I PDPHAC+ LL +L +  +T T  K +  M + GV  N H+YN ++H C KSG+
Sbjct  1     MRARSIVPDPHACSALLTALARSRMTATARKVFDDMTRSGVAMNTHVYNAMLHVCLKSGD  60

Query  1283  VEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNS  1104
                A+  ++ M+  G+  D ++FNT+I+LYCR+GM YEA+ V++RME  GV+ D++T+NS
Sbjct  61    AALAESLMTRMDAAGVPLDRFSFNTMIALYCRKGMQYEAMCVRERMENEGVKADVVTWNS  120

Query  1103  LIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKG  927
              IH   +EGR++EA +L +++    V P+ VTYTTL+DGYCR GD+ EA+RL   ME  G
Sbjct  121   FIHGLSKEGRVKEAAQLLREMTAAGVAPDHVTYTTLVDGYCRAGDLGEAIRLREEMETMG  180

Query  926   LCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSAL  747
             + P VATYN+ILRK CE+G+MKE   LLN+M E K++ D+VTCNTLIN YCK GD+ SA 
Sbjct  181   MLPGVATYNAILRKLCEDGKMKEVNVLLNEMDETKVQADHVTCNTLINAYCKRGDMTSAC  240

Query  746   KVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTY  567
             KVK +M+E+GL+ D FTYKALIHGFCKA   + AKE +F+M+ AGFSP+Y   SW+VD +
Sbjct  241   KVKRQMMESGLQLDHFTYKALIHGFCKANQLDEAKETLFEMMGAGFSPNYSVLSWIVDGF  300

Query  566   CLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDS  387
             C +NN  AL+ + DE + RG+  D + YR++IRRLCK+G +D A + F  M  + +  D 
Sbjct  301   CKKNNAIALLAIPDELTKRGFPPDKAVYRSLIRRLCKKGFIDLAGKVFNEMLGQGLEVDC  360

Query  386   VVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSLLDLFWNNVM  207
             ++Y +LA AY   G + AA D  +EM +++L +T ++Y  +  S  DE   L++ W + +
Sbjct  361   LIYATLACAYLAAGKSGAALDTLNEMARKQLHITPQIYNCMCTSYADEKESLNMLWVHAI  420

Query  206   QRGLISHNVHNSI  168
             +RGLI+ +V+ ++
Sbjct  421   ERGLITKSVYKTM  433


 Score =   134 bits (336),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/305 (26%), Positives = 149/305 (49%), Gaps = 3/305 (1%)
 Frame = -2

Query  1559  DDSDVNSQVFSWLLIFYANSK--RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
             ++  V + V +W    +  SK  R  +A Q+   +    + PD    T L++   + G  
Sbjct  107   ENEGVKADVVTWNSFIHGLSKEGRVKEAAQLLREMTAAGVAPDHVTYTTLVDGYCRAGDL  166

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
                 +  ++M  +G+LP +  YN ++   C+ G++++ +  L+EM+   +  D  T NTL
Sbjct  167   GEAIRLREEMETMGMLPGVATYNAILRKLCEDGKMKEVNVLLNEMDETKVQADHVTCNTL  226

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR-LFKDIKEKV  1029
             I+ YC+RG    A  V+ +M   G++ D  TY +LIH  C+  ++ EA   LF+ +    
Sbjct  227   INAYCKRGDMTSACKVKRQMMESGLQLDHFTYKALIHGFCKANQLDEAKETLFEMMGAGF  286

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
             +PN    + ++DG+C+  +    L +   + ++G  P  A Y S++R+ C++G +  + K
Sbjct  287   SPNYSVLSWIVDGFCKKNNAIALLAIPDELTKRGFPPDKAVYRSLIRRLCKKGFIDLAGK  346

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             + N+M  + +E D +   TL   Y   G   +AL   N+M    L      Y  +   + 
Sbjct  347   VFNEMLGQGLEVDCLIYATLACAYLAAGKSGAALDTLNEMARKQLHITPQIYNCMCTSYA  406

Query  668   KAKDT  654
               K++
Sbjct  407   DEKES  411


 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/304 (26%), Positives = 141/304 (46%), Gaps = 1/304 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             F+ ++  Y      ++A+ V E +    +K D       ++ L KEG      +  ++M 
Sbjct  83    FNTMIALYCRKGMQYEAMCVRERMENEGVKADVVTWNSFIHGLSKEGRVKEAAQLLREMT  142

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               GV P+   Y  L+   C++G++ +A     EME  G+ P + T+N ++   C  G   
Sbjct  143   AAGVAPDHVTYTTLVDGYCRAGDLGEAIRLREEMETMGMLPGVATYNAILRKLCEDGKMK  202

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLI  996
             E   + + M+   V+ D +T N+LI+++C+ G M  A ++ + + E  +  +  TY  LI
Sbjct  203   EVNVLLNEMDETKVQADHVTCNTLINAYCKRGDMTSACKVKRQMMESGLQLDHFTYKALI  262

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
              G+C+   +DEA      M   G  P  +  + I+  FC++        + +++ ++   
Sbjct  263   HGFCKANQLDEAKETLFEMMGAGFSPNYSVLSWIVDGFCKKNNAIALLAIPDELTKRGFP  322

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD     +LI   CK G I  A KV N+ML  GL  D   Y  L   +  A  +  A + 
Sbjct  323   PDKAVYRSLIRRLCKKGFIDLAGKVFNEMLGQGLEVDCLIYATLACAYLAAGKSGAALDT  382

Query  635   IFDM  624
             + +M
Sbjct  383   LNEM  386



>gb|EEC74287.1| hypothetical protein OsI_09537 [Oryza sativa Indica Group]
Length=689

 Score =   446 bits (1146),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 294/416 (71%), Gaps = 1/416 (0%)
 Frame = -2

Query  1529  SWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIK  1350
             SWLL+  + S R  DA++VF+H+R   + PD HA + LL +L K  +T T  K + +M +
Sbjct  206   SWLLLLLSQSARPHDALRVFDHMRAREVVPDAHASSALLTALAKSRMTATARKVFDQMTR  265

Query  1349  LGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYE  1170
              GV  N H+YN ++H C K+G+   A+  ++ M+  G+  D ++FNT+I+LYCR+GM YE
Sbjct  266   AGVAMNTHVYNAMLHVCLKAGDAALAESLMTRMDAAGVPLDRFSFNTVIALYCRKGMQYE  325

Query  1169  ALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTYTTLID  993
             A+ V++RME  GV+ D++T+NSLIH  C+E R++EA +L +++    V P+ VTYTTL+D
Sbjct  326   AMCVRERMENQGVKADVVTWNSLIHGLCKERRVKEASQLLREMAMAGVAPDHVTYTTLVD  385

Query  992   GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEP  813
             GYCR GD++EA++L   ME  G+ P VATYN+ILRK CE+G+MKE   LLN+M E+K++ 
Sbjct  386   GYCRAGDLEEAVKLRGEMEAMGMLPGVATYNAILRKLCEDGKMKEVNVLLNEMDERKVQA  445

Query  812   DNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
             D+VTCNTLIN YCK GD+ SALKVK +M+E+GL+ D FTYKAL+HGFCKAK+ + AKE +
Sbjct  446   DHVTCNTLINAYCKRGDMTSALKVKRRMMESGLQLDQFTYKALVHGFCKAKELDEAKEAL  505

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
             F+M+ AGFSP+Y   SW+VD  C +NN  A++ + DE   RG+  D + YR++IRRLCK+
Sbjct  506   FEMMGAGFSPNYSVLSWIVDGLCNKNNAVAVLAIPDELMKRGFPPDKAVYRSLIRRLCKK  565

Query  452   GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             G +D A   F  MQ + +  D +VY +LA AY   G   AA D+ +EM K++L +T
Sbjct  566   GFIDLAGNVFNEMQGKGLEADCLVYATLACAYLTAGKPVAALDILNEMAKKQLYIT  621


 Score =   159 bits (401),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 102/390 (26%), Positives = 176/390 (45%), Gaps = 36/390 (9%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT-------  1386
             ++   S LL   A S+ T  A +VF+ +    +  + H    +L+  +K G         
Sbjct  236   DAHASSALLTALAKSRMTATARKVFDQMTRAGVAMNTHVYNAMLHVCLKAGDAALAESLM  295

Query  1385  ---------------DTVWKTY-------------KKMIKLGVLPNIHIYNVLIHACCKS  1290
                            +TV   Y             ++M   GV  ++  +N LIH  CK 
Sbjct  296   TRMDAAGVPLDRFSFNTVIALYCRKGMQYEAMCVRERMENQGVKADVVTWNSLIHGLCKE  355

Query  1289  GEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
               V++A + L EM   G+ PD  T+ TL+  YCR G   EA+ ++  ME  G+ P + TY
Sbjct  356   RRVKEASQLLREMAMAGVAPDHVTYTTLVDGYCRAGDLEEAVKLRGEMEAMGMLPGVATY  415

Query  1109  NSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEE  933
             N+++   C +G+M+E   L  ++ E KV  + VT  TLI+ YC+ GD+  AL++   M E
Sbjct  416   NAILRKLCEDGKMKEVNVLLNEMDERKVQADHVTCNTLINAYCKRGDMTSALKVKRRMME  475

Query  932   KGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVS  753
              GL     TY +++  FC+   + E+ + L +M      P+    + +++G C   + V+
Sbjct  476   SGLQLDQFTYKALVHGFCKAKELDEAKEALFEMMGAGFSPNYSVLSWIVDGLCNKNNAVA  535

Query  752   ALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
              L + +++++ G  PD   Y++LI   CK    + A  V  +M   G       Y+ L  
Sbjct  536   VLAIPDELMKRGFPPDKAVYRSLIRRLCKKGFIDLAGNVFNEMQGKGLEADCLVYATLAC  595

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFY  483
              Y       A + + +E + +   +    Y
Sbjct  596   AYLTAGKPVAALDILNEMAKKQLYITPQIY  625



>gb|EMS68666.1| hypothetical protein TRIUR3_04820 [Triticum urartu]
Length=641

 Score =   411 bits (1057),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/391 (50%), Positives = 276/391 (71%), Gaps = 1/391 (0%)
 Frame = -2

Query  1346  GVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEA  1167
             GV  N H+YN ++H C K+G+  +A+  +++M+  GI  DL++FNT I+LY R+GM YEA
Sbjct  5     GVAMNTHVYNAMLHVCLKAGDALRAEALMTKMDAAGIPLDLFSFNTAIALYVRKGMQYEA  64

Query  1166  LSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDG  990
             + V+DRM   GVE DI+T+N++IH  C+EGRM+EA +L +D +   V P+ VTYTTL+DG
Sbjct  65    MCVRDRMANDGVEADIVTWNTVIHGMCKEGRMKEAAQLHRDMVAAGVEPDTVTYTTLVDG  124

Query  989   YCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPD  810
             YCR GD+ EA++L  AME +G+ P VA YN+I+RK CE+G MKE   LL++M E+K++ D
Sbjct  125   YCRAGDVGEAMKLRGAMEARGMLPGVAMYNAIIRKLCEDGEMKEVNGLLSEMDERKVKAD  184

Query  809   NVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF  630
             +VTCNTLIN Y K GD+ SA KVK +M+E+GL+ D FTYKALIHGF KAK  + AKE +F
Sbjct  185   HVTCNTLINSYSKKGDMPSACKVKTRMMESGLQLDQFTYKALIHGFSKAKQLDEAKEALF  244

Query  629   DMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRG  450
             +M+ AGFSP+Y  +SWLVD +  +NN +A++ L DE   RG     S YR++IRRLCK+G
Sbjct  245   EMMGAGFSPNYSVFSWLVDGFYKKNNADAVLLLPDELMKRGLPPHKSVYRSLIRRLCKKG  304

Query  449   KLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklyk  270
              +D A++    MQ + +  D +VY +LAYA    G   AASD  ++M K++L VT ++Y 
Sbjct  305   LVDLAQKVLDQMQGKGLEADCLVYATLAYAQLTAGKLAAASDTLNDMAKKQLSVTPQIYN  364

Query  269   slsassKDENSLLDLFWNNVMQRGLISHNVH  177
              L  S  DE   L++FW + ++RGLI  +V+
Sbjct  365   CLCTSYGDEKETLNMFWVHAIERGLIGKSVY  395


 Score =   136 bits (343),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/301 (28%), Positives = 147/301 (49%), Gaps = 3/301 (1%)
 Frame = -2

Query  1547  VNSQVFSWLLIFYANSK--RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVW  1374
             V + + +W  + +   K  R  +A Q+   +    ++PD    T L++   + G      
Sbjct  76    VEADIVTWNTVIHGMCKEGRMKEAAQLHRDMVAAGVEPDTVTYTTLVDGYCRAGDVGEAM  135

Query  1373  KTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY  1194
             K    M   G+LP + +YN +I   C+ GE+++ +  LSEM+ + +  D  T NTLI+ Y
Sbjct  136   KLRGAMEARGMLPGVAMYNAIIRKLCEDGEMKEVNGLLSEMDERKVKADHVTCNTLINSY  195

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR-LFKDIKEKVTPNE  1017
              ++G    A  V+ RM   G++ D  TY +LIH   +  ++ EA   LF+ +    +PN 
Sbjct  196   SKKGDMPSACKVKTRMMESGLQLDQFTYKALIHGFSKAKQLDEAKEALFEMMGAGFSPNY  255

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
               ++ L+DG+ +  + D  L L   + ++GL P  + Y S++R+ C++G +  + K+L+Q
Sbjct  256   SVFSWLVDGFYKKNNADAVLLLPDELMKRGLPPHKSVYRSLIRRLCKKGLVDLAQKVLDQ  315

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             M  K +E D +   TL       G + +A    N M +  L      Y  L   +   K+
Sbjct  316   MQGKGLEADCLVYATLAYAQLTAGKLAAASDTLNDMAKKQLSVTPQIYNCLCTSYGDEKE  375

Query  656   T  654
             T
Sbjct  376   T  376


 Score =   112 bits (280),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 83/357 (23%), Positives = 160/357 (45%), Gaps = 4/357 (1%)
 Frame = -2

Query  1631  MLHQ-IACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRI  1455
             MLH  +   D L + A++  +  +    D+ S  F+  +  Y      ++A+ V + +  
Sbjct  16    MLHVCLKAGDALRAEALMTKMDAAGIPLDLFS--FNTAIALYVRKGMQYEAMCVRDRMAN  73

Query  1454  CRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEK  1275
               ++ D      +++ + KEG      + ++ M+  GV P+   Y  L+   C++G+V +
Sbjct  74    DGVEADIVTWNTVIHGMCKEGRMKEAAQLHRDMVAAGVEPDTVTYTTLVDGYCRAGDVGE  133

Query  1274  ADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIH  1095
             A +    ME +G+ P +  +N +I   C  G   E   +   M+   V+ D +T N+LI+
Sbjct  134   AMKLRGAMEARGMLPGVAMYNAIIRKLCEDGEMKEVNGLLSEMDERKVKADHVTCNTLIN  193

Query  1094  SHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCP  918
             S+ ++G M  A ++   + E  +  ++ TY  LI G+ +   +DEA      M   G  P
Sbjct  194   SYSKKGDMPSACKVKTRMMESGLQLDQFTYKALIHGFSKAKQLDEAKEALFEMMGAGFSP  253

Query  917   RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
               + ++ ++  F ++        L +++ ++ + P      +LI   CK G +  A KV 
Sbjct  254   NYSVFSWLVDGFYKKNNADAVLLLPDELMKRGLPPHKSVYRSLIRRLCKKGLVDLAQKVL  313

Query  737   NKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTY  567
             ++M   GL  D   Y  L +    A     A + + DM     S +   Y+ L  +Y
Sbjct  314   DQMQGKGLEADCLVYATLAYAQLTAGKLAAASDTLNDMAKKQLSVTPQIYNCLCTSY  370


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 65/144 (45%), Gaps = 0/144 (0%)
 Frame = -2

Query  722  AGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEA  543
            AG+  ++  Y A++H   KA D  RA+ ++  M AAG      +++  +  Y  +     
Sbjct  4    AGVAMNTHVYNAMLHVCLKAGDALRAEALMTKMDAAGIPLDLFSFNTAIALYVRKGMQYE  63

Query  542  LVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAY  363
             + + D  +  G   DI  +  +I  +CK G++  A +    M    +  D+V YT+L  
Sbjct  64   AMCVRDRMANDGVEADIVTWNTVIHGMCKEGRMKEAAQLHRDMVAAGVEPDTVTYTTLVD  123

Query  362  AYFKEGNTRAASDLFDEMYKRRLM  291
             Y + G+   A  L   M  R ++
Sbjct  124  GYCRAGDVGEAMKLRGAMEARGML  147



>gb|EAZ25167.1| hypothetical protein OsJ_08968 [Oryza sativa Japonica Group]
Length=566

 Score =   400 bits (1029),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 208/532 (39%), Positives = 314/532 (59%), Gaps = 39/532 (7%)
 Frame = -2

Query  1880  VKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRH  1701
             V+ +C  V+K            L+ + +++   L  LSP    L  +   +  ++P    
Sbjct  8     VEAVCAAVIKSTLTQPHNHHHLLAASPSLLAAVLHRLSP----LPSTALAFFRSLPPPHP  63

Query  1700  SLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWL  1521
                S   +  +    +H  +A+ +L  ++ +  LSS                +  + SWL
Sbjct  64    LDASLALLRLLAPHPRHHPTARSLLRDLSLRHPLSS-------PLLLPSLLADPHLPSWL  116

Query  1520  LIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGV  1341
             L+  + S R  DA++VF+H+R   + PD HA + LL +L K  +T T  K + +M + GV
Sbjct  117   LLLLSQSARPHDALRVFDHMRAREVVPDAHASSALLTALAKSRMTATARKVFDQMTRAGV  176

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS  1161
               N H+YN ++H C K+G+   A+  ++ M+  G+  D ++FNT+I+LYCR+GM YEA+ 
Sbjct  177   AMNTHVYNAMLHVCLKAGDAALAESLMTRMDAAGVPLDRFSFNTVIALYCRKGMQYEAMC  236

Query  1160  VQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLIDGYCR  981
             V++RME  GV+ D++T+NSLIH  C+E R++EA                           
Sbjct  237   VRERMENQGVKADVVTWNSLIHGLCKERRVKEA---------------------------  269

Query  980   VGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVT  801
               D++EA++L   ME  G+ P VATYN+ILRK CE+G+MKE   LLN+M E+K++ D+VT
Sbjct  270   -SDLEEAVKLRGEMEAMGMLPGVATYNAILRKLCEDGKMKEVNVLLNEMDERKVQADHVT  328

Query  800   CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
             CNTLIN YCK GD+ SALKVK +M+E+GL+ D FTYKAL+HGFCKAK+ + AKE +F+M+
Sbjct  329   CNTLINAYCKRGDMTSALKVKRRMMESGLQLDQFTYKALVHGFCKAKELDEAKEALFEMM  388

Query  620   AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
              AGFSP+Y   SW+VD  C +NN  A++ + DE   RG+  D + YR++IRRLCK+G +D
Sbjct  389   GAGFSPNYSVLSWIVDGLCNKNNAVAVLAIPDELMKRGFPPDKAVYRSLIRRLCKKGFID  448

Query  440   CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
              A   F  MQ + +  D +VY +LA AY   G   AA D+ +EM K++L +T
Sbjct  449   LAGNVFNEMQGKGLEADCLVYATLACAYLTAGKPVAALDILNEMAKKQLYIT  500



>gb|KDP24342.1| hypothetical protein JCGZ_25638 [Jatropha curcas]
Length=243

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 189/235 (80%), Gaps = 0/235 (0%)
 Frame = -2

Query  884  FCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD  705
             CE GR++++ KLLN+M EKKIEPDNVTCNTLIN YCKIGD+ SALKVKN+M+EAGL+ D
Sbjct  2    LCEGGRIRDANKLLNEMSEKKIEPDNVTCNTLINAYCKIGDMKSALKVKNRMVEAGLKLD  61

Query  704  SFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLAD  525
             FTY ALIHGFCK ++ + AKE++F M+ +G  PSYC YSWLVD YC Q+  EA++KL +
Sbjct  62   KFTYNALIHGFCKIQEVDNAKELLFSMLNSGLFPSYCTYSWLVDIYCNQHKEEAIIKLPE  121

Query  524  EFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEG  345
            EF  RG   DIS YRA+IRR CKR K+DCA+R F +MQER ILGDSV+YTSLAYAY+K G
Sbjct  122  EFIRRGLFADISLYRALIRRFCKREKVDCAQRIFNLMQERGILGDSVIYTSLAYAYWKLG  181

Query  344  NTRAASDLFDEMYKRRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
               A SD+ DEMY+RRLM+TLK+Y+S SAS   ++++L LFWN+V++R ++S N+
Sbjct  182  KVHATSDMLDEMYRRRLMITLKIYRSFSASYASDSTILSLFWNHVVERRIMSKNL  236


 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 99/181 (55%), Gaps = 1/181 (1%)
 Frame = -2

Query  1298  CKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDI  1119
             C+ G +  A++ L+EM  K I PD  T NTLI+ YC+ G    AL V++RM   G++ D 
Sbjct  3     CEGGRIRDANKLLNEMSEKKIEPDNVTCNTLINAYCKIGDMKSALKVKNRMVEAGLKLDK  62

Query  1118  ITYNSLIHSHCREGRMREAMR-LFKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
              TYN+LIH  C+   +  A   LF  +   + P+  TY+ L+D YC     +  ++L   
Sbjct  63    FTYNALIHGFCKIQEVDNAKELLFSMLNSGLFPSYCTYSWLVDIYCNQHKEEAIIKLPEE  122

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
                +GL   ++ Y +++R+FC+  ++  + ++ N M E+ I  D+V   +L   Y K+G 
Sbjct  123   FIRRGLFADISLYRALIRRFCKREKVDCAQRIFNLMQERGILGDSVIYTSLAYAYWKLGK  182

Query  761   I  759
             +
Sbjct  183   V  183


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 100/205 (49%), Gaps = 1/205 (0%)
 Frame = -2

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C  GR+R+A +L  ++ EK + P+ VT  TLI+ YC++GD+  AL++ + M E GL    
Sbjct  3     CEGGRIRDANKLLNEMSEKKIEPDNVTCNTLINAYCKIGDMKSALKVKNRMVEAGLKLDK  62

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYN+++  FC+   +  + +LL  M    + P   T + L++ YC      + +K+  +
Sbjct  63    FTYNALIHGFCKIQEVDNAKELLFSMLNSGLFPSYCTYSWLVDIYCNQHKEEAIIKLPEE  122

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
              +  GL  D   Y+ALI  FCK +  + A+ +   M   G       Y+ L   Y     
Sbjct  123   FIRRGLFADISLYRALIRRFCKREKVDCAQRIFNLMQERGILGDSVIYTSLAYAYWKLGK  182

Query  551   NEALVKLADEFSGRGYCVDISFYRA  477
               A   + DE   R   + +  YR+
Sbjct  183   VHATSDMLDEMYRRRLMITLKIYRS  207


 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/239 (26%), Positives = 112/239 (47%), Gaps = 3/239 (1%)
 Frame = -2

Query  1496  RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYN  1317
             R  DA ++   +   +I+PD   C  L+N+  K G   +  K   +M++ G+  +   YN
Sbjct  7     RIRDANKLLNEMSEKKIEPDNVTCNTLINAYCKIGDMKSALKVKNRMVEAGLKLDKFTYN  66

Query  1316  VLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERG  1137
              LIH  CK  EV+ A E L  M   G+FP   T++ L+ +YC +      + + +   R 
Sbjct  67    ALIHGFCKIQEVDNAKELLFSMLNSGLFPSYCTYSWLVDIYCNQHKEEAIIKLPEEFIRR  126

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEA  960
             G+  DI  Y +LI   C+  ++  A R+F  ++E+ +  + V YT+L   Y ++G +   
Sbjct  127   GLFADISLYRALIRRFCKREKVDCAQRIFNLMQERGILGDSVIYTSLAYAYWKLGKVHAT  186

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
               +   M  + L   +  Y S    +  +  +   +   N + E++I   N+  +  +N
Sbjct  187   SDMLDEMYRRRLMITLKIYRSFSASYASDSTI--LSLFWNHVVERRIMSKNLLEDMEVN  243


 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 107/222 (48%), Gaps = 11/222 (5%)
 Frame = -2

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTP  1023
             + C  G   +A  + + M    +EPD +T N+LI+++C+ G M+ A+++   + E  +  
Sbjct  1     MLCEGGRIRDANKLLNEMSEKKIEPDNVTCNTLINAYCKIGDMKSALKVKNRMVEAGLKL  60

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             ++ TY  LI G+C++ ++D A  L  +M   GL P   TY+ ++  +C + + +   KL 
Sbjct  61    DKFTYNALIHGFCKIQEVDNAKELLFSMLNSGLFPSYCTYSWLVDIYCNQHKEEAIIKLP  120

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +   + +  D      LI  +CK   +  A ++ N M E G+  DS  Y +L + + K 
Sbjct  121   EEFIRRGLFADISLYRALIRRFCKREKVDCAQRIFNLMQERGILGDSVIYTSLAYAYWKL  180

Query  662   KDTERAKEVIFDM----------IAAGFSPSYCAYSWLVDTY  567
                    +++ +M          I   FS SY + S ++  +
Sbjct  181   GKVHATSDMLDEMYRRRLMITLKIYRSFSASYASDSTILSLF  222



>ref|XP_006848652.1| hypothetical protein AMTR_s00171p00059700 [Amborella trichopoda]
 gb|ERN10233.1| hypothetical protein AMTR_s00171p00059700 [Amborella trichopoda]
Length=304

 Score =   306 bits (785),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/282 (54%), Positives = 199/282 (71%), Gaps = 0/282 (0%)
 Frame = -2

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             PN +TYTTLI+GYCRV D+ EA RL   ME KG+ P VATYNSI+RK CEEG+M+ +  L
Sbjct  6     PNHITYTTLINGYCRVNDVSEAFRLRHEMEAKGIFPGVATYNSIIRKLCEEGKMRAANLL  65

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             L++M E+KIEPDNVTCNTLIN YCK GD+V A K++N MLE GL+ D FTYKALI GFCK
Sbjct  66    LDEMRERKIEPDNVTCNTLINAYCKRGDMVFAWKIRNMMLEGGLKLDQFTYKALIRGFCK  125

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              ++   A EV+F+M+ AGF PSY  Y+WLVD YC Q N EA +++  E + RG   DIS 
Sbjct  126   TQEISEAAEVLFEMLNAGFCPSYSTYAWLVDGYCNQRNEEAALRIPLELAKRGLGADISV  185

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMY  306
             YRA+IRR CK+G +D A++ F  MQ   + G ++ + ++AYAY   G    AS+L ++M 
Sbjct  186   YRALIRRFCKKGMVDFAQKAFIQMQSNGLPGCTLTFANMAYAYLDAGKPIMASELLNDMA  245

Query  305   KRRLMVTlklykslsassKDENSLLDLFWNNVMQRGLISHNV  180
             K+ L +T K+YKSL  S   E+S L+ FW+    +GL++ NV
Sbjct  246   KKGLNITAKIYKSLGDSHAGEDSKLERFWDYATAKGLVAKNV  287


 Score =   129 bits (323),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 128/255 (50%), Gaps = 1/255 (0%)
 Frame = -2

Query  1445  KPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADE  1266
             KP+    T L+N   +       ++   +M   G+ P +  YN +I   C+ G++  A+ 
Sbjct  5     KPNHITYTTLINGYCRVNDVSEAFRLRHEMEAKGIFPGVATYNSIIRKLCEEGKMRAANL  64

Query  1265  FLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHC  1086
              L EM  + I PD  T NTLI+ YC+RG    A  +++ M  GG++ D  TY +LI   C
Sbjct  65    LLDEMRERKIEPDNVTCNTLINAYCKRGDMVFAWKIRNMMLEGGLKLDQFTYKALIRGFC  124

Query  1085  REGRMREAMR-LFKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVA  909
             +   + EA   LF+ +     P+  TY  L+DGYC   + + ALR+   + ++GL   ++
Sbjct  125   KTQEISEAAEVLFEMLNAGFCPSYSTYAWLVDGYCNQRNEEAALRIPLELAKRGLGADIS  184

Query  908   TYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKM  729
              Y +++R+FC++G +  + K   QM    +    +T   +   Y   G  + A ++ N M
Sbjct  185   VYRALIRRFCKKGMVDFAQKAFIQMQSNGLPGCTLTFANMAYAYLDAGKPIMASELLNDM  244

Query  728   LEAGLRPDSFTYKAL  684
              + GL   +  YK+L
Sbjct  245   AKKGLNITAKIYKSL  259


 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 131/254 (52%), Gaps = 1/254 (0%)
 Frame = -2

Query  1232  PDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL  1053
             P+  T+ TLI+ YCR     EA  ++  ME  G+ P + TYNS+I   C EG+MR A  L
Sbjct  6     PNHITYTTLINGYCRVNDVSEAFRLRHEMEAKGIFPGVATYNSIIRKLCEEGKMRAANLL  65

Query  1052  FKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCE  876
               +++E K+ P+ VT  TLI+ YC+ GD+  A ++ + M E GL     TY +++R FC+
Sbjct  66    LDEMRERKIEPDNVTCNTLINAYCKRGDMVFAWKIRNMMLEGGLKLDQFTYKALIRGFCK  125

Query  875   EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
                + E+ ++L +M      P   T   L++GYC   +  +AL++  ++ + GL  D   
Sbjct  126   TQEISEAAEVLFEMLNAGFCPSYSTYAWLVDGYCNQRNEEAALRIPLELAKRGLGADISV  185

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
             Y+ALI  FCK    + A++    M + G       ++ +   Y          +L ++ +
Sbjct  186   YRALIRRFCKKGMVDFAQKAFIQMQSNGLPGCTLTFANMAYAYLDAGKPIMASELLNDMA  245

Query  515   GRGYCVDISFYRAI  474
              +G  +    Y+++
Sbjct  246   KKGLNITAKIYKSL  259


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 88/195 (45%), Gaps = 1/195 (1%)
 Frame = -2

Query  1475  VFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACC  1296
             + + +R  +I+PD   C  L+N+  K G     WK    M++ G+  +   Y  LI   C
Sbjct  65    LLDEMRERKIEPDNVTCNTLINAYCKRGDMVFAWKIRNMMLEGGLKLDQFTYKALIRGFC  124

Query  1295  KSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDII  1116
             K+ E+ +A E L EM   G  P   T+  L+  YC +     AL +   + + G+  DI 
Sbjct  125   KTQEISEAAEVLFEMLNAGFCPSYSTYAWLVDGYCNQRNEEAALRIPLELAKRGLGADIS  184

Query  1115  TYNSLIHSHCREGRMREAMRLFKDIKEKVTPN-EVTYTTLIDGYCRVGDIDEALRLHSAM  939
              Y +LI   C++G +  A + F  ++    P   +T+  +   Y   G    A  L + M
Sbjct  185   VYRALIRRFCKKGMVDFAQKAFIQMQSNGLPGCTLTFANMAYAYLDAGKPIMASELLNDM  244

Query  938   EEKGLCPRVATYNSI  894
              +KGL      Y S+
Sbjct  245   AKKGLNITAKIYKSL  259


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 88/182 (48%), Gaps = 8/182 (4%)
 Frame = -2

Query  827  KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
            +  +P+++T  TLINGYC++ D+  A +++++M   G+ P   TY ++I   C+      
Sbjct  2    RDTKPNHITYTTLINGYCRVNDVSEAFRLRHEMEAKGIFPGVATYNSIIRKLCEEGKMRA  61

Query  647  AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
            A  ++ +M      P     + L++ YC + +     K+ +     G  +D   Y+A+IR
Sbjct  62   ANLLLDEMRERKIEPDNVTCNTLINAYCKRGDMVFAWKIRNMMLEGGLKLDQFTYKALIR  121

Query  467  RLCKRGKL-DCAERFFGMMQEREILGDSVVYTSLAY---AYFKEGNTRAASDLFDEMYKR  300
              CK  ++ + AE  F M+      G    Y++ A+    Y  + N  AA  +  E+ KR
Sbjct  122  GFCKTQEISEAAEVLFEMLNA----GFCPSYSTYAWLVDGYCNQRNEEAALRIPLELAKR  177

Query  299  RL  294
             L
Sbjct  178  GL  179



>ref|XP_006482079.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Citrus sinensis]
Length=586

 Score =   286 bits (733),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/539 (29%), Positives = 280/539 (52%), Gaps = 10/539 (2%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLK--PKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVET  1719
             +  ++KT+   +     ++L K  P I     + +I     +L P       SFF ++ +
Sbjct  36    DDPILKTISQAIKSNSLSSLTKFLPSISSLQVTNLITRNPHSLPPHSLL---SFFNFLSS  92

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
              P++R +L +  +M++ L  HK    A+D+LH I  K  + S A L A +     + +  
Sbjct  93    QPHFRLTLHAYSTMVHFLAAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPG  152

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              V   L+I Y +     DAIQ F  LR    +     C  L++ +++  L       Y +
Sbjct  153   LVLDALMIVYVDLGFLDDAIQCFRLLRKHNFRIPARGCRCLIDRMMRTNLPTVTLGFYLE  212

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             ++  G  P+++++NVL+H  CK G+++ A     E   +G+     +FNTLI+ +C+   
Sbjct  213   ILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKN  272

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTT  1002
               E   ++  ME  G+ PD+ TY++LI+  C+E R+ +A  L  ++ E+ +TPN+V +TT
Sbjct  273   LDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTT  332

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDG+C+ G ID A+ ++  M  K L P +  YN++    C+ G MKE+ K++++M    
Sbjct  333   LIDGHCKNGRIDMAMEIYQLMLRKDLKPDLIMYNTLTNGLCKVGDMKEARKIVDEMCTNG  392

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + PD +T  TL++G+CK GD+ SAL ++ +M++ G+  D+  + ALI GFC+      A+
Sbjct  393   LNPDKITYTTLLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVIEAE  452

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
              ++ +M+  G  P    Y+ ++D +C   + +   +L  E    G+   +  Y A++  L
Sbjct  453   RMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGL  512

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             CK G+L  A      M +  ++ D + Y  L   + K GN       FD++   + +V+
Sbjct  513   CKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPED----FDKLQSEKGLVS  567



>ref|XP_006430553.1| hypothetical protein CICLE_v10011347mg [Citrus clementina]
 gb|ESR43793.1| hypothetical protein CICLE_v10011347mg [Citrus clementina]
Length=586

 Score =   285 bits (728),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 155/539 (29%), Positives = 280/539 (52%), Gaps = 10/539 (2%)
 Frame = -2

Query  1892  ESQLVKTLCVIVLKGHWNNLLK--PKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVET  1719
             +  ++KT+   +     ++L K  P I     + +I     +L P       SFF ++ +
Sbjct  36    DDPILKTISQAIKSNSLSSLTKFLPSISSLQVTNLITRNPHSLPPHSLL---SFFNFLSS  92

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNS  1539
              P++R +L +  +M++ L  HK    A+D+LH I  K  + S A L A +     + +  
Sbjct  93    QPHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPG  152

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              V   L+I Y +     DAIQ F  LR    +     C  L++ +++  L       Y +
Sbjct  153   LVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLE  212

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             ++  G  P+++++NVL+H  CK G+++ A     E   +G+     +FNTLI+ +C+   
Sbjct  213   ILDYGYSPSVYVFNVLMHKLCKEGKIKDAQIVFDEFGKRGLHATAVSFNTLINGHCKAKN  272

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTT  1002
               E   ++  ME  G+ PD+ TY++LI+  C+E R+ +A  L  ++ E+ +TPN+V +TT
Sbjct  273   LDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTT  332

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LIDG+C+ G ID A+ ++  M  K L P +  YN++    C+ G MKE+ K++++M    
Sbjct  333   LIDGHCKNGRIDMAMEIYQLMLSKDLKPDLIMYNTLTNGLCKAGDMKEARKIVDEMCTNG  392

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + PD +T   L++G+CK GD+ SAL ++ +M++ G+  D+  + ALI GFC+      A+
Sbjct  393   LNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAE  452

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
              ++ +M+  G  P    Y+ ++D +C   +++   +L  E    G+   +  Y A++  L
Sbjct  453   RMLREMLKVGLKPDDATYTMVIDCFCKNGDSKTGFRLLKEMRSDGHVPAVETYNALMNGL  512

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             CK G+L  A      M +  ++ D + Y  L   + K GN       FD++   + +V+
Sbjct  513   CKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPED----FDKLQSEKGLVS  567



>ref|XP_008229438.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Prunus mume]
Length=600

 Score =   284 bits (727),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 154/486 (32%), Positives = 257/486 (53%), Gaps = 1/486 (0%)
 Frame = -2

Query  1796  IINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQI  1617
             +IN   LT          SFF W+ + P +RH++QS  +M + L  H+ +  A+ +L  +
Sbjct  78    VINLINLTPHSLSPLSLLSFFNWLSSHPTFRHNIQSYCTMAHFLCAHQMYPQAQSLLRIV  137

Query  1616  ACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPD  1437
               +    + + + A V     +  ++ VF  L+  Y +     DA Q F  LR    +  
Sbjct  138   VSRKGKETASSVFASVLETRGTHQSNYVFDALMNAYVDCGFVSDACQCFRLLRKHNFRIP  197

Query  1436  PHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLS  1257
              HAC  LL+ ++K       W  Y +++  G  P ++ +NVL+H  CK GE+ +A     
Sbjct  198   FHACGCLLDKMLKLNSPVVAWGFYLEILDSGFPPKVYNFNVLMHKLCKEGEIREAQLVFD  257

Query  1256  EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREG  1077
             E+  +G+ P + +FNTLI+ YC+     E   ++  ME     PD+ TY+ LI+  C+E 
Sbjct  258   EIGKRGLLPTVVSFNTLINGYCKSRNLEECFRLKRDMEESRTRPDVFTYSVLINGLCKEL  317

Query  1076  RMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYN  900
             R+ +A  LF ++ E+ + PN VTYTTLIDG C+ G ID A+ ++  M   G+ P + TYN
Sbjct  318   RLDDANLLFDEMCERGLVPNNVTYTTLIDGQCKNGRIDLAMEVYQKMLGIGIKPDLITYN  377

Query  899   SILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEA  720
             +++   C+ G +KE+ KL+ +M  + ++PD +T  TLI+G CK GD+ SAL+++  M++ 
Sbjct  378   TLINGLCKVGDLKETRKLVEEMNIEGLKPDTITYTTLIDGCCKEGDLQSALEIRKGMIKQ  437

Query  719   GLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEAL  540
             G+  D+  + ALI G C+   T  A+  + +M+ +G  P    Y+ ++D +C + + +  
Sbjct  438   GIELDNVAFTALISGLCREGKTLDAERTLREMLNSGMKPDDATYTMIIDGFCKKGDVKMG  497

Query  539   VKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYA  360
              KL  E  G GY   +  Y A++  LCK G++  A      M    +  D + Y  L   
Sbjct  498   FKLLKEMQGDGYVPSVVTYNALMNGLCKLGQMKNANMLLDAMINLGVAPDDITYNILLEG  557

Query  359   YFKEGN  342
             + K GN
Sbjct  558   HCKHGN  563


 Score =   120 bits (301),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 120/233 (52%), Gaps = 9/233 (4%)
 Frame = -2

Query  971  IDEALRLHSAME---------EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
            +D+ L+L+S +          + G  P+V  +N ++ K C+EG ++E+  + +++G++ +
Sbjct  205  LDKMLKLNSPVVAWGFYLEILDSGFPPKVYNFNVLMHKLCKEGEIREAQLVFDEIGKRGL  264

Query  818  EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             P  V+ NTLINGYCK  ++    ++K  M E+  RPD FTY  LI+G CK    + A  
Sbjct  265  LPTVVSFNTLINGYCKSRNLEECFRLKRDMEESRTRPDVFTYSVLINGLCKELRLDDANL  324

Query  638  VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
            +  +M   G  P+   Y+ L+D  C     +  +++  +  G G   D+  Y  +I  LC
Sbjct  325  LFDEMCERGLVPNNVTYTTLIDGQCKNGRIDLAMEVYQKMLGIGIKPDLITYNTLINGLC  384

Query  458  KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
            K G L    +    M    +  D++ YT+L     KEG+ ++A ++   M K+
Sbjct  385  KVGDLKETRKLVEEMNIEGLKPDTITYTTLIDGCCKEGDLQSALEIRKGMIKQ  437



>ref|XP_007217406.1| hypothetical protein PRUPE_ppa024153mg [Prunus persica]
 gb|EMJ18605.1| hypothetical protein PRUPE_ppa024153mg [Prunus persica]
Length=605

 Score =   282 bits (721),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 148/467 (32%), Positives = 250/467 (54%), Gaps = 1/467 (0%)
 Frame = -2

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSD  1560
             FF W+ + P +RH++QS  +M + L  H+ +  A+ +L  +  +    + + + A +   
Sbjct  102   FFNWLSSHPTFRHNIQSYCTMAHFLCAHQMYPQAQSLLRIVVSRKGKETASSVFASILET  161

Query  1559  DDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDT  1380
               +  ++ VF  L+  Y +     DA Q F  LR    +   HAC  LL+ ++K      
Sbjct  162   RGTHQSNYVFDALMNAYVDCGFVSDACQCFRLLRKHNFRIPFHACGCLLDKMLKLNSPVV  221

Query  1379  VWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLIS  1200
              W  Y +++  G  P ++ +NVL+H  CK GE+ +A     E+  +G+ P + +FNTLI+
Sbjct  222   AWGFYLEILDSGFPPKVYNFNVLMHKLCKEGEIREAQLVFDEIGKRGLLPTVVSFNTLIN  281

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTP  1023
              YC+     E   ++  ME     PD+ TY+ LI+  C+E R+ +A  LF ++ E+ + P
Sbjct  282   GYCKSRNLEECFRLKRDMEESRTRPDVFTYSVLINGLCKELRLDDANLLFDEMCERGLVP  341

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VTYTTLIDG C+ G ID A+ ++  M   G+ P V TYN+++   C+ G +KE+ KL+
Sbjct  342   NNVTYTTLIDGQCKNGRIDLAMEVYQKMLGIGIKPDVITYNTLINGLCKVGDLKEARKLV  401

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +M    ++PD +T  TLI+G CK G++ SAL+++  M++ G+  D+  + ALI G C+ 
Sbjct  402   EEMNIAGLKPDTITYTTLIDGCCKEGNLQSALEIRKGMIKQGIELDNVAFTALISGLCRE  461

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
               T  A+  + +M+ +G  P    Y+ ++D +C + + +   KL  E  G GY   +  Y
Sbjct  462   GKTLDAERTLREMLNSGMKPDDATYTMIIDGFCKKGDVKMGFKLLKEMQGDGYVPSVVTY  521

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGN  342
              A++  LCK G++  A      M    +  D + Y  L   + K GN
Sbjct  522   NALMNGLCKLGQMKNANMLLDAMINLGVAPDDITYNILLEGHCKHGN  568


 Score =   123 bits (309),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 121/233 (52%), Gaps = 9/233 (4%)
 Frame = -2

Query  971  IDEALRLHSAME---------EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
            +D+ L+L+S +          + G  P+V  +N ++ K C+EG ++E+  + +++G++ +
Sbjct  210  LDKMLKLNSPVVAWGFYLEILDSGFPPKVYNFNVLMHKLCKEGEIREAQLVFDEIGKRGL  269

Query  818  EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             P  V+ NTLINGYCK  ++    ++K  M E+  RPD FTY  LI+G CK    + A  
Sbjct  270  LPTVVSFNTLINGYCKSRNLEECFRLKRDMEESRTRPDVFTYSVLINGLCKELRLDDANL  329

Query  638  VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
            +  +M   G  P+   Y+ L+D  C     +  +++  +  G G   D+  Y  +I  LC
Sbjct  330  LFDEMCERGLVPNNVTYTTLIDGQCKNGRIDLAMEVYQKMLGIGIKPDVITYNTLINGLC  389

Query  458  KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
            K G L  A +    M    +  D++ YT+L     KEGN ++A ++   M K+
Sbjct  390  KVGDLKEARKLVEEMNIAGLKPDTITYTTLIDGCCKEGNLQSALEIRKGMIKQ  442



>gb|EPS72925.1| hypothetical protein M569_01830 [Genlisea aurea]
Length=593

 Score =   280 bits (716),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 161/531 (30%), Positives = 286/531 (54%), Gaps = 11/531 (2%)
 Frame = -2

Query  1898  NTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVET  1719
             NT S+ ++   V  L+    NLL P +   + S +I     +LSP   +   SFF+W+ +
Sbjct  36    NTLSEAIRNHPVKPLQSSLKNLL-PSLTPRIVSRLIALNPASLSPHRLF---SFFQWLSS  91

Query  1718  IP--NYRHSLQSSWSMIYILTKHKHFKSAKDMLH-QIACKDFLSSPAVLNALVRSDDDSD  1548
                 N+RH++QS  +MI+ L  H     AK++L   ++ K   S+P V  A++R+     
Sbjct  92    PGRCNFRHTVQSYCTMIHFLCTHGMTVEAKNLLEILVSRKGKNSAPDVFEAMMRTRGKQK  151

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
              +   FS L++ Y       DAIQ F   R  R++     C  +L+ L+        W+ 
Sbjct  152   SDIFAFSGLMMAYLELGFIDDAIQCFRLTRKNRLRLPFDCCKKMLDRLMLFSSLSLTWEF  211

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
             Y++++  G  P+++ +N+L+H  CKS  +  A      +   G+ P + +FNTL++ + +
Sbjct  212   YEEILDSGYPPSLYFFNILMHKFCKSENIHLAQSVFDAIRKWGLTPSVVSFNTLMNGFVK  271

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVT  1011
              G   EA  ++  ME+   +PD+ TY++LI+  C+E  M  A  LF ++ ++ + P++VT
Sbjct  272   LGDLKEAFRLKSTMEKTETQPDVYTYSALINGLCKEEMMDNASELFAEMVDRGLVPSDVT  331

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             +TTLIDGYC++G ++  + ++  M  +GL P + TYN+++  FC++G +K +  L+++M 
Sbjct  332   FTTLIDGYCKIGKLEMGMEMYRQMLSQGLVPDLITYNALINGFCKKGDLKAAHDLVSEMS  391

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
              K ++PD +T  TLI+G C+ GD+ SA  ++ KM+ AG+  D  T+ ALI G C+     
Sbjct  392   VKGLKPDKITFTTLIDGCCREGDLDSAFDLRLKMISAGIPLDGVTHTALISGLCQQGKPS  451

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS--GRGYCVDISFYRA  477
              A++ +  M+++G  P   AY+ ++D +C Q + +    L  E    G G    +  Y  
Sbjct  452   DAEKTLRQMLSSGLKPDDAAYAMIMDGFCKQGDTKRASDLLRELQKDGGGRIPSLVAYNV  511

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKE-GNTRAAS  327
             ++   C+RG++  A+     M    I+ D V Y ++   + +  GN  AAS
Sbjct  512   LLNGYCRRGQMRNADMLLDAMLNLGIVPDDVTYNTMLEGHSRRNGNGEAAS  562


 Score =   177 bits (448),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 156/279 (56%), Gaps = 1/279 (0%)
 Frame = -2

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P +  +N L+H  C+   +  A  +F  I++  +TP+ V++ TL++G+ ++GD+ EA
Sbjct  219   GYPPSLYFFNILMHKFCKSENIHLAQSVFDAIRKWGLTPSVVSFNTLMNGFVKLGDLKEA  278

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              RL S ME+    P V TY++++   C+E  M  +++L  +M ++ + P +VT  TLI+G
Sbjct  279   FRLKSTMEKTETQPDVYTYSALINGLCKEEMMDNASELFAEMVDRGLVPSDVTFTTLIDG  338

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
             YCKIG +   +++  +ML  GL PD  TY ALI+GFCK  D + A +++ +M   G  P 
Sbjct  339   YCKIGKLEMGMEMYRQMLSQGLVPDLITYNALINGFCKKGDLKAAHDLVSEMSVKGLKPD  398

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                ++ L+D  C + + ++   L  +    G  +D   + A+I  LC++GK   AE+   
Sbjct  399   KITFTTLIDGCCREGDLDSAFDLRLKMISAGIPLDGVTHTALISGLCQQGKPSDAEKTLR  458

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
              M    +  D   Y  +   + K+G+T+ ASDL  E+ K
Sbjct  459   QMLSSGLKPDDAAYAMIMDGFCKQGDTKRASDLLRELQK  497


 Score =   160 bits (406),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/360 (30%), Positives = 175/360 (49%), Gaps = 42/360 (12%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             F+ L+  +  S+    A  VF+ +R   + P   +   L+N  VK G     ++    M 
Sbjct  227   FNILMHKFCKSENIHLAQSVFDAIRKWGLTPSVVSFNTLMNGFVKLGDLKEAFRLKSTME  286

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             K    P+++ Y+ LI+  CK   ++ A E  +EM  +G+ P   TF TLI  YC+ G   
Sbjct  287   KTETQPDVYTYSALINGLCKEEMMDNASELFAEMVDRGLVPSDVTFTTLIDGYCKIGKLE  346

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLI  996
               + +  +M   G+ PD+ITYN+LI+  C++G ++ A  L  ++  K + P+++T+TTLI
Sbjct  347   MGMEMYRQMLSQGLVPDLITYNALINGFCKKGDLKAAHDLVSEMSVKGLKPDKITFTTLI  406

Query  995   DGYCRVGDIDEA--LRL-------------HSA--------------------MEEKGLC  921
             DG CR GD+D A  LRL             H+A                    M   GL 
Sbjct  407   DGCCREGDLDSAFDLRLKMISAGIPLDGVTHTALISGLCQQGKPSDAEKTLRQMLSSGLK  466

Query  920   PRVATYNSILRKFCEEGRMKESTKLLNQM---GEKKIEPDNVTCNTLINGYCKIGDIVSA  750
             P  A Y  I+  FC++G  K ++ LL ++   G  +I P  V  N L+NGYC+ G + +A
Sbjct  467   PDDAAYAMIMDGFCKQGDTKRASDLLRELQKDGGGRI-PSLVAYNVLLNGYCRRGQMRNA  525

Query  749   LKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT  570
               + + ML  G+ PD  TY  ++ G  +      A  V  +  A G    + +Y+ L+++
Sbjct  526   DMLLDAMLNLGIVPDDVTYNTMLEGHSRRNGNGEAASVFRN--AKGVVLDHASYTALLNS  583


 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/319 (25%), Positives = 149/319 (47%), Gaps = 19/319 (6%)
 Frame = -2

Query  1220  TFNTLISLYCRRGMHYEAL-------------SVQDRME-----RGGVEPDIITYNSLIH  1095
             ++ T+I   C  GM  EA              S  D  E     RG  + DI  ++ L+ 
Sbjct  103   SYCTMIHFLCTHGMTVEAKNLLEILVSRKGKNSAPDVFEAMMRTRGKQKSDIFAFSGLMM  162

Query  1094  SHCREGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCP  918
             ++   G + +A++ F+   K ++         ++D       +      +  + + G  P
Sbjct  163   AYLELGFIDDAIQCFRLTRKNRLRLPFDCCKKMLDRLMLFSSLSLTWEFYEEILDSGYPP  222

Query  917   RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
              +  +N ++ KFC+   +  +  + + + +  + P  V+ NTL+NG+ K+GD+  A ++K
Sbjct  223   SLYFFNILMHKFCKSENIHLAQSVFDAIRKWGLTPSVVSFNTLMNGFVKLGDLKEAFRLK  282

Query  737   NKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQ  558
             + M +   +PD +TY ALI+G CK +  + A E+  +M+  G  PS   ++ L+D YC  
Sbjct  283   STMEKTETQPDVYTYSALINGLCKEEMMDNASELFAEMVDRGLVPSDVTFTTLIDGYCKI  342

Query  557   NNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVY  378
                E  +++  +   +G   D+  Y A+I   CK+G L  A      M  + +  D + +
Sbjct  343   GKLEMGMEMYRQMLSQGLVPDLITYNALINGFCKKGDLKAAHDLVSEMSVKGLKPDKITF  402

Query  377   TSLAYAYFKEGNTRAASDL  321
             T+L     +EG+  +A DL
Sbjct  403   TTLIDGCCREGDLDSAFDL  421


 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 81/152 (53%), Gaps = 3/152 (2%)
 Frame = -2

Query  1424  TVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEME-  1248
             T L++ L ++G      KT ++M+  G+ P+   Y +++   CK G+ ++A + L E++ 
Sbjct  438   TALISGLCQQGKPSDAEKTLRQMLSSGLKPDDAAYAMIMDGFCKQGDTKRASDLLRELQK  497

Query  1247  -FKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRM  1071
                G  P L  +N L++ YCRRG    A  + D M   G+ PD +TYN+++  H R    
Sbjct  498   DGGGRIPSLVAYNVLLNGYCRRGQMRNADMLLDAMLNLGIVPDDVTYNTMLEGHSRRNGN  557

Query  1070  REAMRLFKDIKEKVTPNEVTYTTLIDGYCRVG  975
              EA  +F++ K  V  +  +YT L++   + G
Sbjct  558   GEAASVFRNAK-GVVLDHASYTALLNSMAKGG  588



>ref|XP_009370553.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Pyrus x bretschneideri]
Length=607

 Score =   279 bits (714),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 146/468 (31%), Positives = 252/468 (54%), Gaps = 1/468 (0%)
 Frame = -2

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSD  1560
             FF W+ + P +RH++QS  +M + L  H+ +  A  +L  +  +    S + + A +   
Sbjct  104   FFDWLSSHPTFRHTVQSYCTMAHFLCAHQMYPQALSLLRLVVSRRGKDSASSVFASILET  163

Query  1559  DDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDT  1380
               +  ++ VF  L+  Y +S    DA Q F  LR    +   H C  LL+ ++K      
Sbjct  164   RGTHRSNYVFDALMNAYLDSGFVSDAFQCFRLLRKHNFRIPFHVCGCLLDKMLKLNSPVV  223

Query  1379  VWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLIS  1200
              W+ + +++  G  P ++ +NVL+H  CK G++E+      E+  +G+ P + +FNTLI+
Sbjct  224   AWENFLEILDAGFPPKVYAFNVLMHKMCKEGKIEQVQMVFDEIGKRGLRPSVVSFNTLIN  283

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTP  1023
              YC+ G   E   ++  ME     PD+ TY+ LI+  C+E R+ +A  LF ++ E+ + P
Sbjct  284   GYCKSGNLEEGFRLKRGMEESRTWPDVYTYSVLINGLCKECRLDDANLLFDEMCERGLVP  343

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N VT+TTLIDG C+ G ID A+ ++  M  +G+ P V +YN+++   C+ G +KE+ KL+
Sbjct  344   NFVTFTTLIDGQCKNGRIDLAMEIYQKMLGRGIKPDVISYNTLINGLCKVGDLKEARKLV  403

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
              +M    ++PD +T  TLI+G CK GD+ SAL+++  M+  G++ D+  + ALI G C+ 
Sbjct  404   EEMNMTGVKPDTITYTTLIDGCCKEGDLHSALEIRQGMIIQGIKLDNVAFTALISGLCRE  463

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
               T  A++++ +M+ +G  P    Y+ ++D +C + N +   KL  E     Y   +  Y
Sbjct  464   GRTLDAEKMLREMLDSGMKPDDATYTMVIDGFCKKGNVKMGFKLLKEMQSDDYVPSVVTY  523

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
              A++  LCK G++  A      M    +  D + Y  L   + K GN 
Sbjct  524   NALMNGLCKLGQMKNANMLLHAMINLGVAPDDITYNILLEGHCKHGNA  571


 Score =   125 bits (313),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/296 (26%), Positives = 145/296 (49%), Gaps = 3/296 (1%)
 Frame = -2

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VTPNE  1017
             RRG    +      +E  G       +++L++++   G + +A + F+ +++     P  
Sbjct  147   RRGKDSASSVFASILETRGTHRSNYVFDALMNAYLDSGFVSDAFQCFRLLRKHNFRIPFH  206

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
             V    L+D   ++     A      + + G  P+V  +N ++ K C+EG++++   + ++
Sbjct  207   VC-GCLLDKMLKLNSPVVAWENFLEILDAGFPPKVYAFNVLMHKMCKEGKIEQVQMVFDE  265

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             +G++ + P  V+ NTLINGYCK G++    ++K  M E+   PD +TY  LI+G CK   
Sbjct  266   IGKRGLRPSVVSFNTLINGYCKSGNLEEGFRLKRGMEESRTWPDVYTYSVLINGLCKECR  325

Query  656   TERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRA  477
              + A  +  +M   G  P++  ++ L+D  C     +  +++  +  GRG   D+  Y  
Sbjct  326   LDDANLLFDEMCERGLVPNFVTFTTLIDGQCKNGRIDLAMEIYQKMLGRGIKPDVISYNT  385

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             +I  LCK G L  A +    M    +  D++ YT+L     KEG+  +A ++   M
Sbjct  386   LINGLCKVGDLKEARKLVEEMNMTGVKPDTITYTTLIDGCCKEGDLHSALEIRQGM  441


 Score = 80.5 bits (197),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 84/163 (52%), Gaps = 2/163 (1%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A+++ + + I  IK D  A T L++ L +EG T    K  ++M+  G+ P+   Y ++I 
Sbjct  434   ALEIRQGMIIQGIKLDNVAFTALISGLCREGRTLDAEKMLREMLDSGMKPDDATYTMVID  493

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               CK G V+   + L EM+     P + T+N L++  C+ G    A  +   M   GV P
Sbjct  494   GFCKKGNVKMGFKLLKEMQSDDYVPSVVTYNALMNGLCKLGQMKNANMLLHAMINLGVAP  553

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLI  996
             D ITYN L+  HC+ G   +  +L  +  + +  +  +YT+L+
Sbjct  554   DDITYNILLEGHCKHGNAGDFEKLRSE--KGLALDYASYTSLV  594


 Score = 75.9 bits (185),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 96/216 (44%), Gaps = 0/216 (0%)
 Frame = -2

Query  947  SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
            S +E +G       +++++  + + G + ++ +    + +         C  L++   K+
Sbjct  159  SILETRGTHRSNYVFDALMNAYLDSGFVSDAFQCFRLLRKHNFRIPFHVCGCLLDKMLKL  218

Query  767  GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
               V A +   ++L+AG  P  + +  L+H  CK    E+ + V  ++   G  PS  ++
Sbjct  219  NSPVVAWENFLEILDAGFPPKVYAFNVLMHKMCKEGKIEQVQMVFDEIGKRGLRPSVVSF  278

Query  587  SWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQE  408
            + L++ YC   N E   +L           D+  Y  +I  LCK  +LD A   F  M E
Sbjct  279  NTLINGYCKSGNLEEGFRLKRGMEESRTWPDVYTYSVLINGLCKECRLDDANLLFDEMCE  338

Query  407  REILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
            R ++ + V +T+L     K G    A +++ +M  R
Sbjct  339  RGLVPNFVTFTTLIDGQCKNGRIDLAMEIYQKMLGR  374


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 69/173 (40%), Gaps = 0/173 (0%)
 Frame = -2

Query  809  NVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF  630
            N   + L+N Y   G +  A +    + +   R        L+    K      A E   
Sbjct  170  NYVFDALMNAYLDSGFVSDAFQCFRLLRKHNFRIPFHVCGCLLDKMLKLNSPVVAWENFL  229

Query  629  DMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRG  450
            +++ AGF P   A++ L+   C +   E +  + DE   RG    +  +  +I   CK G
Sbjct  230  EILDAGFPPKVYAFNVLMHKMCKEGKIEQVQMVFDEIGKRGLRPSVVSFNTLINGYCKSG  289

Query  449  KLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
             L+   R    M+E     D   Y+ L     KE     A+ LFDEM +R L+
Sbjct  290  NLEEGFRLKRGMEESRTWPDVYTYSVLINGLCKECRLDDANLLFDEMCERGLV  342



>ref|XP_006854103.1| hypothetical protein AMTR_s00048p00141020 [Amborella trichopoda]
 gb|ERN15570.1| hypothetical protein AMTR_s00048p00141020 [Amborella trichopoda]
Length=609

 Score =   277 bits (709),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 149/461 (32%), Positives = 241/461 (52%), Gaps = 1/461 (0%)
 Frame = -2

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANS  1500
             M++IL K +    A+  + ++  K  +S   ++ AL+ + D  D N  VF  L+  Y  +
Sbjct  1     MVHILVKSRRLSDAQAFILRMVRKKGVSRLEIVQALLGTYDYCDSNKLVFDLLIKTYVQA  60

Query  1499  KRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIY  1320
             KR  +A +VF+ L    + P  HAC  LL  LVK    D  W+ Y ++I+  +  N++  
Sbjct  61    KRLREATEVFKLLEKNGLLPSIHACNCLLGGLVKVAWVDLTWQIYHEVIRNKIPVNMYTL  120

Query  1319  NVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMER  1140
             N+++++ CK  ++E A  F +EME  G  PD+ T NTLI LYCR G+  EA  + + M  
Sbjct  121   NIMMNSLCKERKIEPAKSFYTEMENMGFAPDVVTHNTLIDLYCREGLLEEAFGILNSMPV  180

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G+ P I+TYNS+I+  CR G   +++ +  ++ +  + PN  TY  +I G  ++G+  E
Sbjct  181   KGLRPGIVTYNSVINGLCRRGDYSKSIEIMDEMHRVGLVPNTSTYNIMISGSAKMGNSVE  240

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
             A R +  M+ KGL P + T+  ++   C EG    +   L  M    + PDNV    +IN
Sbjct  241   ATRNYEKMKSKGLLPDIVTFTLLIGLSCREGNPDIALGYLGDMKNTGLAPDNVVYTMVIN  300

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
              +C+ G    AL+++++M E G  PD  TY  +++G CK      A ++  +M   G  P
Sbjct  301   AFCRAGRTTEALRLRDEMAERGSLPDVVTYNTILNGLCKEGRLSDADDLFKEMAERGLVP  360

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
              Y  ++ L+D YC   + E    L DE   R    DI  Y  +I   CK G ++ A   +
Sbjct  361   DYVTFTTLIDGYCRDGSIEKAQDLFDEMRDRNLKPDIVTYNTLIDGFCKEGDMEKARDLW  420

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
             G M  R IL + V Y+++   +  +GN   A  L+DEM ++
Sbjct  421   GDMINRGILPNLVTYSTMIDGFCSKGNMMQAVGLWDEMVEK  461


 Score =   248 bits (632),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/396 (31%), Positives = 226/396 (57%), Gaps = 1/396 (0%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             +I++ + +    + P+     ++++   K G +    + Y+KM   G+LP+I  + +LI 
Sbjct  206   SIEIMDEMHRVGLVPNTSTYNIMISGSAKMGNSVEATRNYEKMKSKGLLPDIVTFTLLIG  265

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               C+ G  + A  +L +M+  G+ PD   +  +I+ +CR G   EAL ++D M   G  P
Sbjct  266   LSCREGNPDIALGYLGDMKNTGLAPDNVVYTMVINAFCRAGRTTEALRLRDEMAERGSLP  325

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D++TYN++++  C+EGR+ +A  LFK++ E+ + P+ VT+TTLIDGYCR G I++A  L 
Sbjct  326   DVVTYNTILNGLCKEGRLSDADDLFKEMAERGLVPDYVTFTTLIDGYCRDGSIEKAQDLF  385

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
               M ++ L P + TYN+++  FC+EG M+++  L   M  + I P+ VT +T+I+G+C  
Sbjct  386   DEMRDRNLKPDIVTYNTLIDGFCKEGDMEKARDLWGDMINRGILPNLVTYSTMIDGFCSK  445

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
             G+++ A+ + ++M+E G+ P+  TY ++I G+C++ ++ + +E++ +M   G   +   Y
Sbjct  446   GNMMQAVGLWDEMVEKGIAPNVITYNSVIKGYCRSGNSSKGEELLAEMTGEGLVANKITY  505

Query  587   SWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQE  408
             + L+  +C +        L  +    G   D+  Y A++   C++ ++  A   F  M E
Sbjct  506   NTLIHGFCKEEKIPQAFDLVVKMENHGIRPDVVTYNALLNGFCRQERMKEANVVFQKMVE  565

Query  407   REILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
             + ++ D + YTSL   Y    N R A  L D+M ++
Sbjct  566   KGVMPDRLTYTSLMNGYVAVNNVREAFRLHDQMLQK  601


 Score =   226 bits (575),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 183/331 (55%), Gaps = 1/331 (0%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A+     ++   + PD    T+++N+  + G T    +   +M + G LP++  YN +++
Sbjct  276   ALGYLGDMKNTGLAPDNVVYTMVINAFCRAGRTTEALRLRDEMAERGSLPDVVTYNTILN  335

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               CK G +  AD+   EM  +G+ PD  TF TLI  YCR G   +A  + D M    ++P
Sbjct  336   GLCKEGRLSDADDLFKEMAERGLVPDYVTFTTLIDGYCRDGSIEKAQDLFDEMRDRNLKP  395

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             DI+TYN+LI   C+EG M +A  L+ D I   + PN VTY+T+IDG+C  G++ +A+ L 
Sbjct  396   DIVTYNTLIDGFCKEGDMEKARDLWGDMINRGILPNLVTYSTMIDGFCSKGNMMQAVGLW  455

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
               M EKG+ P V TYNS+++ +C  G   +  +LL +M  + +  + +T NTLI+G+CK 
Sbjct  456   DEMVEKGIAPNVITYNSVIKGYCRSGNSSKGEELLAEMTGEGLVANKITYNTLIHGFCKE  515

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
               I  A  +  KM   G+RPD  TY AL++GFC+ +  + A  V   M+  G  P    Y
Sbjct  516   EKIPQAFDLVVKMENHGIRPDVVTYNALLNGFCRQERMKEANVVFQKMVEKGVMPDRLTY  575

Query  587   SWLVDTYCLQNNNEALVKLADEFSGRGYCVD  495
             + L++ Y   NN     +L D+   +G+  D
Sbjct  576   TSLMNGYVAVNNVREAFRLHDQMLQKGFIPD  606


 Score =   222 bits (565),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 140/532 (26%), Positives = 251/532 (47%), Gaps = 25/532 (5%)
 Frame = -2

Query  1763  CWFWLSWSFFKWV--ETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSP  1590
              W  L+W  +  V    IP   ++L     M+  L K +  + AK    ++    F    
Sbjct  96    AWVDLTWQIYHEVIRNKIPVNMYTLNI---MMNSLCKERKIEPAKSFYTEMENMGFAPDV  152

Query  1589  AVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLN  1410
                N L+                   Y       +A  +   + +  ++P       ++N
Sbjct  153   VTHNTLID-----------------LYCREGLLEEAFGILNSMPVKGLRPGIVTYNSVIN  195

Query  1409  SLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFP  1230
              L + G      +   +M ++G++PN   YN++I    K G   +A     +M+ KG+ P
Sbjct  196   GLCRRGDYSKSIEIMDEMHRVGLVPNTSTYNIMISGSAKMGNSVEATRNYEKMKSKGLLP  255

Query  1229  DLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLF  1050
             D+ TF  LI L CR G    AL     M+  G+ PD + Y  +I++ CR GR  EA+RL 
Sbjct  256   DIVTFTLLIGLSCREGNPDIALGYLGDMKNTGLAPDNVVYTMVINAFCRAGRTTEALRLR  315

Query  1049  KDIKEKVT-PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEE  873
              ++ E+ + P+ VTY T+++G C+ G + +A  L   M E+GL P   T+ +++  +C +
Sbjct  316   DEMAERGSLPDVVTYNTILNGLCKEGRLSDADDLFKEMAERGLVPDYVTFTTLIDGYCRD  375

Query  872   GRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTY  693
             G ++++  L ++M ++ ++PD VT NTLI+G+CK GD+  A  +   M+  G+ P+  TY
Sbjct  376   GSIEKAQDLFDEMRDRNLKPDIVTYNTLIDGFCKEGDMEKARDLWGDMINRGILPNLVTY  435

Query  692   KALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSG  513
               +I GFC   +  +A  +  +M+  G +P+   Y+ ++  YC   N+    +L  E +G
Sbjct  436   STMIDGFCSKGNMMQAVGLWDEMVEKGIAPNVITYNSVIKGYCRSGNSSKGEELLAEMTG  495

Query  512   RGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRA  333
              G   +   Y  +I   CK  K+  A      M+   I  D V Y +L   + ++   + 
Sbjct  496   EGLVANKITYNTLIHGFCKEEKIPQAFDLVVKMENHGIRPDVVTYNALLNGFCRQERMKE  555

Query  332   ASDLFDEMYKRRLMVTlklykslsassKDENSLLDLF--WNNVMQRGLISHN  183
             A+ +F +M ++ +M     Y SL       N++ + F   + ++Q+G I  +
Sbjct  556   ANVVFQKMVEKGVMPDRLTYTSLMNGYVAVNNVREAFRLHDQMLQKGFIPDD  607


 Score =   185 bits (470),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/395 (28%), Positives = 197/395 (50%), Gaps = 5/395 (1%)
 Frame = -2

Query  1334  NIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQ  1155
             N  ++++LI    ++  + +A E    +E  G+ P ++  N L+    +         + 
Sbjct  46    NKLVFDLLIKTYVQAKRLREATEVFKLLEKNGLLPSIHACNCLLGGLVKVAWVDLTWQIY  105

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRV  978
               + R  +  ++ T N +++S C+E ++  A   + +++     P+ VT+ TLID YCR 
Sbjct  106   HEVIRNKIPVNMYTLNIMMNSLCKERKIEPAKSFYTEMENMGFAPDVVTHNTLIDLYCRE  165

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G ++EA  + ++M  KGL P + TYNS++   C  G   +S +++++M    + P+  T 
Sbjct  166   GLLEEAFGILNSMPVKGLRPGIVTYNSVINGLCRRGDYSKSIEIMDEMHRVGLVPNTSTY  225

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             N +I+G  K+G+ V A +   KM   GL PD  T+  LI   C+  + + A   + DM  
Sbjct  226   NIMISGSAKMGNSVEATRNYEKMKSKGLLPDIVTFTLLIGLSCREGNPDIALGYLGDMKN  285

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
              G +P    Y+ +++ +C        ++L DE + RG   D+  Y  I+  LCK G+L  
Sbjct  286   TGLAPDNVVYTMVINAFCRAGRTTEALRLRDEMAERGSLPDVVTYNTILNGLCKEGRLSD  345

Query  437   AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL---MVTlklyks  267
             A+  F  M ER ++ D V +T+L   Y ++G+   A DLFDEM  R L   +VT      
Sbjct  346   ADDLFKEMAERGLVPDYVTFTTLIDGYCRDGSIEKAQDLFDEMRDRNLKPDIVTYNTLID  405

Query  266   lsassKDENSLLDLFWNNVMQRGLISHNVHNSIFL  162
                   D     DL W +++ RG++ + V  S  +
Sbjct  406   GFCKEGDMEKARDL-WGDMINRGILPNLVTYSTMI  439



>gb|EYU42661.1| hypothetical protein MIMGU_mgv1a020055mg [Erythranthe guttata]
Length=730

 Score =   280 bits (716),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 157/485 (32%), Positives = 268/485 (55%), Gaps = 23/485 (5%)
 Frame = -2

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDF----LSSPAVLNALVRSDD---------------  1557
             M+  L+  K    A++++    C  F    LS  +VL A+VRS                 
Sbjct  164   MVKALSNMKLIDRARNIMSLARCHGFMPSVLSYNSVLEAIVRSSPRGSAELTGSVYDEMM  223

Query  1556  DSDVNSQVFSW-LLIFYANSKRTWD-AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
             D+DV+  VF++ +LI    S +  D  + +FE +      P+      L+++  K G  D
Sbjct  224   DNDVSPNVFTYNILIRGLCSNKEMDRGLVLFEKMEKKGCLPNVVTYNTLIDAYCKMGKID  283

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
               +   K M +  + PN+  YNV+I+  C+ G +E+  +   EM+ +G+ P+  T+NTLI
Sbjct  284   EAYALLKLMWEKNMEPNVITYNVIINGLCREGRMEETKKVFEEMKEQGLSPNEITYNTLI  343

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VT  1026
             + YC+ G  ++AL +   M R G+ P+++TY SLI+S C+   +R A+  F+ ++ + ++
Sbjct  344   NGYCKEGNFHQALVLHGEMVRNGLSPNVVTYTSLINSMCKSKNLRRAVEFFEQMQVRGLS  403

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             PN+ TYTTLIDG+ + G +DEA RL S M  KGL P + TYN+++   C  GR+ +  +L
Sbjct  404   PNDKTYTTLIDGFSQQGFMDEAYRLLSEMTNKGLLPSIVTYNALINGHCVSGRINDGLEL  463

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             +  M  +   PD V+ +T+I+G+C+  D+  A ++K +M E G+ PD+ TY +LI G C 
Sbjct  464   IKTMTAEGFCPDVVSYSTIISGFCRNFDLDKAFQMKREMGEKGIFPDAITYSSLIQGLCA  523

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              +    A E+  +M+  G  P  C Y+ L++ YC +++  + ++L DE   +G+  D+  
Sbjct  524   QRRLTEACELFKEMLKLGLQPDNCTYTILINAYCGEDDIGSAIRLHDEMIEKGFFPDVVT  583

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMY  306
             Y  +I+  C +G ++ A+R F  M E+       VY  L + + K+GN + A DL+ EM 
Sbjct  584   Y-TLIKGFCMKGLMNEADRVFQAMLEKNQKPSEAVYNVLIHGHCKDGNLQKAVDLYREMM  642

Query  305   KRRLM  291
             +R L+
Sbjct  643   QRELV  647


 Score =   201 bits (512),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/380 (33%), Positives = 184/380 (48%), Gaps = 39/380 (10%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR---RGMHYEALSVQ  1155
             ++++++ A      +++A   +S     G  P + ++N+++    R   RG      SV 
Sbjct  160   VFDLMVKALSNMKLIDRARNIMSLARCHGFMPSVLSYNSVLEAIVRSSPRGSAELTGSVY  219

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRV  978
             D M    V P++ TYN LI   C    M   + LF+ +++K   PN VTY TLID YC++
Sbjct  220   DEMMDNDVSPNVFTYNILIRGLCSNKEMDRGLVLFEKMEKKGCLPNVVTYNTLIDAYCKM  279

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G IDEA  L   M EK + P V TYN I+   C EGRM+E+ K+  +M E+ + P+ +T 
Sbjct  280   GKIDEAYALLKLMWEKNMEPNVITYNVIINGLCREGRMEETKKVFEEMKEQGLSPNEITY  339

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             NTLINGYCK G+   AL +  +M+  GL P+  TY +LI+  CK+K+  RA E    M  
Sbjct  340   NTLINGYCKEGNFHQALVLHGEMVRNGLSPNVVTYTSLINSMCKSKNLRRAVEFFEQMQV  399

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEF---------------------SGR---  510
              G SP+   Y+ L+D +  Q   +   +L  E                      SGR   
Sbjct  400   RGLSPNDKTYTTLIDGFSQQGFMDEAYRLLSEMTNKGLLPSIVTYNALINGHCVSGRIND  459

Query  509   -----------GYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAY  363
                        G+C D+  Y  II   C+   LD A +    M E+ I  D++ Y+SL  
Sbjct  460   GLELIKTMTAEGFCPDVVSYSTIISGFCRNFDLDKAFQMKREMGEKGIFPDAITYSSLIQ  519

Query  362   AYFKEGNTRAASDLFDEMYK  303
                 +     A +LF EM K
Sbjct  520   GLCAQRRLTEACELFKEMLK  539


 Score =   134 bits (336),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 163/351 (46%), Gaps = 37/351 (11%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   ++ L+     SK    A++ FE +++  + P+    T L++   ++G  D  ++  
Sbjct  370   NVVTYTSLINSMCKSKNLRRAVEFFEQMQVRGLSPNDKTYTTLIDGFSQQGFMDEAYRLL  429

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEV--------------------------------  1281
              +M   G+LP+I  YN LI+  C SG +                                
Sbjct  430   SEMTNKGLLPSIVTYNALINGHCVSGRINDGLELIKTMTAEGFCPDVVSYSTIISGFCRN  489

Query  1280  ---EKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
                +KA +   EM  KGIFPD  T+++LI   C +    EA  +   M + G++PD  TY
Sbjct  490   FDLDKAFQMKREMGEKGIFPDAITYSSLIQGLCAQRRLTEACELFKEMLKLGLQPDNCTY  549

Query  1109  NSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEE  933
               LI+++C E  +  A+RL  ++ EK   P+ VTY TLI G+C  G ++EA R+  AM E
Sbjct  550   TILINAYCGEDDIGSAIRLHDEMIEKGFFPDVVTY-TLIKGFCMKGLMNEADRVFQAMLE  608

Query  932   KGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVS  753
             K   P  A YN ++   C++G ++++  L  +M ++++ P  +T   +     K+G    
Sbjct  609   KNQKPSEAVYNVLIHGHCKDGNLQKAVDLYREMMQRELVPHAITVIAITKELHKVGMTEE  668

Query  752   ALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
              +++    L +    D    K L+    K  + +    ++ +M   GF P+
Sbjct  669   LMQILQDTLRSCKVVDGDPAKVLLEVNYKDGNMDAVFNILAEMGKDGFLPN  719



>ref|XP_008457121.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Cucumis melo]
Length=590

 Score =   276 bits (707),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 153/504 (30%), Positives = 262/504 (52%), Gaps = 7/504 (1%)
 Frame = -2

Query  1796  IINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQI  1617
             +INH   +LSP   +   SFF W+ ++P +RH+ QS  +M   L+ H+ F+  + ++  +
Sbjct  71    LINHNPFSLSPLSLF---SFFNWLSSMPTFRHTSQSYCAMANFLSAHQMFEECQSIIRFL  127

Query  1616  ACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPD  1437
               +    S A + A +     +  ++ VF  L+I Y +S    DAIQ F  +R    +  
Sbjct  128   VSRKGKDSAASVFAAILDIAGTRCSNFVFDALMIAYWDSGFVSDAIQCFRLVRKSNFQIP  187

Query  1436  PHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLS  1257
              H C  LL+ ++      T+W  Y +++  G  PN+  +N+LI+  CK G    A     
Sbjct  188   FHGCGYLLDKMMNSNSPVTIWTFYSEILDSGFPPNVKYFNILINKFCKEGSTRDAKLIFD  247

Query  1256  EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREG  1077
             E+   G+ P   +FNTLI+  C+     E   ++  ME   + PD+ TY+ LIH  C+EG
Sbjct  248   EIRKWGLRPTTVSFNTLINGLCKSRNLDEGFRLKKIMEENRIYPDVFTYSVLIHRLCKEG  307

Query  1076  RMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYN  900
             R+  A +LF +++++ + PN VT+T LIDG C+   ID A+  +  M   G+ P +  YN
Sbjct  308   RLDNAEQLFDEMQKRGLRPNGVTFTALIDGQCKRRQIDSAMNTYHQMLTMGVKPDLVMYN  367

Query  899   SILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEA  720
             ++L   C+ G + ++ KL+++M    ++PD ++  TLI+GYCK GD+ SAL+++  M E 
Sbjct  368   TLLYGLCKVGDVNKARKLIDEMRMVGMKPDKISYTTLIDGYCKEGDLESALEIRKGMNEE  427

Query  719   GLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEAL  540
             G+  D+  + ALI GFC+      A+  + +M+ AG  P    Y+ ++D YC + + +  
Sbjct  428   GVVLDNVAFTALISGFCRDGRVRDAERTLREMMEAGMKPDDATYTMVIDGYCKKGDVKTG  487

Query  539   VKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYA  360
              K+  E    G+   +  Y  ++  LCK+G++  A      M    +  D + Y  L   
Sbjct  488   FKMLKEMQINGHKPGVITYNVLMNGLCKQGQMKNAHMLLEAMLNLGVTPDDITYNILLEG  547

Query  359   YFKEGNTRAASDLFDEMYKRRLMV  288
             + K G    A DL     ++ L++
Sbjct  548   HCKNGK---AEDLLKLRNEKGLII  568



>ref|XP_002263590.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Vitis vinifera]
 emb|CBI33459.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   276 bits (706),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 152/504 (30%), Positives = 271/504 (54%), Gaps = 8/504 (2%)
 Frame = -2

Query  1796  IINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQI  1617
             +IN    +LSP       SFFKW+ T  ++R S+ S  +M + L  HK    A+ +L  +
Sbjct  73    LINLNPHSLSPPSLL---SFFKWLSTQHHFRLSIHSYCTMTHFLCTHKMLSEAQSLLQFV  129

Query  1616  ACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPD  1437
               +   +S + +   V     +  ++ VFS L+  Y +S    DAIQ F  +R   ++  
Sbjct  130   VSRKGKNSASSVFTSVLEARGTHQSNLVFSVLMNAYTDSGYFSDAIQCFRLVRKHNLQIP  189

Query  1436  PHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLS  1257
              H+C  L + L+K  LT   W  Y++++  G  P++  +NVL+H  CK  ++ +A     
Sbjct  190   FHSCGYLFDRLMKLNLTSPAWAFYEEILDCGYPPDVCKFNVLMHRLCKEHKINEAQLLFG  249

Query  1256  EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREG  1077
             E+  +G+ P + +FNTLI+ YC+ G   +   ++  M    V PD+ TY+ LI+  C+EG
Sbjct  250   EIGKRGLRPTVVSFNTLINGYCKSGNLDQGFRLKRFMMENRVFPDVFTYSVLINGLCKEG  309

Query  1076  RMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYN  900
             ++ +A +LF ++ ++ + PN+VT+TTLI+G+C  G  D  + ++  M  KG+ P V TYN
Sbjct  310   QLDDANKLFLEMCDRGLVPNDVTFTTLINGHCVTGRADLGMEIYQQMLRKGVKPDVITYN  369

Query  899   SILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEA  720
             +++   C+ G ++E+ KL+ +M ++ ++PD  T   LI+G CK GD+ SAL+++ +M++ 
Sbjct  370   TLINGLCKVGDLREAKKLVIEMTQRGLKPDKFTYTMLIDGCCKEGDLESALEIRKEMVKE  429

Query  719   GLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEAL  540
             G+  D+  + ALI GFC+      A+  + +M+ AG  P    Y+ ++  +C + + +  
Sbjct  430   GIELDNVAFTALISGFCREGQVIEAERTLREMLEAGIKPDDATYTMVIHGFCKKGDVKTG  489

Query  539   VKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYA  360
              KL  E    G+   +  Y  ++  LCK+G++  A      M    ++ D + Y  L   
Sbjct  490   FKLLKEMQCDGHVPGVVTYNVLLNGLCKQGQMKNANMLLDAMLNLGVVPDDITYNILLEG  549

Query  359   YFKEGNTRAASDLFDEMYKRRLMV  288
             + K GN       FD++   + +V
Sbjct  550   HCKHGNRED----FDKLQSEKGLV  569


 Score =   200 bits (508),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 187/335 (56%), Gaps = 7/335 (2%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             ++P   +   L+N   K G  D  ++  + M++  V P++  Y+VLI+  CK G+++ A+
Sbjct  256   LRPTVVSFNTLINGYCKSGNLDQGFRLKRFMMENRVFPDVFTYSVLINGLCKEGQLDDAN  315

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             +   EM  +G+ P+  TF TLI+ +C  G     + +  +M R GV+PD+ITYN+LI+  
Sbjct  316   KLFLEMCDRGLVPNDVTFTTLINGHCVTGRADLGMEIYQQMLRKGVKPDVITYNTLINGL  375

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C+ G +REA +L  ++ ++ + P++ TYT LIDG C+ GD++ AL +   M ++G+    
Sbjct  376   CKVGDLREAKKLVIEMTQRGLKPDKFTYTMLIDGCCKEGDLESALEIRKEMVKEGIELDN  435

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
               + +++  FC EG++ E+ + L +M E  I+PD+ T   +I+G+CK GD+ +  K+  +
Sbjct  436   VAFTALISGFCREGQVIEAERTLREMLEAGIKPDDATYTMVIHGFCKKGDVKTGFKLLKE  495

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M   G  P   TY  L++G CK    + A  ++  M+  G  P    Y+ L++ +C   N
Sbjct  496   MQCDGHVPGVVTYNVLLNGLCKQGQMKNANMLLDAMLNLGVVPDDITYNILLEGHCKHGN  555

Query  551   NEALVKLADEFSGRGYCVDISFYRAII---RRLCK  456
              E   KL  E   +G   D   Y ++I   R+ CK
Sbjct  556   REDFDKLQSE---KGLVQDYGSYTSLIGDLRKTCK  587



>ref|XP_008362531.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Malus domestica]
Length=609

 Score =   276 bits (706),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/466 (31%), Positives = 252/466 (54%), Gaps = 1/466 (0%)
 Frame = -2

Query  1736  FKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDD  1557
             F W+ + P +RH++QS  +M + L  H+ +  A  +L  +  +    S + + A +    
Sbjct  107   FDWLXSHPTFRHTVQSYCTMAHFLCXHQMYPQALSLLRLVVSRRGKDSASSVFASILETR  166

Query  1556  DSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTV  1377
              +  ++ VF  L+  Y +S    DA Q F  +R    +   H C  LL+ ++K       
Sbjct  167   GTHQSNYVFDXLMNAYLDSGFVSDAFQCFRLIRKNNFRIPFHVCGCLLDKMLKLNSPVXA  226

Query  1376  WKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL  1197
             W+ + +++  G  P ++ +NVL+H  CK  ++E+A     E+  +G+ P + +FNTLI+ 
Sbjct  227   WEYFMEILDAGFPPXVYAFNVLMHKMCKEAKIEQAQMVFDEIGKRGLRPSVVSFNTLING  286

Query  1196  YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPN  1020
             YC+ G   E   ++  ME     PD+ TY+ LI+  C+E R+ +A  LF ++ E+ + PN
Sbjct  287   YCKSGNLEEGFRLKRDMEESRTWPDVYTYSVLINGLCKECRLDDANYLFDEMCERGLVPN  346

Query  1019  EVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLN  840
              VT+TTLIDG C+ G ID A+ ++  M  +G+ P V TYN+++   C++G ++E+ KL+ 
Sbjct  347   FVTFTTLIDGQCKNGRIDLAMEIYQKMLGRGIKPDVITYNTLINGLCKDGDLREARKLVE  406

Query  839   QMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAK  660
             +M    ++PD +T  TLI+G CK GD+ SAL+++  M+  G++ D+  + ALI G C+  
Sbjct  407   EMNMTGVKPDTITYTTLIDGCCKEGDLHSALEIRQGMIIQGIKLDNVAFTALISGLCREG  466

Query  659   DTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYR  480
              T  A++++ +M+ +G  P    Y+ ++D +C + N +   KL  E     Y   +  Y 
Sbjct  467   RTLDAEKMLREMLDSGMKPDDATYTMVIDGFCKKGNVKMGFKLLKEMQSDDYVPSVVTYN  526

Query  479   AIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGN  342
             A++  LCK G++  A      M    +  D + Y  L   + K GN
Sbjct  527   ALMNGLCKLGQMKNANMLLHAMINLGVAPDDITYNILLEGHCKHGN  572


 Score =   196 bits (497),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 190/364 (52%), Gaps = 4/364 (1%)
 Frame = -2

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
              F+ L+       +   A  VF+ +    ++P   +   L+N   K G  +  ++  + M
Sbjct  244   AFNVLMHKMCKEAKIEQAQMVFDEIGKRGLRPSVVSFNTLINGYCKSGNLEEGFRLKRDM  303

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              +    P+++ Y+VLI+  CK   ++ A+    EM  +G+ P+  TF TLI   C+ G  
Sbjct  304   EESRTWPDVYTYSVLINGLCKECRLDDANYLFDEMCERGLVPNFVTFTTLIDGQCKNGRI  363

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTYTTL  999
               A+ +  +M   G++PD+ITYN+LI+  C++G +REA +L +++    V P+ +TYTTL
Sbjct  364   DLAMEIYQKMLGRGIKPDVITYNTLINGLCKDGDLREARKLVEEMNMTGVKPDTITYTTL  423

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDG C+ GD+  AL +   M  +G+      + +++   C EGR  ++ K+L +M +  +
Sbjct  424   IDGCCKEGDLHSALEIRQGMIIQGIKLDNVAFTALISGLCREGRTLDAEKMLREMLDSGM  483

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             +PD+ T   +I+G+CK G++    K+  +M      P   TY AL++G CK    + A  
Sbjct  484   KPDDATYTMVIDGFCKKGNVKMGFKLLKEMQSDDYVPSVVTYNALMNGLCKLGQMKNANM  543

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++  MI  G +P    Y+ L++ +C   N E   KL  E   +G  +D + Y +++    
Sbjct  544   LLHAMINLGVAPDDITYNILLEGHCKHGNPEDFEKLRSE---KGLALDYASYTSLVSEFX  600

Query  458   KRGK  447
             K  K
Sbjct  601   KSSK  604


 Score = 79.7 bits (195),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 97/216 (45%), Gaps = 0/216 (0%)
 Frame = -2

Query  947  SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
            S +E +G       ++ ++  + + G + ++ +    + +         C  L++   K+
Sbjct  161  SILETRGTHQSNYVFDXLMNAYLDSGFVSDAFQCFRLIRKNNFRIPFHVCGCLLDKMLKL  220

Query  767  GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
               V A +   ++L+AG  P  + +  L+H  CK    E+A+ V  ++   G  PS  ++
Sbjct  221  NSPVXAWEYFMEILDAGFPPXVYAFNVLMHKMCKEAKIEQAQMVFDEIGKRGLRPSVVSF  280

Query  587  SWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQE  408
            + L++ YC   N E   +L  +        D+  Y  +I  LCK  +LD A   F  M E
Sbjct  281  NTLINGYCKSGNLEEGFRLKRDMEESRTWPDVYTYSVLINGLCKECRLDDANYLFDEMCE  340

Query  407  REILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
            R ++ + V +T+L     K G    A +++ +M  R
Sbjct  341  RGLVPNFVTFTTLIDGQCKNGRIDLAMEIYQKMLGR  376


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/194 (24%), Positives = 75/194 (39%), Gaps = 0/194 (0%)
 Frame = -2

Query  872  GRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTY  693
            G+   S+   + +  +     N   + L+N Y   G +  A +    + +   R      
Sbjct  151  GKDSASSVFASILETRGTHQSNYVFDXLMNAYLDSGFVSDAFQCFRLIRKNNFRIPFHVC  210

Query  692  KALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSG  513
              L+    K      A E   +++ AGF P   A++ L+   C +   E    + DE   
Sbjct  211  GCLLDKMLKLNSPVXAWEYFMEILDAGFPPXVYAFNVLMHKMCKEAKIEQAQMVFDEIGK  270

Query  512  RGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRA  333
            RG    +  +  +I   CK G L+   R    M+E     D   Y+ L     KE     
Sbjct  271  RGLRPSVVSFNTLINGYCKSGNLEEGFRLKRDMEESRTWPDVYTYSVLINGLCKECRLDD  330

Query  332  ASDLFDEMYKRRLM  291
            A+ LFDEM +R L+
Sbjct  331  ANYLFDEMCERGLV  344



>ref|XP_004140820.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Cucumis sativus]
Length=590

 Score =   275 bits (704),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/482 (31%), Positives = 253/482 (52%), Gaps = 4/482 (1%)
 Frame = -2

Query  1730  WVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDS  1551
             W+ +IP +RH+ QS  +M   L+ H+ F+  + ++  +  +    S A + A +     +
Sbjct  90    WLSSIPTFRHTSQSYCAMANFLSAHQMFQECQSIIRFLVSRKGKDSAASVFAAILDTAGT  149

Query  1550  DVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWK  1371
               ++ VF  L+I Y +S    DAIQ F  +R    +   H C  LL+ ++      T+W 
Sbjct  150   RCSNFVFDALMIAYWDSGFVSDAIQCFRLVRNSNFQIPFHGCGYLLDKMINSNSPVTIWT  209

Query  1370  TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYC  1191
              Y ++++ G  P +  YN+LI+  CK G +  A    +E+  +G+ P   +FNTLI+  C
Sbjct  210   FYSEILEYGFPPKVQYYNILINKFCKEGSIRDAKLIFNEIRKRGLRPTTVSFNTLINGLC  269

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEV  1014
             +     E   ++  ME   + PD+ TY+ LIH  C+EGR+  A +LF +++++ + PN +
Sbjct  270   KSRNLDEGFRLKKTMEENRIYPDVFTYSVLIHGLCKEGRLDVAEQLFDEMQQRGLRPNGI  329

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             T+T LIDG CR   ID A+  +  M   G+ P +  YN++L   C+ G + ++ KL+++M
Sbjct  330   TFTALIDGQCRSRRIDSAMNTYHQMLTMGVKPDLVMYNTLLNGLCKVGDVNKARKLVDEM  389

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
                 ++PD +T  TLI+GYCK GD+ SA++++  M E G+  D+  + ALI GFC+    
Sbjct  390   RMVGMKPDKITYTTLIDGYCKEGDLESAMEIRKGMNEEGVVLDNVAFTALISGFCRDGRV  449

Query  653   ERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAI  474
               A+  + +M+ AG  P    Y+ ++D YC + N +   KL  E    G+   +  Y  +
Sbjct  450   RDAERTLREMVEAGMKPDDATYTMVIDGYCKKGNVKMGFKLLKEMQINGHKPGVITYNVL  509

Query  473   IRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             +  LCK+G++  A      M    +  D + Y  L   + K G    A DL     ++ L
Sbjct  510   MNGLCKQGQMKNANMLLEAMLNLGVTPDDITYNILLEGHCKNGK---AEDLLKLRNEKGL  566

Query  293   MV  288
             +V
Sbjct  567   IV  568



>ref|XP_003518371.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Glycine max]
Length=615

 Score =   276 bits (705),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 270/515 (52%), Gaps = 11/515 (2%)
 Frame = -2

Query  1853  KGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLS--WSFFKWVETIPNYRHSLQSSWS  1680
             KG+  N    +I  S+T   ++  L+TL+P     S   SFF  + + P +RH+L S  +
Sbjct  66    KGYSENPRLKRILPSLTPRHVSK-LITLNPLCLPPSSLLSFFNHLASRPPFRHTLHSYCT  124

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDFLSSPA-----VLNALVRSDDDSDVNSQVFSWLLI  1515
             M++ L  H+    A  ++  +  +   +S +     +L  + R          VF  L+ 
Sbjct  125   MLHFLCLHRMLPQAHSLVSFLVSRKGTNSASTLFSSILRTMPRHHHHHHSVGLVFDALIS  184

Query  1514  FYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDT--VWKTYKKMIKLGV  1341
              Y +S  T DA+Q F  +   +       C  LL  +V+    +    W  Y +++  G 
Sbjct  185   AYVDSGFTPDAVQCFRLVTKNKFPVPIRGCENLLRRVVRLRPVEIERSWALYLEVLDSGY  244

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS  1161
              P I+ +NVL+H  CK+G+V  A     E+  +G+ P + +FNTLIS  C+ G   E   
Sbjct  245   PPKIYFFNVLMHGFCKAGDVGNARLVFDEIPKRGLRPTVVSFNTLISGCCKSGDVEEGFR  304

Query  1160  VQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYC  984
             ++  ME  GV PD+ T+++LI+  C+EGR+ E   LF ++    + PN VT+TTLIDG C
Sbjct  305   LKGVMESEGVCPDVFTFSALINGLCKEGRLDEGSLLFDEMCGRGLVPNGVTFTTLIDGQC  364

Query  983   RVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNV  804
             + G +D AL+    M  +G+ P + TYN+++   C+ G +KE+ +L+N+M    ++PD +
Sbjct  365   KGGKVDLALKNFQMMLAQGVRPDLVTYNALINGLCKVGDLKEARRLVNEMTASGLKPDKI  424

Query  803   TCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDM  624
             T  TLI+G CK GD+ SAL++K +M+E G+  D   + ALI G C+      A  ++ DM
Sbjct  425   TFTTLIDGCCKDGDMESALEIKRRMVEEGIELDDVAFTALISGLCREGRVHDAGRMLTDM  484

Query  623   IAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKL  444
             ++AGF P    Y+ ++D +C + + +   KL  E    G+   +  Y A++  LCK+G++
Sbjct  485   LSAGFKPDDPTYTMVIDCFCKKGDVKMGFKLLKEMQSDGHVPGVVTYNALMNGLCKQGQM  544

Query  443   DCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
               A+     M    +  + + Y  L   + K G++
Sbjct  545   KNAKMLLDAMLNVGVAPNDITYNILLDGHSKHGSS  579


 Score =   180 bits (457),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 149/277 (54%), Gaps = 1/277 (0%)
 Frame = -2

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P I  +N L+H  C+ G +  A  +F +I K  + P  V++ TLI G C+ GD++E 
Sbjct  243   GYPPKIYFFNVLMHGFCKAGDVGNARLVFDEIPKRGLRPTVVSFNTLISGCCKSGDVEEG  302

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              RL   ME +G+CP V T+++++   C+EGR+ E + L ++M  + + P+ VT  TLI+G
Sbjct  303   FRLKGVMESEGVCPDVFTFSALINGLCKEGRLDEGSLLFDEMCGRGLVPNGVTFTTLIDG  362

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
              CK G +  ALK    ML  G+RPD  TY ALI+G CK  D + A+ ++ +M A+G  P 
Sbjct  363   QCKGGKVDLALKNFQMMLAQGVRPDLVTYNALINGLCKVGDLKEARRLVNEMTASGLKPD  422

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                ++ L+D  C   + E+ +++       G  +D   + A+I  LC+ G++  A R   
Sbjct  423   KITFTTLIDGCCKDGDMESALEIKRRMVEEGIELDDVAFTALISGLCREGRVHDAGRMLT  482

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              M       D   YT +   + K+G+ +    L  EM
Sbjct  483   DMLSAGFKPDDPTYTMVIDCFCKKGDVKMGFKLLKEM  519


 Score =   165 bits (417),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/286 (33%), Positives = 154/286 (54%), Gaps = 4/286 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+       R  +   +F+ +    + P+    T L++   K G  D   K ++ M+
Sbjct  321   FSALINGLCKEGRLDEGSLLFDEMCGRGLVPNGVTFTTLIDGQCKGGKVDLALKNFQMML  380

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               GV P++  YN LI+  CK G++++A   ++EM   G+ PD  TF TLI   C+ G   
Sbjct  381   AQGVRPDLVTYNALINGLCKVGDLKEARRLVNEMTASGLKPDKITFTTLIDGCCKDGDME  440

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              AL ++ RM   G+E D + + +LI   CREGR+ +A R+  D +     P++ TYT +I
Sbjct  441   SALEIKRRMVEEGIELDDVAFTALISGLCREGRVHDAGRMLTDMLSAGFKPDDPTYTMVI  500

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             D +C+ GD+    +L   M+  G  P V TYN+++   C++G+MK +  LL+ M    + 
Sbjct  501   DCFCKKGDVKMGFKLLKEMQSDGHVPGVVTYNALMNGLCKQGQMKNAKMLLDAMLNVGVA  560

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIH  678
             P+++T N L++G+ K G   S++ V     E GL  D  +Y AL++
Sbjct  561   PNDITYNILLDGHSKHG---SSVDVDIFNSEKGLVTDYASYTALVN  603



>ref|XP_006828912.1| hypothetical protein AMTR_s00001p00203780 [Amborella trichopoda]
 gb|ERM96328.1| hypothetical protein AMTR_s00001p00203780 [Amborella trichopoda]
Length=583

 Score =   274 bits (701),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/466 (31%), Positives = 255/466 (55%), Gaps = 8/466 (2%)
 Frame = -2

Query  1742  SFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIAC-KDFLSSPAVLNALVR  1566
             SFFKWV     +RH++QS  +M + L+ H+    A  +L  +   K   S+ +V NAL+ 
Sbjct  72    SFFKWVAAQKGFRHTIQSYCAMTHFLSLHRMVPEALSLLKTVVSRKGRDSASSVFNALLE  131

Query  1565  SDD------DSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSL  1404
             +        D    S  F  L+  Y +S    DAIQ    ++    K    AC  L++ +
Sbjct  132   TQGEDVQCHDQRSRSTSFELLMNVYIDSGFISDAIQCLRLVKKHGFKLPFQACNYLMDCI  191

Query  1403  VKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDL  1224
             +K       W  Y +++  G  PN++ +N+++H+  + G++++A     E+  +G+ P +
Sbjct  192   MKSNTPAAAWAFYSEILDYGFPPNVYTFNMIMHSFSRIGKIKEAQLLFREIGNRGLTPSV  251

Query  1223  YTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD  1044
              +FNTLI+  C++G      S++  M   G+ PD++TY+ LI+  CRE ++ +A  LF +
Sbjct  252   VSFNTLINGLCKKGDLEGGFSLKRLMVEEGIAPDVVTYSVLINGLCRERKIEQACDLFDE  311

Query  1043  IKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGR  867
             + E+ + PN +T+TTLIDGYC+ G+I++ L+++  M +KGL P + TYNS++   C+ G 
Sbjct  312   MNERGLVPNSITFTTLIDGYCKEGNIEKGLQIYQKMMKKGLKPDLVTYNSLIYGHCKVGE  371

Query  866   MKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKA  687
             +KE+ +L  ++ +  + PD +T  TLI+G+CK GDI +A++++ +M++ G+  D+  Y A
Sbjct  372   LKEARELFFEIRKMGLRPDKITYTTLIDGFCKEGDIKAAMEIRREMVKEGIELDNVAYTA  431

Query  686   LIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRG  507
             LI G  +      A++ + +M+  G +P    Y+ ++D YC + +     KL +E    G
Sbjct  432   LIAGLSREGWIPDAQKALREMLREGLTPDVATYTMVIDGYCRRGDVMMGFKLLEEMKING  491

Query  506   YCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSL  369
                 +  Y  ++  LCK+G++  A      M    I  D V Y  L
Sbjct  492   IVPGVITYNVLMNGLCKQGQMKNAGMLLNAMLNLGIAPDDVTYNIL  537


 Score =   214 bits (544),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/387 (30%), Positives = 212/387 (55%), Gaps = 6/387 (2%)
 Frame = -2

Query  1598  SSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSK--RTWDAIQVFEHLRICRIKPDPHAC  1425
             ++PA   A      D      V+++ +I ++ S+  +  +A  +F  +    + P   + 
Sbjct  195   NTPAAAWAFYSEILDYGFPPNVYTFNMIMHSFSRIGKIKEAQLLFREIGNRGLTPSVVSF  254

Query  1424  TVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEF  1245
               L+N L K+G  +  +   + M++ G+ P++  Y+VLI+  C+  ++E+A +   EM  
Sbjct  255   NTLINGLCKKGDLEGGFSLKRLMVEEGIAPDVVTYSVLINGLCRERKIEQACDLFDEMNE  314

Query  1244  KGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMRE  1065
             +G+ P+  TF TLI  YC+ G   + L +  +M + G++PD++TYNSLI+ HC+ G ++E
Sbjct  315   RGLVPNSITFTTLIDGYCKEGNIEKGLQIYQKMMKKGLKPDLVTYNSLIYGHCKVGELKE  374

Query  1064  AMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILR  888
             A  LF +I++  + P+++TYTTLIDG+C+ GDI  A+ +   M ++G+      Y +++ 
Sbjct  375   ARELFFEIRKMGLRPDKITYTTLIDGFCKEGDIKAAMEIRREMVKEGIELDNVAYTALIA  434

Query  887   KFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRP  708
                 EG + ++ K L +M  + + PD  T   +I+GYC+ GD++   K+  +M   G+ P
Sbjct  435   GLSREGWIPDAQKALREMLREGLTPDVATYTMVIDGYCRRGDVMMGFKLLEEMKINGIVP  494

Query  707   DSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLA  528
                TY  L++G CK    + A  ++  M+  G +P    Y+ L+D  C    ++ LVKL 
Sbjct  495   GVITYNVLMNGLCKQGQMKNAGMLLNAMLNLGIAPDDVTYNILLDGRCRSEGSKELVKLR  554

Query  527   DEFSGRGYCVDISFYRAIIRRLCKRGK  447
              E   +G   D + Y ++I  + +R +
Sbjct  555   GE---KGLVSDYAAYSSLISEVGQRSR  578


 Score =   135 bits (340),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 119/217 (55%), Gaps = 0/217 (0%)
 Frame = -2

Query  953  LHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYC  774
             +S + + G  P V T+N I+  F   G++KE+  L  ++G + + P  V+ NTLING C
Sbjct  203  FYSEILDYGFPPNVYTFNMIMHSFSRIGKIKEAQLLFREIGNRGLTPSVVSFNTLINGLC  262

Query  773  KIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYC  594
            K GD+     +K  M+E G+ PD  TY  LI+G C+ +  E+A ++  +M   G  P+  
Sbjct  263  KKGDLEGGFSLKRLMVEEGIAPDVVTYSVLINGLCRERKIEQACDLFDEMNERGLVPNSI  322

Query  593  AYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMM  414
             ++ L+D YC + N E  +++  +   +G   D+  Y ++I   CK G+L  A   F  +
Sbjct  323  TFTTLIDGYCKEGNIEKGLQIYQKMMKKGLKPDLVTYNSLIYGHCKVGELKEARELFFEI  382

Query  413  QEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
            ++  +  D + YT+L   + KEG+ +AA ++  EM K
Sbjct  383  RKMGLRPDKITYTTLIDGFCKEGDIKAAMEIRREMVK  419


 Score =   119 bits (299),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 83/310 (27%), Positives = 140/310 (45%), Gaps = 1/310 (0%)
 Frame = -2

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI  1041
             +F  L+++Y   G   +A+     +++ G +      N L+    +      A   + +I
Sbjct  148   SFELLMNVYIDSGFISDAIQCLRLVKKHGFKLPFQACNYLMDCIMKSNTPAAAWAFYSEI  207

Query  1040  KE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
              +    PN  T+  ++  + R+G I EA  L   +  +GL P V ++N+++   C++G +
Sbjct  208   LDYGFPPNVYTFNMIMHSFSRIGKIKEAQLLFREIGNRGLTPSVVSFNTLINGLCKKGDL  267

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
             +    L   M E+ I PD VT + LING C+   I  A  + ++M E GL P+S T+  L
Sbjct  268   EGGFSLKRLMVEEGIAPDVVTYSVLINGLCRERKIEQACDLFDEMNERGLVPNSITFTTL  327

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGY  504
             I G+CK  + E+  ++   M+  G  P    Y+ L+  +C     +   +L  E    G 
Sbjct  328   IDGYCKEGNIEKGLQIYQKMMKKGLKPDLVTYNSLIYGHCKVGELKEARELFFEIRKMGL  387

Query  503   CVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASD  324
               D   Y  +I   CK G +  A      M +  I  D+V YT+L     +EG    A  
Sbjct  388   RPDKITYTTLIDGFCKEGDIKAAMEIRREMVKEGIELDNVAYTALIAGLSREGWIPDAQK  447

Query  323   LFDEMYKRRL  294
                EM +  L
Sbjct  448   ALREMLREGL  457


 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/208 (22%), Positives = 99/208 (48%), Gaps = 0/208 (0%)
 Frame = -2

Query  917  RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
            R  ++  ++  + + G + ++ + L  + +   +     CN L++   K     +A    
Sbjct  145  RSTSFELLMNVYIDSGFISDAIQCLRLVKKHGFKLPFQACNYLMDCIMKSNTPAAAWAFY  204

Query  737  NKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQ  558
            +++L+ G  P+ +T+  ++H F +    + A+ +  ++   G +PS  +++ L++  C +
Sbjct  205  SEILDYGFPPNVYTFNMIMHSFSRIGKIKEAQLLFREIGNRGLTPSVVSFNTLINGLCKK  264

Query  557  NNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVY  378
             + E    L       G   D+  Y  +I  LC+  K++ A   F  M ER ++ +S+ +
Sbjct  265  GDLEGGFSLKRLMVEEGIAPDVVTYSVLINGLCRERKIEQACDLFDEMNERGLVPNSITF  324

Query  377  TSLAYAYFKEGNTRAASDLFDEMYKRRL  294
            T+L   Y KEGN      ++ +M K+ L
Sbjct  325  TTLIDGYCKEGNIEKGLQIYQKMMKKGL  352



>ref|XP_010276630.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Nelumbo nucifera]
 ref|XP_010276631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Nelumbo nucifera]
 ref|XP_010276632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Nelumbo nucifera]
 ref|XP_010276633.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Nelumbo nucifera]
 ref|XP_010276635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Nelumbo nucifera]
Length=736

 Score =   277 bits (709),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 150/487 (31%), Positives = 257/487 (53%), Gaps = 1/487 (0%)
 Frame = -2

Query  1757  FWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLN  1578
               L   F  ++ TI ++RHS  S  +MI+IL + +    A+ ++ ++  K  +S   +++
Sbjct  102   LLLGQKFIDFLATISSFRHSSYSLSAMIHILVRSRRISEAQSLVLRMVRKSGVSRAEIVD  161

Query  1577  ALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK  1398
             +L+ +  +   N  VF  L+  Y  +++  +A + F  LR        +A   LL  LVK
Sbjct  162   SLISTYPNCGSNPVVFDVLVRTYVQARKLREASEAFRILRGRGFSLSINASNCLLGGLVK  221

Query  1397  EGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYT  1218
              G  D  W  Y+ +++ G+  N++  N++I+A CK  ++E A+ FLSEME KG+FPD+ T
Sbjct  222   VGWVDMAWGIYEDIVQSGIQVNVYTLNIMINALCKEQKIEDANVFLSEMEEKGVFPDIVT  281

Query  1217  FNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-I  1041
             +NTLI+ YCR G+  EA  V + M   G+ P  +TYN++I+S C+ G+   A  +  + +
Sbjct  282   YNTLINAYCREGLLEEAFDVMNSMPAKGLRPGTVTYNAIINSVCKNGKYGRAREILGEML  341

Query  1040  KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMK  861
             +  ++P+  TY  L+   CR G   +A      M   GL P + +++ ++  F  +G ++
Sbjct  342   QSGLSPDTSTYNILLGECCRKGHTTDAEETFYEMCHHGLVPDLVSFSFLVGLFSRKGDLE  401

Query  860   ESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALI  681
              + K   QM    + PD+V    LI G+C+ GDI  ALK++++M+E G  PD  TY  ++
Sbjct  402   RALKYFKQMKGAGLVPDSVIYTMLIGGFCRNGDISDALKMRDEMVEQGCLPDVVTYNTIL  461

Query  680   HGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYC  501
             +G CK K    A E+  +M+  G  P Y +++ L+  YC     +  + L ++   R   
Sbjct  462   NGLCKEKRLSDADELFNEMVERGIFPDYYSFTTLIHGYCKDGFADKALALFEKMIERNVK  521

Query  500   VDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDL  321
              DI  Y  +I   C+ G ++ A + +  M  REIL + + Y+ L       G    A  L
Sbjct  522   PDIVTYNTLIDGFCREGDVEKANKLWDDMISREILPNHISYSILINELCSRGKVSEAFRL  581

Query  320   FDEMYKR  300
             +DEM  +
Sbjct  582   WDEMVNK  588


 Score =   232 bits (591),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 118/384 (31%), Positives = 211/384 (55%), Gaps = 1/384 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             + PD     +LL    ++G T    +T+ +M   G++P++  ++ L+    + G++E+A 
Sbjct  345   LSPDTSTYNILLGECCRKGHTTDAEETFYEMCHHGLVPDLVSFSFLVGLFSRKGDLERAL  404

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             ++  +M+  G+ PD   +  LI  +CR G   +AL ++D M   G  PD++TYN++++  
Sbjct  405   KYFKQMKGAGLVPDSVIYTMLIGGFCRNGDISDALKMRDEMVEQGCLPDVVTYNTILNGL  464

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C+E R+ +A  LF ++ E+ + P+  ++TTLI GYC+ G  D+AL L   M E+ + P +
Sbjct  465   CKEKRLSDADELFNEMVERGIFPDYYSFTTLIHGYCKDGFADKALALFEKMIERNVKPDI  524

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYN+++  FC EG ++++ KL + M  ++I P++++ + LIN  C  G +  A ++ ++
Sbjct  525   VTYNTLIDGFCREGDVEKANKLWDDMISREILPNHISYSILINELCSRGKVSEAFRLWDE  584

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M+  G+ P+  T  +LI G+C++ D  +A+E    MI  G SP    Y+ ++  +    N
Sbjct  585   MVNKGIEPNIVTCNSLIKGYCRSGDATKAEEFTNKMITKGISPDKITYNTIIHGFVKDEN  644

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
              E    L +    RG   D+  Y  ++   C  G++  A + F  M ER I  D   YTS
Sbjct  645   MERAFALLNNMENRGIIPDVVTYNVLLNGFCGEGRMQEANKIFRKMIERGIEPDRYTYTS  704

Query  371   LAYAYFKEGNTRAASDLFDEMYKR  300
             L   +  + N + A  L DEM +R
Sbjct  705   LINGHVAQDNLKEAFRLHDEMLQR  728


 Score =   231 bits (590),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 193/350 (55%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS+L+  ++       A++ F+ ++   + PD    T+L+    + G      K   +M+
Sbjct  387   FSFLVGLFSRKGDLERALKYFKQMKGAGLVPDSVIYTMLIGGFCRNGDISDALKMRDEMV  446

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G LP++  YN +++  CK   +  ADE  +EM  +GIFPD Y+F TLI  YC+ G   
Sbjct  447   EQGCLPDVVTYNTILNGLCKEKRLSDADELFNEMVERGIFPDYYSFTTLIHGYCKDGFAD  506

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +AL++ ++M    V+PDI+TYN+LI   CREG + +A +L+ D I  ++ PN ++Y+ LI
Sbjct  507   KALALFEKMIERNVKPDIVTYNTLIDGFCREGDVEKANKLWDDMISREILPNHISYSILI  566

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +  C  G + EA RL   M  KG+ P + T NS+++ +C  G   ++ +  N+M  K I 
Sbjct  567   NELCSRGKVSEAFRLWDEMVNKGIEPNIVTCNSLIKGYCRSGDATKAEEFTNKMITKGIS  626

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD +T NT+I+G+ K  ++  A  + N M   G+ PD  TY  L++GFC     + A ++
Sbjct  627   PDKITYNTIIHGFVKDENMERAFALLNNMENRGIIPDVVTYNVLLNGFCGEGRMQEANKI  686

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                MI  G  P    Y+ L++ +  Q+N +   +L DE   RG+  D  F
Sbjct  687   FRKMIERGIEPDRYTYTSLINGHVAQDNLKEAFRLHDEMLQRGFVPDDKF  736


 Score =   172 bits (436),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/407 (27%), Positives = 200/407 (49%), Gaps = 29/407 (7%)
 Frame = -2

Query  1334  NIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQ  1155
             N  +++VL+    ++ ++ +A E    +  +G    +   N L+    + G    A  + 
Sbjct  173   NPVVFDVLVRTYVQARKLREASEAFRILRGRGFSLSINASNCLLGGLVKVGWVDMAWGIY  232

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRV  978
             + + + G++ ++ T N +I++ C+E ++ +A     +++EK V P+ VTY TLI+ YCR 
Sbjct  233   EDIVQSGIQVNVYTLNIMINALCKEQKIEDANVFLSEMEEKGVFPDIVTYNTLINAYCRE  292

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G ++EA  + ++M  KGL P   TYN+I+   C+ G+   + ++L +M +  + PD  T 
Sbjct  293   GLLEEAFDVMNSMPAKGLRPGTVTYNAIINSVCKNGKYGRAREILGEMLQSGLSPDTSTY  352

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             N L+   C+ G    A +   +M   GL PD  ++  L+  F +  D ERA +    M  
Sbjct  353   NILLGECCRKGHTTDAEETFYEMCHHGLVPDLVSFSFLVGLFSRKGDLERALKYFKQMKG  412

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
             AG  P    Y+ L+  +C   +    +K+ DE   +G   D+  Y  I+  LCK  +L  
Sbjct  413   AGLVPDSVIYTMLIGGFCRNGDISDALKMRDEMVEQGCLPDVVTYNTILNGLCKEKRLSD  472

Query  437   AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL---MVTlklyks  267
             A+  F  M ER I  D   +T+L + Y K+G    A  LF++M +R +   +VT      
Sbjct  473   ADELFNEMVERGIFPDYYSFTTLIHGYCKDGFADKALALFEKMIERNVKPDIVTY-----  527

Query  266   lsassKDENSLLDLF------------WNNVMQRGLISHNVHNSIFL  162
                     N+L+D F            W++++ R ++ +++  SI +
Sbjct  528   --------NTLIDGFCREGDVEKANKLWDDMISREILPNHISYSILI  566



>ref|XP_010062285.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At1g09680 [Eucalyptus grandis]
Length=599

 Score =   273 bits (698),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/478 (31%), Positives = 250/478 (52%), Gaps = 1/478 (0%)
 Frame = -2

Query  1742  SFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS  1563
             +FF +V   PN+R ++    +M + L  +  F  A+ ++  +  +    S + L   +  
Sbjct  95    AFFNFVSAQPNFRLAVGCCCAMAHFLCSNGMFTEAQSVISLVVSRKGKDSASSLFCSLLE  154

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
                +  +  VF  L+I YA++    DAIQ F  +R   +      C  LL+ ++K    +
Sbjct  155   TRSAHRSVFVFDALIIAYADADYMPDAIQCFRLMRKRNLPVPFRGCGHLLHRMLKNSSPE  214

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
               W  Y +++  G   NI+ +N+L+    K G+V+ A     EM  +G+ P + +FNTLI
Sbjct  215   AAWGFYMEILNAGYPANIYSFNILMSRFGKVGKVKSARLLFDEMPKRGLAPSIVSFNTLI  274

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VT  1026
             S YC+ G   E   ++  ME+ G + D+ TY++LI+  C+E RM +A  L K++ EK V 
Sbjct  275   SGYCKVGDLEEGFGLKGVMEKSGFQADVFTYSTLINGLCKESRMEDANLLLKEMSEKGVV  334

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             PN V +TTLID  C+ G ID A  L+  M   G+ P + TYN+++   C  G +KE+ KL
Sbjct  335   PNYVIFTTLIDQQCKNGRIDMATPLYQQMLSTGVRPDLVTYNALINGHCRVGDLKEARKL  394

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             + +M    + PD +T  TLI+G CK GD+ SAL ++ +M+E G+  D+  + ALI G CK
Sbjct  395   VEEMKSIGLNPDKITYTTLIDGICKEGDMESALDIRKEMVEKGIELDNIAFTALISGLCK  454

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             A  T  A+ V+ +M+  G  P    Y+ ++D +C + + +   +L  E    G+   +  
Sbjct  455   AGRTVDAERVLREMLKVGIRPDDATYTMIMDGFCKKGDTKMGFQLLKEMQSDGHVPGVVT  514

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDE  312
             Y  ++  LCK+G++  A+     M    ++ D + Y  L   + K GN      + DE
Sbjct  515   YNVLMNGLCKQGQMKNAKMLLDAMMNLGVVPDDITYNILLDGHCKHGNFVNIGKIRDE  572


 Score =   125 bits (315),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 88/365 (24%), Positives = 157/365 (43%), Gaps = 36/365 (10%)
 Frame = -2

Query  1295  KSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDII  1116
             + G+   +  F S +E +     ++ F+ LI  Y       +A+     M +  +     
Sbjct  139   RKGKDSASSLFCSLLETRSAHRSVFVFDALIIAYADADYMPDAIQCFRLMRKRNLPVPFR  198

Query  1115  TYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEV-TYTTLIDGYCRVGDIDEALRLHSAM  939
                 L+H   +      A   + +I     P  + ++  L+  + +VG +  A  L   M
Sbjct  199   GCGHLLHRMLKNSSPEAAWGFYMEILNAGYPANIYSFNILMSRFGKVGKVKSARLLFDEM  258

Query  938   EEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGY------  777
              ++GL P + ++N+++  +C+ G ++E   L   M +   + D  T +TLING       
Sbjct  259   PKRGLAPSIVSFNTLISGYCKVGDLEEGFGLKGVMEKSGFQADVFTYSTLINGLCKESRM  318

Query  776   -----------------------------CKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
                                          CK G I  A  +  +ML  G+RPD  TY AL
Sbjct  319   EDANLLLKEMSEKGVVPNYVIFTTLIDQQCKNGRIDMATPLYQQMLSTGVRPDLVTYNAL  378

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGY  504
             I+G C+  D + A++++ +M + G +P    Y+ L+D  C + + E+ + +  E   +G 
Sbjct  379   INGHCRVGDLKEARKLVEEMKSIGLNPDKITYTTLIDGICKEGDMESALDIRKEMVEKGI  438

Query  503   CVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASD  324
              +D   + A+I  LCK G+   AER    M +  I  D   YT +   + K+G+T+    
Sbjct  439   ELDNIAFTALISGLCKAGRTVDAERVLREMLKVGIRPDDATYTMIMDGFCKKGDTKMGFQ  498

Query  323   LFDEM  309
             L  EM
Sbjct  499   LLKEM  503


 Score =   118 bits (295),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/277 (26%), Positives = 137/277 (49%), Gaps = 5/277 (2%)
 Frame = -2

Query  1121  IITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT---LIDGYCRVGDIDEALRL  951
             +  +++LI ++     M +A++ F+ ++++  P  V +     L+    +    + A   
Sbjct  162   VFVFDALIIAYADADYMPDAIQCFRLMRKRNLP--VPFRGCGHLLHRMLKNSSPEAAWGF  219

Query  950   HSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCK  771
             +  +   G    + ++N ++ +F + G++K +  L ++M ++ + P  V+ NTLI+GYCK
Sbjct  220   YMEILNAGYPANIYSFNILMSRFGKVGKVKSARLLFDEMPKRGLAPSIVSFNTLISGYCK  279

Query  770   IGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCA  591
             +GD+     +K  M ++G + D FTY  LI+G CK    E A  ++ +M   G  P+Y  
Sbjct  280   VGDLEEGFGLKGVMEKSGFQADVFTYSTLINGLCKESRMEDANLLLKEMSEKGVVPNYVI  339

Query  590   YSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQ  411
             ++ L+D  C     +    L  +    G   D+  Y A+I   C+ G L  A +    M+
Sbjct  340   FTTLIDQQCKNGRIDMATPLYQQMLSTGVRPDLVTYNALINGHCRVGDLKEARKLVEEMK  399

Query  410   EREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                +  D + YT+L     KEG+  +A D+  EM ++
Sbjct  400   SIGLNPDKITYTTLIDGICKEGDMESALDIRKEMVEK  436


 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/301 (26%), Positives = 134/301 (45%), Gaps = 41/301 (14%)
 Frame = -2

Query  1559  DDSDVNSQVFSW--LLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
             + S   + VF++  L+       R  DA  + + +    + P+    T L++   K G  
Sbjct  294   EKSGFQADVFTYSTLINGLCKESRMEDANLLLKEMSEKGVVPNYVIFTTLIDQQCKNGRI  353

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
             D     Y++M+  GV P++  YN LI+  C+ G++++A + + EM+  G+ PD  T+ TL
Sbjct  354   DMATPLYQQMLSTGVRPDLVTYNALINGHCRVGDLKEARKLVEEMKSIGLNPDKITYTTL  413

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKV  1029
             I   C+ G    AL ++  M   G+E D I + +LI   C+ GR  +A R+ ++ +K  +
Sbjct  414   IDGICKEGDMESALDIRKEMVEKGIELDNIAFTALISGLCKAGRTVDAERVLREMLKVGI  473

Query  1028  TPNEVTYT-----------------------------------TLIDGYCRVGDIDEALR  954
              P++ TYT                                    L++G C+ G +  A  
Sbjct  474   RPDDATYTMIMDGFCKKGDTKMGFQLLKEMQSDGHVPGVVTYNVLMNGLCKQGQMKNAKM  533

Query  953   LHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYC  774
             L  AM   G+ P   TYN +L   C+ G      K+ +   EK +  D  +  +L+N   
Sbjct  534   LLDAMMNLGVVPDDITYNILLDGHCKHGNFVNIGKIRD---EKGLVQDYASYTSLVNELA  590

Query  773   K  771
             K
Sbjct  591   K  591



>ref|XP_009345567.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Pyrus x bretschneideri]
 ref|XP_009345568.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Pyrus x bretschneideri]
Length=755

 Score =   276 bits (705),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 160/557 (29%), Positives = 269/557 (48%), Gaps = 75/557 (13%)
 Frame = -2

Query  1736  FKWVETI----PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALV  1569
              K+V+ I    PN++HS +S  +MI++L + +    A+ ++ ++  K  +S   V ++LV
Sbjct  124   LKFVDLILLNSPNFKHSSESLSAMIHMLVRGRRVSDAQPLILRMVRKSGISRVGVADSLV  183

Query  1568  RSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGL  1389
              +      +S VF   +  Y  +K+  +  + F+  R        +AC  LL  LVK G 
Sbjct  184   STYTSCGSSSLVFDLFVRTYVQAKKLREGFEAFQVFRRKGFCVSINACNSLLGGLVKVGW  243

Query  1388  TDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNT  1209
              D  W  Y +++  G+  N++  N++++A CK+ ++E    FLS+ME KG+F D+ T+NT
Sbjct  244   IDLAWVVYGEVVSSGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTYNT  303

Query  1208  LISLYCRRGMHYEALSVQDRME-----------------------------------RGG  1134
             LI+ YCR G+  EA  +++ M                                    +GG
Sbjct  304   LINAYCREGLLEEAFQLKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKEMLYEMLQGG  363

Query  1133  VEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--------------------------  1032
             + PD  TYN+++   CR+G   EA  +F ++ ++                          
Sbjct  364   LNPDTTTYNTMLFESCRKGDFLEAEEIFHEMSQRGVVPDMVSFSSLIGVFSRNKNIDRAL  423

Query  1031  ----------VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKF  882
                       + P+ V YT LIDGYCR G + EAL+L   M E+G    V T+N+IL   
Sbjct  424   LYFRDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGL  483

Query  881   CEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
             C E  + ++ +L N+M E+ + PD  T  TLI+GYCK G++  +L + + M    ++PD 
Sbjct  484   CREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDI  543

Query  701   FTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADE  522
              TY  L  GFCK  + ++AKE+  DM++    P++ +Y  L++ +C   N     +L D+
Sbjct  544   VTYNTLFDGFCKLGEMDKAKELWDDMVSRRILPNHISYGILINGFCSMGNVHEAFRLWDQ  603

Query  521   FSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGN  342
                 G    +     +I+  C+ G    A+ F G M  + ++ DS+ Y +L   Y KE N
Sbjct  604   MIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEEN  663

Query  341   TRAASDLFDEMYKRRLM  291
                A     EM K+ ++
Sbjct  664   LNKAFSSVQEMEKQGIL  680


 Score =   230 bits (586),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 138/526 (26%), Positives = 248/526 (47%), Gaps = 54/526 (10%)
 Frame = -2

Query  1760  WFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVL  1581
             W  L+W  +  V +    + ++ +   M+  L K +  +S K  L  +  K   S     
Sbjct  243   WIDLAWVVYGEVVS-SGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTY  301

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             N L+ +                 Y       +A Q+   +    +KP+      ++N L 
Sbjct  302   NTLINA-----------------YCREGLLEEAFQLKNSMSSKGLKPELFTYNAIMNGLC  344

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G      +   +M++ G+ P+   YN ++   C+ G+  +A+E   EM  +G+ PD+ 
Sbjct  345   KVGNYARAKEMLYEMLQGGLNPDTTTYNTMLFESCRKGDFLEAEEIFHEMSQRGVVPDMV  404

Query  1220  TFNTLISL-----------------------------------YCRRGMHYEALSVQDRM  1146
             +F++LI +                                   YCR+GM  EAL ++D M
Sbjct  405   SFSSLIGVFSRNKNIDRALLYFRDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKLRDEM  464

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDI  969
                G   D++T+N++++  CRE  + +A  LF ++ E+ V P+  T+TTLI GYC+ G++
Sbjct  465   LEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCKHGNM  524

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
              ++L L  AM    + P + TYN++   FC+ G M ++ +L + M  ++I P++++   L
Sbjct  525   TKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKAKELWDDMVSRRILPNHISYGIL  584

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             ING+C +G++  A ++ ++M+E G++P   T   +I G+C++ DT +A E +  MI+ G 
Sbjct  585   INGFCSMGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMISKGV  644

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    Y+ L++ Y  + N         E   +G   D   Y  I+   C++G++  AE 
Sbjct  645   VPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSDQFTYNIILNGFCRQGRMHEAEL  704

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
                 M ER +  D   YTSL   +  + N + A    DEM +R  +
Sbjct  705   VLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHDEMLQRGFL  750


 Score =   226 bits (575),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/415 (29%), Positives = 220/415 (53%), Gaps = 23/415 (6%)
 Frame = -2

Query  1667  LTKHKHFKSAKDMLHQI------------------ACK--DFLSSPAVLNALVRSDDDSD  1548
             L K  ++  AK+ML+++                  +C+  DFL +  + + + +     D
Sbjct  343   LCKVGNYARAKEMLYEMLQGGLNPDTTTYNTMLFESCRKGDFLEAEEIFHEMSQRGVVPD  402

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
             + S  FS L+  ++ +K    A+  F  ++   + PD    T+L++   ++G+     K 
Sbjct  403   MVS--FSSLIGVFSRNKNIDRALLYFRDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKL  460

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
               +M++ G   ++  +N +++  C+   +  ADE  +EM  +G+ PD YTF TLI  YC+
Sbjct  461   RDEMLEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCK  520

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVT  1011
              G   ++L++ D M  G ++PDI+TYN+L    C+ G M +A  L+ D +  ++ PN ++
Sbjct  521   HGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKAKELWDDMVSRRILPNHIS  580

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             Y  LI+G+C +G++ EA RL   M E+G+ P + T N++++ +C  G   ++ + L +M 
Sbjct  581   YGILINGFCSMGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMI  640

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
              K + PD++T NTLINGY K  ++  A     +M + G+  D FTY  +++GFC+     
Sbjct  641   SKGVVPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSDQFTYNIILNGFCRQGRMH  700

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              A+ V+  MI  G  P    Y+ L++ +  Q+N +   +  DE   RG+  D  F
Sbjct  701   EAELVLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHDEMLQRGFLPDDEF  755


 Score =   172 bits (437),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 212/432 (49%), Gaps = 12/432 (3%)
 Frame = -2

Query  1586  VLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNS  1407
             +   L R  ++  +  +    +L+   N K + +++    H+ + R +    A  ++L  
Sbjct  109   IAEVLSRCRENLQLGLKFVDLILLNSPNFKHSSESLSAMIHM-LVRGRRVSDAQPLILRM  167

Query  1406  LVKEGLT-----DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFK  1242
             + K G++     D++  TY       +     ++++ +    ++ ++ +  E       K
Sbjct  168   VRKSGISRVGVADSLVSTYTSCGSSSL-----VFDLFVRTYVQAKKLREGFEAFQVFRRK  222

Query  1241  GIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREA  1062
             G    +   N+L+    + G    A  V   +   G++ ++ T N ++++ C+  ++   
Sbjct  223   GFCVSINACNSLLGGLVKVGWIDLAWVVYGEVVSSGIQLNVYTLNIMVNALCKARKIESV  282

Query  1061  MRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRK  885
                  D++EK V  + VTY TLI+ YCR G ++EA +L ++M  KGL P + TYN+I+  
Sbjct  283   KFFLSDMEEKGVFSDIVTYNTLINAYCREGLLEEAFQLKNSMSSKGLKPELFTYNAIMNG  342

Query  884   FCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD  705
              C+ G    + ++L +M +  + PD  T NT++   C+ GD + A ++ ++M + G+ PD
Sbjct  343   LCKVGNYARAKEMLYEMLQGGLNPDTTTYNTMLFESCRKGDFLEAEEIFHEMSQRGVVPD  402

Query  704   SFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLAD  525
               ++ +LI  F + K+ +RA     DM  AG  P    Y+ L+D YC +      +KL D
Sbjct  403   MVSFSSLIGVFSRNKNIDRALLYFRDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKLRD  462

Query  524   EFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEG  345
             E   +G  +D+  +  I+  LC+   L  A+  F  M ER ++ D   +T+L + Y K G
Sbjct  463   EMLEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCKHG  522

Query  344   NTRAASDLFDEM  309
             N   + +LFD M
Sbjct  523   NMTKSLNLFDAM  534



>emb|CAN83994.1| hypothetical protein VITISV_031191 [Vitis vinifera]
Length=559

 Score =   271 bits (692),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/477 (31%), Positives = 260/477 (55%), Gaps = 4/477 (1%)
 Frame = -2

Query  1796  IINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQI  1617
             +IN    +LSP       SFFKW+ T  ++R S+ S  +M + L  HK    A+ +L  +
Sbjct  73    LINLNPHSLSPPSLL---SFFKWLSTQHHFRLSIHSYCTMTHFLCTHKMLSEAQSLLQFV  129

Query  1616  ACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPD  1437
               +   +S + +   V     +  ++ VFS L+  Y +S    DAIQ F  +R   ++  
Sbjct  130   VSRKGKNSASSVFTSVLEARGTHQSNLVFSVLMNAYTDSGYFSDAIQCFRLVRKHNLQIP  189

Query  1436  PHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLS  1257
              H+C  L + L+K  LT   W  Y++++  G  P++  +NVL+H  CK  ++ +A     
Sbjct  190   FHSCGYLFDRLMKLNLTSPAWAFYEEILDCGYPPDVCKFNVLMHRLCKEHKINEAQLLFG  249

Query  1256  EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREG  1077
             E+  +G+ P + +FNTLI+ YC+ G   +   ++  M    V PD+ TY+ LI+  C+EG
Sbjct  250   EIGKRGLRPTVVSFNTLINGYCKSGNLDQGFRLKRFMMENRVFPDVFTYSVLINGLCKEG  309

Query  1076  RMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYN  900
             ++ +A +LF ++ ++ + PN+VT+TTLI+G+C  G  D  + ++  M  KG+ P V TYN
Sbjct  310   QLDDANKLFLEMCDRGLVPNDVTFTTLINGHCVTGRADLGMEIYQQMLRKGVKPDVITYN  369

Query  899   SILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEA  720
             +++   C+ G ++E+ KL+ +M ++ ++PD  T   LI+G CK GD+ SAL+++ +M++ 
Sbjct  370   TLINGLCKVGDLREAKKLVIEMTQRGLKPDKFTYTMLIDGCCKEGDLESALEIRKEMVKE  429

Query  719   GLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEAL  540
             G+  D+  + ALI GFC+      A+  + +M+ AG  P    Y+ ++  +C + + +  
Sbjct  430   GIELDNVAFTALISGFCREGQVIEAERTLREMLEAGIKPDDATYTMVIHGFCKKGDVKTG  489

Query  539   VKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSL  369
              KL  E    G+   +  Y  ++  LCK+G++  A      M    ++ D + Y  L
Sbjct  490   FKLLKEMQCDGHVPGVVTYNVLLNGLCKQGQMKNANMLLDAMLNLGVVPDDITYNIL  546


 Score =   130 bits (327),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 164/345 (48%), Gaps = 16/345 (5%)
 Frame = -2

Query  1328  HIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDR  1149
             H + + IH+ C         + LSE +           + L  +  R+G +  +      
Sbjct  97    HHFRLSIHSYCTMTHFLCTHKMLSEAQ-----------SLLQFVVSRKGKNSASSVFTSV  145

Query  1148  MERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE---KVTPNEVTYTTLIDGYCRV  978
             +E  G     + ++ L++++   G   +A++ F+ +++   ++  +   Y  L D   ++
Sbjct  146   LEARGTHQSNLVFSVLMNAYTDSGYFSDAIQCFRLVRKHNLQIPFHSCGY--LFDRLMKL  203

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
                  A   +  + + G  P V  +N ++ + C+E ++ E+  L  ++G++ + P  V+ 
Sbjct  204   NLTSPAWAFYEEILDCGYPPDVCKFNVLMHRLCKEHKINEAQLLFGEIGKRGLRPTVVSF  263

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             NTLINGYCK G++    ++K  M+E  + PD FTY  LI+G CK    + A ++  +M  
Sbjct  264   NTLINGYCKSGNLDQGFRLKRFMMENRVFPDVFTYSVLINGLCKEGQLDDANKLFLEMCD  323

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
              G  P+   ++ L++ +C+    +  +++  +   +G   D+  Y  +I  LCK G L  
Sbjct  324   RGLVPNDVTFTTLINGHCVTGRADLGMEIYQQMLRKGVKPDVITYNTLINGLCKVGDLRE  383

Query  437   AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
             A++    M +R +  D   YT L     KEG+  +A ++  EM K
Sbjct  384   AKKLVIEMTQRGLKPDKFTYTMLIDGCCKEGDLESALEIRKEMVK  428


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -2

Query  1550  DVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWK  1371
             ++++  F+ L+  +    +  +A +    +    IKPD    T++++   K+G   T +K
Sbjct  432   ELDNVAFTALISGFCREGQVIEAERTLREMLEAGIKPDDATYTMVIHGFCKKGDVKTGFK  491

Query  1370  TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
               K+M   G +P +  YNVL++  CK G+++ A+  L  M   G+ PD  T+N L+
Sbjct  492   LLKEMQCDGHVPGVVTYNVLLNGLCKQGQMKNANMLLDAMLNLGVVPDDITYNILL  547


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/196 (24%), Positives = 79/196 (40%), Gaps = 2/196 (1%)
 Frame = -2

Query  875  EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
            +G+   S+   + +  +     N+  + L+N Y   G    A++    + +  L+    +
Sbjct  133  KGKNSASSVFTSVLEARGTHQSNLVFSVLMNAYTDSGYFSDAIQCFRLVRKHNLQIPFHS  192

Query  695  YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN-NEALVKLADEF  519
               L     K   T  A     +++  G+ P  C ++ L+   C ++  NEA + L  E 
Sbjct  193  CGYLFDRLMKLNLTSPAWAFYEEILDCGYPPDVCKFNVLMHRLCKEHKINEAQL-LFGEI  251

Query  518  SGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
              RG    +  +  +I   CK G LD   R    M E  +  D   Y+ L     KEG  
Sbjct  252  GKRGLRPTVVSFNTLINGYCKSGNLDQGFRLKRFMMENRVFPDVFTYSVLINGLCKEGQL  311

Query  338  RAASDLFDEMYKRRLM  291
              A+ LF EM  R L+
Sbjct  312  DDANKLFLEMCDRGLV  327



>ref|XP_006849567.1| hypothetical protein AMTR_s00024p00183850 [Amborella trichopoda]
 gb|ERN11148.1| hypothetical protein AMTR_s00024p00183850 [Amborella trichopoda]
Length=633

 Score =   271 bits (694),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 159/524 (30%), Positives = 273/524 (52%), Gaps = 5/524 (1%)
 Frame = -2

Query  1874  TLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSL  1695
             TL   +LK  W +L   +I   +T  +I  T++ L      +   F K +E+   +   L
Sbjct  50    TLEKAILKSQWTSL--ERISRVMTMDLIADTMVKLRSRPHKI-LGFVKHLESDLVFHLDL  106

Query  1694  QSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDV-NSQVFSWLL  1518
             +     I+I+   ++ + A  +L +I    F  +  + +AL+++ +  +  N+ VF+ L+
Sbjct  107   RCLCIAIHIIAGLENPQPALQLLQRIVNGGFGPNTLIFDALMKAKEVCETKNTLVFNLLI  166

Query  1517  IFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVL  1338
                 + +++ +A+Q+F  ++  ++ P   +C  LL++L K+  T+T W  Y ++ +L + 
Sbjct  167   KACCHLQKSDEAVQIFYLMKGHKLSPSIESCNFLLSTLSKQNKTETAWVIYAEIFRLKIP  226

Query  1337  PNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSV  1158
              +I  +N++I+  CK G++ KA EFLS ME  G  P + T+NT+++ YC +G    AL +
Sbjct  227   SSIVTFNIMINILCKEGKLNKAKEFLSYMEGLGFKPTVVTYNTVLNGYCNKGKVQIALEI  286

Query  1157  QDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCR  981
              D M+  GV PD  TY SLI   C+EGR+ E+ +    ++E  + P  V Y  +IDG+C 
Sbjct  287   FDTMKNRGVSPDSFTYASLISGLCKEGRLEESAQFLAKMEESGLVPTVVAYNAMIDGFCN  346

Query  980   VGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVT  801
              G ++ A +  + M ++G+ P + TYN ++      G+ KE   ++ +M  + + PD  T
Sbjct  347   NGRLEMAFKYRNEMIKRGIEPTICTYNPLIHGLFMAGKNKEVDDMIKEMVSRNVGPDVFT  406

Query  800   CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
              N LINGYCK G+   A ++  +ML  G+ P   TY +LI+G CK    E A  +  +++
Sbjct  407   YNILINGYCKEGNASKAFELHAEMLHKGIEPTKVTYTSLIYGLCKQNKMEEADRLFKEVM  466

Query  620   AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
               G SP    Y+ L+D +C   N +    L  E   +    D   Y  ++R LC  GK D
Sbjct  467   TKGISPDVVLYNALIDGHCAIGNVDDAFMLLKEMDDKKLFPDEITYNTLMRGLCIVGKAD  526

Query  440   CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              A      M+ER I  D + Y +L   Y ++G    A  + DEM
Sbjct  527   EARGLIDKMKERGIKPDYISYNTLISGYSRKGEMNNAFKIRDEM  570


 Score =   224 bits (570),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 136/447 (30%), Positives = 226/447 (51%), Gaps = 63/447 (14%)
 Frame = -2

Query  1775  TLSPCWFWLSW------SFFKWVETIPNYRHSLQSSWS----MIYILTKHKHFKSAKDML  1626
             ++  C F LS       +   WV     +R  + SS      MI IL K      AK+ L
Sbjct  193   SIESCNFLLSTLSKQNKTETAWVIYAEIFRLKIPSSIVTFNIMINILCKEGKLNKAKEFL  252

Query  1625  HQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRI  1446
               +    F   P V+                ++ +L  Y N  +   A+++F+ ++   +
Sbjct  253   SYMEGLGF--KPTVV---------------TYNTVLNGYCNKGKVQIALEIFDTMKNRGV  295

Query  1445  KPDPHACTVLLNSLVKEG----------------LTDTV-------------------WK  1371
              PD      L++ L KEG                L  TV                   +K
Sbjct  296   SPDSFTYASLISGLCKEGRLEESAQFLAKMEESGLVPTVVAYNAMIDGFCNNGRLEMAFK  355

Query  1370  TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYC  1191
                +MIK G+ P I  YN LIH    +G+ ++ D+ + EM  + + PD++T+N LI+ YC
Sbjct  356   YRNEMIKRGIEPTICTYNPLIHGLFMAGKNKEVDDMIKEMVSRNVGPDVFTYNILINGYC  415

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEV  1014
             + G   +A  +   M   G+EP  +TY SLI+  C++ +M EA RLFK++  K ++P+ V
Sbjct  416   KEGNASKAFELHAEMLHKGIEPTKVTYTSLIYGLCKQNKMEEADRLFKEVMTKGISPDVV  475

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
              Y  LIDG+C +G++D+A  L   M++K L P   TYN+++R  C  G+  E+  L+++M
Sbjct  476   LYNALIDGHCAIGNVDDAFMLLKEMDDKKLFPDEITYNTLMRGLCIVGKADEARGLIDKM  535

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
              E+ I+PD ++ NTLI+GY + G++ +A K++++ML  G  P   TY ALI G CKA++ 
Sbjct  536   KERGIKPDYISYNTLISGYSRKGEMNNAFKIRDEMLSTGFNPTILTYNALIKGLCKAREG  595

Query  653   ERAKEVIFDMIAAGFSPSYCAYSWLVD  573
              +A+E++ +M++ G  P    Y  +++
Sbjct  596   GQAEELLKEMVSRGLMPDDGTYISMIE  622


 Score =   209 bits (531),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/389 (30%), Positives = 188/389 (48%), Gaps = 1/389 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             F+ ++       +   A +   ++     KP       +LN    +G      + +  M 
Sbjct  232   FNIMINILCKEGKLNKAKEFLSYMEGLGFKPTVVTYNTVLNGYCNKGKVQIALEIFDTMK  291

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               GV P+   Y  LI   CK G +E++ +FL++ME  G+ P +  +N +I  +C  G   
Sbjct  292   NRGVSPDSFTYASLISGLCKEGRLEESAQFLAKMEESGLVPTVVAYNAMIDGFCNNGRLE  351

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              A   ++ M + G+EP I TYN LIH     G+ +E   + K+ +   V P+  TY  LI
Sbjct  352   MAFKYRNEMIKRGIEPTICTYNPLIHGLFMAGKNKEVDDMIKEMVSRNVGPDVFTYNILI  411

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +GYC+ G+  +A  LH+ M  KG+ P   TY S++   C++ +M+E+ +L  ++  K I 
Sbjct  412   NGYCKEGNASKAFELHAEMLHKGIEPTKVTYTSLIYGLCKQNKMEEADRLFKEVMTKGIS  471

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD V  N LI+G+C IG++  A  +  +M +  L PD  TY  L+ G C     + A+ +
Sbjct  472   PDVVLYNALIDGHCAIGNVDDAFMLLKEMDDKKLFPDEITYNTLMRGLCIVGKADEARGL  531

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCK  456
             I  M   G  P Y +Y+ L+  Y  +       K+ DE    G+   I  Y A+I+ LCK
Sbjct  532   IDKMKERGIKPDYISYNTLISGYSRKGEMNNAFKIRDEMLSTGFNPTILTYNALIKGLCK  591

Query  455   RGKLDCAERFFGMMQEREILGDSVVYTSL  369
               +   AE     M  R ++ D   Y S+
Sbjct  592   AREGGQAEELLKEMVSRGLMPDDGTYISM  620


 Score =   178 bits (452),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/412 (27%), Positives = 200/412 (49%), Gaps = 9/412 (2%)
 Frame = -2

Query  1520  LIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDT--VWKTYKKMIKL  1347
             L+F+ + +    AI +   L       +P     LL  +V  G      ++    K  ++
Sbjct  100   LVFHLDLRCLCIAIHIIAGLE------NPQPALQLLQRIVNGGFGPNTLIFDALMKAKEV  153

Query  1346  GVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEA  1167
                 N  ++N+LI ACC   + ++A +    M+   + P + + N L+S   ++     A
Sbjct  154   CETKNTLVFNLLIKACCHLQKSDEAVQIFYLMKGHKLSPSIESCNFLLSTLSKQNKTETA  213

Query  1166  LSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDG  990
               +   + R  +   I+T+N +I+  C+EG++ +A      ++     P  VTY T+++G
Sbjct  214   WVIYAEIFRLKIPSSIVTFNIMINILCKEGKLNKAKEFLSYMEGLGFKPTVVTYNTVLNG  273

Query  989   YCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPD  810
             YC  G +  AL +   M+ +G+ P   TY S++   C+EGR++ES + L +M E  + P 
Sbjct  274   YCNKGKVQIALEIFDTMKNRGVSPDSFTYASLISGLCKEGRLEESAQFLAKMEESGLVPT  333

Query  809   NVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF  630
              V  N +I+G+C  G +  A K +N+M++ G+ P   TY  LIHG   A   +   ++I 
Sbjct  334   VVAYNAMIDGFCNNGRLEMAFKYRNEMIKRGIEPTICTYNPLIHGLFMAGKNKEVDDMIK  393

Query  629   DMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRG  450
             +M++    P    Y+ L++ YC + N     +L  E   +G       Y ++I  LCK+ 
Sbjct  394   EMVSRNVGPDVFTYNILINGYCKEGNASKAFELHAEMLHKGIEPTKVTYTSLIYGLCKQN  453

Query  449   KLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             K++ A+R F  +  + I  D V+Y +L   +   GN   A  L  EM  ++L
Sbjct  454   KMEEADRLFKEVMTKGISPDVVLYNALIDGHCAIGNVDDAFMLLKEMDDKKL  505


 Score =   125 bits (313),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/346 (27%), Positives = 156/346 (45%), Gaps = 21/346 (6%)
 Frame = -2

Query  1169  ALSVQDRMERGGVEPDII------------------TYNSLIHSHCREGRMREAMRLFKD  1044
             AL +  R+  GG  P+ +                   +N LI + C   +  EA+++F  
Sbjct  125   ALQLLQRIVNGGFGPNTLIFDALMKAKEVCETKNTLVFNLLIKACCHLQKSDEAVQIFYL  184

Query  1043  IK-EKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGR  867
             +K  K++P+  +   L+    +    + A  +++ +    +   + T+N ++   C+EG+
Sbjct  185   MKGHKLSPSIESCNFLLSTLSKQNKTETAWVIYAEIFRLKIPSSIVTFNIMINILCKEGK  244

Query  866   MKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKA  687
             + ++ + L+ M     +P  VT NT++NGYC  G +  AL++ + M   G+ PDSFTY +
Sbjct  245   LNKAKEFLSYMEGLGFKPTVVTYNTVLNGYCNKGKVQIALEIFDTMKNRGVSPDSFTYAS  304

Query  686   LIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRG  507
             LI G CK    E + + +  M  +G  P+  AY+ ++D +C     E   K  +E   RG
Sbjct  305   LISGLCKEGRLEESAQFLAKMEESGLVPTVVAYNAMIDGFCNNGRLEMAFKYRNEMIKRG  364

Query  506   YCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAAS  327
                 I  Y  +I  L   GK    +     M  R +  D   Y  L   Y KEGN   A 
Sbjct  365   IEPTICTYNPLIHGLFMAGKNKEVDDMIKEMVSRNVGPDVFTYNILINGYCKEGNASKAF  424

Query  326   DLFDEMYKRRLMVTlklykslsassKDENSL--LDLFWNNVMQRGL  195
             +L  EM  + +  T   Y SL      +N +   D  +  VM +G+
Sbjct  425   ELHAEMLHKGIEPTKVTYTSLIYGLCKQNKMEEADRLFKEVMTKGI  470



>ref|XP_004168332.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Cucumis sativus]
Length=590

 Score =   270 bits (691),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/482 (30%), Positives = 252/482 (52%), Gaps = 4/482 (1%)
 Frame = -2

Query  1730  WVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDS  1551
             W+ +IP +RH+ QS  +M   L+ H+ F+  + ++  +  +    S A + A +     +
Sbjct  90    WLSSIPTFRHTSQSYCAMANFLSAHQMFQECQSIIRFLVSRKGKDSAASVFAAILDTAGT  149

Query  1550  DVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWK  1371
               ++ VF  L+I Y +S    DAIQ F  +R    +   H C  LL+ ++      T+W 
Sbjct  150   RCSNFVFDALMIAYWDSGFVSDAIQCFRLVRNSNFQIPFHGCGYLLDKMINSNSPVTIWT  209

Query  1370  TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYC  1191
              Y ++++ G  P +  YN+LI+  CK G +  A    +E+  +G+ P   +FNTLI+  C
Sbjct  210   FYSEILEYGFPPKVQYYNILINKFCKEGSIRDAKLIFNEIRKRGLRPTTVSFNTLINGLC  269

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEV  1014
             +     E   ++  ME   + PD+ TY+ LIH  C+EGR+  A +LF +++++ + PN +
Sbjct  270   KSRNLDEGFRLKKTMEENRIYPDVFTYSVLIHGLCKEGRLDVAEQLFDEMQQRGLRPNGI  329

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             T+T LIDG  R   +D A+  +  M   G+ P +  YN++L   C+ G + ++ KL+++M
Sbjct  330   TFTALIDGQYRSRRMDSAMNTYHQMLTMGVKPDLVMYNTLLNGLCKVGDVNKARKLVDEM  389

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
                 ++PD +T  TLI+GYCK GD+ SA++++  M E G+  D+  + ALI GFC+    
Sbjct  390   KMVGMKPDKITYTTLIDGYCKEGDLESAMEIRKGMNEEGVVLDNVAFTALISGFCRDGRV  449

Query  653   ERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAI  474
               A+  + +M+ AG  P    Y+ ++D YC + N +   KL  E    G+   +  Y  +
Sbjct  450   RDAERTLREMVEAGMKPDDATYTMVIDGYCKKGNVKMGFKLLKEMQINGHKPGVITYNVL  509

Query  473   IRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             +  LCK+G++  A      M    +  D + Y  L   + K G    A DL     ++ L
Sbjct  510   MNGLCKQGQMKNANMLLEAMLNLGVTPDDITYNILLEGHCKNGK---AEDLLKLRNEKGL  566

Query  293   MV  288
             +V
Sbjct  567   IV  568



>ref|XP_006338777.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Solanum tuberosum]
Length=730

 Score =   273 bits (699),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 165/559 (30%), Positives = 268/559 (48%), Gaps = 73/559 (13%)
 Frame = -2

Query  1751  LSWSFFKWVET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNA  1575
             L+ +F   V    PN++H  +S  + +++L + K    A+  + ++  +  +S   ++ +
Sbjct  96    LAQTFINLVSVNCPNFKHCSRSLSATVHVLIRSKRVADAQGFILRMIRRSGVSRIEIVES  155

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE  1395
             LV +      N   F  L+  Y  +++  +A++VF  L+   +    +AC  LL  LVK 
Sbjct  156   LVSTYGVCGSNPYAFDLLIRTYVQARKIREAVEVFRLLQRRNLCVPINACNGLLGGLVKI  215

Query  1394  GLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTF  1215
             G  D  W+ Y +M    + PN++  N++++A CK G++E  + F+ EME KGIFPD+ T+
Sbjct  216   GWVDLAWEVYGEMTGSSIQPNVYTLNIMVNALCKDGKIESVNPFIEEMEKKGIFPDMVTY  275

Query  1214  NTLISLYCRRGMHYEALSVQD------------------------------------RME  1143
             NTLI+ YC  G+  EA  V +                                     ME
Sbjct  276   NTLINAYCHEGLLEEAYEVINIMKATGLRPCLLTYNSILNGLCKNGQYGRARDLLLVEME  335

Query  1142  RGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTY--------------  1008
               G+ PD  +YN+L+   C+ G + EA  +FK++    + P+ V+Y              
Sbjct  336   ESGLSPDTASYNALLAECCKTGNVLEAESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLD  395

Query  1007  ---------------------TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSIL  891
                                  T LI G+CR G + EA+++   M E+ L   V TYN+IL
Sbjct  396   RSLAYYEHMKHKGLKPDNVVYTILIGGFCRNGSMKEAMKMRDEMLEQSLVMDVVTYNTIL  455

Query  890   RKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLR  711
                C+   + E+ +L N+M E+ + PD  T  TLINGYCK G++  A  +   ML   L+
Sbjct  456   NGLCKGKMLHEADELFNEMLERDVNPDFYTLTTLINGYCKCGNMDKAQTLFEAMLLRNLK  515

Query  710   PDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKL  531
             PD  TY +LI GFCK  D E+A  +  +MI+   SP+Y  YS L++ +C +      ++L
Sbjct  516   PDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILINGFCNKGRVSDALRL  575

Query  530   ADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFK  351
              D+    G    I    +II+  C+ G    A +F   MQ + +  DS+ Y +L   + +
Sbjct  576   WDDMIILGIKPTIVTCNSIIKGYCRSGDASRAAKFRNKMQSQGLFPDSITYNTLLDGFIR  635

Query  350   EGNTRAASDLFDEMYKRRL  294
             E N   A DL +EM  + L
Sbjct  636   EENMAKALDLVNEMGNQGL  654


 Score =   217 bits (552),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 142/523 (27%), Positives = 240/523 (46%), Gaps = 55/523 (11%)
 Frame = -2

Query  1760  WFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVL  1581
             W  L+W  +  + T  + + ++ +   M+  L K    +S    + ++  K         
Sbjct  217   WVDLAWEVYGEM-TGSSIQPNVYTLNIMVNALCKDGKIESVNPFIEEMEKKGIFPDMVTY  275

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             N L+ +                 Y +     +A +V   ++   ++P       +LN L 
Sbjct  276   NTLINA-----------------YCHEGLLEEAYEVINIMKATGLRPCLLTYNSILNGLC  318

Query  1400  KEGLTDTVWKTY-KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDL  1224
             K G           +M + G+ P+   YN L+  CCK+G V +A+    EM  + I PDL
Sbjct  319   KNGQYGRARDLLLVEMEESGLSPDTASYNALLAECCKTGNVLEAESVFKEMSCRAIIPDL  378

Query  1223  YTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR----  1056
              ++++LI L+ R G    +L+  + M+  G++PD + Y  LI   CR G M+EAM+    
Sbjct  379   VSYSSLIGLFSRTGRLDRSLAYYEHMKHKGLKPDNVVYTILIGGFCRNGSMKEAMKMRDE  438

Query  1055  -------------------------------LFKDIKEK-VTPNEVTYTTLIDGYCRVGD  972
                                            LF ++ E+ V P+  T TTLI+GYC+ G+
Sbjct  439   MLEQSLVMDVVTYNTILNGLCKGKMLHEADELFNEMLERDVNPDFYTLTTLINGYCKCGN  498

Query  971   IDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNT  792
             +D+A  L  AM  + L P V TYNS++  FC+ G M+++  L ++M    I P+ +T + 
Sbjct  499   MDKAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSI  558

Query  791   LINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAG  612
             LING+C  G +  AL++ + M+  G++P   T  ++I G+C++ D  RA +    M + G
Sbjct  559   LINGFCNKGRVSDALRLWDDMIILGIKPTIVTCNSIIKGYCRSGDASRAAKFRNKMQSQG  618

Query  611   FSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAE  432
               P    Y+ L+D +  + N    + L +E   +G   D+  Y  I+   CK G++  A 
Sbjct  619   LFPDSITYNTLLDGFIREENMAKALDLVNEMGNQGLSPDVISYNTILDGFCKFGRMQEAN  678

Query  431   RFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
               +  M ER I  D   YTSL   +  + N + A    DEM +
Sbjct  679   MLYRKMVERGINPDRSTYTSLINGHVSQDNLKEAFHFHDEMLQ  721


 Score =   203 bits (517),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 189/350 (54%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             +S L+  ++ + R   ++  +EH++   +KPD    T+L+    + G      K   +M+
Sbjct  381   YSSLIGLFSRTGRLDRSLAYYEHMKHKGLKPDNVVYTILIGGFCRNGSMKEAMKMRDEML  440

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             +  ++ ++  YN +++  CK   + +ADE  +EM  + + PD YT  TLI+ YC+ G   
Sbjct  441   EQSLVMDVVTYNTILNGLCKGKMLHEADELFNEMLERDVNPDFYTLTTLINGYCKCGNMD  500

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +A ++ + M    ++PD++TYNSLI   C+ G M +A  L  + I   ++PN +TY+ LI
Sbjct  501   KAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILI  560

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +G+C  G + +ALRL   M   G+ P + T NSI++ +C  G    + K  N+M  + + 
Sbjct  561   NGFCNKGRVSDALRLWDDMIILGIKPTIVTCNSIIKGYCRSGDASRAAKFRNKMQSQGLF  620

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD++T NTL++G+ +  ++  AL + N+M   GL PD  +Y  ++ GFCK    + A  +
Sbjct  621   PDSITYNTLLDGFIREENMAKALDLVNEMGNQGLSPDVISYNTILDGFCKFGRMQEANML  680

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                M+  G +P    Y+ L++ +  Q+N +      DE    G+  D  F
Sbjct  681   YRKMVERGINPDRSTYTSLINGHVSQDNLKEAFHFHDEMLQMGFIPDDKF  730


 Score =   131 bits (330),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/343 (26%), Positives = 165/343 (48%), Gaps = 20/343 (6%)
 Frame = -2

Query  1310  IHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGV  1131
             +H   +S  V  A  F+  M  +     +    +L+S Y   G +  A            
Sbjct  122   VHVLIRSKRVADAQGFILRMIRRSGVSRIEIVESLVSTYGVCGSNPYA------------  169

Query  1130  EPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTY-TTLIDGYCRVGDIDEALR  954
                   ++ LI ++ +  ++REA+ +F+ ++ +     +     L+ G  ++G +D A  
Sbjct  170   ------FDLLIRTYVQARKIREAVEVFRLLQRRNLCVPINACNGLLGGLVKIGWVDLAWE  223

Query  953   LHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYC  774
             ++  M    + P V T N ++   C++G+++     + +M +K I PD VT NTLIN YC
Sbjct  224   VYGEMTGSSIQPNVYTLNIMVNALCKDGKIESVNPFIEEMEKKGIFPDMVTYNTLINAYC  283

Query  773   KIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF-DMIAAGFSPSY  597
               G +  A +V N M   GLRP   TY ++++G CK     RA++++  +M  +G SP  
Sbjct  284   HEGLLEEAYEVINIMKATGLRPCLLTYNSILNGLCKNGQYGRARDLLLVEMEESGLSPDT  343

Query  596   CAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGM  417
              +Y+ L+   C   N      +  E S R    D+  Y ++I    + G+LD +  ++  
Sbjct  344   ASYNALLAECCKTGNVLEAESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLDRSLAYYEH  403

Query  416   MQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMV  288
             M+ + +  D+VVYT L   + + G+ + A  + DEM ++ L++
Sbjct  404   MKHKGLKPDNVVYTILIGGFCRNGSMKEAMKMRDEMLEQSLVM  446



>ref|XP_009361375.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Pyrus x bretschneideri]
 ref|XP_009361376.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Pyrus x bretschneideri]
Length=755

 Score =   273 bits (699),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 160/557 (29%), Positives = 269/557 (48%), Gaps = 75/557 (13%)
 Frame = -2

Query  1736  FKWVETI----PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALV  1569
              K+V+ I    PN++HS +S  +MI++L + +    A+ ++ ++  K  +S   V ++LV
Sbjct  124   LKFVDLILLNSPNFKHSSESLSAMIHMLVRGRRVSDAQPLILRMVRKSGISRVGVADSLV  183

Query  1568  RSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGL  1389
              +      +S VF   +  Y  +K+  +  + F+  R        +AC  LL  LVK G 
Sbjct  184   STYSSCGSSSLVFDLFVRTYVQAKKLKEGFEAFQVFRRKGFCVSINACNSLLGGLVKVGW  243

Query  1388  TDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNT  1209
              D  W  Y +++  G+  N++  N++++A CK+ ++E    FLS+ME KG+F D+ T+NT
Sbjct  244   IDLAWVVYGEVVSSGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTYNT  303

Query  1208  LISLYCRRGMHYEALSVQDRME-----------------------------------RGG  1134
             LI+ YCR G+  EA  +++ M                                    +GG
Sbjct  304   LINAYCREGLLEEAFQLKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKEMLYEMFQGG  363

Query  1133  VEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--------------------------  1032
             + PD  TYN+++   CR+G   EA  +F ++ ++                          
Sbjct  364   LNPDTTTYNTMLFESCRKGDFLEAEEIFHEMSQRGVVPDIVSFSSLIGVFSRNKNIDRAL  423

Query  1031  ----------VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKF  882
                       + P+ V YT LIDGYCR G + EAL+L   M E+G    V T+N+IL   
Sbjct  424   LYFSDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGL  483

Query  881   CEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
             C E  + ++ +L N+M E+ + PD  T  TLI+GYCK G++  +L + + M    ++PD 
Sbjct  484   CREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDI  543

Query  701   FTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADE  522
              TY  L  GFCK  + ++AKE+  DM++    P++ +Y  L++ +C   N     +L D+
Sbjct  544   VTYNTLFDGFCKLGEMDKAKELWGDMVSRRILPNHISYGILINGFCSMGNVHEAFRLWDQ  603

Query  521   FSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGN  342
                 G    +     +I+  C+ G    A+ F G M  + ++ DS+ Y +L   Y KE N
Sbjct  604   MIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEEN  663

Query  341   TRAASDLFDEMYKRRLM  291
                A     EM K+ ++
Sbjct  664   LNKAFSSVQEMEKQGIL  680


 Score =   228 bits (581),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 138/523 (26%), Positives = 245/523 (47%), Gaps = 54/523 (10%)
 Frame = -2

Query  1760  WFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVL  1581
             W  L+W  +  V +    + ++ +   M+  L K +  +S K  L  +  K   S     
Sbjct  243   WIDLAWVVYGEVVS-SGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTY  301

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             N L+ +                 Y       +A Q+   +    +KP+      ++N L 
Sbjct  302   NTLINA-----------------YCREGLLEEAFQLKNSMSSKGLKPELFTYNAIMNGLC  344

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G      +   +M + G+ P+   YN ++   C+ G+  +A+E   EM  +G+ PD+ 
Sbjct  345   KVGNYARAKEMLYEMFQGGLNPDTTTYNTMLFESCRKGDFLEAEEIFHEMSQRGVVPDIV  404

Query  1220  TFNTLISL-----------------------------------YCRRGMHYEALSVQDRM  1146
             +F++LI +                                   YCR+GM  EAL ++D M
Sbjct  405   SFSSLIGVFSRNKNIDRALLYFSDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKLRDEM  464

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDI  969
                G   D++T+N++++  CRE  + +A  LF ++ E+ V P+  T+TTLI GYC+ G++
Sbjct  465   LEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCKHGNM  524

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
              ++L L  AM    + P + TYN++   FC+ G M ++ +L   M  ++I P++++   L
Sbjct  525   TKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKAKELWGDMVSRRILPNHISYGIL  584

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             ING+C +G++  A ++ ++M+E G++P   T   +I G+C++ DT +A E +  MI+ G 
Sbjct  585   INGFCSMGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMISKGV  644

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    Y+ L++ Y  + N         E   +G   D   Y  I+   C++G++  AE 
Sbjct  645   VPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSDQFTYNIILNGFCRQGRMHEAEL  704

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                 M ER +  D   YTSL   +  + N + A    DEM +R
Sbjct  705   VLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHDEMLQR  747


 Score =   226 bits (577),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/415 (29%), Positives = 220/415 (53%), Gaps = 23/415 (6%)
 Frame = -2

Query  1667  LTKHKHFKSAKDMLHQI------------------ACK--DFLSSPAVLNALVRSDDDSD  1548
             L K  ++  AK+ML+++                  +C+  DFL +  + + + +     D
Sbjct  343   LCKVGNYARAKEMLYEMFQGGLNPDTTTYNTMLFESCRKGDFLEAEEIFHEMSQRGVVPD  402

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
             + S  FS L+  ++ +K    A+  F  ++   + PD    T+L++   ++G+     K 
Sbjct  403   IVS--FSSLIGVFSRNKNIDRALLYFSDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKL  460

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
               +M++ G   ++  +N +++  C+   +  ADE  +EM  +G+ PD YTF TLI  YC+
Sbjct  461   RDEMLEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCK  520

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVT  1011
              G   ++L++ D M  G ++PDI+TYN+L    C+ G M +A  L+ D +  ++ PN ++
Sbjct  521   HGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKAKELWGDMVSRRILPNHIS  580

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             Y  LI+G+C +G++ EA RL   M E+G+ P + T N++++ +C  G   ++ + L +M 
Sbjct  581   YGILINGFCSMGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMI  640

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
              K + PD++T NTLINGY K  ++  A     +M + G+  D FTY  +++GFC+     
Sbjct  641   SKGVVPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSDQFTYNIILNGFCRQGRMH  700

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              A+ V+  MI  G  P    Y+ L++ +  Q+N +   +  DE   RG+  D  F
Sbjct  701   EAELVLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHDEMLQRGFVPDDEF  755



>gb|KDP46186.1| hypothetical protein JCGZ_10026 [Jatropha curcas]
Length=649

 Score =   270 bits (689),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 157/503 (31%), Positives = 259/503 (51%), Gaps = 6/503 (1%)
 Frame = -2

Query  1811  SVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKD  1632
             S+T ++++ TLL+L      L+  F   +E        +++    I +++     K++  
Sbjct  85    SLTPSLVSATLLSLQKKP-DLALQFTTHIEF---NSLDIKTKCLAIAVISPSPSPKASLQ  140

Query  1631  MLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV-FSWLLIFYANSKRTWDAIQVFEHLRI  1455
             +L Q    +  +   V N L  + D  +  S + F  L+      KR  +A   F+ ++ 
Sbjct  141   LLKQTISSNIATVEDVFNELESALDQLNTKSSILFDLLIRACCEMKRGDNAFMCFDMMKK  200

Query  1454  CRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEK  1275
                 P    C  +L+  +K   TD  W  Y +M +L +   ++ +N++I+  CK G+++K
Sbjct  201   KGTVPKIETCNDMLSLFLKLNRTDVAWVLYAEMFRLRIQSTVYTFNIMINVLCKEGKLKK  260

Query  1274  ADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIH  1095
             A EF+  ME  G+ P++ T+NT+I  YC RG    A  + D M+  G+EPD  TY SLI 
Sbjct  261   AKEFIGFMESLGVKPNVVTYNTIIHGYCWRGRVEGARMILDVMKTKGIEPDSYTYGSLIS  320

Query  1094  SHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCP  918
               C+EGR+ EA  L + +KE  + PN VTY TLIDGYC  G++++A    + M E+G+ P
Sbjct  321   GMCKEGRLEEASGLLEKMKEIGLRPNAVTYNTLIDGYCNKGNLEKAFGYRNEMVERGILP  380

Query  917   RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
              V+TYN ++     EG+M E+  ++  MGEK I PD++T N LINGYC+ G+   A  + 
Sbjct  381   TVSTYNLLIHALFLEGKMDEADDMIKNMGEKGIFPDSITYNILINGYCRCGNAKKAFSLH  440

Query  737   NKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQ  558
             N+M+  G++P   TY +LI+   K      A  +  +++  G  P    ++ L+D +C  
Sbjct  441   NEMVGKGIQPTRITYTSLIYVLNKRNRMREADNLFENIVRKGVFPDLIMFNALIDGHCAN  500

Query  557   NNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVY  378
              N +    L  E   R    D   Y  ++R  C+ GK++ A +    M+ R I  D + Y
Sbjct  501   GNIDRAFALLKEMDTRKVFPDEVTYNTLMRGRCREGKVEEARKLLEEMKSRGIKPDHISY  560

Query  377   TSLAYAYFKEGNTRAASDLFDEM  309
              +L   Y + G+   A  + DEM
Sbjct  561   NTLISGYSRRGDMNDAFKVRDEM  583


 Score =   180 bits (456),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/387 (29%), Positives = 193/387 (50%), Gaps = 5/387 (1%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLT---DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKA  1272
             P P A   LL   +   +    D   +    + +L    +I ++++LI ACC+    + A
Sbjct  133   PSPKASLQLLKQTISSNIATVEDVFNELESALDQLNTKSSI-LFDLLIRACCEMKRGDNA  191

Query  1271  DEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHS  1092
                   M+ KG  P + T N ++SL+ +      A  +   M R  ++  + T+N +I+ 
Sbjct  192   FMCFDMMKKKGTVPKIETCNDMLSLFLKLNRTDVAWVLYAEMFRLRIQSTVYTFNIMINV  251

Query  1091  HCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPR  915
              C+EG++++A      ++   V PN VTY T+I GYC  G ++ A  +   M+ KG+ P 
Sbjct  252   LCKEGKLKKAKEFIGFMESLGVKPNVVTYNTIIHGYCWRGRVEGARMILDVMKTKGIEPD  311

Query  914   VATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKN  735
               TY S++   C+EGR++E++ LL +M E  + P+ VT NTLI+GYC  G++  A   +N
Sbjct  312   SYTYGSLISGMCKEGRLEEASGLLEKMKEIGLRPNAVTYNTLIDGYCNKGNLEKAFGYRN  371

Query  734   KMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQN  555
             +M+E G+ P   TY  LIH        + A ++I +M   G  P    Y+ L++ YC   
Sbjct  372   EMVERGILPTVSTYNLLIHALFLEGKMDEADDMIKNMGEKGIFPDSITYNILINGYCRCG  431

Query  554   NNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYT  375
             N +    L +E  G+G       Y ++I  L KR ++  A+  F  +  + +  D +++ 
Sbjct  432   NAKKAFSLHNEMVGKGIQPTRITYTSLIYVLNKRNRMREADNLFENIVRKGVFPDLIMFN  491

Query  374   SLAYAYFKEGNTRAASDLFDEMYKRRL  294
             +L   +   GN   A  L  EM  R++
Sbjct  492   ALIDGHCANGNIDRAFALLKEMDTRKV  518


 Score =   134 bits (338),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/311 (30%), Positives = 151/311 (49%), Gaps = 3/311 (1%)
 Frame = -2

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDIKEKVT-PNEVTYTTLIDGYCRVGDIDEALRLHSA  942
             I ++ LI + C   R   A   F  +K+K T P   T   ++  + ++   D A  L++ 
Sbjct  173   ILFDLLIRACCEMKRGDNAFMCFDMMKKKGTVPKIETCNDMLSLFLKLNRTDVAWVLYAE  232

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             M    +   V T+N ++   C+EG++K++ + +  M    ++P+ VT NT+I+GYC  G 
Sbjct  233   MFRLRIQSTVYTFNIMINVLCKEGKLKKAKEFIGFMESLGVKPNVVTYNTIIHGYCWRGR  292

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
             +  A  + + M   G+ PDS+TY +LI G CK    E A  ++  M   G  P+   Y+ 
Sbjct  293   VEGARMILDVMKTKGIEPDSYTYGSLISGMCKEGRLEEASGLLEKMKEIGLRPNAVTYNT  352

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQERE  402
             L+D YC + N E      +E   RG    +S Y  +I  L   GK+D A+     M E+ 
Sbjct  353   LIDGYCNKGNLEKAFGYRNEMVERGILPTVSTYNLLIHALFLEGKMDEADDMIKNMGEKG  412

Query  401   ILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSL--LD  228
             I  DS+ Y  L   Y + GN + A  L +EM  + +  T   Y SL       N +   D
Sbjct  413   IFPDSITYNILINGYCRCGNAKKAFSLHNEMVGKGIQPTRITYTSLIYVLNKRNRMREAD  472

Query  227   LFWNNVMQRGL  195
               + N++++G+
Sbjct  473   NLFENIVRKGV  483


 Score =   104 bits (260),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 98/186 (53%), Gaps = 2/186 (1%)
 Frame = -2

Query  1520  LIFYANSK-RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLG  1344
             LI+  N + R  +A  +FE++    + PD      L++     G  D  +   K+M    
Sbjct  458   LIYVLNKRNRMREADNLFENIVRKGVFPDLIMFNALIDGHCANGNIDRAFALLKEMDTRK  517

Query  1343  VLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEAL  1164
             V P+   YN L+   C+ G+VE+A + L EM+ +GI PD  ++NTLIS Y RRG   +A 
Sbjct  518   VFPDEVTYNTLMRGRCREGKVEEARKLLEEMKSRGIKPDHISYNTLISGYSRRGDMNDAF  577

Query  1163  SVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGY  987
              V+D M   G  P ++TYN+LI   C+    + A  L K++  K + P++ TY +LI+  
Sbjct  578   KVRDEMLSIGFNPTLLTYNALIQGLCKNQEGQHAEELLKEMVSKGIAPDDSTYISLIEAM  637

Query  986   CRVGDI  969
                 D+
Sbjct  638   GNADDL  643


 Score = 67.4 bits (163),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 79/178 (44%), Gaps = 18/178 (10%)
 Frame = -2

Query  1682  SMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALV----------------RSDDDS  1551
             S+IY+L K    + A ++   I  K       + NAL+                +  D  
Sbjct  457   SLIYVLNKRNRMREADNLFENIVRKGVFPDLIMFNALIDGHCANGNIDRAFALLKEMDTR  516

Query  1550  DV--NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTV  1377
              V  +   ++ L+       +  +A ++ E ++   IKPD  +   L++   + G  +  
Sbjct  517   KVFPDEVTYNTLMRGRCREGKVEEARKLLEEMKSRGIKPDHISYNTLISGYSRRGDMNDA  576

Query  1376  WKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             +K   +M+ +G  P +  YN LI   CK+ E + A+E L EM  KGI PD  T+ +LI
Sbjct  577   FKVRDEMLSIGFNPTLLTYNALIQGLCKNQEGQHAEELLKEMVSKGIAPDDSTYISLI  634



>gb|EYU45778.1| hypothetical protein MIMGU_mgv1a023474mg [Erythranthe guttata]
Length=570

 Score =   267 bits (683),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 166/531 (31%), Positives = 271/531 (51%), Gaps = 15/531 (3%)
 Frame = -2

Query  1889  SQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPN  1710
             SQ ++      L+    NLL P++     + +I     +LSP   +   SFF W+ +  N
Sbjct  17    SQAIQNSPSKPLQSSLKNLL-PRLKPQHITNLITLNPNSLSPLSLF---SFFTWLSSPTN  72

Query  1709  ---YRHSLQSSWSMIYILTKHKHFKSAKDMLHQIAC-KDFLSSPAVLNALVRSDDDSDVN  1542
                +RH+L S  +MI+ L  H+    AK ++  +   K   S+P V  A++ +      +
Sbjct  73    SAAFRHTLHSYCTMIHFLCTHQLLVEAKSLIQIVVSRKGKDSAPDVFAAILETKGTQRSD  132

Query  1541  SQVFSWLLIFYANSKRTWDAIQVFEHLRICR---IKPDPHACTVLLNSLVKEGLTDTVWK  1371
               VFS L+  Y       DAIQ F   R+C+    +     C  +L+ L+     + VW 
Sbjct  133   IYVFSGLITAYLELGFVPDAIQCF---RLCKKHDFRVPFDTCKKVLDHLMNLRSFNLVWG  189

Query  1370  TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYC  1191
              YK+++  G  P+++ +N L+H  CK GE+  A    + +   G+ P   +FNTL++ Y 
Sbjct  190   FYKEILGCGYPPSLYFFNNLMHRFCKGGEMVLALSVFNGIRKWGLSPSAVSFNTLMNGYI  249

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEV  1014
             R G   E   ++  ME  G+ PD+ TY+ LI+  C+E RM  A  LF ++ E  + PN+V
Sbjct  250   RVGDIDEGFRLKSDMEASGIRPDVYTYSVLINGLCKERRMDSAHELFDEMLENGLAPNDV  309

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             TYTTLIDG+C+ G +D A+ ++  M  KGL P + TYN+I+   C+ G +K++  L+ +M
Sbjct  310   TYTTLIDGHCKNGRVDLAMEIYDQMLSKGLSPDLVTYNAIINGLCKNGDLKQAQDLIGEM  369

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
               K ++PD +T  TLI+G CK GD+ SA KV+  M++  +  D   Y ALI G CK    
Sbjct  370   SLKGLKPDKITYTTLIDGCCKEGDLESAFKVRETMIKQRIPLDDVAYTALISGLCKEGRE  429

Query  653   ERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAI  474
               A++++ +M   GF      Y+ +++ +C + + +   K+  E    G    +  Y  +
Sbjct  430   VEAEKMLREMSRLGFKADDETYTMIINGFCKKGDVKTASKMLREMQSDGRKPSVVTYNVL  489

Query  473   IRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDL  321
             +   CK+G+L  A      M    ++ D V Y  L   + K GN    S+L
Sbjct  490   MNGYCKQGQLKNANVLLIAMMNLGVVPDDVTYNILLEGHCKYGNPDDVSNL  540


 Score =   189 bits (479),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 118/395 (30%), Positives = 192/395 (49%), Gaps = 54/395 (14%)
 Frame = -2

Query  1331  IHIYNVLIHACC-----------------KSGEVEKADEFLSEMEFKGI-FPDLYTFNTL  1206
             +H Y  +IH  C                 + G+    D F + +E KG    D+Y F+ L
Sbjct  80    LHSYCTMIHFLCTHQLLVEAKSLIQIVVSRKGKDSAPDVFAAILETKGTQRSDIYVFSGL  139

Query  1205  ISLYCRRGMHYEALS-------------------VQDRMER----------------GGV  1131
             I+ Y   G   +A+                    V D +                   G 
Sbjct  140   ITAYLELGFVPDAIQCFRLCKKHDFRVPFDTCKKVLDHLMNLRSFNLVWGFYKEILGCGY  199

Query  1130  EPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALR  954
              P +  +N+L+H  C+ G M  A+ +F  I++  ++P+ V++ TL++GY RVGDIDE  R
Sbjct  200   PPSLYFFNNLMHRFCKGGEMVLALSVFNGIRKWGLSPSAVSFNTLMNGYIRVGDIDEGFR  259

Query  953   LHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYC  774
             L S ME  G+ P V TY+ ++   C+E RM  + +L ++M E  + P++VT  TLI+G+C
Sbjct  260   LKSDMEASGIRPDVYTYSVLINGLCKERRMDSAHELFDEMLENGLAPNDVTYTTLIDGHC  319

Query  773   KIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYC  594
             K G +  A+++ ++ML  GL PD  TY A+I+G CK  D ++A+++I +M   G  P   
Sbjct  320   KNGRVDLAMEIYDQMLSKGLSPDLVTYNAIINGLCKNGDLKQAQDLIGEMSLKGLKPDKI  379

Query  593   AYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMM  414
              Y+ L+D  C + + E+  K+ +    +   +D   Y A+I  LCK G+   AE+    M
Sbjct  380   TYTTLIDGCCKEGDLESAFKVRETMIKQRIPLDDVAYTALISGLCKEGREVEAEKMLREM  439

Query  413   QEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                    D   YT +   + K+G+ + AS +  EM
Sbjct  440   SRLGFKADDETYTMIINGFCKKGDVKTASKMLREM  474


 Score =   139 bits (350),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/285 (28%), Positives = 148/285 (52%), Gaps = 3/285 (1%)
 Frame = -2

Query  1142  RGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VTPNEVTYTTLIDGYCRVGDI  969
             +G    DI  ++ LI ++   G + +A++ F+  K+     P + T   ++D    +   
Sbjct  126   KGTQRSDIYVFSGLITAYLELGFVPDAIQCFRLCKKHDFRVPFD-TCKKVLDHLMNLRSF  184

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
             +     +  +   G  P +  +N+++ +FC+ G M  +  + N + +  + P  V+ NTL
Sbjct  185   NLVWGFYKEILGCGYPPSLYFFNNLMHRFCKGGEMVLALSVFNGIRKWGLSPSAVSFNTL  244

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             +NGY ++GDI    ++K+ M  +G+RPD +TY  LI+G CK +  + A E+  +M+  G 
Sbjct  245   MNGYIRVGDIDEGFRLKSDMEASGIRPDVYTYSVLINGLCKERRMDSAHELFDEMLENGL  304

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
             +P+   Y+ L+D +C     +  +++ D+   +G   D+  Y AII  LCK G L  A+ 
Sbjct  305   APNDVTYTTLIDGHCKNGRVDLAMEIYDQMLSKGLSPDLVTYNAIINGLCKNGDLKQAQD  364

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
               G M  + +  D + YT+L     KEG+  +A  + + M K+R+
Sbjct  365   LIGEMSLKGLKPDKITYTTLIDGCCKEGDLESAFKVRETMIKQRI  409


 Score =   119 bits (297),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 133/291 (46%), Gaps = 39/291 (13%)
 Frame = -2

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
              +S L+      +R   A ++F+ +    + P+    T L++   K G  D   + Y +M
Sbjct  275   TYSVLINGLCKERRMDSAHELFDEMLENGLAPNDVTYTTLIDGHCKNGRVDLAMEIYDQM  334

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             +  G+ P++  YN +I+  CK+G++++A + + EM  KG+ PD  T+ TLI   C+ G  
Sbjct  335   LSKGLSPDLVTYNAIINGLCKNGDLKQAQDLIGEMSLKGLKPDKITYTTLIDGCCKEGDL  394

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGR-------MREAMRL-FKDIKEKVT--  1026
               A  V++ M +  +  D + Y +LI   C+EGR       +RE  RL FK   E  T  
Sbjct  395   ESAFKVRETMIKQRIPLDDVAYTALISGLCKEGREVEAEKMLREMSRLGFKADDETYTMI  454

Query  1025  --------------------------PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
                                       P+ VTY  L++GYC+ G +  A  L  AM   G+
Sbjct  455   INGFCKKGDVKTASKMLREMQSDGRKPSVVTYNVLMNGYCKQGQLKNANVLLIAMMNLGV  514

Query  923   CPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCK  771
              P   TYN +L   C+ G   + + L    G K +  D  + N++I G  K
Sbjct  515   VPDDVTYNILLEGHCKYGNPDDVSNL---RGAKGLVLDYASYNSVIGGLSK  562



>ref|XP_007141926.1| hypothetical protein PHAVU_008G237700g [Phaseolus vulgaris]
 gb|ESW13920.1| hypothetical protein PHAVU_008G237700g [Phaseolus vulgaris]
Length=609

 Score =   268 bits (685),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 150/469 (32%), Positives = 252/469 (54%), Gaps = 5/469 (1%)
 Frame = -2

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSD  1560
             FF ++ + P YRH+L S  +M++ L  H+    A  +L  I  +   +S + L + +   
Sbjct  102   FFNYLASRPPYRHTLHSYCTMLHFLYLHRMLPQAHSLLSFIVSRKGSNSASSLFSSILRT  161

Query  1559  DDSDVNSQ--VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV--KEG  1392
               S  +S   VF  L+  Y +S    DA+Q F  +   +      AC  LL  +V  K  
Sbjct  162   LPSRHHSAGIVFDALICAYVDSGFIPDAVQCFRLVTKNKFPVPVRACDNLLRHVVRLKPL  221

Query  1391  LTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFN  1212
               +  W  Y +++  G  P I+ +NVL+H  CK G+V  A     E+  +G+ P + +FN
Sbjct  222   EVERSWALYLEVLDSGYPPRIYFFNVLMHGFCKVGDVGNARLVFDEIPKRGLRPTVVSFN  281

Query  1211  TLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KE  1035
             TLIS +C+ G   E   ++  ME  G+ PD+ T+++LI+  C+EGR+ E   LF ++   
Sbjct  282   TLISGWCKVGNVGEGFRLKGVMESEGIFPDVFTFSALINGLCKEGRLDEGSLLFDEMCGR  341

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
              + PN VT+TTLIDG C+ G +D AL+    M  +G+ P + TYN++L   C+ G +KE+
Sbjct  342   GLVPNGVTFTTLIDGQCKGGKVDLALKNFQMMLTQGVRPDLVTYNALLNGLCKVGDLKEA  401

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
              +L+N+M    ++PD +T  TLI+G+CK G++ SAL++K +M+E G+  D+  + ALI G
Sbjct  402   RRLVNEMSASGLKPDKITFTTLIDGFCKDGEMESALEIKRRMVEEGIELDNVAFTALISG  461

Query  674   FCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVD  495
              C+      A+ ++ DM++AGF P    Y+ ++D +C +   +   KL  E    G+   
Sbjct  462   LCRDGRVHDAERMLRDMLSAGFKPDDPTYTMVIDCFCKKGEVKVGFKLLKEMQSNGHMPG  521

Query  494   ISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKE  348
             +  Y A++  +CK G++  A+     M    +  + + Y  L   + K 
Sbjct  522   VVTYNALMNGMCKLGQMKNAKMLLDAMLNLGVAPNDITYNILLDGHCKH  570


 Score =   177 bits (449),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 149/277 (54%), Gaps = 1/277 (0%)
 Frame = -2

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P I  +N L+H  C+ G +  A  +F +I K  + P  V++ TLI G+C+VG++ E 
Sbjct  237   GYPPRIYFFNVLMHGFCKVGDVGNARLVFDEIPKRGLRPTVVSFNTLISGWCKVGNVGEG  296

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              RL   ME +G+ P V T+++++   C+EGR+ E + L ++M  + + P+ VT  TLI+G
Sbjct  297   FRLKGVMESEGIFPDVFTFSALINGLCKEGRLDEGSLLFDEMCGRGLVPNGVTFTTLIDG  356

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
              CK G +  ALK    ML  G+RPD  TY AL++G CK  D + A+ ++ +M A+G  P 
Sbjct  357   QCKGGKVDLALKNFQMMLTQGVRPDLVTYNALLNGLCKVGDLKEARRLVNEMSASGLKPD  416

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                ++ L+D +C     E+ +++       G  +D   + A+I  LC+ G++  AER   
Sbjct  417   KITFTTLIDGFCKDGEMESALEIKRRMVEEGIELDNVAFTALISGLCRDGRVHDAERMLR  476

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              M       D   YT +   + K+G  +    L  EM
Sbjct  477   DMLSAGFKPDDPTYTMVIDCFCKKGEVKVGFKLLKEM  513



>ref|XP_009412297.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Musa acuminata subsp. malaccensis]
 ref|XP_009412298.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Musa acuminata subsp. malaccensis]
Length=966

 Score =   275 bits (702),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/540 (30%), Positives = 294/540 (54%), Gaps = 16/540 (3%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTL--LTLSPCWFWLSWSFFKWVE  1722
             + ++LV  +C I+    ++ +  PK+    +  I++  L  L L P        FF+   
Sbjct  43    SRTELVDRICRILTLQRFHAI--PKLPFDFSDGILDDVLVRLRLDP---DACLGFFRIAL  97

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPA-----VLNALVRSDD  1557
                 +R +++S   +++IL++ + F  A+  L  +      +S       V + LV+   
Sbjct  98    RQQYFRPNVESYCRIVHILSRARMFDDARAFLKDLVAMTSSASSKTSVSFVFDTLVKVHK  157

Query  1556  DSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTV  1377
             +   +  VF  LL  YA      +A+ +F+++  C  KP   +C  LL++LV+ G +DT 
Sbjct  158   EFSFSPTVFDMLLKAYAEGGLKKEALFLFDNMGKCGCKPSLRSCNSLLSTLVRGGESDTA  217

Query  1376  WKTYKKMIKLG--VLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
                Y++M++ G  +LP++   +++++A CK G ++KA  F+ +ME KG   +L T+++LI
Sbjct  218   ALVYEQMVRTGTGILPDVFTVSIMVNAYCKDGNLQKASNFVMQMERKGFEVNLVTYHSLI  277

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE--KV  1029
             + YC  G    AL V D M + G+ P++I+Y  LI  +C+EG++REA ++ +++KE   +
Sbjct  278   NGYCSLGQTEAALKVFDLMSQRGIVPNVISYTLLIKGYCKEGKVREAEKILENMKEMHGL  337

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
             + +EV Y  LI+ +C+ G +D+A+R+ + M   GL   +   N+++  +C+ GR+ E+ K
Sbjct  338   SADEVAYGVLINAFCQTGKMDDAIRIRNKMLSMGLKENLFICNTMINGYCKLGRIGEAEK  397

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L+N M     +PD+ + N L++GYCK G + +A K+ ++M+  G+R    TY  L  GFC
Sbjct  398   LINDMELGYPKPDSYSYNALLDGYCKKGLMRNAFKICDRMIMKGIRVTVLTYNTLFKGFC  457

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
              A   + A  + F M+  G +P+  + S L+D +    N E  +KL ++   RG+  +  
Sbjct  458   LAGAMDDALNLWFLMLKRGVAPNEISCSTLLDGFFKSGNFEQALKLWNDMLARGFTKNQI  517

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              +  +I   CK GK+D AE+    M++   L DS+ Y +L   Y + G+   A  + DEM
Sbjct  518   IFNTVINGFCKTGKIDEAEKIIQKMKDCGCLPDSITYRTLIDGYCRVGDMGKAFKVRDEM  577


 Score =   216 bits (549),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 125/451 (28%), Positives = 233/451 (52%), Gaps = 4/451 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLR-ICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             ++ L+  Y    +  +A ++ E+++ +  +  D  A  VL+N+  + G  D   +   KM
Sbjct  308   YTLLIKGYCKEGKVREAEKILENMKEMHGLSADEVAYGVLINAFCQTGKMDDAIRIRNKM  367

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             + +G+  N+ I N +I+  CK G + +A++ +++ME     PD Y++N L+  YC++G+ 
Sbjct  368   LSMGLKENLFICNTMINGYCKLGRIGEAEKLINDMELGYPKPDSYSYNALLDGYCKKGLM  427

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL-FKDIKEKVTPNEVTYTTL  999
               A  + DRM   G+   ++TYN+L    C  G M +A+ L F  +K  V PNE++ +TL
Sbjct  428   RNAFKICDRMIMKGIRVTVLTYNTLFKGFCLAGAMDDALNLWFLMLKRGVAPNEISCSTL  487

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             +DG+ + G+ ++AL+L + M  +G       +N+++  FC+ G++ E+ K++ +M +   
Sbjct  488   LDGFFKSGNFEQALKLWNDMLARGFTKNQIIFNTVINGFCKTGKIDEAEKIIQKMKDCGC  547

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
              PD++T  TLI+GYC++GD+  A KV+++M   G  P    Y +LI G   A  ++R  +
Sbjct  548   LPDSITYRTLIDGYCRVGDMGKAFKVRDEMETLGFSPSIEMYNSLISGNFVANTSDRVDD  607

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++ D+   G  P+   Y  L+  +C +   +       E  G+G   +I    A++  L 
Sbjct  608   LLKDVHEKGLVPNIATYGALIAGWCKEGMMDKAFDAYLEMVGKGLPPNIFICSALVSGLY  667

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlk  279
             ++GK+D A      + +  +L D      L     K       +DLF E     L     
Sbjct  668   RQGKIDEANVLLAKIVDIRMLPDFEASDKLLNHDAKSTYMHRITDLFTEYANENLQPNNV  727

Query  278   lykslsassKDENSLLDL--FWNNVMQRGLI  192
             +   +         +L++  F++N++QRGLI
Sbjct  728   ICNVIICGLCRSGKVLEVKQFYSNLLQRGLI  758


 Score =   195 bits (496),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 124/422 (29%), Positives = 225/422 (53%), Gaps = 2/422 (0%)
 Frame = -2

Query  1550  DVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWK  1371
             +VN   +  L+  Y +  +T  A++VF+ +    I P+  + T+L+    KEG      K
Sbjct  267   EVNLVTYHSLINGYCSLGQTEAALKVFDLMSQRGIVPNVISYTLLIKGYCKEGKVREAEK  326

Query  1370  TYKKMIKL-GVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY  1194
               + M ++ G+  +   Y VLI+A C++G+++ A    ++M   G+  +L+  NT+I+ Y
Sbjct  327   ILENMKEMHGLSADEVAYGVLINAFCQTGKMDDAIRIRNKMLSMGLKENLFICNTMINGY  386

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLF-KDIKEKVTPNE  1017
             C+ G   EA  + + ME G  +PD  +YN+L+  +C++G MR A ++  + I + +    
Sbjct  387   CKLGRIGEAEKLINDMELGYPKPDSYSYNALLDGYCKKGLMRNAFKICDRMIMKGIRVTV  446

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
             +TY TL  G+C  G +D+AL L   M ++G+ P   + +++L  F + G  +++ KL N 
Sbjct  447   LTYNTLFKGFCLAGAMDDALNLWFLMLKRGVAPNEISCSTLLDGFFKSGNFEQALKLWND  506

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             M  +    + +  NT+ING+CK G I  A K+  KM + G  PDS TY+ LI G+C+  D
Sbjct  507   MLARGFTKNQIIFNTVINGFCKTGKIDEAEKIIQKMKDCGCLPDSITYRTLIDGYCRVGD  566

Query  656   TERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRA  477
               +A +V  +M   GFSPS   Y+ L+    + N ++ +  L  +   +G   +I+ Y A
Sbjct  567   MGKAFKVRDEMETLGFSPSIEMYNSLISGNFVANTSDRVDDLLKDVHEKGLVPNIATYGA  626

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRR  297
             +I   CK G +D A   +  M  + +  +  + ++L    +++G    A+ L  ++   R
Sbjct  627   LIAGWCKEGMMDKAFDAYLEMVGKGLPPNIFICSALVSGLYRQGKIDEANVLLAKIVDIR  686

Query  296   LM  291
             ++
Sbjct  687   ML  688


 Score =   191 bits (484),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 123/457 (27%), Positives = 203/457 (44%), Gaps = 71/457 (16%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             + P+  +C+ LL+   K G  +   K +  M+  G   N  I+N +I+  CK+G++++A+
Sbjct  477   VAPNEISCSTLLDGFFKSGNFEQALKLWNDMLARGFTKNQIIFNTVINGFCKTGKIDEAE  536

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             + + +M+  G  PD  T+ TLI  YCR G   +A  V+D ME  G  P I  YNSLI  +
Sbjct  537   KIIQKMKDCGCLPDSITYRTLIDGYCRVGDMGKAFKVRDEMETLGFSPSIEMYNSLISGN  596

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYC------------------------  984
                        L KD+ EK + PN  TY  LI G+C                        
Sbjct  597   FVANTSDRVDDLLKDVHEKGLVPNIATYGALIAGWCKEGMMDKAFDAYLEMVGKGLPPNI  656

Query  983   -----------RVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
                        R G IDEA  L + + +  + P     + +L    +   M   T L  +
Sbjct  657   FICSALVSGLYRQGKIDEANVLLAKIVDIRMLPDFEASDKLLNHDAKSTYMHRITDLFTE  716

Query  836   MGEKKIEPDNVTCN-----------------------------------TLINGYCKIGD  762
                + ++P+NV CN                                   +LI+GY   G 
Sbjct  717   YANENLQPNNVICNVIICGLCRSGKVLEVKQFYSNLLQRGLIPDHFTYCSLIHGYSSAGS  776

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
             +  A +++++ML  GL P+  TY ALI+G CK+ + +RA  +   + + G +P+   Y+ 
Sbjct  777   VDEAFELRDEMLRKGLVPNIVTYNALINGLCKSGNLDRAVNLFNKLQSKGLAPNVITYNT  836

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQERE  402
             L+D YC         K   +    G C ++  Y  +I  LC +G+++ + +    M E  
Sbjct  837   LIDGYCKVGELTEAFKFKQKMIEAGICPNVVTYSTLINGLCCQGEMEASIKILDQMIESG  896

Query  401   ILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
             +  D V Y++L + Y K G T+  + L++EM+ R L+
Sbjct  897   VDPDYVTYSTLIHGYIKRGETQQVTKLYEEMHIRGLL  933


 Score =   178 bits (451),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 112/419 (27%), Positives = 195/419 (47%), Gaps = 36/419 (9%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N  +F+ ++  +  + +  +A ++ + ++ C   PD      L++   + G     +K  
Sbjct  515   NQIIFNTVINGFCKTGKIDEAEKIIQKMKDCGCLPDSITYRTLIDGYCRVGDMGKAFKVR  574

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M  LG  P+I +YN LI     +   ++ D+ L ++  KG+ P++ T+  LI+ +C+ 
Sbjct  575   DEMETLGFSPSIEMYNSLISGNFVANTSDRVDDLLKDVHEKGLVPNIATYGALIAGWCKE  634

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREA---------MRLFKDIK--  1038
             GM  +A      M   G+ P+I   ++L+    R+G++ EA         +R+  D +  
Sbjct  635   GMMDKAFDAYLEMVGKGLPPNIFICSALVSGLYRQGKIDEANVLLAKIVDIRMLPDFEAS  694

Query  1037  -------------------------EKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEE  933
                                      E + PN V    +I G CR G + E  + +S + +
Sbjct  695   DKLLNHDAKSTYMHRITDLFTEYANENLQPNNVICNVIICGLCRSGKVLEVKQFYSNLLQ  754

Query  932   KGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVS  753
             +GL P   TY S++  +   G + E+ +L ++M  K + P+ VT N LING CK G++  
Sbjct  755   RGLIPDHFTYCSLIHGYSSAGSVDEAFELRDEMLRKGLVPNIVTYNALINGLCKSGNLDR  814

Query  752   ALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
             A+ + NK+   GL P+  TY  LI G+CK  +   A +    MI AG  P+   YS L++
Sbjct  815   AVNLFNKLQSKGLAPNVITYNTLIDGYCKVGELTEAFKFKQKMIEAGICPNVVTYSTLIN  874

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
               C Q   EA +K+ D+    G   D   Y  +I    KRG+     + +  M  R +L
Sbjct  875   GLCCQGEMEASIKILDQMIESGVDPDYVTYSTLIHGYIKRGETQQVTKLYEEMHIRGLL  933


 Score =   166 bits (419),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/285 (31%), Positives = 158/285 (55%), Gaps = 1/285 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             + P+   C+ L++ L ++G  D       K++ + +LP+    + L++   KS  + +  
Sbjct  652   LPPNIFICSALVSGLYRQGKIDEANVLLAKIVDIRMLPDFEASDKLLNHDAKSTYMHRIT  711

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             +  +E   + + P+    N +I   CR G   E       + + G+ PD  TY SLIH +
Sbjct  712   DLFTEYANENLQPNNVICNVIICGLCRSGKVLEVKQFYSNLLQRGLIPDHFTYCSLIHGY  771

Query  1088  CREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
                G + EA  L  + +++ + PN VTY  LI+G C+ G++D A+ L + ++ KGL P V
Sbjct  772   SSAGSVDEAFELRDEMLRKGLVPNIVTYNALINGLCKSGNLDRAVNLFNKLQSKGLAPNV  831

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYN+++  +C+ G + E+ K   +M E  I P+ VT +TLING C  G++ +++K+ ++
Sbjct  832   ITYNTLIDGYCKVGELTEAFKFKQKMIEAGICPNVVTYSTLINGLCCQGEMEASIKILDQ  891

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSY  597
             M+E+G+ PD  TY  LIHG+ K  +T++  ++  +M   G  P +
Sbjct  892   MIESGVDPDYVTYSTLIHGYIKRGETQQVTKLYEEMHIRGLLPVF  936


 Score =   127 bits (318),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 123/220 (56%), Gaps = 1/220 (0%)
 Frame = -2

Query  1565  SDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
             ++++   N+ + + ++     S +  +  Q + +L    + PD      L++     G  
Sbjct  718   ANENLQPNNVICNVIICGLCRSGKVLEVKQFYSNLLQRGLIPDHFTYCSLIHGYSSAGSV  777

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
             D  ++   +M++ G++PNI  YN LI+  CKSG +++A    ++++ KG+ P++ T+NTL
Sbjct  778   DEAFELRDEMLRKGLVPNIVTYNALINGLCKSGNLDRAVNLFNKLQSKGLAPNVITYNTL  837

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKV  1029
             I  YC+ G   EA   + +M   G+ P+++TY++LI+  C +G M  ++++    I+  V
Sbjct  838   IDGYCKVGELTEAFKFKQKMIEAGICPNVVTYSTLINGLCCQGEMEASIKILDQMIESGV  897

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVA  909
              P+ VTY+TLI GY + G+  +  +L+  M  +GL P  A
Sbjct  898   DPDYVTYSTLIHGYIKRGETQQVTKLYEEMHIRGLLPVFA  937



>emb|CDP08449.1| unnamed protein product [Coffea canephora]
Length=714

 Score =   269 bits (688),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 166/545 (30%), Positives = 266/545 (49%), Gaps = 71/545 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++HS  S  S I++L + +    A+ ++ ++  K  +S   ++++LV S +D   + +
Sbjct  94    PNFKHSSTSLSSAIHVLVRSRRVSDAQALVLRMIRKSGVSRIEIVDSLVSSYEDFGSDLR  153

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +A++ F  L+        +AC  LL  LVK    D  W+ Y ++
Sbjct  154   VFDLLIRTYVQARKLREAVEAFHVLKSRGFCVSINACNSLLGGLVKIEWIDWAWEVYHEI  213

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY------  1194
             ++ G+  N++  N++++A CK G+++    FLSEME KGIF D  T+NTLI+ Y      
Sbjct  214   VRCGIQVNVYTLNIMVNAMCKQGKIDAVKGFLSEMEEKGIFSDSVTYNTLINAYSREGKL  273

Query  1193  -----------------------------CRRGMHYEALSVQDRMERGGVEPDIITYNSL  1101
                                          C+ G + +A  V D M + G+ PD  TYNSL
Sbjct  274   EEAFGLMNVMSAEGFKPCLLTFNCIVNGLCKNGKYGKATQVLDEMVKIGLSPDTATYNSL  333

Query  1100  IHSHCREGRMREAMRLF-----------------------------------KDIKEK-V  1029
             +   CR G + EA  +F                                   KD+K   +
Sbjct  334   LAECCRSGNLSEAESVFSEMLHRGVIPDLVSYSSLIALFSRVGLLDRALGYYKDMKSNGL  393

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              P++V YT LI G+C+ G + EA+R+   M EKG    V TYN+IL   C +  + E+ +
Sbjct  394   IPDKVIYTILIGGFCKHGSMLEAMRIRDEMLEKGCLMDVVTYNTILNALCNKKMLSEADQ  453

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             LLN+M E+ + PD  T  TLINGYCK G++  AL +   ML+  L+PD  TY  LI GFC
Sbjct  454   LLNEMFERGVFPDYYTYTTLINGYCKDGNMSKALTLFRSMLQRNLKPDIVTYNTLIDGFC  513

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             KA + E A  +  +MI     P+   YS L++ +C +      ++L ++         + 
Sbjct  514   KAGEIEEAILLRDEMITKSVLPNLITYSILINGFCSRGFISDALRLWEKMVDTRIQPSLV  573

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                ++I+  C+ G+ + A +F G M+ + +  D   Y +L   Y KE N   A DL  EM
Sbjct  574   TCNSLIKGYCRHGETEKACQFLGQMRSQGVFPDCFTYNTLINGYIKEENMDKAFDLLSEM  633

Query  308   YKRRL  294
               + L
Sbjct  634   ENQGL  638


 Score =   228 bits (581),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 141/525 (27%), Positives = 246/525 (47%), Gaps = 54/525 (10%)
 Frame = -2

Query  1754  WLSWSFFKWVETIP-NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLN  1578
             W+ W++  + E +    + ++ +   M+  + K     + K  L ++  K   S     N
Sbjct  202   WIDWAWEVYHEIVRCGIQVNVYTLNIMVNAMCKQGKIDAVKGFLSEMEEKGIFSDSVTYN  261

Query  1577  ALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK  1398
              L+ +                 Y+   +  +A  +   +     KP       ++N L K
Sbjct  262   TLINA-----------------YSREGKLEEAFGLMNVMSAEGFKPCLLTFNCIVNGLCK  304

Query  1397  EGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYT  1218
              G      +   +M+K+G+ P+   YN L+  CC+SG + +A+   SEM  +G+ PDL +
Sbjct  305   NGKYGKATQVLDEMVKIGLSPDTATYNSLLAECCRSGNLSEAESVFSEMLHRGVIPDLVS  364

Query  1217  FNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK  1038
             +++LI+L+ R G+   AL     M+  G+ PD + Y  LI   C+ G M EAMR+  ++ 
Sbjct  365   YSSLIALFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILIGGFCKHGSMLEAMRIRDEML  424

Query  1037  EK------------------------------------VTPNEVTYTTLIDGYCRVGDID  966
             EK                                    V P+  TYTTLI+GYC+ G++ 
Sbjct  425   EKGCLMDVVTYNTILNALCNKKMLSEADQLLNEMFERGVFPDYYTYTTLINGYCKDGNMS  484

Query  965   EALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLI  786
             +AL L  +M ++ L P + TYN+++  FC+ G ++E+  L ++M  K + P+ +T + LI
Sbjct  485   KALTLFRSMLQRNLKPDIVTYNTLIDGFCKAGEIEEAILLRDEMITKSVLPNLITYSILI  544

Query  785   NGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFS  606
             NG+C  G I  AL++  KM++  ++P   T  +LI G+C+  +TE+A + +  M + G  
Sbjct  545   NGFCSRGFISDALRLWEKMVDTRIQPSLVTCNSLIKGYCRHGETEKACQFLGQMRSQGVF  604

Query  605   PSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERF  426
             P    Y+ L++ Y  + N +    L  E   +G   ++  Y  ++   CK G++  A   
Sbjct  605   PDCFTYNTLINGYIKEENMDKAFDLLSEMENQGLSPNVITYNVMLDGFCKLGRMQEANML  664

Query  425   FGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
             +  M  R I  D   YTSL   +    N + A+   DEM +R  M
Sbjct  665   YRKMSGRGINPDRATYTSLINGHVSLDNFKEAAWFHDEMLQRGFM  709


 Score =   215 bits (547),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 128/411 (31%), Positives = 217/411 (53%), Gaps = 5/411 (1%)
 Frame = -2

Query  1613  CKD--FLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKP  1440
             CK+  +  +  VL+ +V+     D  +  ++ LL     S    +A  VF  +    + P
Sbjct  303   CKNGKYGKATQVLDEMVKIGLSPD--TATYNSLLAECCRSGNLSEAESVFSEMLHRGVIP  360

Query  1439  DPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFL  1260
             D  + + L+    + GL D     YK M   G++P+  IY +LI   CK G + +A    
Sbjct  361   DLVSYSSLIALFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILIGGFCKHGSMLEAMRIR  420

Query  1259  SEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCRE  1080
              EM  KG   D+ T+NT+++  C + M  EA  + + M   GV PD  TY +LI+ +C++
Sbjct  421   DEMLEKGCLMDVVTYNTILNALCNKKMLSEADQLLNEMFERGVFPDYYTYTTLINGYCKD  480

Query  1079  GRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATY  903
             G M +A+ LF+ + ++ + P+ VTY TLIDG+C+ G+I+EA+ L   M  K + P + TY
Sbjct  481   GNMSKALTLFRSMLQRNLKPDIVTYNTLIDGFCKAGEIEEAILLRDEMITKSVLPNLITY  540

Query  902   NSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLE  723
             + ++  FC  G + ++ +L  +M + +I+P  VTCN+LI GYC+ G+   A +   +M  
Sbjct  541   SILINGFCSRGFISDALRLWEKMVDTRIQPSLVTCNSLIKGYCRHGETEKACQFLGQMRS  600

Query  722   AGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEA  543
              G+ PD FTY  LI+G+ K ++ ++A +++ +M   G SP+   Y+ ++D +C     + 
Sbjct  601   QGVFPDCFTYNTLINGYIKEENMDKAFDLLSEMENQGLSPNVITYNVMLDGFCKLGRMQE  660

Query  542   LVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
                L  + SGRG   D + Y ++I           A  F   M +R  + D
Sbjct  661   ANMLYRKMSGRGINPDRATYTSLINGHVSLDNFKEAAWFHDEMLQRGFMPD  711


 Score =   202 bits (513),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/351 (32%), Positives = 190/351 (54%), Gaps = 3/351 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             +S L+  ++       A+  ++ ++   + PD    T+L+    K G      +   +M+
Sbjct  365   YSSLIALFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILIGGFCKHGSMLEAMRIRDEML  424

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G L ++  YN +++A C    + +AD+ L+EM  +G+FPD YT+ TLI+ YC+ G   
Sbjct  425   EKGCLMDVVTYNTILNALCNKKMLSEADQLLNEMFERGVFPDYYTYTTLINGYCKDGNMS  484

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD--IKEKVTPNEVTYTTL  999
             +AL++   M +  ++PDI+TYN+LI   C+ G + EA+ L +D  I + V PN +TY+ L
Sbjct  485   KALTLFRSMLQRNLKPDIVTYNTLIDGFCKAGEIEEAI-LLRDEMITKSVLPNLITYSIL  543

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             I+G+C  G I +ALRL   M +  + P + T NS+++ +C  G  +++ + L QM  + +
Sbjct  544   INGFCSRGFISDALRLWEKMVDTRIQPSLVTCNSLIKGYCRHGETEKACQFLGQMRSQGV  603

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
              PD  T NTLINGY K  ++  A  + ++M   GL P+  TY  ++ GFCK    + A  
Sbjct  604   FPDCFTYNTLINGYIKEENMDKAFDLLSEMENQGLSPNVITYNVMLDGFCKLGRMQEANM  663

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             +   M   G +P    Y+ L++ +   +N +      DE   RG+  D  F
Sbjct  664   LYRKMSGRGINPDRATYTSLINGHVSLDNFKEAAWFHDEMLQRGFMPDDKF  714



>ref|XP_010907418.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Elaeis guineensis]
Length=713

 Score =   268 bits (686),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 145/488 (30%), Positives = 260/488 (53%), Gaps = 1/488 (0%)
 Frame = -2

Query  1751  LSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNAL  1572
             L   F   +    + R S +S  +MI+I  +++    A+ ++ ++  +   S   +++AL
Sbjct  81    LGQRFVDLLARRSDLRLSSESLSAMIHICIRNQRTSDAQSLILRMVRRRGTSRSEIVDAL  140

Query  1571  VRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEG  1392
               +      N  VF  L+  Y  +++  +A + F  L   +     +AC  LL  LV+ G
Sbjct  141   RSTYGGFGSNPSVFDLLIRTYVQARKLREASEAFRVLHARKQSVPVNACNSLLAGLVRVG  200

Query  1391  LTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFN  1212
               D  ++ YK+++ +G   N++  N++++A CK G  + A  FLS+ME KGIF D+ T+N
Sbjct  201   WVDMAFEIYKEVVGMGTELNVYTLNIMVNAFCKDGRSDDAALFLSDMEKKGIFADIVTYN  260

Query  1211  TLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKE  1035
             TLI  +CR G   EAL + + M   G++PD+ TYN++++  C+ G+ + A  L  + +  
Sbjct  261   TLIDAWCRNGRLEEALELLNSMVGKGLKPDVRTYNAVLNGFCKNGKYKRAQELLGEMVAS  320

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
              +  N  T+   +  +C+ G++ EA+R ++ M  +GL P + +++S++  F ++G M  +
Sbjct  321   GLVLNASTFNIFLGRFCKEGNVKEAVRFYNEMLHRGLVPDMVSFSSMMGLFAKKGDMNRA  380

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
              +   +M    + PDNV    LI+G+CKIG I  ALK++++M++ G  PD  TY  +++G
Sbjct  381   LEYFKEMKTAGLVPDNVIYTMLISGFCKIGLISKALKMRDEMVDHGCMPDVVTYNTILNG  440

Query  674   FCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVD  495
              CK +    A E+  +M+  G SP YC+++ L+  YC     E  + L D    R    D
Sbjct  441   MCKEQRLPEADELFSEMMERGVSPDYCSFTTLIHGYCKNGCIEKALNLFDTMLERNLKPD  500

Query  494   ISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFD  315
             I  Y  +    CK G ++ A   +  M  REIL + + Y+ L   +  +G    A   +D
Sbjct  501   IVTYNTLFDGFCKEGDVEKANELWDDMCNREILPNHITYSILIDYHCSKGQIEKAFGFWD  560

Query  314   EMYKRRLM  291
             EM ++R++
Sbjct  561   EMTEKRIL  568


 Score =   220 bits (561),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/350 (33%), Positives = 190/350 (54%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  +A       A++ F+ ++   + PD    T+L++   K GL     K   +M+
Sbjct  364   FSSMMGLFAKKGDMNRALEYFKEMKTAGLVPDNVIYTMLISGFCKIGLISKALKMRDEMV  423

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               G +P++  YN +++  CK   + +ADE  SEM  +G+ PD  +F TLI  YC+ G   
Sbjct  424   DHGCMPDVVTYNTILNGMCKEQRLPEADELFSEMMERGVSPDYCSFTTLIHGYCKNGCIE  483

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLI  996
             +AL++ D M    ++PDI+TYN+L    C+EG + +A  L+ D+   ++ PN +TY+ LI
Sbjct  484   KALNLFDTMLERNLKPDIVTYNTLFDGFCKEGDVEKANELWDDMCNREILPNHITYSILI  543

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             D +C  G I++A      M EK + P + TYNSI++ +C  G   ++ + L +M +++I 
Sbjct  544   DYHCSKGQIEKAFGFWDEMTEKRILPNIVTYNSIIKGYCRLGNASKAEEFLQRMIQERIF  603

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD +T NTLI+G+ K   +  A  + NKM + G+ PD  TY  +I GFC+    + A  V
Sbjct  604   PDRITYNTLIHGFVKEERMQEAFGLLNKMDDEGVLPDVITYNVIISGFCEQGKMQEADWV  663

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                M   G  P    Y+ L++ +   +N +   +L DE   RG+  D  F
Sbjct  664   FKRMTNRGIQPDKSTYTTLINGFVAADNLKDAFRLHDEMLQRGFVPDDKF  713


 Score =   219 bits (558),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/376 (31%), Positives = 206/376 (55%), Gaps = 1/376 (0%)
 Frame = -2

Query  1424  TVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEF  1245
              + L    KEG      + Y +M+  G++P++  ++ ++    K G++ +A E+  EM+ 
Sbjct  330   NIFLGRFCKEGNVKEAVRFYNEMLHRGLVPDMVSFSSMMGLFAKKGDMNRALEYFKEMKT  389

Query  1244  KGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMRE  1065
              G+ PD   +  LIS +C+ G+  +AL ++D M   G  PD++TYN++++  C+E R+ E
Sbjct  390   AGLVPDNVIYTMLISGFCKIGLISKALKMRDEMVDHGCMPDVVTYNTILNGMCKEQRLPE  449

Query  1064  AMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILR  888
             A  LF ++ E+ V+P+  ++TTLI GYC+ G I++AL L   M E+ L P + TYN++  
Sbjct  450   ADELFSEMMERGVSPDYCSFTTLIHGYCKNGCIEKALNLFDTMLERNLKPDIVTYNTLFD  509

Query  887   KFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRP  708
              FC+EG ++++ +L + M  ++I P+++T + LI+ +C  G I  A    ++M E  + P
Sbjct  510   GFCKEGDVEKANELWDDMCNREILPNHITYSILIDYHCSKGQIEKAFGFWDEMTEKRILP  569

Query  707   DSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLA  528
             +  TY ++I G+C+  +  +A+E +  MI     P    Y+ L+  +  +   +    L 
Sbjct  570   NIVTYNSIIKGYCRLGNASKAEEFLQRMIQERIFPDRITYNTLIHGFVKEERMQEAFGLL  629

Query  527   DEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKE  348
             ++    G   D+  Y  II   C++GK+  A+  F  M  R I  D   YT+L   +   
Sbjct  630   NKMDDEGVLPDVITYNVIISGFCEQGKMQEADWVFKRMTNRGIQPDKSTYTTLINGFVAA  689

Query  347   GNTRAASDLFDEMYKR  300
              N + A  L DEM +R
Sbjct  690   DNLKDAFRLHDEMLQR  705


 Score =   186 bits (471),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 133/492 (27%), Positives = 236/492 (48%), Gaps = 16/492 (3%)
 Frame = -2

Query  1601  LSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACT  1422
             L    VL+ L +    S    Q F  LL   ++ + + +++    H+ I R +    A +
Sbjct  62    LPPSVVLDVLSKCSRRSPALGQRFVDLLARRSDLRLSSESLSAMIHICI-RNQRTSDAQS  120

Query  1421  VLLNSLVKEG-----LTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLS  1257
             ++L  + + G     + D +  TY      G   N  ++++LI    ++ ++ +A E   
Sbjct  121   LILRMVRRRGTSRSEIVDALRSTYG-----GFGSNPSVFDLLIRTYVQARKLREASEAFR  175

Query  1256  EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREG  1077
              +  +     +   N+L++   R G    A  +   +   G E ++ T N ++++ C++G
Sbjct  176   VLHARKQSVPVNACNSLLAGLVRVGWVDMAFEIYKEVVGMGTELNVYTLNIMVNAFCKDG  235

Query  1076  RMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYN  900
             R  +A     D+++K +  + VTY TLID +CR G ++EAL L ++M  KGL P V TYN
Sbjct  236   RSDDAALFLSDMEKKGIFADIVTYNTLIDAWCRNGRLEEALELLNSMVGKGLKPDVRTYN  295

Query  899   SILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEA  720
             ++L  FC+ G+ K + +LL +M    +  +  T N  +  +CK G++  A++  N+ML  
Sbjct  296   AVLNGFCKNGKYKRAQELLGEMVASGLVLNASTFNIFLGRFCKEGNVKEAVRFYNEMLHR  355

Query  719   GLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEAL  540
             GL PD  ++ +++  F K  D  RA E   +M  AG  P    Y+ L+  +C        
Sbjct  356   GLVPDMVSFSSMMGLFAKKGDMNRALEYFKEMKTAGLVPDNVIYTMLISGFCKIGLISKA  415

Query  539   VKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYA  360
             +K+ DE    G   D+  Y  I+  +CK  +L  A+  F  M ER +  D   +T+L + 
Sbjct  416   LKMRDEMVDHGCMPDVVTYNTILNGMCKEQRLPEADELFSEMMERGVSPDYCSFTTLIHG  475

Query  359   YFKEGNTRAASDLFDEMYKRRL---MVTlklykslsassKDENSLLDLFWNNVMQRGLIS  189
             Y K G    A +LFD M +R L   +VT            D     +L W+++  R ++ 
Sbjct  476   YCKNGCIEKALNLFDTMLERNLKPDIVTYNTLFDGFCKEGDVEKANEL-WDDMCNREILP  534

Query  188   HNVHNSIFLKLH  153
             +++  SI +  H
Sbjct  535   NHITYSILIDYH  546



>ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651511.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651512.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
Length=746

 Score =   269 bits (687),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 159/546 (29%), Positives = 268/546 (49%), Gaps = 71/546 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++HSLQS  +MI+IL + +    A+ ++ ++  K  +S   ++ +LV +  +   N  
Sbjct  126   PNFKHSLQSFSAMIHILVRSRRLPDAQAVILRMVRKSGVSRVEIVESLVLTYGNCGSNPL  185

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +  + F  L+   +    +AC  LL  LVK G  D  W+ Y+++
Sbjct  186   VFDLLVRTYVQARKLREGCEAFRVLKSKGLCVSINACNSLLGGLVKVGWVDLAWEIYQEV  245

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             ++ GV  N++  N++I+A CK+ ++E    FLS+ME KG+FPD+ T+NTLI+ YCR+G+ 
Sbjct  246   VRSGVQVNVYTLNIMINALCKNQKIENTKSFLSDMEEKGVFPDVVTYNTLINAYCRQGLL  305

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGR--------------------------  1074
              EA  + D M   G++P + TYN++I+  C+ G+                          
Sbjct  306   EEAFELMDSMSGKGLKPCVFTYNAIINGLCKTGKYLRAKGVLDEMLKIGMSPDTATYNIL  365

Query  1073  ---------MREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
                      M +A R+F ++  + V P+ V+++ LI    + G +D+AL+    M+  GL
Sbjct  366   LVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGL  425

Query  923   CP-----------------------------------RVATYNSILRKFCEEGRMKESTK  849
              P                                    V TYN+IL   C+E  + E+ +
Sbjct  426   APDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADE  485

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L  +M E+ + PD  T  TLINGY K G++  A+ +   M++  L+PD  TY  LI GFC
Sbjct  486   LFTEMTERGVFPDFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFC  545

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  + E+  E+  DMI+    P++ +Y  L++ YC         +L DE   +G+   I 
Sbjct  546   KGSEMEKVNELWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATII  605

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                 I++  C+ G    A+ F   M  + I+ D + Y +L   + KE N   A  L ++M
Sbjct  606   TCNTIVKGYCRAGNAVKADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKM  665

Query  308   YKRRLM  291
                 L+
Sbjct  666   ENSGLL  671


 Score =   222 bits (565),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 145/553 (26%), Positives = 256/553 (46%), Gaps = 64/553 (12%)
 Frame = -2

Query  1835  LLKPKIGLSVTSTIINHTLLTLSPC-WFWLSWSFFKWVETIPNYRHSLQSSWS----MIY  1671
             +LK K GL V+    N  L  L    W  L+W  ++ V      R  +Q +      MI 
Sbjct  209   VLKSK-GLCVSINACNSLLGGLVKVGWVDLAWEIYQEV-----VRSGVQVNVYTLNIMIN  262

Query  1670  ILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRT  1491
              L K++  ++ K  L  +  K         N L+ +                 Y      
Sbjct  263   ALCKNQKIENTKSFLSDMEEKGVFPDVVTYNTLINA-----------------YCRQGLL  305

Query  1490  WDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVL  1311
              +A ++ + +    +KP       ++N L K G          +M+K+G+ P+   YN+L
Sbjct  306   EEAFELMDSMSGKGLKPCVFTYNAIINGLCKTGKYLRAKGVLDEMLKIGMSPDTATYNIL  365

Query  1310  IHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL----------------------  1197
             +  CC++  +  A+    EM  +G+ PDL +F+ LI L                      
Sbjct  366   LVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGL  425

Query  1196  -------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR  1056
                          +CR G+  EAL V+D M   G   D++TYN++++  C+E  + EA  
Sbjct  426   APDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADE  485

Query  1055  LFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFC  879
             LF ++ E+ V P+  T+TTLI+GY + G++++A+ L   M ++ L P V TYN+++  FC
Sbjct  486   LFTEMTERGVFPDFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFC  545

Query  878   EEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSF  699
             +   M++  +L N M  ++I P++++   LINGYC +G +  A ++ ++M+E G      
Sbjct  546   KGSEMEKVNELWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATII  605

Query  698   TYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEF  519
             T   ++ G+C+A +  +A E + +M+  G  P    Y+ L++ +  + N +    L ++ 
Sbjct  606   TCNTIVKGYCRAGNAVKADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKM  665

Query  518   SGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
                G   D+  Y  I+    ++G++  AE     M ER +  D   YTSL   +  + N 
Sbjct  666   ENSGLLPDVITYNVILNGFSRQGRMQEAELIMLKMIERGVNPDRSTYTSLINGHVTQNNL  725

Query  338   RAASDLFDEMYKR  300
             + A  + DEM +R
Sbjct  726   KEAFRVHDEMLQR  738


 Score =   220 bits (560),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 193/350 (55%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+   + +     A++ F  ++   + PD    T+L+    + G+     K   +M+
Sbjct  397   FSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSEALKVRDEML  456

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G + ++  YN +++  CK   + +ADE  +EM  +G+FPD YTF TLI+ Y + G   
Sbjct  457   EQGCVLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLINGYSKDGNMN  516

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +A+++ + M +  ++PD++TYN+LI   C+   M +   L+ D I  ++ PN ++Y  LI
Sbjct  517   KAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILI  576

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +GYC +G + EA RL   M EKG    + T N+I++ +C  G   ++ + L+ M  K I 
Sbjct  577   NGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIV  636

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD +T NTLING+ K  ++  A  + NKM  +GL PD  TY  +++GF +    + A+ +
Sbjct  637   PDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELI  696

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             +  MI  G +P    Y+ L++ +  QNN +   ++ DE   RG+  D  F
Sbjct  697   MLKMIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVPDDKF  746



>ref|XP_008375656.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Malus domestica]
Length=755

 Score =   268 bits (686),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 158/545 (29%), Positives = 264/545 (48%), Gaps = 71/545 (13%)
 Frame = -2

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             N++HS +S  +MI++L + +    A+ ++ ++  K  +S   V ++LV +      +S +
Sbjct  136   NFKHSSESLSAMIHMLVRGRRVSDAQPLILRMVRKSGISRVGVADSLVSTYSSCGSSSLI  195

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             F   +  Y  +K+  +  + F+  R        +AC  LL  LVK G  D  W  Y +++
Sbjct  196   FDLFVRTYVQAKKLREGFEAFQVFRRKGFCVSINACNSLLGGLVKVGWFDLAWVVYGEVV  255

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               G+  N++  N++++A CK+ ++E    FLS+ME KG+F D+ T+NTLI+ YCR G+  
Sbjct  256   SSGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTYNTLINAYCREGLLE  315

Query  1172  EALSVQ-----------------------------------DRMERGGVEPDIITYNSLI  1098
             EA  ++                                   D M +GG+ PD  TYN+++
Sbjct  316   EAFQLKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKELLDEMLQGGLNPDTTTYNTML  375

Query  1097  HSHCREGRMREAMRLF-----------------------------------KDIKEK-VT  1026
                CR+G + EA  +F                                   +D+K   + 
Sbjct  376   FESCRKGDILEAEEIFHEMSLRGVVPDIVSFSSLIGVFSRNKNIDRALLYFRDMKRAGLV  435

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             P+ V YT LIDGYCR G + EAL+L   M E+G    V T+N+IL   C E  + ++ +L
Sbjct  436   PDNVIYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDADEL  495

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
              N+M E+ + PD  T  TLI+GYCK G++  +L + + M    ++PD  TY  L  GFCK
Sbjct  496   FNEMLERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFCK  555

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
               + ++AKE+  DM++    P++ +Y  L++ +C   N     +L D+    G    +  
Sbjct  556   LGEMDKAKELWGDMVSRRILPNHISYGILINGFCSLGNVHEAFRLWDQMIEEGIKPTLVT  615

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMY  306
                +I+  C+ G    A+ F G M  + ++ DS+ Y +L   Y KE N   A     EM 
Sbjct  616   CNTVIKGYCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEENLNKAFSSVQEME  675

Query  305   KRRLM  291
             K+ ++
Sbjct  676   KQGIL  680


 Score =   235 bits (600),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 139/523 (27%), Positives = 248/523 (47%), Gaps = 54/523 (10%)
 Frame = -2

Query  1760  WFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVL  1581
             WF L+W  +  V +    + ++ +   M+  L K +  +S K  L  +  K   S     
Sbjct  243   WFDLAWVVYGEVVS-SGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTY  301

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             N L+ +                 Y       +A Q+   +    +KP+      ++N L 
Sbjct  302   NTLINA-----------------YCREGLLEEAFQLKNSMSSKGLKPELFTYNAIMNGLC  344

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G      +   +M++ G+ P+   YN ++   C+ G++ +A+E   EM  +G+ PD+ 
Sbjct  345   KVGNYARAKELLDEMLQGGLNPDTTTYNTMLFESCRKGDILEAEEIFHEMSLRGVVPDIV  404

Query  1220  TFNTLISL-----------------------------------YCRRGMHYEALSVQDRM  1146
             +F++LI +                                   YCR+GM  EAL ++D M
Sbjct  405   SFSSLIGVFSRNKNIDRALLYFRDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKLRDEM  464

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDI  969
                G   D++T+N++++  CRE  + +A  LF ++ E+ V P+  T+TTLI GYC+ G++
Sbjct  465   LEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCKHGNM  524

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
              ++L L  AM    + P + TYN++   FC+ G M ++ +L   M  ++I P++++   L
Sbjct  525   TKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKAKELWGDMVSRRILPNHISYGIL  584

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             ING+C +G++  A ++ ++M+E G++P   T   +I G+C++ DT +A E +  MI+ G 
Sbjct  585   INGFCSLGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMISKGV  644

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    Y+ L++ Y  + N         E   +G   D   Y  I+   C++G++  AE 
Sbjct  645   VPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSDQFTYNIILNGFCRQGRMHEAEL  704

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                 M ER +  D   YTSL   +  + N + A    DEM +R
Sbjct  705   VLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHDEMLQR  747


 Score =   223 bits (569),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 194/350 (55%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+  ++ +K    A+  F  ++   + PD    T+L++   ++G+     K   +M+
Sbjct  406   FSSLIGVFSRNKNIDRALLYFRDMKRAGLVPDNVIYTILIDGYCRKGMMLEALKLRDEML  465

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  +N +++  C+   +  ADE  +EM  +G+ PD YTF TLI  YC+ G   
Sbjct  466   EQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLERGVIPDFYTFTTLIHGYCKHGNMT  525

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             ++L++ D M  G ++PDI+TYN+L    C+ G M +A  L+ D +  ++ PN ++Y  LI
Sbjct  526   KSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKAKELWGDMVSRRILPNHISYGILI  585

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +G+C +G++ EA RL   M E+G+ P + T N++++ +C  G   ++ + L +M  K + 
Sbjct  586   NGFCSLGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGDTTKADEFLGKMISKGVV  645

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD++T NTLINGY K  ++  A     +M + G+  D FTY  +++GFC+      A+ V
Sbjct  646   PDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSDQFTYNIILNGFCRQGRMHEAELV  705

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             +  MI  G  P    Y+ L++ +  Q+N +   +  DE   RG+  D  F
Sbjct  706   LRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHDEMLQRGFVPDDEF  755



>ref|XP_007032116.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOY03042.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=658

 Score =   266 bits (679),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/501 (29%), Positives = 266/501 (53%), Gaps = 5/501 (1%)
 Frame = -2

Query  1802  STIINHTLLTLSP--CWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDM  1629
             S +IN  L+TL+P         SFF ++ + P +RH+L+S  +M + L  HK F  A+ +
Sbjct  76    SHVIN--LITLNPHSLSPLSLLSFFNFLSSHPPFRHTLRSYSTMAHFLIAHKMFHQAQSL  133

Query  1628  LHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICR  1449
             LH +  +    S +++   +     +     VF  L+I Y +     DAIQ F  +R  +
Sbjct  134   LHFLVSRKGKGSASLVFTSIIETKGTHQCGFVFDSLMIAYKDLGFVPDAIQCFRLVRKHK  193

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
              K     C  LL+ ++K          Y +++  G  P+++ +N+L+H  C+  +++ A 
Sbjct  194   FKLPFQGCKYLLDRMMKISSPMVSLGFYLEILDYGFSPSVYNFNILMHKLCRVSQIKDAQ  253

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
                +E+  +G+   + +FNTLI+ YC+ G   E   ++  ME  G+ PD+ TY+ LI+  
Sbjct  254   MVFNEIGKRGLRATVVSFNTLINGYCKSGNLGEGFRLKRAMEDSGIRPDVFTYSVLINGL  313

Query  1088  CREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C+E R+ +A  LF+++    + PN+VT+TTLIDG C+ G ID A+  +  +  KGL P +
Sbjct  314   CKESRLDDANGLFEEMCNRGLVPNDVTFTTLIDGQCKNGRIDLAMTTYQRILSKGLKPDL  373

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
               +N+++   C+ G +KE+  L+ +M  + ++PD  T   LI+G+CK G++  A++++++
Sbjct  374   VMFNTLINGLCKAGDLKEAKNLIAEMSLRGLKPDKFTYTILIDGFCKEGNMELAIEIRDE  433

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M++ G+  D+  + ALI G C+      A+  + +M++AG  P    Y+ ++D +C   N
Sbjct  434   MVKHGIELDNVAFTALISGLCREGRLIDAERTLREMLSAGMKPDDATYTMVIDGFCKNGN  493

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
              +   KL  E    G+   +  Y  ++  LCK G++  A      M    ++ D + Y  
Sbjct  494   VKMGFKLLKEMQSDGHVPGVITYNVLMNGLCKLGQMKNANMLLDAMIGLGVVPDDITYNI  553

Query  371   LAYAYFKEGNTRAASDLFDEM  309
             L   + K+GN +  + L  EM
Sbjct  554   LLDGHCKKGNPKDFNRLKSEM  574


 Score =   133 bits (335),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 143/286 (50%), Gaps = 38/286 (13%)
 Frame = -2

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSK--RTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             L R+ +DS +   VF++ ++     K  R  DA  +FE +    + P+    T L++   
Sbjct  290   LKRAMEDSGIRPDVFTYSVLINGLCKESRLDDANGLFEEMCNRGLVPNDVTFTTLIDGQC  349

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G  D    TY++++  G+ P++ ++N LI+  CK+G++++A   ++EM  +G+ PD +
Sbjct  350   KNGRIDLAMTTYQRILSKGLKPDLVMFNTLINGLCKAGDLKEAKNLIAEMSLRGLKPDKF  409

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL----  1053
             T+  LI  +C+ G    A+ ++D M + G+E D + + +LI   CREGR+ +A R     
Sbjct  410   TYTILIDGFCKEGNMELAIEIRDEMVKHGIELDNVAFTALISGLCREGRLIDAERTLREM  469

Query  1052  ----------------------------FKDIKEKVT----PNEVTYTTLIDGYCRVGDI  969
                                         FK +KE  +    P  +TY  L++G C++G +
Sbjct  470   LSAGMKPDDATYTMVIDGFCKNGNVKMGFKLLKEMQSDGHVPGVITYNVLMNGLCKLGQM  529

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
               A  L  AM   G+ P   TYN +L   C++G  K+  +L ++MG
Sbjct  530   KNANMLLDAMIGLGVVPDDITYNILLDGHCKKGNPKDFNRLKSEMG  575


 Score =   132 bits (333),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/302 (27%), Positives = 145/302 (48%), Gaps = 5/302 (2%)
 Frame = -2

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE---KV  1029
             L  R+G    +L     +E  G       ++SL+ ++   G + +A++ F+ +++   K+
Sbjct  137   LVSRKGKGSASLVFTSIIETKGTHQCGFVFDSLMIAYKDLGFVPDAIQCFRLVRKHKFKL  196

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
                   Y  L+D   ++     +L  +  + + G  P V  +N ++ K C   ++K++  
Sbjct  197   PFQGCKY--LLDRMMKISSPMVSLGFYLEILDYGFSPSVYNFNILMHKLCRVSQIKDAQM  254

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             + N++G++ +    V+ NTLINGYCK G++    ++K  M ++G+RPD FTY  LI+G C
Sbjct  255   VFNEIGKRGLRATVVSFNTLINGYCKSGNLGEGFRLKRAMEDSGIRPDVFTYSVLINGLC  314

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K    + A  +  +M   G  P+   ++ L+D  C     +  +        +G   D+ 
Sbjct  315   KESRLDDANGLFEEMCNRGLVPNDVTFTTLIDGQCKNGRIDLAMTTYQRILSKGLKPDLV  374

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              +  +I  LCK G L  A+     M  R +  D   YT L   + KEGN   A ++ DEM
Sbjct  375   MFNTLINGLCKAGDLKEAKNLIAEMSLRGLKPDKFTYTILIDGFCKEGNMELAIEIRDEM  434

Query  308   YK  303
              K
Sbjct  435   VK  436


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (46%), Gaps = 0/174 (0%)
 Frame = -2

Query  815  PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
            P     N L++  C++  I  A  V N++ + GLR    ++  LI+G+CK+ +      +
Sbjct  231  PSVYNFNILMHKLCRVSQIKDAQMVFNEIGKRGLRATVVSFNTLINGYCKSGNLGEGFRL  290

Query  635  IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCK  456
               M  +G  P    YS L++  C ++  +    L +E   RG   +   +  +I   CK
Sbjct  291  KRAMEDSGIRPDVFTYSVLINGLCKESRLDDANGLFEEMCNRGLVPNDVTFTTLIDGQCK  350

Query  455  RGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             G++D A   +  +  + +  D V++ +L     K G+ + A +L  EM  R L
Sbjct  351  NGRIDLAMTTYQRILSKGLKPDLVMFNTLINGLCKAGDLKEAKNLIAEMSLRGL  404


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 97/230 (42%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  RVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNV  804
            R G    +L   S +E KG       ++S++  + + G + ++ +    + + K +    
Sbjct  140  RKGKGSASLVFTSIIETKGTHQCGFVFDSLMIAYKDLGFVPDAIQCFRLVRKHKFKLPFQ  199

Query  803  TCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDM  624
             C  L++   KI   + +L    ++L+ G  P  + +  L+H  C+    + A+ V  ++
Sbjct  200  GCKYLLDRMMKISSPMVSLGFYLEILDYGFSPSVYNFNILMHKLCRVSQIKDAQMVFNEI  259

Query  623  IAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKL  444
               G   +  +++ L++ YC   N     +L       G   D+  Y  +I  LCK  +L
Sbjct  260  GKRGLRATVVSFNTLINGYCKSGNLGEGFRLKRAMEDSGIRPDVFTYSVLINGLCKESRL  319

Query  443  DCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
            D A   F  M  R ++ + V +T+L     K G    A   +  +  + L
Sbjct  320  DDANGLFEEMCNRGLVPNDVTFTTLIDGQCKNGRIDLAMTTYQRILSKGL  369



>ref|XP_003616261.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES99219.1| PPR containing plant-like protein [Medicago truncatula]
Length=811

 Score =   269 bits (688),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 154/502 (31%), Positives = 265/502 (53%), Gaps = 9/502 (2%)
 Frame = -2

Query  1826  PKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHF  1647
             P +     + +IN   L+L P   +   SFF ++ + P +RH+L +  +M + L+ H   
Sbjct  59    PSLTSHHITNLINLNPLSLPPLSLF---SFFNYLASRPPFRHTLHNYSTMAHFLSSHNLL  115

Query  1646  KSAKDM----LHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAI  1479
                  +    + ++      S  + L   V +    + +  VF  L+I Y +S+   DAI
Sbjct  116   SQTHSLFLFIISKMGHHSSTSLISSLIQTVPTHHRHNHSVLVFDALIIAYTDSEFIEDAI  175

Query  1478  QVFEHLRICRIKPDPHACTVLLNSLVK-EGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHA  1302
             Q    ++          C  LL  ++K        W+ Y +++  G  PN++++N+L+H 
Sbjct  176   QCLRLVKKNNFSIPVCGCDYLLRRVMKLNQQPGHCWEFYLEVLDYGYPPNVYLFNILMHG  235

Query  1301  CCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPD  1122
              CK G+V  A     E+  +G+ P + +FNTLIS YCR     E   ++  ME   + PD
Sbjct  236   FCKIGDVMNARMVFDEISRRGLRPSVVSFNTLISGYCRSKNVEEGFVLKSVMESERISPD  295

Query  1121  IITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHS  945
             + TY++LI+  C+E R+ EA  LF ++ E  + PN VT+TTLIDG C+ G ID ALR   
Sbjct  296   VFTYSALINGLCKESRVEEANGLFDEMCEMGLVPNGVTFTTLIDGQCKHGKIDLALRNFE  355

Query  944   AMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIG  765
              M+++G+ P + TYN+++   C +G +KE+ KLLN+M     +PD +T  TL++G CK G
Sbjct  356   IMKDRGIRPDLITYNALINGLCRDGDLKEARKLLNEMIGNGFKPDKITFTTLMDGCCKDG  415

Query  764   DIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYS  585
             D+ SAL++K++M+E G+  D   + ALI G C+      A+ ++ DM++AG  P    Y+
Sbjct  416   DMDSALEIKDRMVEEGIELDDVAFTALISGLCRDGRVRDAERMLKDMLSAGHKPDDPTYT  475

Query  584   WLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQER  405
              ++D +C + + +   KL  E    G    +  Y A++   CK+G++  A+     M   
Sbjct  476   MVIDCFCKKGDVKMGAKLLKEMQRDGRVPGVVTYNALMNGFCKQGQMKNAKMLLHAMLNM  535

Query  404   EILGDSVVYTSLAYAYFKEGNT  339
             E++ + + +  L   + K G++
Sbjct  536   EVVPNDITFNILLDGHCKHGSS  557


 Score =   172 bits (435),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 160/287 (56%), Gaps = 4/287 (1%)
 Frame = -2

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
              +S L+       R  +A  +F+ +    + P+    T L++   K G  D   + ++ M
Sbjct  298   TYSALINGLCKESRVEEANGLFDEMCEMGLVPNGVTFTTLIDGQCKHGKIDLALRNFEIM  357

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
                G+ P++  YN LI+  C+ G++++A + L+EM   G  PD  TF TL+   C+ G  
Sbjct  358   KDRGIRPDLITYNALINGLCRDGDLKEARKLLNEMIGNGFKPDKITFTTLMDGCCKDGDM  417

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTL  999
               AL ++DRM   G+E D + + +LI   CR+GR+R+A R+ KD +     P++ TYT +
Sbjct  418   DSALEIKDRMVEEGIELDDVAFTALISGLCRDGRVRDAERMLKDMLSAGHKPDDPTYTMV  477

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             ID +C+ GD+    +L   M+  G  P V TYN+++  FC++G+MK +  LL+ M   ++
Sbjct  478   IDCFCKKGDVKMGAKLLKEMQRDGRVPGVVTYNALMNGFCKQGQMKNAKMLLHAMLNMEV  537

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIH  678
              P+++T N L++G+CK G  V   K+ N   E GL  D  +Y AL++
Sbjct  538   VPNDITFNILLDGHCKHGSSVD-FKIFNG--EKGLVSDYASYTALVN  581


 Score =   172 bits (435),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 154/279 (55%), Gaps = 1/279 (0%)
 Frame = -2

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P++  +N L+H  C+ G +  A  +F +I  + + P+ V++ TLI GYCR  +++E 
Sbjct  221   GYPPNVYLFNILMHGFCKIGDVMNARMVFDEISRRGLRPSVVSFNTLISGYCRSKNVEEG  280

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
               L S ME + + P V TY++++   C+E R++E+  L ++M E  + P+ VT  TLI+G
Sbjct  281   FVLKSVMESERISPDVFTYSALINGLCKESRVEEANGLFDEMCEMGLVPNGVTFTTLIDG  340

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
              CK G I  AL+    M + G+RPD  TY ALI+G C+  D + A++++ +MI  GF P 
Sbjct  341   QCKHGKIDLALRNFEIMKDRGIRPDLITYNALINGLCRDGDLKEARKLLNEMIGNGFKPD  400

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                ++ L+D  C   + ++ +++ D     G  +D   + A+I  LC+ G++  AER   
Sbjct  401   KITFTTLMDGCCKDGDMDSALEIKDRMVEEGIELDDVAFTALISGLCRDGRVRDAERMLK  460

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
              M       D   YT +   + K+G+ +  + L  EM +
Sbjct  461   DMLSAGHKPDDPTYTMVIDCFCKKGDVKMGAKLLKEMQR  499


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 0/145 (0%)
 Frame = -2

Query  734  KMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQN  555
            ++L+ G  P+ + +  L+HGFCK  D   A+ V  ++   G  PS  +++ L+  YC   
Sbjct  216  EVLDYGYPPNVYLFNILMHGFCKIGDVMNARMVFDEISRRGLRPSVVSFNTLISGYCRSK  275

Query  554  NNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYT  375
            N E    L           D+  Y A+I  LCK  +++ A   F  M E  ++ + V +T
Sbjct  276  NVEEGFVLKSVMESERISPDVFTYSALINGLCKESRVEEANGLFDEMCEMGLVPNGVTFT  335

Query  374  SLAYAYFKEGNTRAASDLFDEMYKR  300
            +L     K G    A   F+ M  R
Sbjct  336  TLIDGQCKHGKIDLALRNFEIMKDR  360



>ref|XP_004237581.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Solanum lycopersicum]
Length=738

 Score =   267 bits (683),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 166/558 (30%), Positives = 267/558 (48%), Gaps = 72/558 (13%)
 Frame = -2

Query  1751  LSWSFFKWVET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNA  1575
             L+  F   V    PN++H   S  + +++L + K    A+  + ++  +  +S   ++ +
Sbjct  105   LAQKFINLVSVNCPNFKHCTSSLGATVHVLIRSKRVADAQGFILRMIRRSGVSRIEIVES  164

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE  1395
             LV +      N  VF  L+  Y  +++  +A++VF  L+        +AC  LL  LVK 
Sbjct  165   LVSTYGLCGSNPYVFDLLIRTYVQARKIREAVEVFRLLQRRNFCVPINACNGLLGGLVKI  224

Query  1394  GLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTF  1215
             G  D  W+ Y +M    + PN++  N++++A CK G++E  + F+ EME K IFPD+ T+
Sbjct  225   GWVDLAWEVYGEMTGSSIQPNVYTLNIMVNALCKDGKIESVNPFIEEMEKKEIFPDMVTY  284

Query  1214  NTLISLYCRRGMHYEALSVQD-----------------------------------RMER  1140
             NTLI+ YC  G+  EA  V +                                    ME 
Sbjct  285   NTLINAYCHEGLLEEADEVINIMKATGLRPCLLTYNSILNGLCKNGQYGRARELLVEMEE  344

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTYTTLIDGYCRVGDIDE  963
              G+ PD  +YN+L+   CR G + EA  +FK++    + P+ V+Y++LI  + R G +D 
Sbjct  345   CGLAPDTTSYNALLAECCRAGNVLEAESVFKEMLCRAIIPDLVSYSSLIGLFARTGRLDR  404

Query  962   ALRLHSAMEEKGLCP-----------------------------------RVATYNSILR  888
             +L  +  M+ KGL P                                    V TYN+IL 
Sbjct  405   SLVYYEHMKRKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLERSLVMDVVTYNTILN  464

Query  887   KFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRP  708
               C+   ++E+ +L N+M E+ + PD  T  TLINGYCK G++  A  +   ML   L+P
Sbjct  465   GLCKGKMLQEANELFNEMLERDVNPDFYTFTTLINGYCKCGNMDKAQTLFEAMLLRNLKP  524

Query  707   DSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLA  528
             D  TY +LI GFCK  D E+A  +  +MI+   SP+Y  YS L++ +C + +    ++L 
Sbjct  525   DVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILINGFCNKGHVSDALRLW  584

Query  527   DEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKE  348
             D+    G    I    +II+  C+ G    A +F   MQ + +  DS+ Y +L     +E
Sbjct  585   DDMIILGIKPTIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGLFPDSITYNTLLDGLIRE  644

Query  347   GNTRAASDLFDEMYKRRL  294
              N   A DL +EM K+ L
Sbjct  645   ENMDKALDLVNEMGKQGL  662


 Score =   227 bits (579),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 144/523 (28%), Positives = 243/523 (46%), Gaps = 54/523 (10%)
 Frame = -2

Query  1760  WFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVL  1581
             W  L+W  +  + T  + + ++ +   M+  L K    +S    + ++  K+        
Sbjct  226   WVDLAWEVYGEM-TGSSIQPNVYTLNIMVNALCKDGKIESVNPFIEEMEKKEIFPDMVTY  284

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             N L+ +                 Y +     +A +V   ++   ++P       +LN L 
Sbjct  285   NTLINA-----------------YCHEGLLEEADEVINIMKATGLRPCLLTYNSILNGLC  327

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G      +   +M + G+ P+   YN L+  CC++G V +A+    EM  + I PDL 
Sbjct  328   KNGQYGRARELLVEMEECGLAPDTTSYNALLAECCRAGNVLEAESVFKEMLCRAIIPDLV  387

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR-----  1056
             ++++LI L+ R G    +L   + M+R G+ PD + Y  LI   CR G M+EAM+     
Sbjct  388   SYSSLIGLFARTGRLDRSLVYYEHMKRKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEM  447

Query  1055  ------------------------------LFKDIKEK-VTPNEVTYTTLIDGYCRVGDI  969
                                           LF ++ E+ V P+  T+TTLI+GYC+ G++
Sbjct  448   LERSLVMDVVTYNTILNGLCKGKMLQEANELFNEMLERDVNPDFYTFTTLINGYCKCGNM  507

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
             D+A  L  AM  + L P V TYNS++  FC+ G M+++  L ++M    I P+ +T + L
Sbjct  508   DKAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSIL  567

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             ING+C  G +  AL++ + M+  G++P   T  ++I G+C+  DT RA + +  M   G 
Sbjct  568   INGFCNKGHVSDALRLWDDMIILGIKPTIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGL  627

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    Y+ L+D    + N +  + L +E   +G   D+  Y  I+   CK G++  A  
Sbjct  628   FPDSITYNTLLDGLIREENMDKALDLVNEMGKQGLSPDVFSYNTILDGFCKFGRMQEANM  687

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
              +  M ER I  D   YTSL   +  + N + A    DEM +R
Sbjct  688   LYSKMVERGINPDRSTYTSLINGHVSQDNLKEAFRFHDEMLQR  730


 Score =   207 bits (527),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 194/350 (55%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             +S L+  +A + R   ++  +EH++   + PD    T+L+    + G      K   +M+
Sbjct  389   YSSLIGLFARTGRLDRSLVYYEHMKRKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEML  448

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             +  ++ ++  YN +++  CK   +++A+E  +EM  + + PD YTF TLI+ YC+ G   
Sbjct  449   ERSLVMDVVTYNTILNGLCKGKMLQEANELFNEMLERDVNPDFYTFTTLINGYCKCGNMD  508

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +A ++ + M    ++PD++TYNSLI   C+ G M +A  L  + I   ++PN +TY+ LI
Sbjct  509   KAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILI  568

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +G+C  G + +ALRL   M   G+ P + T NSI++ +C  G    + K LN+M  + + 
Sbjct  569   NGFCNKGHVSDALRLWDDMIILGIKPTIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGLF  628

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD++T NTL++G  +  ++  AL + N+M + GL PD F+Y  ++ GFCK    + A  +
Sbjct  629   PDSITYNTLLDGLIREENMDKALDLVNEMGKQGLSPDVFSYNTILDGFCKFGRMQEANML  688

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                M+  G +P    Y+ L++ +  Q+N +   +  DE   RG+  D  F
Sbjct  689   YSKMVERGINPDRSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFIPDDKF  738


 Score =   134 bits (337),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/279 (29%), Positives = 146/279 (52%), Gaps = 5/279 (2%)
 Frame = -2

Query  1115  TYNSLIHSHCREGRMREAMRLFKDIKEK---VTPNEVTYTTLIDGYCRVGDIDEALRLHS  945
              ++ LI ++ +  ++REA+ +F+ ++ +   V  N      L+ G  ++G +D A  ++ 
Sbjct  178   VFDLLIRTYVQARKIREAVEVFRLLQRRNFCVPINACN--GLLGGLVKIGWVDLAWEVYG  235

Query  944   AMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIG  765
              M    + P V T N ++   C++G+++     + +M +K+I PD VT NTLIN YC  G
Sbjct  236   EMTGSSIQPNVYTLNIMVNALCKDGKIESVNPFIEEMEKKEIFPDMVTYNTLINAYCHEG  295

Query  764   DIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYS  585
              +  A +V N M   GLRP   TY ++++G CK     RA+E++ +M   G +P   +Y+
Sbjct  296   LLEEADEVINIMKATGLRPCLLTYNSILNGLCKNGQYGRARELLVEMEECGLAPDTTSYN  355

Query  584   WLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQER  405
              L+   C   N      +  E   R    D+  Y ++I    + G+LD +  ++  M+ +
Sbjct  356   ALLAECCRAGNVLEAESVFKEMLCRAIIPDLVSYSSLIGLFARTGRLDRSLVYYEHMKRK  415

Query  404   EILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMV  288
              +  D+VVYT L   + + G+ + A  + DEM +R L++
Sbjct  416   GLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLERSLVM  454


 Score =   131 bits (330),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 145/296 (49%), Gaps = 15/296 (5%)
 Frame = -2

Query  1649  FKSAKDMLHQIACKDFLSSPAVLNALVRSDD------------DSDVNSQ--VFSWLLIF  1512
              K   +ML +    D ++   +LN L +               + DVN     F+ L+  
Sbjct  441   MKMRDEMLERSLVMDVVTYNTILNGLCKGKMLQEANELFNEMLERDVNPDFYTFTTLING  500

Query  1511  YANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPN  1332
             Y        A  +FE + +  +KPD      L++   K G  +  +    +MI + + PN
Sbjct  501   YCKCGNMDKAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPN  560

Query  1331  IHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQD  1152
                Y++LI+  C  G V  A     +M   GI P + T N++I  YCR G    A    +
Sbjct  561   YITYSILINGFCNKGHVSDALRLWDDMIILGIKPTIVTCNSIIKGYCRCGDTSRAAKFLN  620

Query  1151  RMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVG  975
             +M+  G+ PD ITYN+L+    RE  M +A+ L  ++ K+ ++P+  +Y T++DG+C+ G
Sbjct  621   KMQIQGLFPDSITYNTLLDGLIREENMDKALDLVNEMGKQGLSPDVFSYNTILDGFCKFG  680

Query  974   DIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDN  807
              + EA  L+S M E+G+ P  +TY S++     +  +KE+ +  ++M ++   PD+
Sbjct  681   RMQEANMLYSKMVERGINPDRSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFIPDD  736



>ref|XP_007201524.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica]
 gb|EMJ02723.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica]
Length=545

 Score =   262 bits (670),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 156/505 (31%), Positives = 257/505 (51%), Gaps = 10/505 (2%)
 Frame = -2

Query  1793  INHTLLTLSP-----CWFWLSWS---FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSA  1638
             I H    LSP       F L  S     +++  +  +R  +Q+    I I+ +    + A
Sbjct  4     IKHLSPNLSPSLISEALFELQKSPQLVLEFISNVDFHRLDIQTRCLAIAIVARQSSPQPA  63

Query  1637  KDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV-FSWLLIFYANSKRTWDAIQVFEHL  1461
              ++L Q+      +   V N L  S D   VNS + F  LL      K+  +A+  F  +
Sbjct  64    LELLKQVVGSGIATIREVFNPLALSRDRLSVNSSIIFDLLLRACCEMKKADEAVDCFYLM  123

Query  1460  RICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEV  1281
                   P    C  +L+  +K   T+ VW  Y +M +L +  ++  +N++I+  CK G++
Sbjct  124   VDKGFMPKTETCNDMLSLFLKLNQTERVWVLYAEMFRLKINSSVCTFNIMINVLCKEGKL  183

Query  1280  EKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSL  1101
             +KA+EF+  ME  G  P++ T+NT+I  +C RG    A  + + M+  GVEPD  TY SL
Sbjct  184   KKANEFVGFMESSGTKPNVVTYNTVIHGFCSRGRVGRAQMIFNAMKGKGVEPDSYTYGSL  243

Query  1100  IHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
             I   C++ R++EA+ LF  + E  + P+ VTY TLIDGYC  GD+D+A      M +KG+
Sbjct  244   ISGMCKDRRLQEAVGLFNKMLEIGLLPSAVTYNTLIDGYCNEGDLDKAFSYRDEMVKKGI  303

Query  923   CPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALK  744
              P V+TYN ++     EGRM E+ +++ +M EK +  + +T N LINGYC+ G+   A  
Sbjct  304   RPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKGVVSNGITYNILINGYCRSGNAKKAFS  363

Query  743   VKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYC  564
             + ++ML   ++P   TY +L++   K K  + A ++   ++  G  P    ++ L+D +C
Sbjct  364   LLDEMLSKSIKPTKVTYTSLMYVLSKNKRMKEADDLFKKILTKGVLPDLVMFNALIDGHC  423

Query  563   LQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSV  384
                N E    L  E        D   Y  +++  C++GK++ A +    M+ R I  D +
Sbjct  424   ANGNMERAFALLGEMDKMKVHPDEVTYNTLMQGRCRQGKVEEARQLLDQMKRRGIKPDHI  483

Query  383   VYTSLAYAYFKEGNTRAASDLFDEM  309
              Y +L   Y K G+ + A  + DEM
Sbjct  484   SYNTLISGYSKRGDLKDAFKVRDEM  508


 Score =   197 bits (502),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 175/308 (57%), Gaps = 1/308 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             +S  +  L+      +R  +A+ +F  +    + P       L++    EG  D  +   
Sbjct  236   DSYTYGSLISGMCKDRRLQEAVGLFNKMLEIGLLPSAVTYNTLIDGYCNEGDLDKAFSYR  295

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M+K G+ P +  YN+LIHA    G + +A E + EME KG+  +  T+N LI+ YCR 
Sbjct  296   DEMVKKGIRPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKGVVSNGITYNILINGYCRS  355

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
             G   +A S+ D M    ++P  +TY SL++   +  RM+EA  LFK I  K V P+ V +
Sbjct  356   GNAKKAFSLLDEMLSKSIKPTKVTYTSLMYVLSKNKRMKEADDLFKKILTKGVLPDLVMF  415

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
               LIDG+C  G+++ A  L   M++  + P   TYN++++  C +G+++E+ +LL+QM  
Sbjct  416   NALIDGHCANGNMERAFALLGEMDKMKVHPDEVTYNTLMQGRCRQGKVEEARQLLDQMKR  475

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             + I+PD+++ NTLI+GY K GD+  A KV+++ML  G  P   TY ALI G  K ++ + 
Sbjct  476   RGIKPDHISYNTLISGYSKRGDLKDAFKVRDEMLSIGFNPTLLTYNALIQGLSKTQEGDL  535

Query  647   AKEVIFDM  624
             A+ ++ +M
Sbjct  536   AEVLLKEM  543


 Score =   167 bits (424),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 113/392 (29%), Positives = 194/392 (49%), Gaps = 13/392 (3%)
 Frame = -2

Query  1445  KPDPHACTVLLNSLVKEGLTDTVWKTYKKMI----KLGVLPNIHIYNVLIHACCKSGEVE  1278
             +  P     LL  +V  G+  T+ + +  +     +L V  +I I+++L+ ACC   E++
Sbjct  57    QSSPQPALELLKQVVGSGIA-TIREVFNPLALSRDRLSVNSSI-IFDLLLRACC---EMK  111

Query  1277  KADEFLS---EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYN  1107
             KADE +     M  KG  P   T N ++SL+ +         +   M R  +   + T+N
Sbjct  112   KADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQTERVWVLYAEMFRLKINSSVCTFN  171

Query  1106  SLIHSHCREGRMREAMRLFKDIKEKVT-PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEK  930
              +I+  C+EG++++A      ++   T PN VTY T+I G+C  G +  A  + +AM+ K
Sbjct  172   IMINVLCKEGKLKKANEFVGFMESSGTKPNVVTYNTVIHGFCSRGRVGRAQMIFNAMKGK  231

Query  929   GLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSA  750
             G+ P   TY S++   C++ R++E+  L N+M E  + P  VT NTLI+GYC  GD+  A
Sbjct  232   GVEPDSYTYGSLISGMCKDRRLQEAVGLFNKMLEIGLLPSAVTYNTLIDGYCNEGDLDKA  291

Query  749   LKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT  570
                +++M++ G+RP   TY  LIH          A E++ +M   G   +   Y+ L++ 
Sbjct  292   FSYRDEMVKKGIRPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKGVVSNGITYNILING  351

Query  569   YCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
             YC   N +    L DE   +        Y +++  L K  ++  A+  F  +  + +L D
Sbjct  352   YCRSGNAKKAFSLLDEMLSKSIKPTKVTYTSLMYVLSKNKRMKEADDLFKKILTKGVLPD  411

Query  389   SVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
              V++ +L   +   GN   A  L  EM K ++
Sbjct  412   LVMFNALIDGHCANGNMERAFALLGEMDKMKV  443


 Score =   124 bits (311),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/279 (27%), Positives = 135/279 (48%), Gaps = 1/279 (0%)
 Frame = -2

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
             I ++ L+ + C   +  EA+  F  + +K   P   T   ++  + ++   +    L++ 
Sbjct  98    IIFDLLLRACCEMKKADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQTERVWVLYAE  157

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             M    +   V T+N ++   C+EG++K++ + +  M     +P+ VT NT+I+G+C  G 
Sbjct  158   MFRLKINSSVCTFNIMINVLCKEGKLKKANEFVGFMESSGTKPNVVTYNTVIHGFCSRGR  217

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
             +  A  + N M   G+ PDS+TY +LI G CK +  + A  +   M+  G  PS   Y+ 
Sbjct  218   VGRAQMIFNAMKGKGVEPDSYTYGSLISGMCKDRRLQEAVGLFNKMLEIGLLPSAVTYNT  277

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQERE  402
             L+D YC + + +      DE   +G    +S Y  +I  L   G++  A      M+E+ 
Sbjct  278   LIDGYCNEGDLDKAFSYRDEMVKKGIRPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKG  337

Query  401   ILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             ++ + + Y  L   Y + GN + A  L DEM  + +  T
Sbjct  338   VVSNGITYNILINGYCRSGNAKKAFSLLDEMLSKSIKPT  376



>ref|XP_010673744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673745.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=733

 Score =   266 bits (680),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 147/473 (31%), Positives = 249/473 (53%), Gaps = 1/473 (0%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             P +RHS  S   MI++  + +    A+ ++ ++  K  +S   +++ LV S D    N  
Sbjct  113   PKFRHSTLSYCVMIHMFVRGRRASDAQGLILRMVRKSGVSRVEIIDTLVGSYDQCGSNLG  172

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  +  +KR  +A +VF+ L         +AC  LL  LVK G  D VW+ YK++
Sbjct  173   VFDLLVRTFVQAKRLREAAEVFKMLISRGFCVSINACNSLLGGLVKVGWVDLVWEIYKEV  232

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             ++ GV  N++  N++I+A CK G++E    FL EME K +FPD  T+NTLI+ YCR G  
Sbjct  233   VRNGVQLNVYTLNIMINALCKDGKIEDVKSFLLEMEVKRVFPDNVTYNTLINAYCREGNV  292

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTL  999
              +AL + + M   G+   ++TYN+++   CR G+   A ++  D+ +  + P+  +Y  L
Sbjct  293   EKALEMMNSMSGKGLRAGVLTYNAILKGLCRTGKYSRARQMLSDMWQMGICPDTNSYNAL  352

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             +    +  +I +  +L   M   G+ P + +Y S++  F     +  +    N M  K +
Sbjct  353   LIECTKKDNIVDGEQLFDEMLRLGVAPDIVSYTSLINMFSRNKHLDRALMHFNDMKSKGL  412

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
              PD+V    LI+G+CK G +  AL+++N+MLE G   D  TY ++++G CK +    A +
Sbjct  413   APDSVIYTILIDGFCKSGVVSEALRMRNEMLEKGCLMDVVTYNSILNGMCKERTLSEADQ  472

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             ++ +M+  G SP Y  Y+ L+  YC   + +  V L +    R    DI  Y  ++   C
Sbjct  473   LLDEMLQRGISPDYYTYTTLIHGYCKARDMDRAVVLFETMIQRNLKPDIVTYNTLMDGFC  532

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
             K G ++ A   +G M  R I  + + Y++L   Y   G+  AA  L+DEM ++
Sbjct  533   KEGVMEKAHELWGDMAHRGIYPNYISYSTLINGYCSVGHLNAAFKLWDEMVEK  585


 Score =   227 bits (578),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/384 (31%), Positives = 213/384 (55%), Gaps = 1/384 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             I PD ++   LL    K+       + + +M++LGV P+I  Y  LI+   ++  +++A 
Sbjct  342   ICPDTNSYNALLIECTKKDNIVDGEQLFDEMLRLGVAPDIVSYTSLINMFSRNKHLDRAL  401

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
                ++M+ KG+ PD   +  LI  +C+ G+  EAL +++ M   G   D++TYNS+++  
Sbjct  402   MHFNDMKSKGLAPDSVIYTILIDGFCKSGVVSEALRMRNEMLEKGCLMDVVTYNSILNGM  461

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C+E  + EA +L  ++ ++ ++P+  TYTTLI GYC+  D+D A+ L   M ++ L P +
Sbjct  462   CKERTLSEADQLLDEMLQRGISPDYYTYTTLIHGYCKARDMDRAVVLFETMIQRNLKPDI  521

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYN+++  FC+EG M+++ +L   M  + I P+ ++ +TLINGYC +G + +A K+ ++
Sbjct  522   VTYNTLMDGFCKEGVMEKAHELWGDMAHRGIYPNYISYSTLINGYCSVGHLNAAFKLWDE  581

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M+E G+ P + T   +I G+C + D   A++ +  M A G  P    Y+ L+  Y  +  
Sbjct  582   MVEKGIEPTTVTCNIIIKGYCISGDATEAEKFLTKMAAKGTLPDSVTYNTLIQGYIKEEK  641

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
              + +  L +E   +G   D+  Y  I+   C++ ++D A   +  M ER +  D   YTS
Sbjct  642   MDKVFILLNEMEVKGILPDVISYNVILDGFCRQARMDEANLIYKKMIERGVNPDRSTYTS  701

Query  371   LAYAYFKEGNTRAASDLFDEMYKR  300
             L   Y  + N + A    DEM +R
Sbjct  702   LIDGYVSQDNLKEAFRFHDEMLRR  725


 Score =   214 bits (545),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/350 (33%), Positives = 189/350 (54%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+  ++ +K    A+  F  ++   + PD    T+L++   K G+     +   +M+
Sbjct  384   YTSLINMFSRNKHLDRALMHFNDMKSKGLAPDSVIYTILIDGFCKSGVVSEALRMRNEML  443

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G L ++  YN +++  CK   + +AD+ L EM  +GI PD YT+ TLI  YC+     
Sbjct  444   EKGCLMDVVTYNSILNGMCKERTLSEADQLLDEMLQRGISPDYYTYTTLIHGYCKARDMD  503

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLI  996
              A+ + + M +  ++PDI+TYN+L+   C+EG M +A  L+ D+  + + PN ++Y+TLI
Sbjct  504   RAVVLFETMIQRNLKPDIVTYNTLMDGFCKEGVMEKAHELWGDMAHRGIYPNYISYSTLI  563

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +GYC VG ++ A +L   M EKG+ P   T N I++ +C  G   E+ K L +M  K   
Sbjct  564   NGYCSVGHLNAAFKLWDEMVEKGIEPTTVTCNIIIKGYCISGDATEAEKFLTKMAAKGTL  623

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD+VT NTLI GY K   +     + N+M   G+ PD  +Y  ++ GFC+    + A  +
Sbjct  624   PDSVTYNTLIQGYIKEEKMDKVFILLNEMEVKGILPDVISYNVILDGFCRQARMDEANLI  683

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                MI  G +P    Y+ L+D Y  Q+N +   +  DE   RG+  D  F
Sbjct  684   YKKMIERGVNPDRSTYTSLIDGYVSQDNLKEAFRFHDEMLRRGFVPDDKF  733


 Score =   167 bits (422),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 96/348 (28%), Positives = 183/348 (53%), Gaps = 1/348 (0%)
 Frame = -2

Query  1334  NIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQ  1155
             N+ ++++L+    ++  + +A E    +  +G    +   N+L+    + G       + 
Sbjct  170   NLGVFDLLVRTFVQAKRLREAAEVFKMLISRGFCVSINACNSLLGGLVKVGWVDLVWEIY  229

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTYTTLIDGYCRV  978
               + R GV+ ++ T N +I++ C++G++ +      +++ ++V P+ VTY TLI+ YCR 
Sbjct  230   KEVVRNGVQLNVYTLNIMINALCKDGKIEDVKSFLLEMEVKRVFPDNVTYNTLINAYCRE  289

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G++++AL + ++M  KGL   V TYN+IL+  C  G+   + ++L+ M +  I PD  + 
Sbjct  290   GNVEKALEMMNSMSGKGLRAGVLTYNAILKGLCRTGKYSRARQMLSDMWQMGICPDTNSY  349

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             N L+    K  +IV   ++ ++ML  G+ PD  +Y +LI+ F + K  +RA     DM +
Sbjct  350   NALLIECTKKDNIVDGEQLFDEMLRLGVAPDIVSYTSLINMFSRNKHLDRALMHFNDMKS  409

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
              G +P    Y+ L+D +C        +++ +E   +G  +D+  Y +I+  +CK   L  
Sbjct  410   KGLAPDSVIYTILIDGFCKSGVVSEALRMRNEMLEKGCLMDVVTYNSILNGMCKERTLSE  469

Query  437   AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             A++    M +R I  D   YT+L + Y K  +   A  LF+ M +R L
Sbjct  470   ADQLLDEMLQRGISPDYYTYTTLIHGYCKARDMDRAVVLFETMIQRNL  517



>ref|XP_009625742.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625743.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625745.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
Length=726

 Score =   266 bits (679),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 172/587 (29%), Positives = 278/587 (47%), Gaps = 85/587 (14%)
 Frame = -2

Query  1799  TIINHTLLT--LSPCWFW-----------LSWSFFKWVET-IPNYRHSLQSSWSMIYILT  1662
             TI N +LL   L+P  F            L+  F   +    PN++HS  S  +++++L 
Sbjct  64    TITNSSLLLHRLNPSTFLEVLGNCRDNLHLAQKFINLINVNCPNFKHSSTSLSAVVHVLI  123

Query  1661  KHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDA  1482
             + K    A+  + ++  +  +S   ++ +LV +      N   F  L+  Y  +++  ++
Sbjct  124   RCKRVADAQAFILRMIRRSGVSRIEIVESLVSTYGICGSNPYAFDLLIRTYVQARKIRES  183

Query  1481  IQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHA  1302
             ++ F  L+   +    +AC  LL  LVK G  D  W+ Y +M    + PN++  N++++A
Sbjct  184   VEAFRLLQSRNLCVSINACNGLLGGLVKIGWVDLAWEVYGEMRGSDIQPNVYTLNIMVNA  243

Query  1301  CCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPD  1122
              CK  ++E   +F+ EME KGIFPD+ T+NTLI+ YC  G+  EA  V + M+  G+ P 
Sbjct  244   LCKDEKIESVKQFIQEMEEKGIFPDMVTYNTLINAYCHVGLLEEAYEVINLMKVTGLRPC  303

Query  1121  IITYNSLIHSH-----------------------------------CREGRMREAMRLFK  1047
             ++TYNS+I+                                     CR G ++EA  +FK
Sbjct  304   LLTYNSIINGLCKNGHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQEAESVFK  363

Query  1046  DIK-EKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEG  870
             ++    + P+ V+Y++LI  + R G +D +L  +  M+ KGL P    Y  ++  FC  G
Sbjct  364   EMLCRAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNG  423

Query  869   RMKESTK-----------------------------------LLNQMGEKKIEPDNVTCN  795
              MKE+ K                                   L N+M E+ + PD  T  
Sbjct  424   SMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFT  483

Query  794   TLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAA  615
             TLING CK G++  AL +   ML   L+PD  TY +LI GFCK  D E+A  +  +MI+ 
Sbjct  484   TLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFNLRDEMISV  543

Query  614   GFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCA  435
               SP+Y  YS L++ +C +      ++L DE    G    I    +II+  C+ G    A
Sbjct  544   NISPNYITYSILINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRA  603

Query  434   ERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             ++F   M+ + I  DSV   +L   + +EGN   A DL +EM  + L
Sbjct  604   DKFLNNMRSQRIFPDSVTSNTLLDGFIREGNMDKALDLVNEMGNQGL  650


 Score =   223 bits (568),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/523 (26%), Positives = 249/523 (48%), Gaps = 54/523 (10%)
 Frame = -2

Query  1760  WFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVL  1581
             W  L+W  +  +    + + ++ +   M+  L K +  +S K  + ++  K         
Sbjct  214   WVDLAWEVYGEMRG-SDIQPNVYTLNIMVNALCKDEKIESVKQFIQEMEEKGIFPDMVTY  272

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             N L+ +                 Y +     +A +V   +++  ++P       ++N L 
Sbjct  273   NTLINA-----------------YCHVGLLEEAYEVINLMKVTGLRPCLLTYNSIINGLC  315

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G      +   ++ + G+ P+   YN L+  CC++G +++A+    EM  + I PDL 
Sbjct  316   KNGHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMLCRAIIPDLV  375

Query  1220  TFNTLISLY-----------------------------------CRRGMHYEALSVQDRM  1146
             ++++LI L+                                   CR G   EA+ ++D M
Sbjct  376   SYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEM  435

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDI  969
                G+  D++TYN++++  C+E  + EA  LF ++ E+ V P+  T+TTLI+G C+ G++
Sbjct  436   LEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTLINGCCKCGNM  495

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
             D+AL L   M  + L P V TYNS++  FC+ G M+++  L ++M    I P+ +T + L
Sbjct  496   DKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFNLRDEMISVNISPNYITYSIL  555

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             ING+C  G +  AL++ ++M++ G++P   T  ++I G+C++ D  RA + + +M +   
Sbjct  556   INGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRI  615

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P     + L+D +  + N +  + L +E   +G   D+  Y  I+   CK G++  A  
Sbjct  616   FPDSVTSNTLLDGFIREGNMDKALDLVNEMGNQGLSPDVITYNTILDGFCKFGRMKEANM  675

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
              +  M ER I  D   YTSL   +    N + A    DEM +R
Sbjct  676   LYRKMVERGINPDKSTYTSLINGHVSLDNLKEAFRFHDEMLQR  718


 Score =   217 bits (552),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/430 (30%), Positives = 221/430 (51%), Gaps = 19/430 (4%)
 Frame = -2

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALV----RSDDDS  1551
             +   R  L +  S+I  L K+ H+  A+ +L ++A        A  N L+    R+ +  
Sbjct  297   VTGLRPCLLTYNSIINGLCKNGHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQ  356

Query  1550  DVNSQV--------------FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLL  1413
             +  S                +S L+  ++ + R   ++  +E ++   + PD    T+L+
Sbjct  357   EAESVFKEMLCRAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILI  416

Query  1412  NSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIF  1233
                 + G      K   +M++ G+  ++  YN +++  CK   + +ADE  +EM  +G+ 
Sbjct  417   GGFCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVN  476

Query  1232  PDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL  1053
             PD YTF TLI+  C+ G   +AL++ + M    ++PD++TYNSLI   C+ G M +A  L
Sbjct  477   PDFYTFTTLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFNL  536

Query  1052  FKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCE  876
               + I   ++PN +TY+ LI+G+C  G + +ALRL   M + G+ P + T NSI++ +C 
Sbjct  537   RDEMISVNISPNYITYSILINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCR  596

Query  875   EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
              G    + K LN M  ++I PD+VT NTL++G+ + G++  AL + N+M   GL PD  T
Sbjct  597   SGDASRADKFLNNMRSQRIFPDSVTSNTLLDGFIREGNMDKALDLVNEMGNQGLSPDVIT  656

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
             Y  ++ GFCK    + A  +   M+  G +P    Y+ L++ +   +N +   +  DE  
Sbjct  657   YNTILDGFCKFGRMKEANMLYRKMVERGINPDKSTYTSLINGHVSLDNLKEAFRFHDEML  716

Query  515   GRGYCVDISF  486
              RG+  D  F
Sbjct  717   QRGFVPDDKF  726



>emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera]
Length=850

 Score =   268 bits (685),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 159/546 (29%), Positives = 268/546 (49%), Gaps = 71/546 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++HSLQS  +MI+IL + +    A+ ++ ++  K  +S   ++ +LV +  +   N  
Sbjct  230   PNFKHSLQSFSAMIHILVRSRRLPDAQAVILRMVRKSGVSRVEIVESLVLTYGNCGSNPL  289

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +  + F  L+   +    +AC  LL  LVK G  D  W+ Y+++
Sbjct  290   VFDLLVRTYVQARKLREGCEAFRVLKSKGLCVSINACNSLLGGLVKVGWVDLAWEIYQEV  349

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             ++ GV  N++  N++I+A CK+ ++E    FLS+ME KG+FPD+ T+NTLI+ YCR+G+ 
Sbjct  350   VRSGVQVNVYTLNIMINALCKNQKIENTKSFLSDMEEKGVFPDVVTYNTLINAYCRQGLL  409

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGR--------------------------  1074
              EA  + D M   G++P + TYN++I+  C+ G+                          
Sbjct  410   EEAFELMDSMSGKGLKPCVFTYNAIINGLCKTGKYLRAKGVLDEMLKIGMSPDTATYNIL  469

Query  1073  ---------MREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
                      M +A R+F ++  + V P+ V+++ LI    + G +D+AL+    M+  GL
Sbjct  470   LVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGL  529

Query  923   CP-----------------------------------RVATYNSILRKFCEEGRMKESTK  849
              P                                    V TYN+IL   C+E  + E+ +
Sbjct  530   APDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCXLDVVTYNTILNGLCKEKMLSEADE  589

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L  +M E+ + PD  T  TLINGY K G++  A+ +   M++  L+PD  TY  LI GFC
Sbjct  590   LFTEMTERGVFPDFYTFTTLINGYXKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFC  649

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  + E+  E+  DMI+    P++ +Y  L++ YC         +L DE   +G+   I 
Sbjct  650   KGSEMEKVNELWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATII  709

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                 I++  C+ G    A+ F   M  + I+ D + Y +L   + KE N   A  L ++M
Sbjct  710   TCNTIVKGYCRAGNAVKADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKM  769

Query  308   YKRRLM  291
                 L+
Sbjct  770   ENSGLL  775


 Score =   221 bits (564),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 145/553 (26%), Positives = 256/553 (46%), Gaps = 64/553 (12%)
 Frame = -2

Query  1835  LLKPKIGLSVTSTIINHTLLTLSPC-WFWLSWSFFKWVETIPNYRHSLQSSWS----MIY  1671
             +LK K GL V+    N  L  L    W  L+W  ++ V      R  +Q +      MI 
Sbjct  313   VLKSK-GLCVSINACNSLLGGLVKVGWVDLAWEIYQEV-----VRSGVQVNVYTLNIMIN  366

Query  1670  ILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRT  1491
              L K++  ++ K  L  +  K         N L+ +                 Y      
Sbjct  367   ALCKNQKIENTKSFLSDMEEKGVFPDVVTYNTLINA-----------------YCRQGLL  409

Query  1490  WDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVL  1311
              +A ++ + +    +KP       ++N L K G          +M+K+G+ P+   YN+L
Sbjct  410   EEAFELMDSMSGKGLKPCVFTYNAIINGLCKTGKYLRAKGVLDEMLKIGMSPDTATYNIL  469

Query  1310  IHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL----------------------  1197
             +  CC++  +  A+    EM  +G+ PDL +F+ LI L                      
Sbjct  470   LVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGL  529

Query  1196  -------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR  1056
                          +CR G+  EAL V+D M   G   D++TYN++++  C+E  + EA  
Sbjct  530   APDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCXLDVVTYNTILNGLCKEKMLSEADE  589

Query  1055  LFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFC  879
             LF ++ E+ V P+  T+TTLI+GY + G++++A+ L   M ++ L P V TYN+++  FC
Sbjct  590   LFTEMTERGVFPDFYTFTTLINGYXKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFC  649

Query  878   EEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSF  699
             +   M++  +L N M  ++I P++++   LINGYC +G +  A ++ ++M+E G      
Sbjct  650   KGSEMEKVNELWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATII  709

Query  698   TYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEF  519
             T   ++ G+C+A +  +A E + +M+  G  P    Y+ L++ +  + N +    L ++ 
Sbjct  710   TCNTIVKGYCRAGNAVKADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKM  769

Query  518   SGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
                G   D+  Y  I+    ++G++  AE     M ER +  D   YTSL   +  + N 
Sbjct  770   ENSGLLPDVITYNVILNGFSRQGRMQEAELIMLKMIERGVNPDRSTYTSLINGHVTQNNL  829

Query  338   RAASDLFDEMYKR  300
             + A  + DEM +R
Sbjct  830   KEAFRVHDEMLQR  842


 Score =   218 bits (556),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 192/350 (55%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+   + +     A++ F  ++   + PD    T+L+    + G+     K   +M+
Sbjct  501   FSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSEALKVRDEML  560

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  YN +++  CK   + +ADE  +EM  +G+FPD YTF TLI+ Y + G   
Sbjct  561   EQGCXLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLINGYXKDGNMN  620

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +A+++ + M +  ++PD++TYN+LI   C+   M +   L+ D I  ++ PN ++Y  LI
Sbjct  621   KAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILI  680

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +GYC +G + EA RL   M EKG    + T N+I++ +C  G   ++ + L+ M  K I 
Sbjct  681   NGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIV  740

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD +T NTLING+ K  ++  A  + NKM  +GL PD  TY  +++GF +    + A+ +
Sbjct  741   PDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELI  800

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             +  MI  G +P    Y+ L++ +  QNN +   ++ DE   RG+  D  F
Sbjct  801   MLKMIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVPDDKF  850



>ref|XP_006417549.1| hypothetical protein EUTSA_v10007116mg [Eutrema salsugineum]
 gb|ESQ35902.1| hypothetical protein EUTSA_v10007116mg [Eutrema salsugineum]
Length=608

 Score =   262 bits (670),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/507 (29%), Positives = 269/507 (53%), Gaps = 9/507 (2%)
 Frame = -2

Query  1826  PKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHF  1647
             P + +     +IN   L+LS    +   +FFK++ + P +R +++S + M   L  H+ F
Sbjct  79    PSLSVRHVVDLINRNPLSLSHRSIF---AFFKFISSQPGFRFTVESYFVMARFLAVHEMF  135

Query  1646  KSAKDMLHQIACKDFL-SSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVF  1470
               A+ ++  +  +    S+ +V +ALV     +  +  V   L+I Y +     DAIQ F
Sbjct  136   AEAESLIGLVVSRRGKNSASSVFSALVELRGTAMCDFLV-DALMITYTDLGFIPDAIQCF  194

Query  1469  EHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKS  1290
                R  +       C  LL+ ++K   T TVW  Y +++  G   N++++N+L++  CK 
Sbjct  195   RLSRKHKFAVPIRGCGNLLDRMMKLNPTGTVWGFYMEILDAGYPSNVYVFNILMNKFCKE  254

Query  1289  GEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
             G++  A +   E+  + + P + +FNTLI+ YC+ G   E   ++ RME+    PD+ TY
Sbjct  255   GKICVAQKVFDEITKRSLRPTVVSFNTLINGYCKSGNLDEGFRLKHRMEKSRTRPDVFTY  314

Query  1109  NSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEE  933
             ++LI++ C+E +M  A  LF ++ EK ++PN+V +TTLI G+ R G I+     +  M  
Sbjct  315   SALINALCKENKMEGAHGLFDEMCEKGLSPNDVIFTTLIHGHSRNGQIELMKESYQKMLS  374

Query  932   KGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVS  753
             +GL P +  YN+++  FC+ G +  +  +++ M  + + PD VT  TLI+G+C++GD+ +
Sbjct  375   RGLVPDIVLYNTLVNGFCKNGDLVAARNIVDGMIHRGLRPDKVTYTTLIDGFCRVGDVET  434

Query  752   ALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
             AL+++ KM + GL  D  ++ ALI G CK      A+  + +M+ AG  P    Y+ ++D
Sbjct  435   ALEIRKKMDQDGLELDRVSFSALICGMCKEGRVIDAERALREMLRAGMKPDDVIYTMMMD  494

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILG  393
              +C + + +   KL  E    G+   +  Y  ++  LCK G++  A+     M    ++ 
Sbjct  495   AFCKKGDVQTGFKLLKEMQSDGHVPSVVTYNVLLNGLCKLGQMKNADMLLDAMLNIGVVP  554

Query  392   DSVVYTSLAYAYFKEGNTRAASDLFDE  312
             D + Y  L   + +  N   AS L+++
Sbjct  555   DDITYNILLEGHHRHAN---ASKLYNQ  578


 Score =   118 bits (296),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 107/209 (51%), Gaps = 0/209 (0%)
 Frame = -2

Query  935  EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
            + G    V  +N ++ KFC+EG++  + K+ +++ ++ + P  V+ NTLINGYCK G++ 
Sbjct  234  DAGYPSNVYVFNILMNKFCKEGKICVAQKVFDEITKRSLRPTVVSFNTLINGYCKSGNLD  293

Query  755  SALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLV  576
               ++K++M ++  RPD FTY ALI+  CK    E A  +  +M   G SP+   ++ L+
Sbjct  294  EGFRLKHRMEKSRTRPDVFTYSALINALCKENKMEGAHGLFDEMCEKGLSPNDVIFTTLI  353

Query  575  DTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
              +      E + +   +   RG   DI  Y  ++   CK G L  A      M  R + 
Sbjct  354  HGHSRNGQIELMKESYQKMLSRGLVPDIVLYNTLVNGFCKNGDLVAARNIVDGMIHRGLR  413

Query  395  GDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             D V YT+L   + + G+   A ++  +M
Sbjct  414  PDKVTYTTLIDGFCRVGDVETALEIRKKM  442


 Score =   110 bits (276),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/273 (26%), Positives = 121/273 (44%), Gaps = 35/273 (13%)
 Frame = -2

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N   +  L++ +C+ G I  A ++   + ++ L P V ++N+++  +C+ G + E  +L 
Sbjct  240   NVYVFNILMNKFCKEGKICVAQKVFDEITKRSLRPTVVSFNTLINGYCKSGNLDEGFRLK  299

Query  842   NQMGEKKIEPDNVTCNTLINGYCK-----------------------------------I  768
             ++M + +  PD  T + LIN  CK                                    
Sbjct  300   HRMEKSRTRPDVFTYSALINALCKENKMEGAHGLFDEMCEKGLSPNDVIFTTLIHGHSRN  359

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
             G I    +   KML  GL PD   Y  L++GFCK  D   A+ ++  MI  G  P    Y
Sbjct  360   GQIELMKESYQKMLSRGLVPDIVLYNTLVNGFCKNGDLVAARNIVDGMIHRGLRPDKVTY  419

Query  587   SWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQE  408
             + L+D +C   + E  +++  +    G  +D   + A+I  +CK G++  AER    M  
Sbjct  420   TTLIDGFCRVGDVETALEIRKKMDQDGLELDRVSFSALICGMCKEGRVIDAERALREMLR  479

Query  407   REILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
               +  D V+YT +  A+ K+G+ +    L  EM
Sbjct  480   AGMKPDDVIYTMMMDAFCKKGDVQTGFKLLKEM  512


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 85/175 (49%), Gaps = 1/175 (1%)
 Frame = -2

Query  815  PDNV-TCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
            P NV   N L+N +CK G I  A KV +++ +  LRP   ++  LI+G+CK+ + +    
Sbjct  238  PSNVYVFNILMNKFCKEGKICVAQKVFDEITKRSLRPTVVSFNTLINGYCKSGNLDEGFR  297

Query  638  VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
            +   M  +   P    YS L++  C +N  E    L DE   +G   +   +  +I    
Sbjct  298  LKHRMEKSRTRPDVFTYSALINALCKENKMEGAHGLFDEMCEKGLSPNDVIFTTLIHGHS  357

Query  458  KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
            + G+++  +  +  M  R ++ D V+Y +L   + K G+  AA ++ D M  R L
Sbjct  358  RNGQIELMKESYQKMLSRGLVPDIVLYNTLVNGFCKNGDLVAARNIVDGMIHRGL  412


 Score = 63.5 bits (153),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/170 (22%), Positives = 78/170 (46%), Gaps = 0/170 (0%)
 Frame = -2

Query  800  CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
            C  L++   K+    +      ++L+AG   + + +  L++ FCK      A++V  ++ 
Sbjct  209  CGNLLDRMMKLNPTGTVWGFYMEILDAGYPSNVYVFNILMNKFCKEGKICVAQKVFDEIT  268

Query  620  AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
                 P+  +++ L++ YC   N +   +L           D+  Y A+I  LCK  K++
Sbjct  269  KRSLRPTVVSFNTLINGYCKSGNLDEGFRLKHRMEKSRTRPDVFTYSALINALCKENKME  328

Query  440  CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
             A   F  M E+ +  + V++T+L + + + G      + + +M  R L+
Sbjct  329  GAHGLFDEMCEKGLSPNDVIFTTLIHGHSRNGQIELMKESYQKMLSRGLV  378



>emb|CDP06762.1| unnamed protein product [Coffea canephora]
Length=613

 Score =   262 bits (670),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 165/544 (30%), Positives = 282/544 (52%), Gaps = 9/544 (2%)
 Frame = -2

Query  1901  ANTESQLVKTLCVIVLKGHWNNL-LKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWV  1725
             + ++ Q+ K + V ++    + L L+P     +   II H +L+         + FF ++
Sbjct  17    SKSDRQIAKAISVALISSTKDPLRLEPTCNSDLNPQII-HLVLSNPRVPAQNCFCFFNFL  75

Query  1724  ETIPNY---RHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDD  1554
             +T P+    + ++ +  ++   L K + F+ AK +L+ +A  D L S     A     + 
Sbjct  76    KTNPSVAPQKPNIDAHITLALRLFKARKFREAKSVLNAVASDDNLRSSISEIASSAGKNS  135

Query  1553  SD--VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDT  1380
             S+  +  ++F  L   YA++KR  + ++VFEH+     + D  +C V L +L K    ++
Sbjct  136   SEPRIVGKLFDMLFRVYADNKRFKEGLEVFEHMLSSGFEIDERSCLVYLIALKKFDQFES  195

Query  1379  VWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLIS  1200
             ++  + +M++  V   ++    +I   CK  EV+KA   L EM  KGI P+ +T+NTLI 
Sbjct  196   LFAFFNRMVEANVKITVYSVTTVIGGLCKRREVDKARILLDEMVAKGIKPNEFTYNTLID  255

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VT  1026
              Y R         +   M++ GV  ++ TY  LIH  C  GR+ EA +LF+++ EK  +T
Sbjct  256   AYIRIQDFDGVQEILSAMKKDGVGFNVTTYTLLIHGRCISGRVAEAQKLFEELHEKGGLT  315

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             P+   YT +I+GYC++G++ +A  L  ++ E+GL P V TY +++   C  G+M  +  L
Sbjct  316   PDVHVYTVMINGYCKLGNVKQAFVLFDSLVERGLVPNVHTYGALIEGVCGAGQMGAAEIL  375

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             L +M  K I+ + V  NTL++GYCK G +  A +++  M   GL  D + Y  +  G CK
Sbjct  376   LKEMQSKGIDLNRVIFNTLMDGYCKQGMVGEARRLQAIMEGKGLEADVYVYNIIATGLCK  435

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             AK  + AK+V+F M+  G  P+   Y+ L+D Y  + N     ++  E   RG   +   
Sbjct  436   AKQYDEAKKVLFSMMDKGVVPNTVTYTTLIDIYSKEGNLVEAKRIFREMLNRGEKPNEVT  495

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMY  306
             Y A+I   CK+G +  A +    MQ + +  D   YTSL +     G   +A +LF+EM+
Sbjct  496   YNALIDGYCKKGNVKEAYQMRSEMQVKGLTPDVYTYTSLVHGECMHGKIDSAVELFNEMH  555

Query  305   KRRL  294
              R L
Sbjct  556   GRLL  559


 Score =   212 bits (539),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/362 (34%), Positives = 195/362 (54%), Gaps = 2/362 (1%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             IKP+      L+++ ++    D V +    M K GV  N+  Y +LIH  C SG V +A 
Sbjct  243   IKPNEFTYNTLIDAYIRIQDFDGVQEILSAMKKDGVGFNVTTYTLLIHGRCISGRVAEAQ  302

Query  1268  EFLSEMEFKG-IFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHS  1092
             +   E+  KG + PD++ +  +I+ YC+ G   +A  + D +   G+ P++ TY +LI  
Sbjct  303   KLFEELHEKGGLTPDVHVYTVMINGYCKLGNVKQAFVLFDSLVERGLVPNVHTYGALIEG  362

Query  1091  HCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPR  915
              C  G+M  A  L K+++ K +  N V + TL+DGYC+ G + EA RL + ME KGL   
Sbjct  363   VCGAGQMGAAEILLKEMQSKGIDLNRVIFNTLMDGYCKQGMVGEARRLQAIMEGKGLEAD  422

Query  914   VATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKN  735
             V  YN I    C+  +  E+ K+L  M +K + P+ VT  TLI+ Y K G++V A ++  
Sbjct  423   VYVYNIIATGLCKAKQYDEAKKVLFSMMDKGVVPNTVTYTTLIDIYSKEGNLVEAKRIFR  482

Query  734   KMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQN  555
             +ML  G +P+  TY ALI G+CK  + + A ++  +M   G +P    Y+ LV   C+  
Sbjct  483   EMLNRGEKPNEVTYNALIDGYCKKGNVKEAYQMRSEMQVKGLTPDVYTYTSLVHGECMHG  542

Query  554   NNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYT  375
               ++ V+L +E  GR    ++  Y A+I  L K G+ D A R +  M E  +  D  VY+
Sbjct  543   KIDSAVELFNEMHGRLLAPNVVTYTALISGLSKEGRSDEAFRLYDEMTEAGLTPDDTVYS  602

Query  374   SL  369
             SL
Sbjct  603   SL  604


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 101/213 (47%), Gaps = 3/213 (1%)
 Frame = -2

Query  920  PRVAT--YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSAL  747
            PR+    ++ + R + +  R KE  ++   M     E D  +C   +    K     S  
Sbjct  138  PRIVGKLFDMLFRVYADNKRFKEGLEVFEHMLSSGFEIDERSCLVYLIALKKFDQFESLF  197

Query  746  KVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTY  567
               N+M+EA ++   ++   +I G CK ++ ++A+ ++ +M+A G  P+   Y+ L+D Y
Sbjct  198  AFFNRMVEANVKITVYSVTTVIGGLCKRREVDKARILLDEMVAKGIKPNEFTYNTLIDAY  257

Query  566  CLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDS  387
                + + + ++       G   +++ Y  +I   C  G++  A++ F  + E+  L   
Sbjct  258  IRIQDFDGVQEILSAMKKDGVGFNVTTYTLLIHGRCISGRVAEAQKLFEELHEKGGLTPD  317

Query  386  V-VYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
            V VYT +   Y K GN + A  LFD + +R L+
Sbjct  318  VHVYTVMINGYCKLGNVKQAFVLFDSLVERGLV  350



>gb|EPS66849.1| hypothetical protein M569_07924, partial [Genlisea aurea]
Length=729

 Score =   264 bits (675),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/493 (30%), Positives = 257/493 (52%), Gaps = 7/493 (1%)
 Frame = -2

Query  1751  LSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACK--DFLSSPAVLN  1578
             L   F  W   +P +R  LQ     I+ILT+ K +K+A+ +  ++A +        +V +
Sbjct  53    LVLKFLDWARGLPFFRDHLQCYCLSIHILTRFKLYKTAQSLAEEVALRFPQDEHGDSVFS  112

Query  1577  ALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK  1398
              L  +    + +S VF  ++  ++N K T  A+ +    + C   P   +   +L ++ +
Sbjct  113   CLRDTYQACESSSGVFDLVVKAFSNLKLTDRALNMIYSAKCCGFMPSVLSYNAVLEAIFR  172

Query  1397  EGL---TDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPD  1227
                    D+    + +M++ G+ PN++ YNVLI   C + E+ +      +ME +G+ P+
Sbjct  173   NSSCRNVDSARCVFHEMMENGISPNVYTYNVLIRGLCANKEMNQGLSLFEQMEKRGVLPN  232

Query  1226  LYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFK  1047
             + TFNT+I  YC+     +A  +  +M    +EP++ITYN +I+  C+EGR++E   +  
Sbjct  233   VVTFNTVIDAYCKSRNIDQAYGLLKQMWERNLEPNVITYNVIINGLCKEGRIKETDDVLV  292

Query  1046  DIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEG  870
             D+K K + PNE+TY TL+DGYC+ G+  +AL LH+ M + GL P V TY  ++   C+ G
Sbjct  293   DMKAKGLAPNEITYNTLVDGYCKEGNFHQALALHAEMVKNGLSPNVVTYTCLINSLCKAG  352

Query  869   RMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYK  690
              ++ +    NQM  + ++P+  T  TLI+G+ + G +  A  +  +M+  G  P   TY 
Sbjct  353   NLQRAMDYFNQMAVRGLKPNEKTYTTLIDGFSQQGFMDEAYGLVEEMISKGFSPSIVTYN  412

Query  689   ALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGR  510
             ALI+G C+    +    VI  M + G  P   +YS +++ YC   + +    + ++ S +
Sbjct  413   ALINGHCQLGRVDEGLNVIQTMTSRGVFPDVVSYSSIINGYCRNLDLDKAFSVKEDMSQK  472

Query  509   GYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQER-EILGDSVVYTSLAYAYFKEGNTRA  333
             G   D   Y ++I+ LC+  +LD A + F  M  +  +L D   YT L  AY  E +   
Sbjct  473   GIFPDTITYSSLIQGLCELRRLDEACKLFTEMSSKLNLLPDKCTYTCLINAYCAENDIPK  532

Query  332   ASDLFDEMYKRRL  294
             A  L DEM +R L
Sbjct  533   AIHLHDEMIRRGL  545


 Score =   197 bits (501),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/384 (28%), Positives = 200/384 (52%), Gaps = 31/384 (8%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             + P+      L++   KEG        + +M+K G+ PN+  Y  LI++ CK+G +++A 
Sbjct  299   LAPNEITYNTLVDGYCKEGNFHQALALHAEMVKNGLSPNVVTYTCLINSLCKAGNLQRAM  358

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             ++ ++M  +G+ P+  T+ TLI  + ++G   EA  + + M   G  P I+TYN+LI+ H
Sbjct  359   DYFNQMAVRGLKPNEKTYTTLIDGFSQQGFMDEAYGLVEEMISKGFSPSIVTYNALINGH  418

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C+ GR+ E + + + +  + V P+ V+Y+++I+GYCR  D+D+A  +   M +KG+ P  
Sbjct  419   CQLGRVDEGLNVIQTMTSRGVFPDVVSYSSIINGYCRNLDLDKAFSVKEDMSQKGIFPDT  478

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEK-KIEPDNVTCNTLINGYCKIGDIVSALKVKN  735
              TY+S+++  CE  R+ E+ KL  +M  K  + PD  T   LIN YC   DI  A+ + +
Sbjct  479   ITYSSLIQGLCELRRLDEACKLFTEMSSKLNLLPDKCTYTCLINAYCAENDIPKAIHLHD  538

Query  734   KMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQN  555
             +M+  GL PD  +Y  L++G  K   ++ A+ ++F     G    Y  + +L+       
Sbjct  539   EMIRRGLFPDVISYNVLVNGINKQSRSDEARRLLFKSTTHGSQHEY-THDYLIQR-----  592

Query  554   NNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYT  375
                              C+ ++   ++++  C  G ++ A+R    M+E+      V+Y 
Sbjct  593   -----------------CISVA---SLMKAFCMNGLMNEADRLLMSMKEKP---SEVIYN  629

Query  374   SLAYAYFKEGNTRAASDLFDEMYK  303
              +   + + GN   A +L+ EM +
Sbjct  630   VVIRGHCRAGNLAKAMELYSEMVR  653


 Score =   162 bits (409),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/304 (30%), Positives = 161/304 (53%), Gaps = 14/304 (5%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A+  F  + +  +KP+    T L++   ++G  D  +   ++MI  G  P+I  YN LI+
Sbjct  357   AMDYFNQMAVRGLKPNEKTYTTLIDGFSQQGFMDEAYGLVEEMISKGFSPSIVTYNALIN  416

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               C+ G V++    +  M  +G+FPD+ +++++I+ YCR     +A SV++ M + G+ P
Sbjct  417   GHCQLGRVDEGLNVIQTMTSRGVFPDVVSYSSIINGYCRNLDLDKAFSVKEDMSQKGIFP  476

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIKEKVT--PNEVTYTTLIDGYCRVGDIDEALRL  951
             D ITY+SLI   C   R+ EA +LF ++  K+   P++ TYT LI+ YC   DI +A+ L
Sbjct  477   DTITYSSLIQGLCELRRLDEACKLFTEMSSKLNLLPDKCTYTCLINAYCAENDIPKAIHL  536

Query  950   HSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL---------NQMGEKKIEPDNVTC  798
             H  M  +GL P V +YN ++    ++ R  E+ +LL         ++     +    ++ 
Sbjct  537   HDEMIRRGLFPDVISYNVLVNGINKQSRSDEARRLLFKSTTHGSQHEYTHDYLIQRCISV  596

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
              +L+  +C  G +  A ++   M E   +P    Y  +I G C+A +  +A E+  +M+ 
Sbjct  597   ASLMKAFCMNGLMNEADRLLMSMKE---KPSEVIYNVVIRGHCRAGNLAKAMELYSEMVR  653

Query  617   AGFS  606
              GF+
Sbjct  654   VGFA  657


 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 134/311 (43%), Gaps = 51/311 (16%)
 Frame = -2

Query  1496  RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYN  1317
             R  + + V + +    + PD  + + ++N   +    D  +   + M + G+ P+   Y+
Sbjct  423   RVDEGLNVIQTMTSRGVFPDVVSYSSIINGYCRNLDLDKAFSVKEDMSQKGIFPDTITYS  482

Query  1316  VLIHACCKSGEVEKADEFLSEMEFK-GIFPDLYTFNTLISLYCRRGMHYEALSVQDRMER  1140
              LI   C+   +++A +  +EM  K  + PD  T+  LI+ YC      +A+ + D M R
Sbjct  483   SLIQGLCELRRLDEACKLFTEMSSKLNLLPDKCTYTCLINAYCAENDIPKAIHLHDEMIR  542

Query  1139  GGVEPDIITYN--------------------------------------------SLIHS  1092
              G+ PD+I+YN                                            SL+ +
Sbjct  543   RGLFPDVISYNVLVNGINKQSRSDEARRLLFKSTTHGSQHEYTHDYLIQRCISVASLMKA  602

Query  1091  HCREGRMREAMRLFKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
              C  G M EA RL   +KEK  P+EV Y  +I G+CR G++ +A+ L+S M   G     
Sbjct  603   FCMNGLMNEADRLLMSMKEK--PSEVIYNVVIRGHCRAGNLAKAMELYSEMVRVGFAAHA  660

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGE--KKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
              T  SI+    E G M+E  K+L +     K ++ D       +N Y + G++ +  K+ 
Sbjct  661   GTVISIIEGLHEGGMMEELRKVLEETFRSCKVVDGDGAKLQVEVN-YGE-GNMDAVFKMI  718

Query  737   NKMLEAGLRPD  705
               M   GL P+
Sbjct  719   RDMARDGLLPN  729



>ref|XP_009781997.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009781998.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
Length=726

 Score =   263 bits (672),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 255/483 (53%), Gaps = 2/483 (0%)
 Frame = -2

Query  1751  LSWSFFKWVET-IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNA  1575
             L+  F   V    PN++HS  S  +++++L + K    A+  + ++  +  +S   ++ +
Sbjct  93    LAQKFINLVTVNCPNFKHSSTSLSTVVHVLIRCKRVADAQAFILRMIRRSGVSRIEIVES  152

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE  1395
             LV +   S  N   F  L+  Y  +++  +A++ F  L+   +    +AC  LL  LV+ 
Sbjct  153   LVSTYGISGSNPYSFDLLIRTYVQARKIREAVEAFRLLQSRNLCVSINACNGLLGGLVRI  212

Query  1394  GLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTF  1215
             G  D  W+ Y +M    + PN++  N++++A CK G++E A+ F+ EME KGIFPD+ T+
Sbjct  213   GWVDLAWEVYGEMRGSDIQPNVYTLNIMVNALCKDGKIENANPFIKEMEEKGIFPDMVTY  272

Query  1214  NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             NTLI+ YC  G+  EA  V + M+  G+ P ++TYNS+I+  C+ G+ R A +L  ++ E
Sbjct  273   NTLINAYCHVGLLEEAYEVINLMKVTGLRPCLLTYNSIINGLCKNGQYRRARQLLVEMVE  332

Query  1034  K-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKE  858
               + P+  +Y TL+   CR G++ EA  +   M  + + P + +Y+S++  F   GR+  
Sbjct  333   SGLAPDTASYNTLLAECCRTGNLQEAESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHC  392

Query  857   STKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIH  678
             S      M  K + PDNV    LI G+C+IG +  A+K++++MLE GL  D  TY  +++
Sbjct  393   SLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILN  452

Query  677   GFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCV  498
             G CK K    A E+  +M+  G +P +  ++ +++  C   N +  + L +    R    
Sbjct  453   GLCKEKMLHEADELFNEMVERGVNPDFYTFTTVINGCCKCGNMDKALTLFEAMLLRNLKP  512

Query  497   DISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLF  318
             D+  Y ++I   CK G ++ A      M    I  + + Y+     +  +G    A  L+
Sbjct  513   DVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSIFINGFCNKGCVSDALRLW  572

Query  317   DEM  309
             DEM
Sbjct  573   DEM  575


 Score =   228 bits (582),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/447 (28%), Positives = 229/447 (51%), Gaps = 36/447 (8%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+  Y +     +A +V   +++  ++P       ++N L K G      +   +M+
Sbjct  272   YNTLINAYCHVGLLEEAYEVINLMKVTGLRPCLLTYNSIINGLCKNGQYRRARQLLVEMV  331

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY-------  1194
             + G+ P+   YN L+  CC++G +++A+    EM  + I PDL ++++LI L+       
Sbjct  332   ESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLH  391

Query  1193  ----------------------------CRRGMHYEALSVQDRMERGGVEPDIITYNSLI  1098
                                         CR G   EA+ ++D M   G+  D++TYN+++
Sbjct  392   CSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTIL  451

Query  1097  HSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLC  921
             +  C+E  + EA  LF ++ E+ V P+  T+TT+I+G C+ G++D+AL L  AM  + L 
Sbjct  452   NGLCKEKMLHEADELFNEMVERGVNPDFYTFTTVINGCCKCGNMDKALTLFEAMLLRNLK  511

Query  920   PRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKV  741
             P V TYNS++  FC+ G M+++  L ++M    I P+ +T +  ING+C  G +  AL++
Sbjct  512   PDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSIFINGFCNKGCVSDALRL  571

Query  740   KNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCL  561
              ++M++ G++P   T  ++I G+C++ D  RA + + +M +    P    Y+ L+D +  
Sbjct  572   WDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYPDSVTYNTLLDGFIR  631

Query  560   QNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVV  381
             + N +  + L +E   RG   D+  Y  I+   CK G++  A   +  M ER I  D   
Sbjct  632   EENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINPDKST  691

Query  380   YTSLAYAYFKEGNTRAASDLFDEMYKR  300
             YTSL   +  + N + A    DEM +R
Sbjct  692   YTSLINGHVSQDNLKEAFRFHDEMLQR  718


 Score =   209 bits (532),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/430 (29%), Positives = 219/430 (51%), Gaps = 19/430 (4%)
 Frame = -2

Query  1718  IPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALV----RSDDDS  1551
             +   R  L +  S+I  L K+  ++ A+ +L ++         A  N L+    R+ +  
Sbjct  297   VTGLRPCLLTYNSIINGLCKNGQYRRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQ  356

Query  1550  DVNSQV--------------FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLL  1413
             +  S                +S L+  ++ + R   ++  +E ++   + PD    T+L+
Sbjct  357   EAESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILI  416

Query  1412  NSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIF  1233
                 + G      K   +M++ G+  ++  YN +++  CK   + +ADE  +EM  +G+ 
Sbjct  417   GGFCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVN  476

Query  1232  PDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL  1053
             PD YTF T+I+  C+ G   +AL++ + M    ++PD++TYNSLI   C+ G M +A  L
Sbjct  477   PDFYTFTTVINGCCKCGNMDKALTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSL  536

Query  1052  FKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCE  876
               + I   ++PN +TY+  I+G+C  G + +ALRL   M + G+ P + T NSI++ +C 
Sbjct  537   RDEMISVNISPNYITYSIFINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCR  596

Query  875   EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
              G    + K LN M  ++I PD+VT NTL++G+ +  ++  AL + N+M   GL PD  T
Sbjct  597   SGDASRADKFLNNMRSQRIYPDSVTYNTLLDGFIREENMDKALDLVNEMGNRGLSPDVIT  656

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
             Y  ++ GFCK    + A  +   M+  G +P    Y+ L++ +  Q+N +   +  DE  
Sbjct  657   YNTILDGFCKFGRMKEANMLYRKMVERGINPDKSTYTSLINGHVSQDNLKEAFRFHDEML  716

Query  515   GRGYCVDISF  486
              RG+  D  F
Sbjct  717   QRGFVPDDKF  726


 Score =   147 bits (372),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/312 (29%), Positives = 166/312 (53%), Gaps = 7/312 (2%)
 Frame = -2

Query  1115  TYNSLIHSHCREGRMREAMRLFKDIKEK---VTPNEVTYTTLIDGYCRVGDIDEALRLHS  945
             +++ LI ++ +  ++REA+  F+ ++ +   V+ N      L+ G  R+G +D A  ++ 
Sbjct  166   SFDLLIRTYVQARKIREAVEAFRLLQSRNLCVSINACN--GLLGGLVRIGWVDLAWEVYG  223

Query  944   AMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIG  765
              M    + P V T N ++   C++G+++ +   + +M EK I PD VT NTLIN YC +G
Sbjct  224   EMRGSDIQPNVYTLNIMVNALCKDGKIENANPFIKEMEEKGIFPDMVTYNTLINAYCHVG  283

Query  764   DIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYS  585
              +  A +V N M   GLRP   TY ++I+G CK     RA++++ +M+ +G +P   +Y+
Sbjct  284   LLEEAYEVINLMKVTGLRPCLLTYNSIINGLCKNGQYRRARQLLVEMVESGLAPDTASYN  343

Query  584   WLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQER  405
              L+   C   N +    +  E S R    D+  Y ++I    + G+L C+  ++  M+ +
Sbjct  344   TLLAECCRTGNLQEAESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSK  403

Query  404   EILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSL--L  231
              +  D+VVYT L   + + G+ + A  + DEM ++ L + +  Y ++      E  L   
Sbjct  404   GLTPDNVVYTILIGGFCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEA  463

Query  230   DLFWNNVMQRGL  195
             D  +N +++RG+
Sbjct  464   DELFNEMVERGV  475



>ref|XP_008232168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Prunus mume]
Length=700

 Score =   263 bits (671),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 141/470 (30%), Positives = 251/470 (53%), Gaps = 1/470 (0%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++HS QS  +MI++L + +    A+ ++ ++  K  +S   V+++LV +  +   +S 
Sbjct  80    PNFKHSSQSLSAMIHLLVRGRRVSDAQALILRMVRKSGVSRVEVVDSLVSTYSNCGSSSL  139

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +  +VF+  R        +AC  LL  LVK G  D  W+ Y ++
Sbjct  140   VFDLLVRTYVQARKLREGFEVFQLFRSKGFCVSINACNSLLGGLVKVGWVDLAWQVYGEV  199

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             +  G+  N++  N++++A CK  +++    FLS+ME KGIF D+ T+NTLI+ YCR G+ 
Sbjct  200   VSSGIQLNVYTLNIMVNALCKDRKIDSVKSFLSDMEEKGIFSDIVTYNTLINAYCREGLL  259

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTL  999
              EA  +++ M   G+ P++ TYN++I+  C+ G    A  +  + +   ++P+  TY TL
Sbjct  260   EEAFQLKNSMSCKGLRPEVFTYNAIINGLCKVGNYARAKEILCEMLNNGLSPDTTTYNTL  319

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             +   CR  DI EA  + + M  +G+ P + +++S++  F   G +  +      M +   
Sbjct  320   LVESCRKDDISEAEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHALVYFRDMKKAGW  379

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
              PDNV    LI+GYC+ G ++ ALK++++MLE G   D  T+  +++G C+ K    A E
Sbjct  380   VPDNVIYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCREKMLSDADE  439

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             +  +M+  G  P +  ++ L+  Y    N    + L +  + R    DI  Y  +I   C
Sbjct  440   LFNEMVERGVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDIVTYNTLIDGFC  499

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             K G++D A+  +  M  R IL + + Y  L   +   G+   A  L+D+M
Sbjct  500   KVGEMDKAKELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQM  549


 Score =   229 bits (583),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 202/377 (54%), Gaps = 1/377 (0%)
 Frame = -2

Query  1418  LLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKG  1239
             L+N+  +EGL +  ++    M   G+ P +  YN +I+  CK G   +A E L EM   G
Sbjct  249   LINAYCREGLLEEAFQLKNSMSCKGLRPEVFTYNAIINGLCKVGNYARAKEILCEMLNNG  308

Query  1238  IFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAM  1059
             + PD  T+NTL+   CR+    EA  + + M   GV PD+++++SLI    R G +  A+
Sbjct  309   LSPDTTTYNTLLVESCRKDDISEAEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHAL  368

Query  1058  RLFKDIKEKV-TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKF  882
               F+D+K+    P+ V YT LI GYCR G + EAL+L   M E+G    V T+N+IL   
Sbjct  369   VYFRDMKKAGWVPDNVIYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGL  428

Query  881   CEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
             C E  + ++ +L N+M E+ + PD  T  TLI+GY K G++  +L +   M +  ++PD 
Sbjct  429   CREKMLSDADELFNEMVERGVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDI  488

Query  701   FTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADE  522
              TY  LI GFCK  + ++AKE+  DM++    P++ +Y  L++ +C   +     +L D+
Sbjct  489   VTYNTLIDGFCKVGEMDKAKELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQ  548

Query  521   FSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGN  342
                 G    +     +I+  C+ G    A+ F G M  + I+ DS+ Y +L   Y KE N
Sbjct  549   MIEEGIKPTLVTCNTVIKGYCRSGNTTKADEFLGKMVSKGIVPDSITYNTLINGYVKEEN  608

Query  341   TRAASDLFDEMYKRRLM  291
                A  +  EM  + ++
Sbjct  609   LDKAFSVVKEMENQGIL  625


 Score =   225 bits (574),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/523 (26%), Positives = 246/523 (47%), Gaps = 54/523 (10%)
 Frame = -2

Query  1760  WFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVL  1581
             W  L+W  +  V +    + ++ +   M+  L K +   S K  L  +  K   S     
Sbjct  188   WVDLAWQVYGEVVS-SGIQLNVYTLNIMVNALCKDRKIDSVKSFLSDMEEKGIFSDIVTY  246

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             N L+ +                 Y       +A Q+   +    ++P+      ++N L 
Sbjct  247   NTLINA-----------------YCREGLLEEAFQLKNSMSCKGLRPEVFTYNAIINGLC  289

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G      +   +M+  G+ P+   YN L+   C+  ++ +A+   +EM  +G+ PDL 
Sbjct  290   KVGNYARAKEILCEMLNNGLSPDTTTYNTLLVESCRKDDISEAEGIFNEMSCRGVIPDLV  349

Query  1220  TFNTLISL-----------------------------------YCRRGMHYEALSVQDRM  1146
             +F++LI +                                   YCR GM  EAL ++D M
Sbjct  350   SFSSLIGVFSRNGHIDHALVYFRDMKKAGWVPDNVIYTILIHGYCRNGMMLEALKLRDEM  409

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDI  969
                G   D++T+N++++  CRE  + +A  LF ++ E+ V P+  T+TTLI GY + G++
Sbjct  410   LEQGCVMDVVTFNTILNGLCREKMLSDADELFNEMVERGVFPDFYTFTTLIHGYSKHGNM  469

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
              ++L L  AM ++ + P + TYN+++  FC+ G M ++ +L   M  ++I P++++   L
Sbjct  470   TKSLNLFEAMTKRNIKPDIVTYNTLIDGFCKVGEMDKAKELWADMVSRRILPNHISYGIL  529

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             ING+C  G +  A ++ ++M+E G++P   T   +I G+C++ +T +A E +  M++ G 
Sbjct  530   INGFCSTGHVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGNTTKADEFLGKMVSKGI  589

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    Y+ L++ Y  + N +    +  E   +G   D+  Y  I+   C++G++  AE 
Sbjct  590   VPDSITYNTLINGYVKEENLDKAFSVVKEMENQGILPDLFTYNIILNGFCRQGRMHEAEL  649

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                 M ER +  D   YTSL   +  + N R A    DEM +R
Sbjct  650   VLRKMIERGVKPDRDTYTSLINGHVTQDNLREAFRFHDEMLQR  692


 Score =   219 bits (557),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/350 (32%), Positives = 191/350 (55%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+  ++ +     A+  F  ++     PD    T+L++   + G+     K   +M+
Sbjct  351   FSSLIGVFSRNGHIDHALVYFRDMKKAGWVPDNVIYTILIHGYCRNGMMLEALKLRDEML  410

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G + ++  +N +++  C+   +  ADE  +EM  +G+FPD YTF TLI  Y + G   
Sbjct  411   EQGCVMDVVTFNTILNGLCREKMLSDADELFNEMVERGVFPDFYTFTTLIHGYSKHGNMT  470

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             ++L++ + M +  ++PDI+TYN+LI   C+ G M +A  L+ D +  ++ PN ++Y  LI
Sbjct  471   KSLNLFEAMTKRNIKPDIVTYNTLIDGFCKVGEMDKAKELWADMVSRRILPNHISYGILI  530

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +G+C  G + EA RL   M E+G+ P + T N++++ +C  G   ++ + L +M  K I 
Sbjct  531   NGFCSTGHVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGNTTKADEFLGKMVSKGIV  590

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD++T NTLINGY K  ++  A  V  +M   G+ PD FTY  +++GFC+      A+ V
Sbjct  591   PDSITYNTLINGYVKEENLDKAFSVVKEMENQGILPDLFTYNIILNGFCRQGRMHEAELV  650

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             +  MI  G  P    Y+ L++ +  Q+N     +  DE   RG+  D  F
Sbjct  651   LRKMIERGVKPDRDTYTSLINGHVTQDNLREAFRFHDEMLQRGFVPDDEF  700



>ref|XP_009413406.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=635

 Score =   261 bits (667),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 153/507 (30%), Positives = 261/507 (51%), Gaps = 8/507 (2%)
 Frame = -2

Query  1808  VTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDM  1629
             ++  +++  LL L P    +     +++  +  +R  L+S  +   IL+  +    A  +
Sbjct  72    LSHPLLSAVLLRLRPSPDLIP----RFLHRVGLHRLDLRSLSTAAAILSSLRPPNPALQL  127

Query  1628  LHQ-IACKDFLSSPAVLNALVRSDDDSDVNSQ--VFSWLLIFYANSKRTWDAIQVFEHLR  1458
             L + I+ +       + +ALV +  + +++    VF  LL  YA++     A+QVF  ++
Sbjct  128   LKKAISARRSDLPKHLFDALVEAHQELELSDPPVVFDLLLKAYADAGEPERALQVFYLMK  187

Query  1457  ICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVE  1278
                  P   +C  LL++ +K    D  W  Y +M ++ +   +  +N++I+  CK G+++
Sbjct  188   DANFVPRIESCNALLSAFLKSDHKDRAWVLYAEMFRMRIPSTVVTFNIMINVLCKEGKLK  247

Query  1277  KADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLI  1098
             KA  F+  ME  G++P + T+NT+I  +C RG     + + D M    +EPD  TY +LI
Sbjct  248   KAKAFMQHMESFGVWPTVITYNTIIHGHCSRGKVQMGIEMLDIMREKAIEPDSYTYGTLI  307

Query  1097  HSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLC  921
                C+EGR+++A  +F +++++ + P  VTY  LIDG C  G++D+A R    M EKG+ 
Sbjct  308   SGLCKEGRLQDASMMFVEMQDRGLVPTAVTYNALIDGCCNKGNLDDAFRYRDEMVEKGIE  367

Query  920   PRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKV  741
             P V TYN ++     EGR +E+  L+ +M +K + PD +T N LINGYCK G+   A K+
Sbjct  368   PTVCTYNLLVHALFMEGRNEEAHTLIKEMEQKGMVPDAITFNILINGYCKEGNADKAFKM  427

Query  740   KNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCL  561
               +M   G+RP   TY +LI+GFCK      A  +  + +  G  P    Y+ L+D +C 
Sbjct  428   FEEMKGKGIRPTRVTYTSLIYGFCKRNRLAEADGLFKEAMHKGLLPDLVMYNALIDGHCG  487

Query  560   QNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVV  381
                 E   +L  E   +    D   + +++R LC  GK++ A      M  R I+ D V 
Sbjct  488   GGKMERAFELLKELERKKIAPDEVTFNSLMRGLCLLGKVEEARGLIDEMTRRGIIPDLVS  547

Query  380   YTSLAYAYFKEGNTRAASDLFDEMYKR  300
             Y +L   Y + G+ + A  + D M  R
Sbjct  548   YNTLISGYSRRGDVKDALSVRDLMLSR  574


 Score =   207 bits (528),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 179/325 (55%), Gaps = 1/325 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             +S  +  L+       R  DA  +F  ++   + P       L++    +G  D  ++  
Sbjct  299   DSYTYGTLISGLCKEGRLQDASMMFVEMQDRGLVPTAVTYNALIDGCCNKGNLDDAFRYR  358

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M++ G+ P +  YN+L+HA    G  E+A   + EME KG+ PD  TFN LI+ YC+ 
Sbjct  359   DEMVEKGIEPTVCTYNLLVHALFMEGRNEEAHTLIKEMEQKGMVPDAITFNILINGYCKE  418

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
             G   +A  + + M+  G+ P  +TY SLI+  C+  R+ EA  LFK+   K + P+ V Y
Sbjct  419   GNADKAFKMFEEMKGKGIRPTRVTYTSLIYGFCKRNRLAEADGLFKEAMHKGLLPDLVMY  478

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
               LIDG+C  G ++ A  L   +E K + P   T+NS++R  C  G+++E+  L+++M  
Sbjct  479   NALIDGHCGGGKMERAFELLKELERKKIAPDEVTFNSLMRGLCLLGKVEEARGLIDEMTR  538

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             + I PD V+ NTLI+GY + GD+  AL V++ ML  G  P   TY ALI G CK  + + 
Sbjct  539   RGIIPDLVSYNTLISGYSRRGDVKDALSVRDLMLSRGFNPTLITYNALIQGLCKNGEGDH  598

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVD  573
             A++++ +M++ G +P    Y  L++
Sbjct  599   AEQLLKEMVSKGITPVDSTYMALIE  623


 Score =   201 bits (510),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 126/428 (29%), Positives = 211/428 (49%), Gaps = 22/428 (5%)
 Frame = -2

Query  1730  WVETIPNYRHSLQSSWS----MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS  1563
             WV     +R  + S+      MI +L K    K AK  +  +  + F   P V+      
Sbjct  215   WVLYAEMFRMRIPSTVVTFNIMINVLCKEGKLKKAKAFMQHM--ESFGVWPTVIT-----  267

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
                       ++ ++  + +  +    I++ + +R   I+PD +    L++ L KEG   
Sbjct  268   ----------YNTIIHGHCSRGKVQMGIEMLDIMREKAIEPDSYTYGTLISGLCKEGRLQ  317

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
                  + +M   G++P    YN LI  CC  G ++ A  +  EM  KGI P + T+N L+
Sbjct  318   DASMMFVEMQDRGLVPTAVTYNALIDGCCNKGNLDDAFRYRDEMVEKGIEPTVCTYNLLV  377

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VT  1026
                   G + EA ++   ME+ G+ PD IT+N LI+ +C+EG   +A ++F+++K K + 
Sbjct  378   HALFMEGRNEEAHTLIKEMEQKGMVPDAITFNILINGYCKEGNADKAFKMFEEMKGKGIR  437

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             P  VTYT+LI G+C+   + EA  L      KGL P +  YN+++   C  G+M+ + +L
Sbjct  438   PTRVTYTSLIYGFCKRNRLAEADGLFKEAMHKGLLPDLVMYNALIDGHCGGGKMERAFEL  497

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             L ++  KKI PD VT N+L+ G C +G +  A  + ++M   G+ PD  +Y  LI G+ +
Sbjct  498   LKELERKKIAPDEVTFNSLMRGLCLLGKVEEARGLIDEMTRRGIIPDLVSYNTLISGYSR  557

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
               D + A  V   M++ GF+P+   Y+ L+   C     +   +L  E   +G     S 
Sbjct  558   RGDVKDALSVRDLMLSRGFNPTLITYNALIQGLCKNGEGDHAEQLLKEMVSKGITPVDST  617

Query  485   YRAIIRRL  462
             Y A+I  L
Sbjct  618   YMALIEGL  625


 Score =   165 bits (417),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/345 (26%), Positives = 176/345 (51%), Gaps = 1/345 (0%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRM  1146
             ++++L+ A   +GE E+A +    M+     P + + N L+S + +      A  +   M
Sbjct  162   VFDLLLKAYADAGEPERALQVFYLMKDANFVPRIESCNALLSAFLKSDHKDRAWVLYAEM  221

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDI  969
              R  +   ++T+N +I+  C+EG++++A    + ++   V P  +TY T+I G+C  G +
Sbjct  222   FRMRIPSTVVTFNIMINVLCKEGKLKKAKAFMQHMESFGVWPTVITYNTIIHGHCSRGKV  281

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
                + +   M EK + P   TY +++   C+EGR+++++ +  +M ++ + P  VT N L
Sbjct  282   QMGIEMLDIMREKAIEPDSYTYGTLISGLCKEGRLQDASMMFVEMQDRGLVPTAVTYNAL  341

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             I+G C  G++  A + +++M+E G+ P   TY  L+H        E A  +I +M   G 
Sbjct  342   IDGCCNKGNLDDAFRYRDEMVEKGIEPTVCTYNLLVHALFMEGRNEEAHTLIKEMEQKGM  401

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    ++ L++ YC + N +   K+ +E  G+G       Y ++I   CKR +L  A+ 
Sbjct  402   VPDAITFNILINGYCKEGNADKAFKMFEEMKGKGIRPTRVTYTSLIYGFCKRNRLAEADG  461

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
              F     + +L D V+Y +L   +   G    A +L  E+ ++++
Sbjct  462   LFKEAMHKGLLPDLVMYNALIDGHCGGGKMERAFELLKELERKKI  506


 Score =   164 bits (415),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 147/265 (55%), Gaps = 3/265 (1%)
 Frame = -2

Query  1439  DPHACT--VLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADE  1266
             +P  CT  +L+++L  EG  +      K+M + G++P+   +N+LI+  CK G  +KA +
Sbjct  367   EPTVCTYNLLVHALFMEGRNEEAHTLIKEMEQKGMVPDAITFNILINGYCKEGNADKAFK  426

Query  1265  FLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHC  1086
                EM+ KGI P   T+ +LI  +C+R    EA  +       G+ PD++ YN+LI  HC
Sbjct  427   MFEEMKGKGIRPTRVTYTSLIYGFCKRNRLAEADGLFKEAMHKGLLPDLVMYNALIDGHC  486

Query  1085  REGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVA  909
               G+M  A  L K++ ++K+ P+EVT+ +L+ G C +G ++EA  L   M  +G+ P + 
Sbjct  487   GGGKMERAFELLKELERKKIAPDEVTFNSLMRGLCLLGKVEEARGLIDEMTRRGIIPDLV  546

Query  908   TYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKM  729
             +YN+++  +   G +K++  + + M  +   P  +T N LI G CK G+   A ++  +M
Sbjct  547   SYNTLISGYSRRGDVKDALSVRDLMLSRGFNPTLITYNALIQGLCKNGEGDHAEQLLKEM  606

Query  728   LEAGLRPDSFTYKALIHGFCKAKDT  654
             +  G+ P   TY ALI G    K T
Sbjct  607   VSKGITPVDSTYMALIEGLGDGKKT  631


 Score =   144 bits (364),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 147/311 (47%), Gaps = 1/311 (0%)
 Frame = -2

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI  1041
              F+ L+  Y   G    AL V   M+     P I + N+L+ +  +      A  L+ ++
Sbjct  162   VFDLLLKAYADAGEPERALQVFYLMKDANFVPRIESCNALLSAFLKSDHKDRAWVLYAEM  221

Query  1040  -KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
              + ++    VT+  +I+  C+ G + +A      ME  G+ P V TYN+I+   C  G++
Sbjct  222   FRMRIPSTVVTFNIMINVLCKEGKLKKAKAFMQHMESFGVWPTVITYNTIIHGHCSRGKV  281

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
             +   ++L+ M EK IEPD+ T  TLI+G CK G +  A  +  +M + GL P + TY AL
Sbjct  282   QMGIEMLDIMREKAIEPDSYTYGTLISGLCKEGRLQDASMMFVEMQDRGLVPTAVTYNAL  341

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGY  504
             I G C   + + A     +M+  G  P+ C Y+ LV    ++  NE    L  E   +G 
Sbjct  342   IDGCCNKGNLDDAFRYRDEMVEKGIEPTVCTYNLLVHALFMEGRNEEAHTLIKEMEQKGM  401

Query  503   CVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASD  324
               D   +  +I   CK G  D A + F  M+ + I    V YTSL Y + K      A  
Sbjct  402   VPDAITFNILINGYCKEGNADKAFKMFEEMKGKGIRPTRVTYTSLIYGFCKRNRLAEADG  461

Query  323   LFDEMYKRRLM  291
             LF E   + L+
Sbjct  462   LFKEAMHKGLL  472


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/223 (22%), Positives = 97/223 (43%), Gaps = 0/223 (0%)
 Frame = -2

Query  953  LHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYC  774
            L  A +E  L      ++ +L+ + + G  + + ++   M +    P   +CN L++ + 
Sbjct  147  LVEAHQELELSDPPVVFDLLLKAYADAGEPERALQVFYLMKDANFVPRIESCNALLSAFL  206

Query  773  KIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYC  594
            K      A  +  +M    +     T+  +I+  CK    ++AK  +  M + G  P+  
Sbjct  207  KSDHKDRAWVLYAEMFRMRIPSTVVTFNIMINVLCKEGKLKKAKAFMQHMESFGVWPTVI  266

Query  593  AYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMM  414
             Y+ ++  +C +   +  +++ D    +    D   Y  +I  LCK G+L  A   F  M
Sbjct  267  TYNTIIHGHCSRGKVQMGIEMLDIMREKAIEPDSYTYGTLISGLCKEGRLQDASMMFVEM  326

Query  413  QEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
            Q+R ++  +V Y +L      +GN   A    DEM ++ +  T
Sbjct  327  QDRGLVPTAVTYNALIDGCCNKGNLDDAFRYRDEMVEKGIEPT  369



>ref|XP_010528566.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Tarenaya hassleriana]
Length=607

 Score =   260 bits (665),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 141/508 (28%), Positives = 264/508 (52%), Gaps = 4/508 (1%)
 Frame = -2

Query  1832  LKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHK  1653
             L P + +     +++   L+L P   +   SFF+++ + P++R ++++ ++M   L  H+
Sbjct  76    LLPLLNVRHVIDLVDRNPLSLPPRSVF---SFFRFLSSQPDFRLTIETYFAMARFLAVHE  132

Query  1652  HFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQV  1473
              F  A+ ++  +  +   SS + +   +     + +   +   L+I Y N     DAIQ 
Sbjct  133   MFAEAQSLVEFVVSRKGKSSASSVFISLAEMRRTHMLDFLVDVLMIAYVNLGFLSDAIQC  192

Query  1472  FEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCK  1293
             F   R  +       C  LL+ ++    T  VW  Y +++  G  PN++++N+L++  CK
Sbjct  193   FRLARKHKFAVPVRGCGNLLDRMMNSNPTRNVWGFYMEILDSGFPPNVYVFNILMNKFCK  252

Query  1292  SGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIIT  1113
              G++  A     EM  + + P + +FNTLI+ YC+ G   E   ++  ME   + PD+ T
Sbjct  253   EGKISDAQMVFDEMPSRRLRPTVVSFNTLINGYCKSGNLDEGFRLKRVMEENRIRPDVFT  312

Query  1112  YNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAME  936
             Y+ LI+  C++ RM +A R+F ++    +TPN++T+TTLI G  R G ID    ++  M 
Sbjct  313   YSVLINGLCKDNRMDDAHRIFDEMCVRGLTPNDITFTTLIHGQSRNGKIDLMTEIYQKML  372

Query  935   EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
              +GL P +  YN+++  FC+ G +  + K++++M ++ + PD VT  TLI+GYCK GD+ 
Sbjct  373   LRGLQPDIVLYNTLINGFCKNGDVVTARKIVDEMIQRGLRPDKVTYTTLIDGYCKGGDLE  432

Query  755   SALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLV  576
             +AL+++ +M + G   DS  + ALI G C+ +    A+  + +M+  G  P    Y+ ++
Sbjct  433   TALEIRKEMDQNGTELDSMAFAALISGMCREERVIDAERTLREMLRNGKKPDDITYTMIM  492

Query  575   DTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
             D +C + + +   KL  E    G+   +  Y  ++  LCK G++  A+     M    ++
Sbjct  493   DGFCKKGDVKMGFKLLKEMQRDGHVPSVVTYNVLLNGLCKLGQMKNADMLLDSMLNLGVV  552

Query  395   GDSVVYTSLAYAYFKEGNTRAASDLFDE  312
              D + Y  L   +++  N     +L  E
Sbjct  553   PDDITYNILLEGHYRHVNAANLDELKGE  580


 Score =   172 bits (435),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 153/279 (55%), Gaps = 1/279 (0%)
 Frame = -2

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P++  +N L++  C+EG++ +A  +F ++   ++ P  V++ TLI+GYC+ G++DE 
Sbjct  235   GFPPNVYVFNILMNKFCKEGKISDAQMVFDEMPSRRLRPTVVSFNTLINGYCKSGNLDEG  294

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              RL   MEE  + P V TY+ ++   C++ RM ++ ++ ++M  + + P+++T  TLI+G
Sbjct  295   FRLKRVMEENRIRPDVFTYSVLINGLCKDNRMDDAHRIFDEMCVRGLTPNDITFTTLIHG  354

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
               + G I    ++  KML  GL+PD   Y  LI+GFCK  D   A++++ +MI  G  P 
Sbjct  355   QSRNGKIDLMTEIYQKMLLRGLQPDIVLYNTLINGFCKNGDVVTARKIVDEMIQRGLRPD  414

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                Y+ L+D YC   + E  +++  E    G  +D   + A+I  +C+  ++  AER   
Sbjct  415   KVTYTTLIDGYCKGGDLETALEIRKEMDQNGTELDSMAFAALISGMCREERVIDAERTLR  474

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
              M       D + YT +   + K+G+ +    L  EM +
Sbjct  475   EMLRNGKKPDDITYTMIMDGFCKKGDVKMGFKLLKEMQR  513


 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 80/175 (46%), Gaps = 1/175 (1%)
 Frame = -2

Query  815  PDNV-TCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
            P NV   N L+N +CK G I  A  V ++M    LRP   ++  LI+G+CK+ + +    
Sbjct  237  PPNVYVFNILMNKFCKEGKISDAQMVFDEMPSRRLRPTVVSFNTLINGYCKSGNLDEGFR  296

Query  638  VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
            +   M      P    YS L++  C  N  +   ++ DE   RG   +   +  +I    
Sbjct  297  LKRVMEENRIRPDVFTYSVLINGLCKDNRMDDAHRIFDEMCVRGLTPNDITFTTLIHGQS  356

Query  458  KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
            + GK+D     +  M  R +  D V+Y +L   + K G+   A  + DEM +R L
Sbjct  357  RNGKIDLMTEIYQKMLLRGLQPDIVLYNTLINGFCKNGDVVTARKIVDEMIQRGL  411



>ref|XP_010253962.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 
[Nelumbo nucifera]
Length=618

 Score =   260 bits (664),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 153/518 (30%), Positives = 274/518 (53%), Gaps = 9/518 (2%)
 Frame = -2

Query  1838  NLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTK  1659
             +LL P++   +   + N  L T S   F+   +F +W  +   Y+H + +  ++IY L K
Sbjct  53    HLLNPEV---IQLVLSNPLLRTKSYLDFF---NFLQWKGSTSPYQHDISAYLTLIYRLFK  106

Query  1658  HKHFKSAKDMLHQIACKDFLSSPAVLNALVRSD--DDSDVNSQVFSWLLIFYANSKRTWD  1485
              + F  AK +L+ +   + +   A + A +  +  D S + +++   L   Y+++++  +
Sbjct  107   DRRFALAKHLLNSVVINEDIKCTATVTASLLENVCDGSWIRAKLVDMLFRVYSDNRKFGE  166

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A++ FE+++    K D  +C + L +L +     + ++  +KM++ GV  ++    +++ 
Sbjct  167   ALETFEYMKNNGFKIDERSCIIYLLALKRSNQVKSAFRFLRKMLEAGVEVSVRSMTIVVD  226

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               CK GE+E A   + EM  +GI P++ T+N L+  Y ++G   EA  V++ ME+ GV  
Sbjct  227   GLCKIGEIETAKGLMDEMAGRGIKPNVATYNCLMGTYLKQGAFEEATKVRNLMEQKGVAY  286

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             +I+TY  LI      G++ EA RLF+++ +K +  +   YT LI+G+CR GD+  A  L 
Sbjct  287   NILTYTILIDRFSSCGKVGEAERLFQEMHQKGIIADIYVYTALINGHCRAGDMKRAFILF  346

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
               + E+GL P   TY SI+   C+ G ++ +  L+++M  K I  + V  N+L+NGYC+ 
Sbjct  347   DELTERGLSPNAHTYGSIINGLCKVGNLEAAQMLVDEMQSKGINVNEVIFNSLMNGYCRE  406

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
             G +  ALK++  M + GL+ D FTY  +  G CKAK T  AK ++  M     +P+  ++
Sbjct  407   GLVDEALKLQVVMEKKGLKLDVFTYNTIASGLCKAKRTNEAKRLLITMEERDVTPNKLSF  466

Query  587   SWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQE  408
             + L+D YC + +     ++  E   +G   + + Y A+I   C++G L  A +    M+ 
Sbjct  467   TTLIDAYCKEGDLLGAKRVFHEMEKKGVKPNAATYNALIYGYCRKGNLKEAYKLRDEMEM  526

Query  407   REILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
               I  D   YT+L +          A +LF EM KR L
Sbjct  527   NGIAADIYTYTTLIHGNCMVRKVDEAWELFHEMPKRGL  564


 Score =   204 bits (518),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 188/326 (58%), Gaps = 1/326 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   ++ L+  +++  +  +A ++F+ +    I  D +  T L+N   + G     +  +
Sbjct  287   NILTYTILIDRFSSCGKVGEAERLFQEMHQKGIIADIYVYTALINGHCRAGDMKRAFILF  346

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              ++ + G+ PN H Y  +I+  CK G +E A   + EM+ KGI  +   FN+L++ YCR 
Sbjct  347   DELTERGLSPNAHTYGSIINGLCKVGNLEAAQMLVDEMQSKGINVNEVIFNSLMNGYCRE  406

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
             G+  EAL +Q  ME+ G++ D+ TYN++    C+  R  EA RL   ++E+ VTPN++++
Sbjct  407   GLVDEALKLQVVMEKKGLKLDVFTYNTIASGLCKAKRTNEAKRLLITMEERDVTPNKLSF  466

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTLID YC+ GD+  A R+   ME+KG+ P  ATYN+++  +C +G +KE+ KL ++M  
Sbjct  467   TTLIDAYCKEGDLLGAKRVFHEMEKKGVKPNAATYNALIYGYCRKGNLKEAYKLRDEMEM  526

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
               I  D  T  TLI+G C +  +  A ++ ++M + GL+ ++ TY A+I GF K   ++ 
Sbjct  527   NGIAADIYTYTTLIHGNCMVRKVDEAWELFHEMPKRGLQHNAVTYTAIISGFSKEGRSDE  586

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDT  570
             A  +  +MI AG  P    YS LV +
Sbjct  587   AFRLYDEMIEAGLKPDDTVYSSLVGS  612


 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 127/308 (41%), Gaps = 23/308 (7%)
 Frame = -2

Query  1142  RGGVEP---DIITYNSLIHSHCREGRMREAMRLFKD--IKEKVTPNEVTYTTLIDGYC--  984
             +G   P   DI  Y +LI+   ++ R   A  L     I E +        +L++  C  
Sbjct  84    KGSTSPYQHDISAYLTLIYRLFKDRRFALAKHLLNSVVINEDIKCTATVTASLLENVCDG  143

Query  983   ---RVGDIDEALRLHSAMEEKGLCPRVATYNS-----ILRKFC--------EEGRMKEST  852
                R   +D   R++S   + G       Y       I  + C           ++K + 
Sbjct  144   SWIRAKLVDMLFRVYSDNRKFGEALETFEYMKNNGFKIDERSCIIYLLALKRSNQVKSAF  203

Query  851   KLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGF  672
             + L +M E  +E    +   +++G CKIG+I +A  + ++M   G++P+  TY  L+  +
Sbjct  204   RFLRKMLEAGVEVSVRSMTIVVDGLCKIGEIETAKGLMDEMAGRGIKPNVATYNCLMGTY  263

Query  671   CKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDI  492
              K    E A +V   M   G + +   Y+ L+D +          +L  E   +G   DI
Sbjct  264   LKQGAFEEATKVRNLMEQKGVAYNILTYTILIDRFSSCGKVGEAERLFQEMHQKGIIADI  323

Query  491   SFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDE  312
               Y A+I   C+ G +  A   F  + ER +  ++  Y S+     K GN  AA  L DE
Sbjct  324   YVYTALINGHCRAGDMKRAFILFDELTERGLSPNAHTYGSIINGLCKVGNLEAAQMLVDE  383

Query  311   MYKRRLMV  288
             M  + + V
Sbjct  384   MQSKGINV  391


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 78/174 (45%), Gaps = 0/174 (0%)
 Frame = -2

Query  1613  CKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDP  1434
             CK   ++ A    +   + D   N   F+ L+  Y        A +VF  +    +KP+ 
Sbjct  439   CKAKRTNEAKRLLITMEERDVTPNKLSFTTLIDAYCKEGDLLGAKRVFHEMEKKGVKPNA  498

Query  1433  HACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSE  1254
                  L+    ++G     +K   +M   G+  +I+ Y  LIH  C   +V++A E   E
Sbjct  499   ATYNALIYGYCRKGNLKEAYKLRDEMEMNGIAADIYTYTTLIHGNCMVRKVDEAWELFHE  558

Query  1253  MEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHS  1092
             M  +G+  +  T+  +IS + + G   EA  + D M   G++PD   Y+SL+ S
Sbjct  559   MPKRGLQHNAVTYTAIISGFSKEGRSDEAFRLYDEMIEAGLKPDDTVYSSLVGS  612



>ref|XP_011085872.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Sesamum indicum]
Length=613

 Score =   259 bits (663),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 252/476 (53%), Gaps = 8/476 (2%)
 Frame = -2

Query  1730  WVETIPN--YRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALV---R  1566
             W+ +  N  +RH+L S  +MI+ L  H+ F  AK +L  +  +    S + + A++   +
Sbjct  110   WLSSPGNSTFRHTLHSYCTMIHFLCTHQMFLEAKSLLEVVVSRKGKDSASDVFAVILETK  169

Query  1565  SDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
                 SD+   VFS L+  Y +S    DAIQ F   +  + +     C  +L  L+K    
Sbjct  170   GTQKSDI--YVFSGLMTAYLDSGFVLDAIQCFRLAKKQKFRVPFDTCRKVLEHLMKLRSF  227

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
               VW  YK++++ G   +++ +N+L+H  CK  E+  A      +   G+ P   +FNTL
Sbjct  228   KLVWGFYKEILECGYPASLYFFNILMHRFCKGEEMRLARSVFDGIRRWGLRPSDVSFNTL  287

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-V  1029
             I+ Y R G   E   +++ M+  G++PD+ TY+ LI+  CRE RM +A  L  ++ +  +
Sbjct  288   INGYVRLGDLDEGFRLKNAMQASGIQPDVYTYSVLINGMCRERRMDDADELLNEMLDNGL  347

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              PN VTYTTLIDG+C+ G +D A+ L+  M  +GL P + TYN+++   C++G +KE+  
Sbjct  348   VPNYVTYTTLIDGHCKNGRVDLAMELYQQMLNQGLVPDLITYNTLINGLCKKGDLKEARY  407

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
              +++M  K ++PD +T  TLI+G CK GD+ +A K+K  M++  +  D   Y ALI G C
Sbjct  408   RVDEMSAKGLKPDKITYTTLIDGSCKEGDLENAFKLKESMIKDNIALDDVAYTALISGLC  467

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             +      A+ ++ +M++ G  P    Y+ +++ +C + + +   KL  E    G+   + 
Sbjct  468   QEGRGVDAERMLREMLSVGLKPDDGTYTMIINDFCKKGDLKTASKLLREMQRDGHVPSVV  527

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDL  321
              Y  ++   CK+G++  A      M    ++ D V Y  L   Y K GN    S+L
Sbjct  528   TYNVLMNGYCKQGQMKNANMLLNAMLNIGVVPDDVTYNILLEWYCKNGNHEDVSNL  583


 Score =   178 bits (451),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/279 (35%), Positives = 152/279 (54%), Gaps = 1/279 (0%)
 Frame = -2

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEA  960
             G    +  +N L+H  C+   MR A  +F  I+   + P++V++ TLI+GY R+GD+DE 
Sbjct  241   GYPASLYFFNILMHRFCKGEEMRLARSVFDGIRRWGLRPSDVSFNTLINGYVRLGDLDEG  300

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              RL +AM+  G+ P V TY+ ++   C E RM ++ +LLN+M +  + P+ VT  TLI+G
Sbjct  301   FRLKNAMQASGIQPDVYTYSVLINGMCRERRMDDADELLNEMLDNGLVPNYVTYTTLIDG  360

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
             +CK G +  A+++  +ML  GL PD  TY  LI+G CK  D + A+  + +M A G  P 
Sbjct  361   HCKNGRVDLAMELYQQMLNQGLVPDLITYNTLINGLCKKGDLKEARYRVDEMSAKGLKPD  420

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                Y+ L+D  C + + E   KL +        +D   Y A+I  LC+ G+   AER   
Sbjct  421   KITYTTLIDGSCKEGDLENAFKLKESMIKDNIALDDVAYTALISGLCQEGRGVDAERMLR  480

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
              M    +  D   YT +   + K+G+ + AS L  EM +
Sbjct  481   EMLSVGLKPDDGTYTMIINDFCKKGDLKTASKLLREMQR  519


 Score =   114 bits (285),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 133/286 (47%), Gaps = 38/286 (13%)
 Frame = -2

Query  1580  NALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             NA+  S    DV +  +S L+      +R  DA ++   +    + P+    T L++   
Sbjct  305   NAMQASGIQPDVYT--YSVLINGMCRERRMDDADELLNEMLDNGLVPNYVTYTTLIDGHC  362

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G  D   + Y++M+  G++P++  YN LI+  CK G++++A   + EM  KG+ PD  
Sbjct  363   KNGRVDLAMELYQQMLNQGLVPDLITYNTLINGLCKKGDLKEARYRVDEMSAKGLKPDKI  422

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI  1041
             T+ TLI   C+ G    A  +++ M +  +  D + Y +LI   C+EGR  +A R+ +++
Sbjct  423   TYTTLIDGSCKEGDLENAFKLKESMIKDNIALDDVAYTALISGLCQEGRGVDAERMLREM  482

Query  1040  ------------------------------------KEKVTPNEVTYTTLIDGYCRVGDI  969
                                                 ++   P+ VTY  L++GYC+ G +
Sbjct  483   LSVGLKPDDGTYTMIINDFCKKGDLKTASKLLREMQRDGHVPSVVTYNVLMNGYCKQGQM  542

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
               A  L +AM   G+ P   TYN +L  +C+ G  ++ + L +  G
Sbjct  543   KNANMLLNAMLNIGVVPDDVTYNILLEWYCKNGNHEDVSNLRSAKG  588


 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/330 (22%), Positives = 146/330 (44%), Gaps = 54/330 (16%)
 Frame = -2

Query  1226  LYTFNTLISLYCRRGMHYEALSVQDRM------------------ERGGVEPDIITYNSL  1101
             L+++ T+I   C   M  EA S+ + +                   +G  + DI  ++ L
Sbjct  123   LHSYCTMIHFLCTHQMFLEAKSLLEVVVSRKGKDSASDVFAVILETKGTQKSDIYVFSGL  182

Query  1100  IHSHCREGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
             + ++   G + +A++ F+   K+K      T   +++   ++         +  + E G 
Sbjct  183   MTAYLDSGFVLDAIQCFRLAKKQKFRVPFDTCRKVLEHLMKLRSFKLVWGFYKEILECGY  242

Query  923   CPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALK  744
                +  +N ++ +FC+   M+ +  + + +    + P +V+ NTLINGY ++GD+    +
Sbjct  243   PASLYFFNILMHRFCKGEEMRLARSVFDGIRRWGLRPSDVSFNTLINGYVRLGDLDEGFR  302

Query  743   VKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYC  564
             +KN M  +G++PD +TY  LI+G C+ +  + A E++ +M+  G  P+Y  Y+ L+D +C
Sbjct  303   LKNAMQASGIQPDVYTYSVLINGMCRERRMDDADELLNEMLDNGLVPNYVTYTTLIDGHC  362

Query  563   LQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSV  384
                                                K G++D A   +  M  + ++ D +
Sbjct  363   -----------------------------------KNGRVDLAMELYQQMLNQGLVPDLI  387

Query  383   VYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
              Y +L     K+G+ + A    DEM  + L
Sbjct  388   TYNTLINGLCKKGDLKEARYRVDEMSAKGL  417


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/208 (19%), Positives = 91/208 (44%), Gaps = 0/208 (0%)
 Frame = -2

Query  914  VATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKN  735
            +  ++ ++  + + G + ++ +      ++K      TC  ++    K+           
Sbjct  176  IYVFSGLMTAYLDSGFVLDAIQCFRLAKKQKFRVPFDTCRKVLEHLMKLRSFKLVWGFYK  235

Query  734  KMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQN  555
            ++LE G     + +  L+H FCK ++   A+ V   +   G  PS  +++ L++ Y    
Sbjct  236  EILECGYPASLYFFNILMHRFCKGEEMRLARSVFDGIRRWGLRPSDVSFNTLINGYVRLG  295

Query  554  NNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYT  375
            + +   +L +     G   D+  Y  +I  +C+  ++D A+     M +  ++ + V YT
Sbjct  296  DLDEGFRLKNAMQASGIQPDVYTYSVLINGMCRERRMDDADELLNEMLDNGLVPNYVTYT  355

Query  374  SLAYAYFKEGNTRAASDLFDEMYKRRLM  291
            +L   + K G    A +L+ +M  + L+
Sbjct  356  TLIDGHCKNGRVDLAMELYQQMLNQGLV  383



>ref|XP_009406650.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Musa acuminata subsp. malaccensis]
Length=605

 Score =   259 bits (663),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/480 (30%), Positives = 245/480 (51%), Gaps = 6/480 (1%)
 Frame = -2

Query  1739  FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQ-IACKDFLSSPAVLNALVRS  1563
             FF W+   P +RH+  S  +M   L +H+   +A  +L   +A +   S+PA+ +A +++
Sbjct  104   FFHWLSARPTFRHTPLSYLAMAAFLLRHRLPSAALPLLRLLVARRGHHSAPALFSAALQA  163

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVF--EHLRICRIKPDPHACTVLLNSLVKEGL  1389
                + + S +   L + YA      DAIQ     H     +  D  +C+ LL+ L+K   
Sbjct  164   VTPAPLQSSLVGALAVEYARVGHVSDAIQCLRLSHRHALPLPLD--SCSRLLDHLLKSNS  221

Query  1388  TDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNT  1209
                 W  Y +++  G  P +  +NVL+H+ CK G++++A    +E+   G  P + +FNT
Sbjct  222   PAAAWAFYSEILAAGFPPRVTTFNVLMHSFCKEGKIKQAKSIFNEITKHGSCPTVVSFNT  281

Query  1208  LISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-  1032
             LI+ YC+ G       ++ RM   G+ PD+ TY+ LI   C+ GR+ +A  LF ++  K 
Sbjct  282   LINGYCKVGNLEAGFELKGRMLDVGLVPDVFTYSVLIRGLCKAGRLDDANELFDEMCSKG  341

Query  1031  VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKEST  852
             + PN VT+TTLIDG+C+ G I++A+ ++  M ++ + P V T N+ +   C+ G + E+ 
Sbjct  342   LVPNAVTFTTLIDGHCKEGKIEDAMEIYKEMLKRSVRPDVITLNATVNVLCKSGDLGEAN  401

Query  851   KLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGF  672
             +++ +M    + PD VT  TLI+G CK GD+  A+++K +M   G+  D  TY  LI G 
Sbjct  402   RVVEEMRHSGLLPDKVTYTTLIDGCCKEGDLKMAIEIKKRMAVEGIELDEVTYTTLIAGL  461

Query  671   CKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDI  492
              +      A   + +M+ AG  P    Y+ ++D +C + + +   KL  E   +G+   +
Sbjct  462   SREGWVADANTTLHEMVRAGLLPDMATYTMVIDAFCRKGDVKMGFKLLKEMQSKGHKPGV  521

Query  491   SFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDE  312
               Y  I+  LCK G+   A      M    +  D + Y  L   + K GN     +L  E
Sbjct  522   VTYNVIMNGLCKLGQTKNANMLLNAMINVGVAPDDITYNILLDGHCKHGNIEDHEELKGE  581


 Score =   170 bits (431),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/281 (31%), Positives = 152/281 (54%), Gaps = 1/281 (0%)
 Frame = -2

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G  P + T+N L+HS C+EG++++A  +F +I K    P  V++ TLI+GYC+VG+++ 
Sbjct  235   AGFPPRVTTFNVLMHSFCKEGKIKQAKSIFNEITKHGSCPTVVSFNTLINGYCKVGNLEA  294

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
                L   M + GL P V TY+ ++R  C+ GR+ ++ +L ++M  K + P+ VT  TLI+
Sbjct  295   GFELKGRMLDVGLVPDVFTYSVLIRGLCKAGRLDDANELFDEMCSKGLVPNAVTFTTLID  354

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             G+CK G I  A+++  +ML+  +RPD  T  A ++  CK+ D   A  V+ +M  +G  P
Sbjct  355   GHCKEGKIEDAMEIYKEMLKRSVRPDVITLNATVNVLCKSGDLGEANRVVEEMRHSGLLP  414

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
                 Y+ L+D  C + + +  +++    +  G  +D   Y  +I  L + G +  A    
Sbjct  415   DKVTYTTLIDGCCKEGDLKMAIEIKKRMAVEGIELDEVTYTTLIAGLSREGWVADANTTL  474

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
               M    +L D   YT +  A+ ++G+ +    L  EM  +
Sbjct  475   HEMVRAGLLPDMATYTMVIDAFCRKGDVKMGFKLLKEMQSK  515


 Score =   148 bits (373),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/308 (29%), Positives = 152/308 (49%), Gaps = 11/308 (4%)
 Frame = -2

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIIT---YNSLIHSHCREGRMREAMRLFKDIKEKV  1029
             L  RRG H         ++   V P  +      +L   + R G + +A++  +      
Sbjct  144   LVARRGHHSAPALFSAALQ--AVTPAPLQSSLVGALAVEYARVGHVSDAIQCLRLSHRHA  201

Query  1028  TPNEV-TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKEST  852
              P  + + + L+D   +      A   +S +   G  PRV T+N ++  FC+EG++K++ 
Sbjct  202   LPLPLDSCSRLLDHLLKSNSPAAAWAFYSEILAAGFPPRVTTFNVLMHSFCKEGKIKQAK  261

Query  851   KLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGF  672
              + N++ +    P  V+ NTLINGYCK+G++ +  ++K +ML+ GL PD FTY  LI G 
Sbjct  262   SIFNEITKHGSCPTVVSFNTLINGYCKVGNLEAGFELKGRMLDVGLVPDVFTYSVLIRGL  321

Query  671   CKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDI  492
             CKA   + A E+  +M + G  P+   ++ L+D +C +   E  +++  E   R    D+
Sbjct  322   CKAGRLDDANELFDEMCSKGLVPNAVTFTTLIDGHCKEGKIEDAMEIYKEMLKRSVRPDV  381

Query  491   SFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDE  312
                 A +  LCK G L  A R    M+   +L D V YT+L     KEG+ + A ++   
Sbjct  382   ITLNATVNVLCKSGDLGEANRVVEEMRHSGLLPDKVTYTTLIDGCCKEGDLKMAIEI---  438

Query  311   MYKRRLMV  288
               K+R+ V
Sbjct  439   --KKRMAV  444


 Score =   123 bits (309),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 131/259 (51%), Gaps = 4/259 (2%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N+  F+ L+  +    +  DA+++++ +    ++PD       +N L K G      +  
Sbjct  345   NAVTFTTLIDGHCKEGKIEDAMEIYKEMLKRSVRPDVITLNATVNVLCKSGDLGEANRVV  404

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             ++M   G+LP+   Y  LI  CCK G+++ A E    M  +GI  D  T+ TLI+   R 
Sbjct  405   EEMRHSGLLPDKVTYTTLIDGCCKEGDLKMAIEIKKRMAVEGIELDEVTYTTLIAGLSRE  464

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKV-TPNEVTY  1008
             G   +A +    M R G+ PD+ TY  +I + CR+G ++   +L K+++ K   P  VTY
Sbjct  465   GWVADANTTLHEMVRAGLLPDMATYTMVIDAFCRKGDVKMGFKLLKEMQSKGHKPGVVTY  524

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
               +++G C++G    A  L +AM   G+ P   TYN +L   C+ G +++  +L    GE
Sbjct  525   NVIMNGLCKLGQTKNANMLLNAMINVGVAPDDITYNILLDGHCKHGNIEDHEEL---KGE  581

Query  827   KKIEPDNVTCNTLINGYCK  771
             K +  D  + ++ IN   K
Sbjct  582   KGMILDFASYSSFINELVK  600



>ref|XP_008790931.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Phoenix dactylifera]
Length=743

 Score =   263 bits (671),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/492 (31%), Positives = 258/492 (52%), Gaps = 6/492 (1%)
 Frame = -2

Query  1751  LSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAV--LN  1578
             L+ +F +W   +P +  SL      + +L++ +   SA  +  ++A + F   P V  + 
Sbjct  59    LTLAFLRWASPLPFFSGSLHPQSLALLLLSRFRLLPSALSLARRLASR-FPPPPVVHSVA  117

Query  1577  ALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK  1398
             A +     S   S  F  L+  YA+  R  DA+      +     P   +   +L+++ +
Sbjct  118   AAIPFLRTSPSPSAAFDLLIKSYASLGRVPDALSALSLTKGAGFAPATLSYNSILDAMFR  177

Query  1397  EGLT--DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDL  1224
                T  +T+ +    + + GV  N++ YN+LI   C   E+++    L+EME  G  P++
Sbjct  178   FSRTPRNTIEEFLADITRSGVSFNVYSYNILIRGFCSWSELDRGLVLLAEMEHAGCSPNV  237

Query  1223  YTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD  1044
              T+NTLI  +C+ G   +A  +   M   GV+P+ +TYN++I+  CREGR++E  ++  +
Sbjct  238   VTYNTLIDGHCKSGKADDAFGLLKTMHEKGVQPNAVTYNTIINGLCREGRVKETGKVVDE  297

Query  1043  I-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGR  867
             + +E  +P+ +TY TL++GYCR GD+ +AL LH+ M +KG+ P V TY S++   C+ G 
Sbjct  298   MAREGFSPDAITYNTLVNGYCRKGDVHKALVLHAEMAQKGVAPNVVTYTSLISAMCKAGN  357

Query  866   MKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKA  687
             +  + +   QM E+ ++ + +T  TLI+G+ K G +  AL +  +M E+G+ P   +Y A
Sbjct  358   LARAMEFAKQMRERGLQLNEITFTTLIDGFAKKGFLDDALLLMKEMQESGILPSVVSYNA  417

Query  686   LIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRG  507
             LI+G+C     + A E+I +M   G  P    YS L+  YC     E   +L  E   +G
Sbjct  418   LINGYCTLGRMDEALEIIREMEGNGLVPDVVTYSTLLSGYCKNGELEMAFQLNREMVAKG  477

Query  506   YCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAAS  327
                D   Y ++IR LC+  +LD A      M    +  D   YT+L  A+ KEG+ + A 
Sbjct  478   VLPDAITYSSLIRGLCEVRRLDNAHELVEKMLSLGLHPDEFTYTTLIDAHCKEGDIKKAL  537

Query  326   DLFDEMYKRRLM  291
              L DEM K+ ++
Sbjct  538   LLHDEMTKKGIL  549


 Score =   244 bits (623),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 140/469 (30%), Positives = 240/469 (51%), Gaps = 53/469 (11%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             P+      L++   K G  D  +   K M + GV PN   YN +I+  C+ G V++  + 
Sbjct  235   PNVVTYNTLIDGHCKSGKADDAFGLLKTMHEKGVQPNAVTYNTIINGLCREGRVKETGKV  294

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
             + EM  +G  PD  T+NTL++ YCR+G  ++AL +   M + GV P+++TY SLI + C+
Sbjct  295   VDEMAREGFSPDAITYNTLVNGYCRKGDVHKALVLHAEMAQKGVAPNVVTYTSLISAMCK  354

Query  1082  EGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVAT  906
              G +  AM   K ++E+ +  NE+T+TTLIDG+ + G +D+AL L   M+E G+ P V +
Sbjct  355   AGNLARAMEFAKQMRERGLQLNEITFTTLIDGFAKKGFLDDALLLMKEMQESGILPSVVS  414

Query  905   YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
             YN+++  +C  GRM E+ +++ +M    + PD VT +TL++GYCK G++  A ++  +M+
Sbjct  415   YNALINGYCTLGRMDEALEIIREMEGNGLVPDVVTYSTLLSGYCKNGELEMAFQLNREMV  474

Query  725   EAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNE  546
               G+ PD+ TY +LI G C+ +  + A E++  M++ G  P    Y+ L+D +C + + +
Sbjct  475   AKGVLPDAITYSSLIRGLCEVRRLDNAHELVEKMLSLGLHPDEFTYTTLIDAHCKEGDIK  534

Query  545   ALVKLADEFSGRGYCVDISFYRAIIRRL--------------------------------  462
               + L DE + +G   D+  Y  +I  L                                
Sbjct  535   KALLLHDEMTKKGILPDVVTYNVLINGLRKIARTKEAKRLLFRLYYEESIPDNIAYDVLM  594

Query  461   ------------------CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTR  336
                               C +G ++ A++ F  + ER+   + VVY+ L + + + GN +
Sbjct  595   DCCDKGEFKSVVSLLKGFCMKGLMNEADKVFESILERKWKPNEVVYSVLIHGHCRGGNVQ  654

Query  335   AASDLFDEMYKRRLMVTlklykslsassKDENSLLDLFWNNVMQRGLIS  189
              A DL+ EM    L+       SL     +E   +D   N+V+Q+ L S
Sbjct  655   KALDLYKEMMLAGLVPNAISTISLIKGLSEEG--MDEEMNHVIQKLLGS  701


 Score =   143 bits (361),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 90/323 (28%), Positives = 164/323 (51%), Gaps = 23/323 (7%)
 Frame = -2

Query  1574  LVRSDDDSDVNSQVFSW--LLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             L++   +S +   V S+  L+  Y    R  +A+++   +    + PD    + LL+   
Sbjct  399   LMKEMQESGILPSVVSYNALINGYCTLGRMDEALEIIREMEGNGLVPDVVTYSTLLSGYC  458

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K G  +  ++  ++M+  GVLP+   Y+ LI   C+   ++ A E + +M   G+ PD +
Sbjct  459   KNGELEMAFQLNREMVAKGVLPDAITYSSLIRGLCEVRRLDNAHELVEKMLSLGLHPDEF  518

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR-LFKD  1044
             T+ TLI  +C+ G   +AL + D M + G+ PD++TYN LI+   +  R +EA R LF+ 
Sbjct  519   TYTTLIDAHCKEGDIKKALLLHDEMTKKGILPDVVTYNVLINGLRKIARTKEAKRLLFRL  578

Query  1043  IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
               E+  P+ + Y  L+D  C  G+    +                   S+L+ FC +G M
Sbjct  579   YYEESIPDNIAYDVLMD-CCDKGEFKSVV-------------------SLLKGFCMKGLM  618

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
              E+ K+   + E+K +P+ V  + LI+G+C+ G++  AL +  +M+ AGL P++ +  +L
Sbjct  619   NEADKVFESILERKWKPNEVVYSVLIHGHCRGGNVQKALDLYKEMMLAGLVPNAISTISL  678

Query  683   IHGFCKAKDTERAKEVIFDMIAA  615
             I G  +    E    VI  ++ +
Sbjct  679   IKGLSEEGMDEEMNHVIQKLLGS  701


 Score = 97.4 bits (241),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/245 (26%), Positives = 108/245 (44%), Gaps = 2/245 (1%)
 Frame = -2

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKEST--KLL  843
               +  LI  Y  +G + +AL   S  +  G  P   +YNSIL       R   +T  + L
Sbjct  131   AAFDLLIKSYASLGRVPDALSALSLTKGAGFAPATLSYNSILDAMFRFSRTPRNTIEEFL  190

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKA  663
               +    +  +  + N LI G+C   ++   L +  +M  AG  P+  TY  LI G CK+
Sbjct  191   ADITRSGVSFNVYSYNILIRGFCSWSELDRGLVLLAEMEHAGCSPNVVTYNTLIDGHCKS  250

Query  662   KDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFY  483
                + A  ++  M   G  P+   Y+ +++  C +   +   K+ DE +  G+  D   Y
Sbjct  251   GKADDAFGLLKTMHEKGVQPNAVTYNTIINGLCREGRVKETGKVVDEMAREGFSPDAITY  310

Query  482   RAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
               ++   C++G +  A      M ++ +  + V YTSL  A  K GN   A +   +M +
Sbjct  311   NTLVNGYCRKGDVHKALVLHAEMAQKGVAPNVVTYTSLISAMCKAGNLARAMEFAKQMRE  370

Query  302   RRLMV  288
             R L +
Sbjct  371   RGLQL  375



>ref|XP_004490829.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Cicer arietinum]
Length=603

 Score =   259 bits (662),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/501 (30%), Positives = 261/501 (52%), Gaps = 8/501 (2%)
 Frame = -2

Query  1826  PKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHF  1647
             P +     + +IN   L+LSP   +   SFF ++ + P +RH+L S  +M + L+ H   
Sbjct  70    PSLTSHHITNLINLNPLSLSPQSLF---SFFNYLASRPPFRHTLHSYTTMAHFLSSHNML  126

Query  1646  KSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ----VFSWLLIFYANSKRTWDAI  1479
                  +   +  K    S   L + +     +   +Q    VF  L+  Y +S    +AI
Sbjct  127   SQTHSLFIFVVSKMGHHSSHSLFSSLLQTTPTHYRNQRSFLVFDALITAYTDSGFIEEAI  186

Query  1478  QVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHAC  1299
             QV   ++  + +     C  LL+ ++K       W+ Y +++  G  P ++++N+L+H  
Sbjct  187   QVLRLMKNKKFQIPLRGCEYLLSHVMKLKQPGPCWEFYLEVLDYGYPPKVYLFNILMHGF  246

Query  1298  CKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDI  1119
             CK G+VE A     E+  +G+   + +FNTLIS YC      E   ++  ME   + PD+
Sbjct  247   CKVGDVENARMVFDEIPKRGLRFTVVSFNTLISGYCNNRNVKEGFVLKAVMESEKIFPDV  306

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
              TY+SLI+  C+  R+ EA  LF ++    + PN VT+TTLIDG C+ G ID AL+    
Sbjct  307   FTYSSLINGLCKASRLDEANLLFDEMCGRGLVPNGVTFTTLIDGQCKDGKIDLALKNFKT  366

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             M+++G+ P + TYN+++   C  G +KE+ KL  +M +   +PD +T  TL++G CK G+
Sbjct  367   MKDRGVRPDLVTYNALINGLCRVGDLKEARKLWEEMSQNGFKPDKITFTTLMDGCCKDGE  426

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
             + SAL++K++M+E G+  D   Y ALI G C+      A+ ++ DM++AG  P    Y+ 
Sbjct  427   MESALEIKDRMVEEGIELDDVAYTALISGLCRDGRVCDAERMLRDMLSAGHRPDDPTYTM  486

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQERE  402
             ++D++C + + +   KL  E    G    +  Y A++  LCK+G++  A+     M    
Sbjct  487   VIDSFCKKGDVKMGTKLFKEMQSDGRIPGVVTYNALMNGLCKQGQMKNAKMLLDAMLNLG  546

Query  401   ILGDSVVYTSLAYAYFKEGNT  339
             ++ + + +  L   + K  ++
Sbjct  547   VVPNDITFNILLDGHCKHASS  567


 Score =   160 bits (406),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/340 (30%), Positives = 168/340 (49%), Gaps = 1/340 (0%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRM  1146
             +++ LI A   SG +E+A + L  M+ K     L     L+S   +             +
Sbjct  168   VFDALITAYTDSGFIEEAIQVLRLMKNKKFQIPLRGCEYLLSHVMKLKQPGPCWEFYLEV  227

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDI  969
                G  P +  +N L+H  C+ G +  A  +F +I K  +    V++ TLI GYC   ++
Sbjct  228   LDYGYPPKVYLFNILMHGFCKVGDVENARMVFDEIPKRGLRFTVVSFNTLISGYCNNRNV  287

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
              E   L + ME + + P V TY+S++   C+  R+ E+  L ++M  + + P+ VT  TL
Sbjct  288   KEGFVLKAVMESEKIFPDVFTYSSLINGLCKASRLDEANLLFDEMCGRGLVPNGVTFTTL  347

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             I+G CK G I  ALK    M + G+RPD  TY ALI+G C+  D + A+++  +M   GF
Sbjct  348   IDGQCKDGKIDLALKNFKTMKDRGVRPDLVTYNALINGLCRVGDLKEARKLWEEMSQNGF  407

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    ++ L+D  C     E+ +++ D     G  +D   Y A+I  LC+ G++  AER
Sbjct  408   KPDKITFTTLMDGCCKDGEMESALEIKDRMVEEGIELDDVAYTALISGLCRDGRVCDAER  467

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                 M       D   YT +  ++ K+G+ +  + LF EM
Sbjct  468   MLRDMLSAGHRPDDPTYTMVIDSFCKKGDVKMGTKLFKEM  507


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 91/202 (45%), Gaps = 0/202 (0%)
 Frame = -2

Query  905  YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
            +++++  + + G ++E+ ++L  M  KK +     C  L++   K+       +   ++L
Sbjct  169  FDALITAYTDSGFIEEAIQVLRLMKNKKFQIPLRGCEYLLSHVMKLKQPGPCWEFYLEVL  228

Query  725  EAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNE  546
            + G  P  + +  L+HGFCK  D E A+ V  ++   G   +  +++ L+  YC   N +
Sbjct  229  DYGYPPKVYLFNILMHGFCKVGDVENARMVFDEIPKRGLRFTVVSFNTLISGYCNNRNVK  288

Query  545  ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLA  366
                L           D+  Y ++I  LCK  +LD A   F  M  R ++ + V +T+L 
Sbjct  289  EGFVLKAVMESEKIFPDVFTYSSLINGLCKASRLDEANLLFDEMCGRGLVPNGVTFTTLI  348

Query  365  YAYFKEGNTRAASDLFDEMYKR  300
                K+G    A   F  M  R
Sbjct  349  DGQCKDGKIDLALKNFKTMKDR  370


 Score = 59.7 bits (143),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/152 (24%), Positives = 71/152 (47%), Gaps = 3/152 (2%)
 Frame = -2

Query  1550  DVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWK  1371
             +++   ++ L+       R  DA ++   +     +PD    T++++S  K+G      K
Sbjct  443   ELDDVAYTALISGLCRDGRVCDAERMLRDMLSAGHRPDDPTYTMVIDSFCKKGDVKMGTK  502

Query  1370  TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYC  1191
              +K+M   G +P +  YN L++  CK G+++ A   L  M   G+ P+  TFN L+  +C
Sbjct  503   LFKEMQSDGRIPGVVTYNALMNGLCKQGQMKNAKMLLDAMLNLGVVPNDITFNILLDGHC  562

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIH  1095
             +   H  +          G+  D  +Y +L++
Sbjct  563   K---HASSFDFDIFSGEKGLVSDYASYTALVN  591



>ref|XP_008797845.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, 
mitochondrial [Phoenix dactylifera]
Length=639

 Score =   260 bits (664),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 160/526 (30%), Positives = 260/526 (49%), Gaps = 14/526 (3%)
 Frame = -2

Query  1859  VLKGHWNNL--LKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSS  1686
             VL+  W +L  L P +   + S ++ H  L   P           ++  +  +R  L+S 
Sbjct  59    VLRSQWTSLDTLLPTLSPPLVSAVLLH--LRRYPDII------LPFLHRLGLHRLDLRSL  110

Query  1685  WSMIYILTKHKHFKSAKDMLHQ-IACKDFLSSPAVLNALVRSDDDSDVNSQ--VFSWLLI  1515
                  +L   +    A ++L + IA   F SS    NALV + ++   +    VF  LL 
Sbjct  111   SIAASLLCSLRPPNPAFNLLKEAIATGRFDSSQKFFNALVVAGEELKPSKPQLVFDLLLR  170

Query  1514  FYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLP  1335
              Y +S +  +A+ VF  ++     P   +C  LL++ +K   T+  W  Y +M ++ +  
Sbjct  171   AYLDSGQIQEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLYAEMFRMRIPS  230

Query  1334  NIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQ  1155
             ++  +N++I+  CK G+++KA  F+  ME  G+ P + T+NT+I  +C R      L + 
Sbjct  231   SVVTFNIMINVLCKEGKLKKAKAFIQFMESSGVRPTVVTYNTIIHGHCSREKVQMGLEML  290

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRV  978
             D M+  G++PD  TY +LI   C+EGR+ +A  +F D+ E+ + P  V Y  LIDGYC  
Sbjct  291   DVMKEKGIKPDAYTYGTLISGMCKEGRVEDASVMFDDMLERGLIPCAVNYNALIDGYCNK  350

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G +D A R    M  KG+ P V TYN ++     EGR +E+  L+ +M  K + PD +T 
Sbjct  351   GKLDVAFRYRDEMGRKGIEPTVCTYNLLVHALFMEGRNEEANALIKEMEAKGMAPDAITY  410

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             N LINGYCK G++  A  V  +M   G+RP   TY +LI+  CK      A  +  ++  
Sbjct  411   NILINGYCKEGNVKKAFDVFEEMSRKGVRPTMVTYTSLIYVLCKRSRVTEADRMFKEVTE  470

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
              G  P    Y+ L+D +C   N E   +L  E   +    D   Y  ++R LC  G+++ 
Sbjct  471   KGLYPDLVMYNALIDGHCANGNMERAFQLLKEMESKKLAPDEVTYNTLMRGLCLLGEVEE  530

Query  437   AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
             A +    M  + I  D + Y +L   Y + G+ + A  + DEM  +
Sbjct  531   ARKLIDEMSRQGIKPDLISYNTLISGYSRRGDVKDAFKVRDEMLSK  576


 Score =   210 bits (535),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 134/440 (30%), Positives = 222/440 (50%), Gaps = 28/440 (6%)
 Frame = -2

Query  1730  WVETIPNYRHSLQSSWS----MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS  1563
             WV     +R  + SS      MI +L K    K AK                   A ++ 
Sbjct  217   WVLYAEMFRMRIPSSVVTFNIMINVLCKEGKLKKAK-------------------AFIQF  257

Query  1562  DDDSDVNSQVFSWLLIFYANSKR--TWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGL  1389
              + S V   V ++  I + +  R      +++ + ++   IKPD +    L++ + KEG 
Sbjct  258   MESSGVRPTVVTYNTIIHGHCSREKVQMGLEMLDVMKEKGIKPDAYTYGTLISGMCKEGR  317

Query  1388  TDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNT  1209
              +     +  M++ G++P    YN LI   C  G+++ A  +  EM  KGI P + T+N 
Sbjct  318   VEDASVMFDDMLERGLIPCAVNYNALIDGYCNKGKLDVAFRYRDEMGRKGIEPTVCTYNL  377

Query  1208  LISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-  1032
             L+      G + EA ++   ME  G+ PD ITYN LI+ +C+EG +++A  +F+++  K 
Sbjct  378   LVHALFMEGRNEEANALIKEMEAKGMAPDAITYNILINGYCKEGNVKKAFDVFEEMSRKG  437

Query  1031  VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKEST  852
             V P  VTYT+LI   C+   + EA R+   + EKGL P +  YN+++   C  G M+ + 
Sbjct  438   VRPTMVTYTSLIYVLCKRSRVTEADRMFKEVTEKGLYPDLVMYNALIDGHCANGNMERAF  497

Query  851   KLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGF  672
             +LL +M  KK+ PD VT NTL+ G C +G++  A K+ ++M   G++PD  +Y  LI G+
Sbjct  498   QLLKEMESKKLAPDEVTYNTLMRGLCLLGEVEEARKLIDEMSRQGIKPDLISYNTLISGY  557

Query  671   CKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDI  492
              +  D + A +V  +M++ GF+P+   Y+ L+   C     +    L  E   +G   D 
Sbjct  558   SRRGDVKDAFKVRDEMLSKGFNPTLLTYNALIQGLCKNGEGDHAEGLLKEMVNKGITPDD  617

Query  491   SFYRAIIRRLCKRGKLDCAE  432
             S Y ++I  L   G+ DCA+
Sbjct  618   STYISLIEGL-SNGE-DCAK  635


 Score =   179 bits (453),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/394 (27%), Positives = 200/394 (51%), Gaps = 8/394 (2%)
 Frame = -2

Query  1457  ICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLG-----VLPNIHIYNVLIHACCK  1293
             +C ++P P+    LL   +  G  D+  K +  ++  G       P + ++++L+ A   
Sbjct  117   LCSLRP-PNPAFNLLKEAIATGRFDSSQKFFNALVVAGEELKPSKPQL-VFDLLLRAYLD  174

Query  1292  SGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIIT  1113
             SG++++A +    M+     P + + N L+S + +     +A  +   M R  +   ++T
Sbjct  175   SGQIQEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLYAEMFRMRIPSSVVT  234

Query  1112  YNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAME  936
             +N +I+  C+EG++++A    + ++   V P  VTY T+I G+C    +   L +   M+
Sbjct  235   FNIMINVLCKEGKLKKAKAFIQFMESSGVRPTVVTYNTIIHGHCSREKVQMGLEMLDVMK  294

Query  935   EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
             EKG+ P   TY +++   C+EGR+++++ + + M E+ + P  V  N LI+GYC  G + 
Sbjct  295   EKGIKPDAYTYGTLISGMCKEGRVEDASVMFDDMLERGLIPCAVNYNALIDGYCNKGKLD  354

Query  755   SALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLV  576
              A + +++M   G+ P   TY  L+H        E A  +I +M A G +P    Y+ L+
Sbjct  355   VAFRYRDEMGRKGIEPTVCTYNLLVHALFMEGRNEEANALIKEMEAKGMAPDAITYNILI  414

Query  575   DTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
             + YC + N +    + +E S +G    +  Y ++I  LCKR ++  A+R F  + E+ + 
Sbjct  415   NGYCKEGNVKKAFDVFEEMSRKGVRPTMVTYTSLIYVLCKRSRVTEADRMFKEVTEKGLY  474

Query  395   GDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
              D V+Y +L   +   GN   A  L  EM  ++L
Sbjct  475   PDLVMYNALIDGHCANGNMERAFQLLKEMESKKL  508


 Score =   174 bits (441),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 154/271 (57%), Gaps = 3/271 (1%)
 Frame = -2

Query  1439  DPHACT--VLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADE  1266
             +P  CT  +L+++L  EG  +      K+M   G+ P+   YN+LI+  CK G V+KA +
Sbjct  369   EPTVCTYNLLVHALFMEGRNEEANALIKEMEAKGMAPDAITYNILINGYCKEGNVKKAFD  428

Query  1265  FLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHC  1086
                EM  KG+ P + T+ +LI + C+R    EA  +   +   G+ PD++ YN+LI  HC
Sbjct  429   VFEEMSRKGVRPTMVTYTSLIYVLCKRSRVTEADRMFKEVTEKGLYPDLVMYNALIDGHC  488

Query  1085  REGRMREAMRLFKDIK-EKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVA  909
               G M  A +L K+++ +K+ P+EVTY TL+ G C +G+++EA +L   M  +G+ P + 
Sbjct  489   ANGNMERAFQLLKEMESKKLAPDEVTYNTLMRGLCLLGEVEEARKLIDEMSRQGIKPDLI  548

Query  908   TYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKM  729
             +YN+++  +   G +K++ K+ ++M  K   P  +T N LI G CK G+   A  +  +M
Sbjct  549   SYNTLISGYSRRGDVKDAFKVRDEMLSKGFNPTLLTYNALIQGLCKNGEGDHAEGLLKEM  608

Query  728   LEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             +  G+ PD  TY +LI G    +D  + + V
Sbjct  609   VNKGITPDDSTYISLIEGLSNGEDCAKNENV  639


 Score =   129 bits (323),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/282 (27%), Positives = 141/282 (50%), Gaps = 4/282 (1%)
 Frame = -2

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
             + ++ L+ ++   G+++EA+ +F  +K+    P   +   L+  + +    ++A  L++ 
Sbjct  163   LVFDLLLRAYLDSGQIQEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLYAE  222

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             M    +   V T+N ++   C+EG++K++   +  M    + P  VT NT+I+G+C    
Sbjct  223   MFRMRIPSSVVTFNIMINVLCKEGKLKKAKAFIQFMESSGVRPTVVTYNTIIHGHCSREK  282

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
             +   L++ + M E G++PD++TY  LI G CK    E A  +  DM+  G  P    Y+ 
Sbjct  283   VQMGLEMLDVMKEKGIKPDAYTYGTLISGMCKEGRVEDASVMFDDMLERGLIPCAVNYNA  342

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQERE  402
             L+D YC +   +   +  DE   +G    +  Y  ++  L   G+ + A      M+ + 
Sbjct  343   LIDGYCNKGKLDVAFRYRDEMGRKGIEPTVCTYNLLVHALFMEGRNEEANALIKEMEAKG  402

Query  401   ILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK---RRLMVT  285
             +  D++ Y  L   Y KEGN + A D+F+EM +   R  MVT
Sbjct  403   MAPDAITYNILINGYCKEGNVKKAFDVFEEMSRKGVRPTMVT  444


 Score = 63.5 bits (153),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 88/216 (41%), Gaps = 5/216 (2%)
 Frame = -2

Query  926  LCPRVATYNSILRKFCEEGRMKESTKLLNQM---GEK-KIEPDNVTCNTLINGYCKIGDI  759
            L P    +N +L++    GR   S K  N +   GE+ K     +  + L+  Y   G I
Sbjct  120  LRPPNPAFN-LLKEAIATGRFDSSQKFFNALVVAGEELKPSKPQLVFDLLLRAYLDSGQI  178

Query  758  VSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWL  579
              AL V   M +A   P   +   L+  F K+  TE+A  +  +M       S   ++ +
Sbjct  179  QEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLYAEMFRMRIPSSVVTFNIM  238

Query  578  VDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREI  399
            ++  C +   +            G    +  Y  II   C R K+        +M+E+ I
Sbjct  239  INVLCKEGKLKKAKAFIQFMESSGVRPTVVTYNTIIHGHCSREKVQMGLEMLDVMKEKGI  298

Query  398  LGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
              D+  Y +L     KEG    AS +FD+M +R L+
Sbjct  299  KPDAYTYGTLISGMCKEGRVEDASVMFDDMLERGLI  334



>ref|XP_009596549.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596550.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596551.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596552.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596553.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
Length=777

 Score =   263 bits (671),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 155/490 (32%), Positives = 251/490 (51%), Gaps = 12/490 (2%)
 Frame = -2

Query  1751  LSWSFFKWVETIPNYRH----SLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPA-  1587
             L   F  W       RH    +LQ     I+ILT+ K +K+A+ +   +A K        
Sbjct  88    LVLRFINWA------RHRQFFNLQCKCISIHILTRFKLYKTAQSLAEDVAVKATDDKGEF  141

Query  1586  VLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNS  1407
             V   L  +    + +S VF  ++  Y++ K    A+ +FE  +         +   +L++
Sbjct  142   VFLCLKDTYHSCNSSSAVFDLMVKSYSHLKMIDKAMNIFELAKSNGFMLTVLSYNSILDA  201

Query  1406  LVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPD  1227
             L++    +   + Y  M+K GV PN++ YN++I   C  G++EK   F  EME  G  P 
Sbjct  202   LIRVSSNELAQEFYDDMVKSGVSPNVYTYNIMIRGLCGKGDLEKGLAFFKEMEKCGCLPS  261

Query  1226  LYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFK  1047
             + T+NT+I  YC+ G   EA+ +   M+   +EP ++TYN++I+  CREGRM+E   + +
Sbjct  262   VVTYNTIIGAYCKIGKVDEAVKLLKLMQVRNLEPSVVTYNAIINGLCREGRMKETSEVLE  321

Query  1046  DIK-EKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEG  870
             D++   + P+EVTY TL++GYCR G+  +AL LHS M   GL P V TY S++   C+ G
Sbjct  322   DMRGTGLVPDEVTYNTLVNGYCREGNFHQALVLHSDMLRNGLSPDVVTYTSLINSMCKAG  381

Query  869   RMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYK  690
              +  + +  +Q+  + + P+  T  TLI G+ + G +  A K+ N+M+ +G  P   TY 
Sbjct  382   NLHRAMEFFDQLRARGLYPNKRTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYN  441

Query  689   ALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGR  510
             AL++G C     E A  VI +M   G  P    YS ++  +C  +N E    +  +   +
Sbjct  442   ALVNGHCALGRMEDALSVIQEMEWRGVVPDVVTYSTMISGFCRNHNLERAFCVKQQMVEK  501

Query  509   GYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAA  330
             G   D+  Y ++I+ LC++  L  A   F  M    I  D   YT+L  AY  EG+ + A
Sbjct  502   GVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCVEGDIKGA  561

Query  329   SDLFDEMYKR  300
              +L DEM  +
Sbjct  562   LNLHDEMINK  571


 Score =   236 bits (601),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 148/538 (28%), Positives = 256/538 (48%), Gaps = 73/538 (14%)
 Frame = -2

Query  1703  HSLQSSWSMIYILTK-HKHFK---SAKDMLHQIACKDF----LSSPAVLNALVRSD----  1560
             HS  SS ++  ++ K + H K    A ++        F    LS  ++L+AL+R      
Sbjct  151   HSCNSSSAVFDLMVKSYSHLKMIDKAMNIFELAKSNGFMLTVLSYNSILDALIRVSSNEL  210

Query  1559  -----DD---SDVNSQVFSWLLIFYA--NSKRTWDAIQVFEHLRICRIKPDPHACTVLLN  1410
                  DD   S V+  V+++ ++             +  F+ +  C   P       ++ 
Sbjct  211   AQEFYDDMVKSGVSPNVYTYNIMIRGLCGKGDLEKGLAFFKEMEKCGCLPSVVTYNTIIG  270

Query  1409  SLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFP  1230
             +  K G  D   K  K M    + P++  YN +I+  C+ G +++  E L +M   G+ P
Sbjct  271   AYCKIGKVDEAVKLLKLMQVRNLEPSVVTYNAIINGLCREGRMKETSEVLEDMRGTGLVP  330

Query  1229  DLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLF  1050
             D  T+NTL++ YCR G  ++AL +   M R G+ PD++TY SLI+S C+ G +  AM  F
Sbjct  331   DEVTYNTLVNGYCREGNFHQALVLHSDMLRNGLSPDVVTYTSLINSMCKAGNLHRAMEFF  390

Query  1049  KDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEE  873
               ++ + + PN+ TYTTLI G+ + G ++EA +L + M   G  P + TYN+++   C  
Sbjct  391   DQLRARGLYPNKRTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNALVNGHCAL  450

Query  872   GRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTY  693
             GRM+++  ++ +M  + + PD VT +T+I+G+C+  ++  A  VK +M+E G+ PD  TY
Sbjct  451   GRMEDALSVIQEMEWRGVVPDVVTYSTMISGFCRNHNLERAFCVKQQMVEKGVSPDVITY  510

Query  692   KALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSG  513
              +LI G C+ +    A+E+  +M+  G  P    Y+ L+  YC++ + +  + L DE   
Sbjct  511   SSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCVEGDIKGALNLHDEMIN  570

Query  512   RGY------------------------------------------------CVDISFYRA  477
             +G+                                                C D+ F  A
Sbjct  571   KGFFPDAVTYSVLINGLNKQARTREAKRLLFKLLYEQSVPNSVTYDMLIESCNDLDFKSA  630

Query  476   --IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
               +I+  C +G LD A+R F +M +++     V Y  L + + + GN   A  L+ EM
Sbjct  631   TDLIKGFCMKGLLDEADRVFELMLQKDKKPSEVAYNLLIHGHSRGGNLHRALHLYREM  688


 Score =   191 bits (485),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 112/366 (31%), Positives = 183/366 (50%), Gaps = 16/366 (4%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A++ F+ LR   + P+    T L+    ++G  +  +K   +MI  G  P+I  YN L++
Sbjct  386   AMEFFDQLRARGLYPNKRTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNALVN  445

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               C  G +E A   + EME++G+ PD+ T++T+IS +CR      A  V+ +M   GV P
Sbjct  446   GHCALGRMEDALSVIQEMEWRGVVPDVVTYSTMISGFCRNHNLERAFCVKQQMVEKGVSP  505

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D+ITY+SLI   C +  + EA  LF++ ++  + P++ TYTTLI  YC  GDI  AL LH
Sbjct  506   DVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCVEGDIKGALNLH  565

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVT-------CNTL  789
               M  KG  P   TY+ ++    ++ R +E+ +LL ++  ++  P++VT       CN L
Sbjct  566   DEMINKGFFPDAVTYSVLINGLNKQARTREAKRLLFKLLYEQSVPNSVTYDMLIESCNDL  625

Query  788   --------INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
                     I G+C  G +  A +V   ML+   +P    Y  LIHG  +  +  RA  + 
Sbjct  626   DFKSATDLIKGFCMKGLLDEADRVFELMLQKDKKPSEVAYNLLIHGHSRGGNLHRALHLY  685

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
              +M++ GF P   +   L+     +  +E L ++     G     D    + I+    K 
Sbjct  686   REMVSVGFVPHAISLIVLMKELFKEGMSEELNQVIQSTLGSCKLADGELAKGIVDVNYKE  745

Query  452   GKLDCA  435
             G +D  
Sbjct  746   GNMDAV  751


 Score =   117 bits (294),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 98/388 (25%), Positives = 160/388 (41%), Gaps = 37/388 (10%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN R    +  ++I   ++      A  +L+++    F  S    NALV           
Sbjct  400   PNKR----TYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNALVNG---------  446

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
                     +    R  DA+ V + +    + PD    + +++   +    +  +   ++M
Sbjct  447   --------HCALGRMEDALSVIQEMEWRGVVPDVVTYSTMISGFCRNHNLERAFCVKQQM  498

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             ++ GV P++  Y+ LI   C+   + +A E   EM   GI PD +T+ TLI  YC  G  
Sbjct  499   VEKGVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCVEGDI  558

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL-FKDIKEKVTPNEVTY---  1008
               AL++ D M   G  PD +TY+ LI+   ++ R REA RL FK + E+  PN VTY   
Sbjct  559   KGALNLHDEMINKGFFPDAVTYSVLINGLNKQARTREAKRLLFKLLYEQSVPNSVTYDML  618

Query  1007  ------------TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
                         T LI G+C  G +DEA R+   M +K   P    YN ++      G +
Sbjct  619   IESCNDLDFKSATDLIKGFCMKGLLDEADRVFELMLQKDKKPSEVAYNLLIHGHSRGGNL  678

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
               +  L  +M      P  ++   L+    K G      +V    L +    D    K +
Sbjct  679   HRALHLYREMVSVGFVPHAISLIVLMKELFKEGMSEELNQVIQSTLGSCKLADGELAKGI  738

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPS  600
             +    K  + +    V+ DM   G  P+
Sbjct  739   VDVNYKEGNMDAVFNVLTDMAKDGLFPN  766



>ref|XP_008237676.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, 
mitochondrial [Prunus mume]
Length=630

 Score =   259 bits (662),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 155/505 (31%), Positives = 255/505 (50%), Gaps = 10/505 (2%)
 Frame = -2

Query  1793  INHTLLTLSP-----CWFWLSWS---FFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSA  1638
             I H    LSP       F L  S     +++  +  +R  +Q+    I I+ +    + A
Sbjct  60    IKHLSPNLSPSLISEALFELQKSPQLVLEFISNVEFHRLDIQTRCLAIAIVARQSSPQPA  119

Query  1637  KDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV-FSWLLIFYANSKRTWDAIQVFEHL  1461
              ++L Q+      +   + N L  S +   VNS + F  LL      K+  +A+  F  +
Sbjct  120   FELLKQVVGSGIATIREIFNPLALSREHLSVNSSIIFDLLLRACCEMKKADEAVDCFYLM  179

Query  1460  RICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEV  1281
                   P    C  +L+  +K   T+ VW  Y +M +L +  ++  +N++I+  CK G++
Sbjct  180   VDKGFMPKTETCNDMLSLFLKLNQTERVWVLYAEMFRLKINSSVCTFNIMINVLCKEGKL  239

Query  1280  EKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSL  1101
             +KA EF+  ME  GI P++ T+NT+I  +C RG    A  +   M+  GVEPD  TY SL
Sbjct  240   KKAKEFVGFMESSGIKPNVVTYNTVIHGFCSRGRVGRAQMIFSAMKGKGVEPDSYTYGSL  299

Query  1100  IHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
             I   C+E R++EA+ LF  + E  + P+ VTY  LIDGYC  GD+D+A      M +KG+
Sbjct  300   ISGMCKERRLQEAVGLFNKMLEIGLLPSAVTYNILIDGYCNEGDLDKAFSYRDEMVKKGI  359

Query  923   CPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALK  744
              P V+TYN ++     EGRM E+ +++ +M EK +  + +T N LINGYC+ G+   A  
Sbjct  360   RPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKGVVSNGITYNILINGYCRSGNAKKAFS  419

Query  743   VKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYC  564
             + ++ML   ++P   TY +L++   K K  + A ++   ++  G  P    ++ L+D +C
Sbjct  420   LLDEMLSKSIKPTKVTYTSLMYVLSKNKRMKEADDLFKKILTKGVLPDLVMFNALIDGHC  479

Query  563   LQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSV  384
                N E    L  E        D   Y  +++  C++GK++ A +    M+ R I  D +
Sbjct  480   ANGNMERAFALLGEMDKMKVHPDEVTYNTLMQGRCRQGKVEEARQLLDQMKRRGIKPDHI  539

Query  383   VYTSLAYAYFKEGNTRAASDLFDEM  309
              Y +L   Y K G+ + A  + DEM
Sbjct  540   SYNTLISGYSKRGDLKDAFKVRDEM  564


 Score =   207 bits (527),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/324 (34%), Positives = 183/324 (56%), Gaps = 1/324 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             +S  +  L+      +R  +A+ +F  +    + P      +L++    EG  D  +   
Sbjct  292   DSYTYGSLISGMCKERRLQEAVGLFNKMLEIGLLPSAVTYNILIDGYCNEGDLDKAFSYR  351

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M+K G+ P +  YN+LIHA    G + +A E + EME KG+  +  T+N LI+ YCR 
Sbjct  352   DEMVKKGIRPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKGVVSNGITYNILINGYCRS  411

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
             G   +A S+ D M    ++P  +TY SL++   +  RM+EA  LFK I  K V P+ V +
Sbjct  412   GNAKKAFSLLDEMLSKSIKPTKVTYTSLMYVLSKNKRMKEADDLFKKILTKGVLPDLVMF  471

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
               LIDG+C  G+++ A  L   M++  + P   TYN++++  C +G+++E+ +LL+QM  
Sbjct  472   NALIDGHCANGNMERAFALLGEMDKMKVHPDEVTYNTLMQGRCRQGKVEEARQLLDQMKR  531

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             + I+PD+++ NTLI+GY K GD+  A KV+++ML  G  P   TY ALI G  K ++ + 
Sbjct  532   RGIKPDHISYNTLISGYSKRGDLKDAFKVRDEMLSIGFNPTLLTYNALIQGLSKTQEGDL  591

Query  647   AKEVIFDMIAAGFSPSYCAYSWLV  576
             A+ ++ +M++ G  P    Y  L+
Sbjct  592   AEVLLKEMVSRGIKPDDSTYYSLI  615


 Score =   166 bits (421),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/348 (30%), Positives = 175/348 (50%), Gaps = 7/348 (2%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLS---EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQ  1155
             I+++L+ ACC   E++KADE +     M  KG  P   T N ++SL+ +         + 
Sbjct  155   IFDLLLRACC---EMKKADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQTERVWVLY  211

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRV  978
               M R  +   + T+N +I+  C+EG++++A      ++   + PN VTY T+I G+C  
Sbjct  212   AEMFRLKINSSVCTFNIMINVLCKEGKLKKAKEFVGFMESSGIKPNVVTYNTVIHGFCSR  271

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G +  A  + SAM+ KG+ P   TY S++   C+E R++E+  L N+M E  + P  VT 
Sbjct  272   GRVGRAQMIFSAMKGKGVEPDSYTYGSLISGMCKERRLQEAVGLFNKMLEIGLLPSAVTY  331

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             N LI+GYC  GD+  A   +++M++ G+RP   TY  LIH          A E++ +M  
Sbjct  332   NILIDGYCNEGDLDKAFSYRDEMVKKGIRPTVSTYNLLIHALFMEGRMVEAYEMVKEMEE  391

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
              G   +   Y+ L++ YC   N +    L DE   +        Y +++  L K  ++  
Sbjct  392   KGVVSNGITYNILINGYCRSGNAKKAFSLLDEMLSKSIKPTKVTYTSLMYVLSKNKRMKE  451

Query  437   AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             A+  F  +  + +L D V++ +L   +   GN   A  L  EM K ++
Sbjct  452   ADDLFKKILTKGVLPDLVMFNALIDGHCANGNMERAFALLGEMDKMKV  499


 Score =   132 bits (333),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 80/269 (30%), Positives = 132/269 (49%), Gaps = 40/269 (15%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             I+P      +L+++L  EG     ++  K+M + GV+ N   YN+LI+  C+SG  +KA 
Sbjct  359   IRPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKGVVSNGITYNILINGYCRSGNAKKAF  418

Query  1268  EFLSEME-----------------------------------FKGIFPDLYTFNTLISLY  1194
               L EM                                     KG+ PDL  FN LI  +
Sbjct  419   SLLDEMLSKSIKPTKVTYTSLMYVLSKNKRMKEADDLFKKILTKGVLPDLVMFNALIDGH  478

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNE  1017
             C  G    A ++   M++  V PD +TYN+L+   CR+G++ EA +L   +K + + P+ 
Sbjct  479   CANGNMERAFALLGEMDKMKVHPDEVTYNTLMQGRCRQGKVEEARQLLDQMKRRGIKPDH  538

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKF--CEEGRMKESTKLL  843
             ++Y TLI GY + GD+ +A ++   M   G  P + TYN++++     +EG + E   LL
Sbjct  539   ISYNTLISGYSKRGDLKDAFKVRDEMLSIGFNPTLLTYNALIQGLSKTQEGDLAEV--LL  596

Query  842   NQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
              +M  + I+PD+ T  +LI G   + + V
Sbjct  597   KEMVSRGIKPDDSTYYSLIKGIGNVDEFV  625


 Score =   124 bits (312),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 96/391 (25%), Positives = 175/391 (45%), Gaps = 28/391 (7%)
 Frame = -2

Query  1433  HACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACC-------KSGEVEK  1275
             H    L  SL+ E L + + K+ + +++   + N+  + + I   C       +    + 
Sbjct  62    HLSPNLSPSLISEALFE-LQKSPQLVLEF--ISNVEFHRLDIQTRCLAIAIVARQSSPQP  118

Query  1274  ADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIH  1095
             A E L ++   GI      FN L        +  E LSV             I ++ L+ 
Sbjct  119   AFELLKQVVGSGIATIREIFNPL-------ALSREHLSVNSS----------IIFDLLLR  161

Query  1094  SHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCP  918
             + C   +  EA+  F  + +K   P   T   ++  + ++   +    L++ M    +  
Sbjct  162   ACCEMKKADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQTERVWVLYAEMFRLKINS  221

Query  917   RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
              V T+N ++   C+EG++K++ + +  M    I+P+ VT NT+I+G+C  G +  A  + 
Sbjct  222   SVCTFNIMINVLCKEGKLKKAKEFVGFMESSGIKPNVVTYNTVIHGFCSRGRVGRAQMIF  281

Query  737   NKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQ  558
             + M   G+ PDS+TY +LI G CK +  + A  +   M+  G  PS   Y+ L+D YC +
Sbjct  282   SAMKGKGVEPDSYTYGSLISGMCKERRLQEAVGLFNKMLEIGLLPSAVTYNILIDGYCNE  341

Query  557   NNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVY  378
              + +      DE   +G    +S Y  +I  L   G++  A      M+E+ ++ + + Y
Sbjct  342   GDLDKAFSYRDEMVKKGIRPTVSTYNLLIHALFMEGRMVEAYEMVKEMEEKGVVSNGITY  401

Query  377   TSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
               L   Y + GN + A  L DEM  + +  T
Sbjct  402   NILINGYCRSGNAKKAFSLLDEMLSKSIKPT  432



>ref|XP_007042371.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOX98202.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=745

 Score =   261 bits (668),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/491 (30%), Positives = 251/491 (51%), Gaps = 6/491 (1%)
 Frame = -2

Query  1751  LSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACK--DFLSSPAVLN  1578
             L   F KW    P +  + Q     ++ILTK K +KSA+ +   +A    D      V  
Sbjct  63    LILKFLKWARPHPFF--TPQCKCLTLHILTKFKLYKSAQSLAEDLAVNTSDDEKGSFVFQ  120

Query  1577  ALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK  1398
              L  +      +S VF  ++  YA  K    A+ +    +     P   +   +L+++++
Sbjct  121   CLKETYHSCASSSSVFDLVVKSYARLKLIVKALNIVNLAKFNGFMPGVLSYNAILDAVIR  180

Query  1397  -EGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
              +       + + +MI+ GV PN+  YN+LI   C +G +     F SEME KG  P++ 
Sbjct  181   CKKPVRFAEEVFAEMIRHGVTPNVFTYNILIRGFCTAGNLYMGLRFFSEMERKGCLPNVV  240

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI  1041
             T+NTLI  +C+      A  +   M   G+EP++I+YN +I+  CREGRM+E   + +++
Sbjct  241   TYNTLIDAHCKLKKIDGAFKLLRAMGLKGLEPNLISYNVIINGLCREGRMKETSEVLREM  300

Query  1040  KEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
               K  +P+E+TY TL++GYC+ G+  +AL LH+ M   GL P V TY S++   C+ G M
Sbjct  301   SWKGFSPDEITYNTLVNGYCKDGNFHQALVLHAEMVRNGLTPNVITYTSLINSMCKAGNM  360

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
               + +  +QM  + + P+  T  TLI+G+ + G +  A ++ ++M   G  P   TY  L
Sbjct  361   NRAMEFFDQMHVRGLRPNERTYTTLIDGFSQQGRLNEAYRLLDEMGRNGFSPSLVTYNTL  420

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGY  504
             I+G C     E + ++I DM+  G +P   +YS ++  +C   + E   ++  E   +G+
Sbjct  421   INGHCMVGSVEESLKLIQDMVGKGLAPDLVSYSTIISGFCKSQDLERAFRMKQEMVEKGF  480

Query  503   CVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASD  324
               D   Y ++I+ LC++ +L  A   F  M    +  D   YT+L  +Y KEG+   A  
Sbjct  481   LPDAITYSSLIQGLCQQSRLTEACDLFQEMLNAGVTPDEFTYTTLINSYCKEGDIEKAFL  540

Query  323   LFDEMYKRRLM  291
             L DEM ++ L+
Sbjct  541   LHDEMVQKGLL  551


 Score =   246 bits (627),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 147/497 (30%), Positives = 240/497 (48%), Gaps = 66/497 (13%)
 Frame = -2

Query  1601  LSSPAVLNALVRSDDDSDVNSQVFSWLL-------IFYAN--------SKRTWDAIQVFE  1467
             LS  A+L+A++R         +VF+ ++       +F  N        +   +  ++ F 
Sbjct  169   LSYNAILDAVIRCKKPVRFAEEVFAEMIRHGVTPNVFTYNILIRGFCTAGNLYMGLRFFS  228

Query  1466  HLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSG  1287
              +      P+      L+++  K    D  +K  + M   G+ PN+  YNV+I+  C+ G
Sbjct  229   EMERKGCLPNVVTYNTLIDAHCKLKKIDGAFKLLRAMGLKGLEPNLISYNVIINGLCREG  288

Query  1286  EVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYN  1107
              +++  E L EM +KG  PD  T+NTL++ YC+ G  ++AL +   M R G+ P++ITY 
Sbjct  289   RMKETSEVLREMSWKGFSPDEITYNTLVNGYCKDGNFHQALVLHAEMVRNGLTPNVITYT  348

Query  1106  SLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEK  930
             SLI+S C+ G M  AM  F  +  + + PNE TYTTLIDG+ + G ++EA RL   M   
Sbjct  349   SLINSMCKAGNMNRAMEFFDQMHVRGLRPNERTYTTLIDGFSQQGRLNEAYRLLDEMGRN  408

Query  929   GLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSA  750
             G  P + TYN+++   C  G ++ES KL+  M  K + PD V+ +T+I+G+CK  D+  A
Sbjct  409   GFSPSLVTYNTLINGHCMVGSVEESLKLIQDMVGKGLAPDLVSYSTIISGFCKSQDLERA  468

Query  749   LKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT  570
              ++K +M+E G  PD+ TY +LI G C+      A ++  +M+ AG +P    Y+ L+++
Sbjct  469   FRMKQEMVEKGFLPDAITYSSLIQGLCQQSRLTEACDLFQEMLNAGVTPDEFTYTTLINS  528

Query  569   YCLQNNNEALVKLADEFSGRGYCVDISFYR------------------------------  480
             YC + + E    L DE   +G   D+  Y                               
Sbjct  529   YCKEGDIEKAFLLHDEMVQKGLLPDVVTYSVLINGLNKQTRTREAKKLLLKFFYDESVPS  588

Query  479   --------------------AIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYA  360
                                 A+++  C  G +  AER F  M +R    D  VY  + + 
Sbjct  589   DVMYNTLIENCRNIEFKSVLALMKGFCMNGLMKEAERVFESMLQRNFKPDEAVYNVIIHG  648

Query  359   YFKEGNTRAASDLFDEM  309
             + + GN + A DL+ EM
Sbjct  649   HCRGGNIQKAYDLYKEM  665


 Score =   195 bits (496),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/382 (29%), Positives = 195/382 (51%), Gaps = 16/382 (4%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A++ F+ + +  ++P+    T L++   ++G  +  ++   +M + G  P++  YN LI+
Sbjct  363   AMEFFDQMHVRGLRPNERTYTTLIDGFSQQGRLNEAYRLLDEMGRNGFSPSLVTYNTLIN  422

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               C  G VE++ + + +M  KG+ PDL +++T+IS +C+      A  ++  M   G  P
Sbjct  423   GHCMVGSVEESLKLIQDMVGKGLAPDLVSYSTIISGFCKSQDLERAFRMKQEMVEKGFLP  482

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D ITY+SLI   C++ R+ EA  LF++ +   VTP+E TYTTLI+ YC+ GDI++A  LH
Sbjct  483   DAITYSSLIQGLCQQSRLTEACDLFQEMLNAGVTPDEFTYTTLINSYCKEGDIEKAFLLH  542

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLI------  786
               M +KGL P V TY+ ++    ++ R +E+ KLL +    +  P +V  NTLI      
Sbjct  543   DEMVQKGLLPDVVTYSVLINGLNKQTRTREAKKLLLKFFYDESVPSDVMYNTLIENCRNI  602

Query  785   ---------NGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
                       G+C  G +  A +V   ML+   +PD   Y  +IHG C+  + ++A ++ 
Sbjct  603   EFKSVLALMKGFCMNGLMKEAERVFESMLQRNFKPDEAVYNVIIHGHCRGGNIQKAYDLY  662

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
              +M+ +GF P       LV    +    + + ++          +D    + ++    K 
Sbjct  663   KEMVNSGFVPHTLTVIALVKALFMDGKTDKISQVIANTIRSCKLIDAELAKVLVEINHKE  722

Query  452   GKLDCAERFFGMMQEREILGDS  387
             G +D A      M +  +L +S
Sbjct  723   GNMDAAFNVLTEMAKDGLLPNS  744



>emb|CDX94959.1| BnaC05g07120D [Brassica napus]
Length=608

 Score =   257 bits (657),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 137/470 (29%), Positives = 250/470 (53%), Gaps = 4/470 (1%)
 Frame = -2

Query  1745  WSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVR  1566
             +SFFK++ + P +R ++ S ++M   L  HK F  A+ ++  +  +   +S + +   V 
Sbjct  106   FSFFKFISSQPGFRFTVDSYFAMARFLAVHKMFDEAQSLIALVVSRKGKNSASSVFISVL  165

Query  1565  SDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
                 SD    +   L+I Y N+    DAIQ F   R  +       C  LL+ ++K   T
Sbjct  166   ETRGSDF---LVDALMIAYTNAGFIPDAIQCFRLSRKHKFTVPIRGCGSLLDRMMKVNPT  222

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
             +TVW  Y +++  G   N++++N+L++  CK  ++  A +   E+  +G+ P + +FN L
Sbjct  223   ETVWGFYMEILDAGYPSNVYVFNILMNKFCKECKMCDAQKVFDEITKRGLRPSVVSFNIL  282

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-V  1029
             I+ YC+ G   E   V++RME+GG   D+ TY++LI++ C+E +M  A  LF ++ E+ +
Sbjct  283   INGYCKAGNLDEGFRVKERMEKGGTRADVFTYSALINALCKENKMDGAHGLFDEMCERGL  342

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              PN+V +TTLI G+ R G ID     +  M  +GL P +  YN+++  FC+ G +  +  
Sbjct  343   IPNDVVFTTLIHGHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGDLVATRN  402

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             +++ M  + + PD VT  TLI+G+C+ GD+ +AL+++ KM + G+  D   +  LI G C
Sbjct  403   VVDGMIHRGLRPDKVTYTTLIDGFCRGGDVDAALEIRKKMDQNGIELDRVGFSVLICGMC  462

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K      A+  + +M+ AG  P    Y+ ++D +C + + +   +L  E    G+   + 
Sbjct  463   KEGRVVDAERGLREMLRAGMKPDDVIYTMMMDAFCKKGDVQTGFRLLKEMQRDGHVPSVV  522

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
              Y  ++  LCK G++  A+     M    ++ D + +  L   + +  N+
Sbjct  523   TYNVLLNGLCKLGQMKNADVLLDAMLNIGVVPDDITFNILLEGHHRHANS  572


 Score =   160 bits (405),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 151/280 (54%), Gaps = 1/280 (0%)
 Frame = -2

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G   ++  +N L++  C+E +M +A ++F +I K  + P+ V++  LI+GYC+ G++DE
Sbjct  235   AGYPSNVYVFNILMNKFCKECKMCDAQKVFDEITKRGLRPSVVSFNILINGYCKAGNLDE  294

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
               R+   ME+ G    V TY++++   C+E +M  +  L ++M E+ + P++V   TLI+
Sbjct  295   GFRVKERMEKGGTRADVFTYSALINALCKENKMDGAHGLFDEMCERGLIPNDVVFTTLIH  354

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             G+ + G I    +   KML  GL+PD   Y  L++GFCK  D    + V+  MI  G  P
Sbjct  355   GHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGDLVATRNVVDGMIHRGLRP  414

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
                 Y+ L+D +C   + +A +++  +    G  +D   +  +I  +CK G++  AER  
Sbjct  415   DKVTYTTLIDGFCRGGDVDAALEIRKKMDQNGIELDRVGFSVLICGMCKEGRVVDAERGL  474

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
               M    +  D V+YT +  A+ K+G+ +    L  EM +
Sbjct  475   REMLRAGMKPDDVIYTMMMDAFCKKGDVQTGFRLLKEMQR  514


 Score =   115 bits (289),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 155/346 (45%), Gaps = 5/346 (1%)
 Frame = -2

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS  1161
             LP+  I++       + G     D + +   F  +        +LI+L   R     A S
Sbjct  100   LPHHSIFSFFKFISSQPGFRFTVDSYFAMARFLAVHKMFDEAQSLIALVVSRKGKNSASS  159

Query  1160  V-QDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGY  987
             V    +E  G +      ++L+ ++   G + +A++ F+   K K T       +L+D  
Sbjct  160   VFISVLETRGSD---FLVDALMIAYTNAGFIPDAIQCFRLSRKHKFTVPIRGCGSLLDRM  216

Query  986   CRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDN  807
              +V   +     +  + + G    V  +N ++ KFC+E +M ++ K+ +++ ++ + P  
Sbjct  217   MKVNPTETVWGFYMEILDAGYPSNVYVFNILMNKFCKECKMCDAQKVFDEITKRGLRPSV  276

Query  806   VTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFD  627
             V+ N LINGYCK G++    +VK +M + G R D FTY ALI+  CK    + A  +  +
Sbjct  277   VSFNILINGYCKAGNLDEGFRVKERMEKGGTRADVFTYSALINALCKENKMDGAHGLFDE  336

Query  626   MIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGK  447
             M   G  P+   ++ L+  +      + + +   +   RG   DI  Y  ++   CK G 
Sbjct  337   MCERGLIPNDVVFTTLIHGHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGD  396

Query  446   LDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             L         M  R +  D V YT+L   + + G+  AA ++  +M
Sbjct  397   LVATRNVVDGMIHRGLRPDKVTYTTLIDGFCRGGDVDAALEIRKKM  442


 Score = 79.3 bits (194),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 82/175 (47%), Gaps = 1/175 (1%)
 Frame = -2

Query  815  PDNV-TCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
            P NV   N L+N +CK   +  A KV +++ + GLRP   ++  LI+G+CKA + +    
Sbjct  238  PSNVYVFNILMNKFCKECKMCDAQKVFDEITKRGLRPSVVSFNILINGYCKAGNLDEGFR  297

Query  638  VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
            V   M   G       YS L++  C +N  +    L DE   RG   +   +  +I    
Sbjct  298  VKERMEKGGTRADVFTYSALINALCKENKMDGAHGLFDEMCERGLIPNDVVFTTLIHGHS  357

Query  458  KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
            + G++D  +  +  M  R +  D V+Y +L   + K G+  A  ++ D M  R L
Sbjct  358  RNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGDLVATRNVVDGMIHRGL  412


 Score = 75.5 bits (184),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 83/169 (49%), Gaps = 4/169 (2%)
 Frame = -2

Query  800  CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
            C +L++   K+    +      ++L+AG   + + +  L++ FCK      A++V  ++ 
Sbjct  209  CGSLLDRMMKVNPTETVWGFYMEILDAGYPSNVYVFNILMNKFCKECKMCDAQKVFDEIT  268

Query  620  AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
              G  PS  +++ L++ YC   N +   ++ +     G   D+  Y A+I  LCK  K+D
Sbjct  269  KRGLRPSVVSFNILINGYCKAGNLDEGFRVKERMEKGGTRADVFTYSALINALCKENKMD  328

Query  440  CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             A   F  M ER ++ + VV+T+L + + + G      DL  E Y++ L
Sbjct  329  GAHGLFDEMCERGLIPNDVVFTTLIHGHSRNGRI----DLMKESYQKML  373



>ref|XP_011092729.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Sesamum indicum]
 ref|XP_011092730.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Sesamum indicum]
 ref|XP_011092731.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Sesamum indicum]
 ref|XP_011092732.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Sesamum indicum]
 ref|XP_011092733.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Sesamum indicum]
 ref|XP_011092734.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Sesamum indicum]
Length=769

 Score =   261 bits (666),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 160/528 (30%), Positives = 267/528 (51%), Gaps = 8/528 (2%)
 Frame = -2

Query  1865  VIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSS  1686
             V +LK H  + L P +      T     LL  S     L+  F  W   +P + + LQ  
Sbjct  45    VSILKHHHPSQLDPLVSQFTPQTA--SYLLLQSQNNRNLTLKFLNWARKLPFFSNHLQCH  102

Query  1685  WSMIYILTKHKHFKSAKDMLHQIACK--DFLSSPAVLNALVRSDDDSDVNSQVFSWLLIF  1512
                I+ILT+ K +K+A+ +   +A    D      V + L  +    + +S VF  ++  
Sbjct  103   CLCIHILTRFKLYKTAQSLAEDVALSFPDDEKGDVVFSCLRDTYQACNSSSAVFDLMVKA  162

Query  1511  YANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE---GLTDTVWKTYKKMIKLGV  1341
             + + K    A  +    +     P   +   +L ++++    G  ++    Y  MI  G+
Sbjct  163   FCSLKLIDRASNIMNFAKHHGFMPSVLSYNSVLEAIIRSSVRGYVESARNVYHDMIDNGI  222

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS  1161
              PN+  YN+LI   C + E++K   FL EME KG  P++ T+NTLI   C+ G   +A +
Sbjct  223   SPNVFTYNILIRGLCANKEMDKGLCFLEEMEKKGCLPNVVTYNTLIDGCCKMGNINKACA  282

Query  1160  VQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYC  984
             +   M    +EP++ITYN +I+  CREGRM+E  ++FK +K K + P+E+TY TL++GYC
Sbjct  283   LLKLMWEKNLEPNVITYNVIINGLCREGRMKETNKVFKQMKAKGIIPDEITYNTLVNGYC  342

Query  983   RVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNV  804
             + G+  +AL LH+ M   GL P V TY S++   C+   +  + +  +QM  + + P+  
Sbjct  343   KEGNFHQALVLHAEMVWNGLSPNVVTYTSLINCMCKARNLHRAMEFFDQMQIRGLTPNEK  402

Query  803   TCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDM  624
             T  T+I+G+ + G +  A K+ ++M+  G  P   TY ALI+G C +   +   EV+  M
Sbjct  403   TYTTVIDGFSQQGLMDEAYKLLSEMISRGFSPSIVTYNALIYGHCVSGRIDIGLEVVRSM  462

Query  623   IAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKL  444
              A G  P   +YS ++  +C   + +   ++ +E    G   D   Y ++I  LCK+ +L
Sbjct  463   TAKGVQPDVVSYSTIISGFCRNFDLDKAFRMKEEMIENGILPDAITYSSLIEGLCKQRRL  522

Query  443   DCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
               A + F  M + ++  D   YT+L  AY  E + R+A  L DEM  +
Sbjct  523   TEACKLFKEMWKLDLQPDKCTYTTLINAYCAEDDIRSAIHLHDEMINK  570


 Score =   214 bits (546),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/404 (30%), Positives = 204/404 (50%), Gaps = 24/404 (6%)
 Frame = -2

Query  1496  RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYN  1317
             R  +  +VF+ ++   I PD      L+N   KEG        + +M+  G+ PN+  Y 
Sbjct  311   RMKETNKVFKQMKAKGIIPDEITYNTLVNGYCKEGNFHQALVLHAEMVWNGLSPNVVTYT  370

Query  1316  VLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERG  1137
              LI+  CK+  + +A EF  +M+ +G+ P+  T+ T+I  + ++G+  EA  +   M   
Sbjct  371   SLINCMCKARNLHRAMEFFDQMQIRGLTPNEKTYTTVIDGFSQQGLMDEAYKLLSEMISR  430

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P I+TYN+LI+ HC  GR+   + + + +  K V P+ V+Y+T+I G+CR  D+D+A
Sbjct  431   GFSPSIVTYNALIYGHCVSGRIDIGLEVVRSMTAKGVQPDVVSYSTIISGFCRNFDLDKA  490

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              R+   M E G+ P   TY+S++   C++ R+ E+ KL  +M +  ++PD  T  TLIN 
Sbjct  491   FRMKEEMIENGILPDAITYSSLIEGLCKQRRLTEACKLFKEMWKLDLQPDKCTYTTLINA  550

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
             YC   DI SA+ + ++M+  G  PD  TY  LI+G  K   +  AK ++F +      P 
Sbjct  551   YCAEDDIRSAIHLHDEMINKGFFPDVVTYSVLINGLNKQARSREAKRLLFKLFYEQPVPH  610

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYC-VDISFYRAIIRRLCKRGKLDCAERFF  423
                Y  L+++                      C ++     A+I+  C +G ++ A+R F
Sbjct  611   DVTYDLLIES----------------------CNIEFQSVVALIKGFCMKGLMNEADRVF  648

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
               M ++       VY  L + + + GN   A DL+ EM    L+
Sbjct  649   KGMLQKNHKPSEAVYNVLIHGHCRAGNLHKAIDLYREMVHHGLV  692


 Score =   203 bits (516),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 123/383 (32%), Positives = 192/383 (50%), Gaps = 39/383 (10%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR---RGMHYEALSVQ  1155
             ++++++ A C    +++A   ++  +  G  P + ++N+++    R   RG    A +V 
Sbjct  155   VFDLMVKAFCSLKLIDRASNIMNFAKHHGFMPSVLSYNSVLEAIIRSSVRGYVESARNVY  214

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRV  978
               M   G+ P++ TYN LI   C    M + +   +++++K   PN VTY TLIDG C++
Sbjct  215   HDMIDNGISPNVFTYNILIRGLCANKEMDKGLCFLEEMEKKGCLPNVVTYNTLIDGCCKM  274

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G+I++A  L   M EK L P V TYN I+   C EGRMKE+ K+  QM  K I PD +T 
Sbjct  275   GNINKACALLKLMWEKNLEPNVITYNVIINGLCREGRMKETNKVFKQMKAKGIIPDEITY  334

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE-------  639
             NTL+NGYCK G+   AL +  +M+  GL P+  TY +LI+  CKA++  RA E       
Sbjct  335   NTLVNGYCKEGNFHQALVLHAEMVWNGLSPNVVTYTSLINCMCKARNLHRAMEFFDQMQI  394

Query  638   ----------------------------VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEA  543
                                         ++ +MI+ GFSPS   Y+ L+  +C+    + 
Sbjct  395   RGLTPNEKTYTTVIDGFSQQGLMDEAYKLLSEMISRGFSPSIVTYNALIYGHCVSGRIDI  454

Query  542   LVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAY  363
              +++    + +G   D+  Y  II   C+   LD A R    M E  IL D++ Y+SL  
Sbjct  455   GLEVVRSMTAKGVQPDVVSYSTIISGFCRNFDLDKAFRMKEEMIENGILPDAITYSSLIE  514

Query  362   AYFKEGNTRAASDLFDEMYKRRL  294
                K+     A  LF EM+K  L
Sbjct  515   GLCKQRRLTEACKLFKEMWKLDL  537


 Score =   186 bits (471),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/329 (32%), Positives = 177/329 (54%), Gaps = 15/329 (5%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   ++ L+     ++    A++ F+ ++I  + P+    T +++   ++GL D  +K  
Sbjct  365   NVVTYTSLINCMCKARNLHRAMEFFDQMQIRGLTPNEKTYTTVIDGFSQQGLMDEAYKLL  424

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +MI  G  P+I  YN LI+  C SG ++   E +  M  KG+ PD+ +++T+IS +CR 
Sbjct  425   SEMISRGFSPSIVTYNALIYGHCVSGRIDIGLEVVRSMTAKGVQPDVVSYSTIISGFCRN  484

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTY  1008
                 +A  +++ M   G+ PD ITY+SLI   C++ R+ EA +LFK++ K  + P++ TY
Sbjct  485   FDLDKAFRMKEEMIENGILPDAITYSSLIEGLCKQRRLTEACKLFKEMWKLDLQPDKCTY  544

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTLI+ YC   DI  A+ LH  M  KG  P V TY+ ++    ++ R +E+ +LL ++  
Sbjct  545   TTLINAYCAEDDIRSAIHLHDEMINKGFFPDVVTYSVLINGLNKQARSREAKRLLFKLFY  604

Query  827   KKIEPDNVT-------CN-------TLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYK  690
             ++  P +VT       CN        LI G+C  G +  A +V   ML+   +P    Y 
Sbjct  605   EQPVPHDVTYDLLIESCNIEFQSVVALIKGFCMKGLMNEADRVFKGMLQKNHKPSEAVYN  664

Query  689   ALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
              LIHG C+A +  +A ++  +M+  G  P
Sbjct  665   VLIHGHCRAGNLHKAIDLYREMVHHGLVP  693



>ref|XP_010452022.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X1 [Camelina sativa]
Length=736

 Score =   260 bits (664),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/544 (28%), Positives = 259/544 (48%), Gaps = 71/544 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++H+  S  +MI++L +      A+  L ++  +  +S   ++N+LV +      N  
Sbjct  113   PNFKHTSLSLSAMIHVLVRSGRLSDAQSCLLRMIRRSGVSRAEIVNSLVSTYSTCGSNDS  172

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +A++ F  LR         AC  L+ SLV+ G  +  W  Y+++
Sbjct  173   VFDLLIRTYVQARKLREALEAFTLLRSKGYTVSIDACNALMGSLVRVGWVELAWGVYQEI  232

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              + GV  N++  N++++A CK G++EK   FLSE++ KG++PD+ T+NTLIS Y  +G+ 
Sbjct  233   SRSGVGMNVYTLNIMVNALCKDGKMEKIGTFLSEVQEKGVYPDIVTYNTLISAYSSKGLM  292

Query  1175  YEALSVQDRME-----------------------------------RGGVEPDIITYNSL  1101
              EA    D M                                    R G+ PD  TY SL
Sbjct  293   EEAFESMDAMPSKGFSPGVYTYNTVINGLCKHGKYERAKEAFAEMLRSGLSPDSTTYRSL  352

Query  1100  IHSHCREGRMREAMRLFKDIKEK------------------------------------V  1029
             +   C++G   E  ++F D++ +                                    +
Sbjct  353   LMEACKKGDAVETEKIFSDMRSRDIVPDLVCFSSMMSLFARSGNLEKALVYFNSVKDAGL  412

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              P+ V YT LI GYC+ G I EA+ L   M  +G    V TYN+IL   C+   ++E+ K
Sbjct  413   IPDNVIYTILIQGYCKKGMISEAMNLRDEMLRQGCAMDVVTYNTILHGLCKRKMLREADK  472

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L N+M E+ + PD+ T   LI+G+CK+G++ +A+++  KM E  ++ D  TY  L+ GF 
Sbjct  473   LFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIKFDVVTYNTLLDGFG  532

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  D + AKE+  DM++    P+  +YS +V+  C + +     ++ DE   +     + 
Sbjct  533   KVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRVWDEMISKSIKPTVM  592

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                ++I+  C+ G     E F   M     + D + Y +L Y + KE N   A  L  +M
Sbjct  593   ICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKM  652

Query  308   YKRR  297
              +++
Sbjct  653   EEKQ  656


 Score =   196 bits (497),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/399 (28%), Positives = 205/399 (51%), Gaps = 4/399 (1%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A + F  +    + PD      LL    K+G      K +  M    ++P++  ++ ++ 
Sbjct  330   AKEAFAEMLRSGLSPDSTTYRSLLMEACKKGDAVETEKIFSDMRSRDIVPDLVCFSSMMS  389

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
                +SG +EKA  + + ++  G+ PD   +  LI  YC++GM  EA++++D M R G   
Sbjct  390   LFARSGNLEKALVYFNSVKDAGLIPDNVIYTILIQGYCKKGMISEAMNLRDEMLRQGCAM  449

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D++TYN+++H  C+   +REA +LF ++ E+ + P+  T T LIDG+C++G++  A+ L 
Sbjct  450   DVVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELF  509

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
               M+EK +   V TYN++L  F + G +  + ++   M  ++I P  ++ + ++N  C  
Sbjct  510   KKMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSK  569

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
             G +  A +V ++M+   ++P      ++I G+C++ +    +  +  MI+ GF P   +Y
Sbjct  570   GHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISY  629

Query  587   SWLVDTYCLQNNNE---ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGM  417
             + L+  +  + N      LVK  +E  G     D+  Y +I+   C++ ++  AE     
Sbjct  630   NTLIYGFVKEENMSKAFGLVKKMEEKQGGLVVPDVFTYNSILHGFCRQNQMKEAEVVLRK  689

Query  416   MQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
             M ER +  D   YTSL   +  + N   A    DEM +R
Sbjct  690   MIERGVEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQR  728


 Score =   183 bits (465),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 178/353 (50%), Gaps = 4/353 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  +A S     A+  F  ++   + PD    T+L+    K+G+         +M+
Sbjct  384   FSSMMSLFARSGNLEKALVYFNSVKDAGLIPDNVIYTILIQGYCKKGMISEAMNLRDEML  443

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  YN ++H  CK   + +AD+  +EM  +G+FPD YT   LI  +C+ G   
Sbjct  444   RQGCAMDVVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQ  503

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              A+ +  +M+   ++ D++TYN+L+    + G +  A  ++ D +  ++ P  ++Y+ ++
Sbjct  504   NAMELFKKMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMV  563

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +  C  G + EA R+   M  K + P V   NS+++ +C  G   +    L +M  +   
Sbjct  564   NALCSKGHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFV  623

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLE--AGLR-PDSFTYKALIHGFCKAKDTERA  645
             PD ++ NTLI G+ K  ++  A  +  KM E   GL  PD FTY +++HGFC+    + A
Sbjct  624   PDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGGLVVPDVFTYNSILHGFCRQNQMKEA  683

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             + V+  MI  G  P    Y+ L++ +  Q+N     +  DE   RG+  D  F
Sbjct  684   EVVLRKMIERGVEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQRGFSPDDQF  736


 Score =   143 bits (360),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 148/283 (52%), Gaps = 6/283 (2%)
 Frame = -2

Query  1535  VFSWLLIFYANSKRTW--DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             V ++  I +   KR    +A ++F  +    + PD +  T+L++   K G      + +K
Sbjct  451   VVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFK  510

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM +  +  ++  YN L+    K G+++ A E  ++M  + I P   +++ +++  C +G
Sbjct  511   KMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKG  570

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLF-KDIKEKVTPNEVTYT  1005
                EA  V D M    ++P ++  NS+I  +CR G   +      K I E   P+ ++Y 
Sbjct  571   HLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYN  630

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEK--GL-CPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             TLI G+ +  ++ +A  L   MEEK  GL  P V TYNSIL  FC + +MKE+  +L +M
Sbjct  631   TLIYGFVKEENMSKAFGLVKKMEEKQGGLVVPDVFTYNSILHGFCRQNQMKEAEVVLRKM  690

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD  705
              E+ +EPD  T  +LING+    ++  A +  ++ML+ G  PD
Sbjct  691   IERGVEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQRGFSPD  733



>ref|XP_006372553.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP50350.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=599

 Score =   257 bits (656),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/479 (29%), Positives = 254/479 (53%), Gaps = 1/479 (0%)
 Frame = -2

Query  1742  SFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS  1563
             SFF ++ + P + H++QS  SM++ L  H+  + A+ +LH +  +    S + + A +  
Sbjct  95    SFFDFLSSYPTFSHTVQSYCSMVHFLIAHRMNQQAESLLHFVVSRKGKGSASSVFASILE  154

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
                +  +S VF  L+  Y       DAIQ F   +   +K   + C  LL  ++K     
Sbjct  155   TKGTLSSSFVFDALMSVYTEFGYVSDAIQCFRLTKKHNLKIPFNGCKCLLERMIKMSSPM  214

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
                + Y +++  G  PN++ +NVL++  CK G+V+ A     E+   G+ P   +FNTLI
Sbjct  215   VALEFYLEILDSGYPPNVYTFNVLMNRLCKEGKVKDAQLIFDEIRKTGLQPTAVSFNTLI  274

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VT  1026
             + YC+ G   E   ++  ME   V PD+ TY++LI   C+E ++ +A  LFK++ ++ + 
Sbjct  275   NGYCKSGNLEEGFRLKMVMEEFRVFPDVFTYSALIDGLCKECQLDDANHLFKEMCDRGLV  334

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             PN+VT+TTLI+G C+ G +D AL ++  M  KGL   +  YN+++   C+ G  +E+ K 
Sbjct  335   PNDVTFTTLINGQCKNGRVDLALEIYQQMFTKGLKADLVLYNTLIDGLCKGGYFREARKF  394

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             + +M ++ + PD  T  TL++G CK GD+  AL+++ +M++ G++ D+  + A+I G C+
Sbjct  395   VGEMTKRGLIPDKFTYTTLLDGSCKEGDLELALEMRKEMVKEGIQLDNVAFTAIISGLCR  454

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                   A+  + +M+ AG  P    Y+ ++D +C + + +   KL  E    G+   +  
Sbjct  455   DGKIVDAERTLREMLRAGLKPDDGTYTMVMDGFCKKGDVKMGFKLLKEMQSDGHIPGVIT  514

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             Y  ++  LCK+G++  A+     M    ++ D + Y  L   + K G      ++  EM
Sbjct  515   YNVLMNGLCKQGQVKNADMLLNAMLNLGVVPDDITYNILLQGHCKHGKLGDFQNVKTEM  573


 Score =   129 bits (325),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/304 (26%), Positives = 149/304 (49%), Gaps = 5/304 (2%)
 Frame = -2

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE---KVTPN  1020
             R+G    +      +E  G       +++L+  +   G + +A++ F+  K+   K+  N
Sbjct  139   RKGKGSASSVFASILETKGTLSSSFVFDALMSVYTEFGYVSDAIQCFRLTKKHNLKIPFN  198

Query  1019  EVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLN  840
                   L++   ++     AL  +  + + G  P V T+N ++ + C+EG++K++  + +
Sbjct  199   GCK--CLLERMIKMSSPMVALEFYLEILDSGYPPNVYTFNVLMNRLCKEGKVKDAQLIFD  256

Query  839   QMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAK  660
             ++ +  ++P  V+ NTLINGYCK G++    ++K  M E  + PD FTY ALI G CK  
Sbjct  257   EIRKTGLQPTAVSFNTLINGYCKSGNLEEGFRLKMVMEEFRVFPDVFTYSALIDGLCKEC  316

Query  659   DTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYR  480
               + A  +  +M   G  P+   ++ L++  C     +  +++  +   +G   D+  Y 
Sbjct  317   QLDDANHLFKEMCDRGLVPNDVTFTTLINGQCKNGRVDLALEIYQQMFTKGLKADLVLYN  376

Query  479   AIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
              +I  LCK G    A +F G M +R ++ D   YT+L     KEG+   A ++  EM K 
Sbjct  377   TLIDGLCKGGYFREARKFVGEMTKRGLIPDKFTYTTLLDGSCKEGDLELALEMRKEMVKE  436

Query  299   RLMV  288
              + +
Sbjct  437   GIQL  440


 Score =   114 bits (284),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 82/342 (24%), Positives = 149/342 (44%), Gaps = 2/342 (1%)
 Frame = -2

Query  1313  LIH-ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERG  1137
             L+H    + G+   +  F S +E KG     + F+ L+S+Y   G   +A+      ++ 
Sbjct  132   LLHFVVSRKGKGSASSVFASILETKGTLSSSFVFDALMSVYTEFGYVSDAIQCFRLTKKH  191

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEA  960
              ++        L+    +      A+  + +I +    PN  T+  L++  C+ G + +A
Sbjct  192   NLKIPFNGCKCLLERMIKMSSPMVALEFYLEILDSGYPPNVYTFNVLMNRLCKEGKVKDA  251

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
               +   + + GL P   ++N+++  +C+ G ++E  +L   M E ++ PD  T + LI+G
Sbjct  252   QLIFDEIRKTGLQPTAVSFNTLINGYCKSGNLEEGFRLKMVMEEFRVFPDVFTYSALIDG  311

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
              CK   +  A  +  +M + GL P+  T+  LI+G CK    + A E+   M   G    
Sbjct  312   LCKECQLDDANHLFKEMCDRGLVPNDVTFTTLINGQCKNGRVDLALEIYQQMFTKGLKAD  371

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                Y+ L+D  C         K   E + RG   D   Y  ++   CK G L+ A     
Sbjct  372   LVLYNTLIDGLCKGGYFREARKFVGEMTKRGLIPDKFTYTTLLDGSCKEGDLELALEMRK  431

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
              M +  I  D+V +T++     ++G    A     EM +  L
Sbjct  432   EMVKEGIQLDNVAFTAIISGLCRDGKIVDAERTLREMLRAGL  473


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 118/239 (49%), Gaps = 1/239 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   F+ L+     + R   A+++++ +    +K D      L++ L K G      K  
Sbjct  336   NDVTFTTLINGQCKNGRVDLALEIYQQMFTKGLKADLVLYNTLIDGLCKGGYFREARKFV  395

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M K G++P+   Y  L+   CK G++E A E   EM  +GI  D   F  +IS  CR 
Sbjct  396   GEMTKRGLIPDKFTYTTLLDGSCKEGDLELALEMRKEMVKEGIQLDNVAFTAIISGLCRD  455

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTY  1008
             G   +A      M R G++PD  TY  ++   C++G ++   +L K+++ +   P  +TY
Sbjct  456   GKIVDAERTLREMLRAGLKPDDGTYTMVMDGFCKKGDVKMGFKLLKEMQSDGHIPGVITY  515

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
               L++G C+ G +  A  L +AM   G+ P   TYN +L+  C+ G++ +   +  +MG
Sbjct  516   NVLMNGLCKQGQVKNADMLLNAMLNLGVVPDDITYNILLQGHCKHGKLGDFQNVKTEMG  574



>ref|XP_010490605.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Camelina sativa]
Length=740

 Score =   260 bits (664),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/544 (28%), Positives = 261/544 (48%), Gaps = 71/544 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++H+  S  +MI++L +      A+  + ++  +  +S   ++NALV +  +   N  
Sbjct  118   PNFKHTSLSLSAMIHVLVRSGRLSDAQSCVLRMIRRSGVSRAEIVNALVSTYSNCGSNDS  177

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +A + F  LR         AC  L+ SLV+ G  +  W  Y+++
Sbjct  178   VFDLLIRTYVQARKLREAHEAFTLLRSKGYTVSIDACNALMGSLVRIGWVELAWGVYREI  237

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              + GV  N++  N++++A CK G++EK   FLSE++ KG++PD+ T+NTLIS Y  +G+ 
Sbjct  238   SRSGVGMNVYTLNIMVNALCKDGKMEKIGSFLSEVQEKGVYPDIVTYNTLISAYSSKGLM  297

Query  1175  YEALSVQDRME-----------------------------------RGGVEPDIITYNSL  1101
              EA  + D M                                    R G+ PD  TY SL
Sbjct  298   EEAFELMDAMPSKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMMRSGLSPDSTTYRSL  357

Query  1100  IHSHCREGRMREAMRLFKDIKEK------------------------------------V  1029
             +   C++G   E  ++F D++ +                                    +
Sbjct  358   LMEACKKGDAVETEKIFSDMRSREIVPDLVCFSSMMSLFARSGNLDKALVYFNNVKEAGL  417

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              P+ V YT LI GYC+ G I EA+ L + M  +G    V TYN+IL   C+   ++E+ K
Sbjct  418   VPDNVIYTILIQGYCKKGMISEAMNLRNEMLRQGCAMDVVTYNTILHGLCKRKMLREADK  477

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L N+M E+ + PD+ T   LI+G+CK+G++ +A+++  KM E  ++ D  TY  L+ GF 
Sbjct  478   LFNEMTERGLFPDSYTLTILIDGHCKLGNLHNAMELFKKMKEKRIKFDVVTYNTLLDGFG  537

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  D + AKE+  DM++    P+  +YS +V+  C + +     ++ DE   +     + 
Sbjct  538   KVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRVWDEMISKSIKPTVM  597

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                ++I+  C+ G     E F   M     + D + Y +L Y + KE N   A  L  +M
Sbjct  598   ICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKM  657

Query  308   YKRR  297
              +++
Sbjct  658   EEKQ  661


 Score =   193 bits (491),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/450 (25%), Positives = 221/450 (49%), Gaps = 40/450 (9%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+  Y++     +A ++ + +      P  +    ++N L K G  +   + + +M+
Sbjct  284   YNTLISAYSSKGLMEEAFELMDAMPSKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMM  343

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL--------  1197
             + G+ P+   Y  L+   CK G+  + ++  S+M  + I PDL  F++++SL        
Sbjct  344   RSGLSPDSTTYRSLLMEACKKGDAVETEKIFSDMRSREIVPDLVCFSSMMSLFARSGNLD  403

Query  1196  ---------------------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLI  1098
                                        YC++GM  EA+++++ M R G   D++TYN+++
Sbjct  404   KALVYFNNVKEAGLVPDNVIYTILIQGYCKKGMISEAMNLRNEMLRQGCAMDVVTYNTIL  463

Query  1097  HSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLC  921
             H  C+   +REA +LF ++ E+ + P+  T T LIDG+C++G++  A+ L   M+EK + 
Sbjct  464   HGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLHNAMELFKKMKEKRIK  523

Query  920   PRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKV  741
               V TYN++L  F + G +  + ++   M  ++I P  ++ + ++N  C  G +  A +V
Sbjct  524   FDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRV  583

Query  740   KNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCL  561
              ++M+   ++P      ++I G+C++ +    +  +  MI+ GF P   +Y+ L+  +  
Sbjct  584   WDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVK  643

Query  560   QNNNE---ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
             + N      LVK  +E  G G   D+  Y +I+   C++ ++  AE     M ER +  D
Sbjct  644   EENMSKAFGLVKKMEEKQG-GLLPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVEPD  702

Query  389   SVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                YTSL   +  + N   A    DEM +R
Sbjct  703   RSTYTSLINGFVSQDNLTEAFRFHDEMLQR  732


 Score =   189 bits (481),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 180/352 (51%), Gaps = 3/352 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  +A S     A+  F +++   + PD    T+L+    K+G+         +M+
Sbjct  389   FSSMMSLFARSGNLDKALVYFNNVKEAGLVPDNVIYTILIQGYCKKGMISEAMNLRNEML  448

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  YN ++H  CK   + +AD+  +EM  +G+FPD YT   LI  +C+ G  +
Sbjct  449   RQGCAMDVVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLH  508

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              A+ +  +M+   ++ D++TYN+L+    + G +  A  ++ D +  ++ P  ++Y+ ++
Sbjct  509   NAMELFKKMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMV  568

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +  C  G + EA R+   M  K + P V   NS+++ +C  G   +    L +M  +   
Sbjct  569   NALCSKGHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFV  628

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLE--AGLRPDSFTYKALIHGFCKAKDTERAK  642
             PD ++ NTLI G+ K  ++  A  +  KM E   GL PD FTY +++HGFC+    + A+
Sbjct  629   PDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGGLLPDVFTYNSILHGFCRQNQMKEAE  688

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              V+  MI  G  P    Y+ L++ +  Q+N     +  DE   RG+  D  F
Sbjct  689   VVLRKMIERGVEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQRGFSPDDQF  740


 Score =   148 bits (373),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/314 (30%), Positives = 162/314 (52%), Gaps = 7/314 (2%)
 Frame = -2

Query  1631  MLHQIACKDFLSSPA--VLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLR  1458
             +L Q  CK  + S A  + N ++R     DV +  ++ +L      K   +A ++F  + 
Sbjct  426   ILIQGYCKKGMISEAMNLRNEMLRQGCAMDVVT--YNTILHGLCKRKMLREADKLFNEMT  483

Query  1457  ICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVE  1278
                + PD +  T+L++   K G      + +KKM +  +  ++  YN L+    K G+++
Sbjct  484   ERGLFPDSYTLTILIDGHCKLGNLHNAMELFKKMKEKRIKFDVVTYNTLLDGFGKVGDID  543

Query  1277  KADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLI  1098
              A E  ++M  + I P   +++ +++  C +G   EA  V D M    ++P ++  NS+I
Sbjct  544   TAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRVWDEMISKSIKPTVMICNSMI  603

Query  1097  HSHCREGRMREAMRLF-KDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEK--G  927
               +CR G   +      K I E   P+ ++Y TLI G+ +  ++ +A  L   MEEK  G
Sbjct  604   KGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGG  663

Query  926   LCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSAL  747
             L P V TYNSIL  FC + +MKE+  +L +M E+ +EPD  T  +LING+    ++  A 
Sbjct  664   LLPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVEPDRSTYTSLINGFVSQDNLTEAF  723

Query  746   KVKNKMLEAGLRPD  705
             +  ++ML+ G  PD
Sbjct  724   RFHDEMLQRGFSPD  737


 Score = 86.3 bits (212),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 81/377 (21%), Positives = 150/377 (40%), Gaps = 58/377 (15%)
 Frame = -2

Query  1274  ADEFLSEMEFKGIFPDL----YTFNTLISLYCRRGMHYEALSVQDRM-ERGGVEPDIITY  1110
                F+ ++ F   FP+      + + +I +  R G   +A S   RM  R GV    I  
Sbjct  106   GQRFIYQLGFN--FPNFKHTSLSLSAMIHVLVRSGRLSDAQSCVLRMIRRSGVSRAEIV-  162

Query  1109  NSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEK  930
             N+L+ ++   G                  N+  +  LI  Y +   + EA    + +  K
Sbjct  163   NALVSTYSNCG-----------------SNDSVFDLLIRTYVQARKLREAHEAFTLLRSK  205

Query  929   GLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSA  750
             G    +   N+++      G ++ +  +  ++    +  +  T N ++N  CK G +   
Sbjct  206   GYTVSIDACNALMGSLVRIGWVELAWGVYREISRSGVGMNVYTLNIMVNALCKDGKMEKI  265

Query  749   LKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT  570
                 +++ E G+ PD  TY  LI  +      E A E++  M + GFSP    Y+ +++ 
Sbjct  266   GSFLSEVQEKGVYPDIVTYNTLISAYSSKGLMEEAFELMDAMPSKGFSPGVYTYNTVING  325

Query  569   YCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
              C     E   ++  E    G   D + YR+++   CK+G     E+ F  M+ REI+ D
Sbjct  326   LCKHGKYERAKEVFAEMMRSGLSPDSTTYRSLLMEACKKGDAVETEKIFSDMRSREIVPD  385

Query  389   SVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSLLDLFWNNV  210
              V ++S+   + + GN   A                                  +++NNV
Sbjct  386   LVCFSSMMSLFARSGNLDKAL---------------------------------VYFNNV  412

Query  209   MQRGLISHNVHNSIFLK  159
              + GL+  NV  +I ++
Sbjct  413   KEAGLVPDNVIYTILIQ  429



>ref|XP_010452023.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X2 [Camelina sativa]
Length=735

 Score =   260 bits (664),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/544 (28%), Positives = 259/544 (48%), Gaps = 71/544 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++H+  S  +MI++L +      A+  L ++  +  +S   ++N+LV +      N  
Sbjct  113   PNFKHTSLSLSAMIHVLVRSGRLSDAQSCLLRMIRRSGVSRAEIVNSLVSTYSTCGSNDS  172

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +A++ F  LR         AC  L+ SLV+ G  +  W  Y+++
Sbjct  173   VFDLLIRTYVQARKLREALEAFTLLRSKGYTVSIDACNALMGSLVRVGWVELAWGVYQEI  232

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              + GV  N++  N++++A CK G++EK   FLSE++ KG++PD+ T+NTLIS Y  +G+ 
Sbjct  233   SRSGVGMNVYTLNIMVNALCKDGKMEKIGTFLSEVQEKGVYPDIVTYNTLISAYSSKGLM  292

Query  1175  YEALSVQDRME-----------------------------------RGGVEPDIITYNSL  1101
              EA    D M                                    R G+ PD  TY SL
Sbjct  293   EEAFESMDAMPSKGFSPGVYTYNTVINGLCKHGKYERAKEAFAEMLRSGLSPDSTTYRSL  352

Query  1100  IHSHCREGRMREAMRLFKDIKEK------------------------------------V  1029
             +   C++G   E  ++F D++ +                                    +
Sbjct  353   LMEACKKGDAVETEKIFSDMRSRDIVPDLVCFSSMMSLFARSGNLEKALVYFNSVKDAGL  412

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              P+ V YT LI GYC+ G I EA+ L   M  +G    V TYN+IL   C+   ++E+ K
Sbjct  413   IPDNVIYTILIQGYCKKGMISEAMNLRDEMLRQGCAMDVVTYNTILHGLCKRKMLREADK  472

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L N+M E+ + PD+ T   LI+G+CK+G++ +A+++  KM E  ++ D  TY  L+ GF 
Sbjct  473   LFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIKFDVVTYNTLLDGFG  532

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  D + AKE+  DM++    P+  +YS +V+  C + +     ++ DE   +     + 
Sbjct  533   KVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRVWDEMISKSIKPTVM  592

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                ++I+  C+ G     E F   M     + D + Y +L Y + KE N   A  L  +M
Sbjct  593   ICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKM  652

Query  308   YKRR  297
              +++
Sbjct  653   EEKQ  656


 Score =   196 bits (497),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/399 (28%), Positives = 206/399 (52%), Gaps = 5/399 (1%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A + F  +    + PD      LL    K+G      K +  M    ++P++  ++ ++ 
Sbjct  330   AKEAFAEMLRSGLSPDSTTYRSLLMEACKKGDAVETEKIFSDMRSRDIVPDLVCFSSMMS  389

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
                +SG +EKA  + + ++  G+ PD   +  LI  YC++GM  EA++++D M R G   
Sbjct  390   LFARSGNLEKALVYFNSVKDAGLIPDNVIYTILIQGYCKKGMISEAMNLRDEMLRQGCAM  449

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D++TYN+++H  C+   +REA +LF ++ E+ + P+  T T LIDG+C++G++  A+ L 
Sbjct  450   DVVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELF  509

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
               M+EK +   V TYN++L  F + G +  + ++   M  ++I P  ++ + ++N  C  
Sbjct  510   KKMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSK  569

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
             G +  A +V ++M+   ++P      ++I G+C++ +    +  +  MI+ GF P   +Y
Sbjct  570   GHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISY  629

Query  587   SWLVDTYCLQNNNE---ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGM  417
             + L+  +  + N      LVK  +E  G G   D+  Y +I+   C++ ++  AE     
Sbjct  630   NTLIYGFVKEENMSKAFGLVKKMEEKQG-GLVPDVFTYNSILHGFCRQNQMKEAEVVLRK  688

Query  416   MQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
             M ER +  D   YTSL   +  + N   A    DEM +R
Sbjct  689   MIERGVEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQR  727


 Score =   188 bits (477),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 178/352 (51%), Gaps = 3/352 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  +A S     A+  F  ++   + PD    T+L+    K+G+         +M+
Sbjct  384   FSSMMSLFARSGNLEKALVYFNSVKDAGLIPDNVIYTILIQGYCKKGMISEAMNLRDEML  443

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  YN ++H  CK   + +AD+  +EM  +G+FPD YT   LI  +C+ G   
Sbjct  444   RQGCAMDVVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQ  503

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              A+ +  +M+   ++ D++TYN+L+    + G +  A  ++ D +  ++ P  ++Y+ ++
Sbjct  504   NAMELFKKMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMV  563

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +  C  G + EA R+   M  K + P V   NS+++ +C  G   +    L +M  +   
Sbjct  564   NALCSKGHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFV  623

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLE--AGLRPDSFTYKALIHGFCKAKDTERAK  642
             PD ++ NTLI G+ K  ++  A  +  KM E   GL PD FTY +++HGFC+    + A+
Sbjct  624   PDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGGLVPDVFTYNSILHGFCRQNQMKEAE  683

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              V+  MI  G  P    Y+ L++ +  Q+N     +  DE   RG+  D  F
Sbjct  684   VVLRKMIERGVEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQRGFSPDDQF  735


 Score =   147 bits (372),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 148/282 (52%), Gaps = 5/282 (2%)
 Frame = -2

Query  1535  VFSWLLIFYANSKRTW--DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             V ++  I +   KR    +A ++F  +    + PD +  T+L++   K G      + +K
Sbjct  451   VVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFK  510

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM +  +  ++  YN L+    K G+++ A E  ++M  + I P   +++ +++  C +G
Sbjct  511   KMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKG  570

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLF-KDIKEKVTPNEVTYT  1005
                EA  V D M    ++P ++  NS+I  +CR G   +      K I E   P+ ++Y 
Sbjct  571   HLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYN  630

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEK--GLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             TLI G+ +  ++ +A  L   MEEK  GL P V TYNSIL  FC + +MKE+  +L +M 
Sbjct  631   TLIYGFVKEENMSKAFGLVKKMEEKQGGLVPDVFTYNSILHGFCRQNQMKEAEVVLRKMI  690

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD  705
             E+ +EPD  T  +LING+    ++  A +  ++ML+ G  PD
Sbjct  691   ERGVEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQRGFSPD  732



>ref|XP_002281859.2| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Vitis vinifera]
 ref|XP_010664643.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Vitis vinifera]
 ref|XP_010664644.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Vitis vinifera]
 ref|XP_010664645.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Vitis vinifera]
Length=939

 Score =   263 bits (671),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 157/525 (30%), Positives = 276/525 (53%), Gaps = 11/525 (2%)
 Frame = -2

Query  1886  QLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTL--LTLSPCWFWLSWSFFKWVETIP  1713
             +LV  +C +VL    N +   K+    +  I++  L  L L+P     S  FF++V    
Sbjct  42    ELVSRICRLVLLRRCNAI--SKLNFVFSDDIVDAVLRNLRLNPTA---SLGFFQFVSKQQ  96

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIA--CKDFLSSPAVLNALVRSDDDSDVNS  1539
             N+R +++S   +++IL++ + +   +  L+Q+   CK       + + LV    +   + 
Sbjct  97    NFRPNVKSYCKLVHILSRGRMYDETRAYLNQLVDLCKFKDRGNVIWDELVGVYREFAFSP  156

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              VF  +L  Y     T +A+ VF+++  C   P   +C  LLN+LVK G T T    Y++
Sbjct  157   TVFDMILKVYVEKGLTKNALYVFDNMGKCGRIPSLRSCNSLLNNLVKNGETHTAHYVYQQ  216

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MI++G++P++ + +++++A CK G+V++A  F+ +ME  G+ P++ T+++LI+ Y   G 
Sbjct  217   MIRVGIVPDVFMVSIMVNAFCKDGKVDEAAGFVKKMENLGVEPNIVTYHSLINGYVSLGD  276

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VTPNEVTYT  1005
                A  V   M   GV  +++TY  LI  +C++ +M EA ++ + ++E+  + P+E  Y 
Sbjct  277   VEAAKGVLKFMSEKGVSRNVVTYTLLIKGYCKQCKMDEAEKVLRGMQEEAALVPDERAYG  336

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEK  825
              LIDGYCR G ID+A+RL   M   GL   +   NS++  +C+ G + E+  ++ +M + 
Sbjct  337   VLIDGYCRTGKIDDAVRLLDEMLRLGLKTNLFICNSLINGYCKRGEIHEAEGVITRMVDW  396

Query  824   KIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERA  645
              ++PD+ + NTL++GYC+ G    A  + +KML+ G+ P   TY  L+ G C+    + A
Sbjct  397   NLKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDA  456

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRR  465
              ++   M+  G +P    YS L+D      N E    L  +   RG+      +  +I  
Sbjct  457   LQIWHLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTMISG  516

Query  464   LCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAA  330
             LCK GK+  AE  F  M++     D + Y +L   Y K  N   A
Sbjct  517   LCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQA  561


 Score =   187 bits (476),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/352 (29%), Positives = 184/352 (52%), Gaps = 1/352 (0%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD  A  VL++   + G  D   +   +M++LG+  N+ I N LI+  CK GE+ +A+  
Sbjct  330   PDERAYGVLIDGYCRTGKIDDAVRLLDEMLRLGLKTNLFICNSLINGYCKRGEIHEAEGV  389

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
             ++ M    + PD Y++NTL+  YCR G   EA ++ D+M + G+EP ++TYN+L+   CR
Sbjct  390   ITRMVDWNLKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCR  449

Query  1082  EGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVAT  906
              G   +A++++   +K  V P+EV Y+TL+DG  ++ + + A  L   +  +G      T
Sbjct  450   VGAFDDALQIWHLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRIT  509

Query  905   YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
             +N+++   C+ G+M E+ ++ ++M +    PD +T  TLI+GYCK  ++  A KVK  M 
Sbjct  510   FNTMISGLCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAME  569

Query  725   EAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNE  546
                + P    Y +LI G  K++      +++ +M   G +P+   Y  L+D +C +   +
Sbjct  570   REPISPSIEMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLD  629

Query  545   ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
                    E +  G   +I     ++  L + G++D A      M +     D
Sbjct  630   KAFSSYFEMTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPD  681


 Score =   187 bits (475),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 130/470 (28%), Positives = 209/470 (44%), Gaps = 70/470 (15%)
 Frame = -2

Query  1487  DAIQVFEHLRICR-IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVL  1311
             DA+Q++ HL + R + PD    + LL+ L K    +     +K ++  G   +   +N +
Sbjct  455   DALQIW-HLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTM  513

Query  1310  IHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGV  1131
             I   CK G++ +A+E   +M+  G  PD  T+ TLI  YC+     +A  V+  MER  +
Sbjct  514   ISGLCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAMEREPI  573

Query  1130  EPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYC----------  984
              P I  YNSLI    +  R+ E   L  ++  + +TPN VTY  LIDG+C          
Sbjct  574   SPSIEMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFS  633

Query  983   -------------------------RVGDIDEALRLHSAMEEKG----------------  927
                                      R+G IDEA  L   M + G                
Sbjct  634   SYFEMTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSDIRYA  693

Query  926   ----------------LCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCN  795
                             L P    YN  +   C+ G++ ++ +  + +  K   PDN T  
Sbjct  694   AIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYC  753

Query  794   TLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAA  615
             TLI+GY   G++  A +++++ML  GL P+  TY ALI+G CK+++ +RA+ +   +   
Sbjct  754   TLIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQK  813

Query  614   GFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCA  435
             G  P+   Y+ L+D YC   N +A  KL D+    G    +  Y A+I  LCK G ++ +
Sbjct  814   GLFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEGISPSVVTYSALINGLCKHGDIERS  873

Query  434   ERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
              +    M +  +    + Y +L   Y + G  +    L+D M+ R L  T
Sbjct  874   MKLLNQMIKAGVDSKLIEYCTLVQGYIRSGEMQKIHKLYDMMHIRCLSTT  923


 Score =   184 bits (466),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 191/374 (51%), Gaps = 2/374 (1%)
 Frame = -2

Query  1424  TVLLNSLVKEGLTDTVWKTYKKMIKLGVL-PNIHIYNVLIHACCKSGEVEKADEFLSEME  1248
             T+L+    K+   D   K  + M +   L P+   Y VLI   C++G+++ A   L EM 
Sbjct  300   TLLIKGYCKQCKMDEAEKVLRGMQEEAALVPDERAYGVLIDGYCRTGKIDDAVRLLDEML  359

Query  1247  FKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMR  1068
               G+  +L+  N+LI+ YC+RG  +EA  V  RM    ++PD  +YN+L+  +CREG   
Sbjct  360   RLGLKTNLFICNSLINGYCKRGEIHEAEGVITRMVDWNLKPDSYSYNTLLDGYCREGHTS  419

Query  1067  EAMRLF-KDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSIL  891
             EA  L  K ++E + P  +TY TL+ G CRVG  D+AL++   M ++G+ P    Y+++L
Sbjct  420   EAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDALQIWHLMMKRGVAPDEVGYSTLL  479

Query  890   RKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLR  711
                 +    + ++ L   +  +      +T NT+I+G CK+G +V A ++ +KM + G  
Sbjct  480   DGLFKMENFEGASTLWKDILARGFTKSRITFNTMISGLCKMGKMVEAEEIFDKMKDLGCS  539

Query  710   PDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKL  531
             PD  TY+ LI G+CKA +  +A +V   M     SPS   Y+ L+           +  L
Sbjct  540   PDGITYRTLIDGYCKASNVGQAFKVKGAMEREPISPSIEMYNSLISGLFKSRRLVEVTDL  599

Query  530   ADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFK  351
               E   RG   +I  Y A+I   CK G LD A   +  M E  +  + ++ +++    ++
Sbjct  600   LTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFEMTENGLSANIIICSTMVSGLYR  659

Query  350   EGNTRAASDLFDEM  309
              G    A+ L  +M
Sbjct  660   LGRIDEANLLMQKM  673


 Score =   183 bits (465),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 105/343 (31%), Positives = 181/343 (53%), Gaps = 12/343 (3%)
 Frame = -2

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
             ++++ L+     S+R  +   +   + I  + P+      L++   KEG+ D  + +Y +
Sbjct  578   EMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFE  637

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             M + G+  NI I + ++    + G +++A+  + +M   G FPD   F        +  +
Sbjct  638   MTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECF-------LKSDI  690

Query  1178  HYEALS-VQDRME---RGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEV  1014
              Y A+  + D ++   +  + P+ I YN  I   C+ G++ +A R F  +  K   P+  
Sbjct  691   RYAAIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNF  750

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             TY TLI GY   G++DEA RL   M  +GL P + TYN+++   C+   +  + +L +++
Sbjct  751   TYCTLIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKL  810

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
              +K + P+ VT NTLI+GYCKIG++ +A K+K+KM+E G+ P   TY ALI+G CK  D 
Sbjct  811   HQKGLFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEGISPSVVTYSALINGLCKHGDI  870

Query  653   ERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLAD  525
             ER+ +++  MI AG       Y  LV  Y      + + KL D
Sbjct  871   ERSMKLLNQMIKAGVDSKLIEYCTLVQGYIRSGEMQKIHKLYD  913


 Score =   169 bits (428),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/448 (26%), Positives = 193/448 (43%), Gaps = 68/448 (15%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             +KPD ++   LL+   +EG T   +    KM++ G+ P +  YN L+   C+ G  + A 
Sbjct  398   LKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDAL  457

Query  1268  EFLSEMEFKGIFPD-----------------------------------LYTFNTLISLY  1194
             +    M  +G+ PD                                     TFNT+IS  
Sbjct  458   QIWHLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTMISGL  517

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNE  1017
             C+ G   EA  + D+M+  G  PD ITY +LI  +C+   + +A ++   + +E ++P+ 
Sbjct  518   CKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAMEREPISPSI  577

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
               Y +LI G  +   + E   L + M  +GL P + TY +++  +C+EG + ++     +
Sbjct  578   EMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFE  637

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD----------------  705
             M E  +  + + C+T+++G  ++G I  A  +  KM++ G  PD                
Sbjct  638   MTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSDIRYAAIQK  697

Query  704   ----------------SFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
                             +  Y   I G CK    + A+     +   GF P    Y  L+ 
Sbjct  698   IADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYCTLIH  757

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILG  393
              Y    N +   +L DE   RG   +I  Y A+I  LCK   +D A+R F  + ++ +  
Sbjct  758   GYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQKGLFP  817

Query  392   DSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             + V Y +L   Y K GN  AA  L D+M
Sbjct  818   NVVTYNTLIDGYCKIGNMDAAFKLKDKM  845


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 102/414 (25%), Positives = 180/414 (43%), Gaps = 56/414 (14%)
 Frame = -2

Query  1337  PNIHIYNVLIHACCKSGEVEKADEFLSEM---------------EFKGIFPDLY----TF  1215
             PN+  Y  L+H   +    ++   +L+++               E  G++ +       F
Sbjct  100   PNVKSYCKLVHILSRGRMYDETRAYLNQLVDLCKFKDRGNVIWDELVGVYREFAFSPTVF  159

Query  1214  NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             + ++ +Y  +G+   AL V D M + G  P + + NSL+++  + G    A  +++    
Sbjct  160   DMILKVYVEKGLTKNALYVFDNMGKCGRIPSLRSCNSLLNNLVKNGETHTAHYVYQQ---  216

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
                                            M   G+ P V   + ++  FC++G++ E+
Sbjct  217   -------------------------------MIRVGIVPDVFMVSIMVNAFCKDGKVDEA  245

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
                + +M    +EP+ VT ++LINGY  +GD+ +A  V   M E G+  +  TY  LI G
Sbjct  246   AGFVKKMENLGVEPNIVTYHSLINGYVSLGDVEAAKGVLKFMSEKGVSRNVVTYTLLIKG  305

Query  674   FCKAKDTERAKEVIFDMIA-AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCV  498
             +CK    + A++V+  M   A   P   AY  L+D YC     +  V+L DE    G   
Sbjct  306   YCKQCKMDEAEKVLRGMQEEAALVPDERAYGVLIDGYCRTGKIDDAVRLLDEMLRLGLKT  365

Query  497   DISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLF  318
             ++    ++I   CKRG++  AE     M +  +  DS  Y +L   Y +EG+T  A +L 
Sbjct  366   NLFICNSLINGYCKRGEIHEAEGVITRMVDWNLKPDSYSYNTLLDGYCREGHTSEAFNLC  425

Query  317   DEMYKRRLMVTlklykslsassKDENSLLDLF--WNNVMQRGLISHNVHNSIFL  162
             D+M +  +  T+  Y +L        +  D    W+ +M+RG+    V  S  L
Sbjct  426   DKMLQEGIEPTVLTYNTLLKGLCRVGAFDDALQIWHLMMKRGVAPDEVGYSTLL  479


 Score =   121 bits (303),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 114/218 (52%), Gaps = 1/218 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N+ V++  +     + +  DA + F  L +    PD      L++     G  D  ++  
Sbjct  713   NNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYCTLIHGYSAAGNVDEAFRLR  772

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M++ G++PNI  YN LI+  CKS  V++A     ++  KG+FP++ T+NTLI  YC+ 
Sbjct  773   DEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQKGLFPNVVTYNTLIDGYCKI  832

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTY  1008
             G    A  ++D+M   G+ P ++TY++LI+  C+ G +  +M+L    IK  V    + Y
Sbjct  833   GNMDAAFKLKDKMIEEGISPSVVTYSALINGLCKHGDIERSMKLLNQMIKAGVDSKLIEY  892

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSI  894
              TL+ GY R G++ +  +L+  M  + L     ++  +
Sbjct  893   CTLVQGYIRSGEMQKIHKLYDMMHIRCLSTTAISHKQV  930



>ref|XP_006303935.1| hypothetical protein CARUB_v10008618mg [Capsella rubella]
 gb|EOA36833.1| hypothetical protein CARUB_v10008618mg [Capsella rubella]
Length=607

 Score =   256 bits (655),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 253/498 (51%), Gaps = 6/498 (1%)
 Frame = -2

Query  1826  PKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHF  1647
             P + +     +IN   L+L     +   +FFK++ + P +  + +S ++M   L  HK F
Sbjct  78    PSLSVRHVVDLINRNPLSLPHRSIF---AFFKFISSQPGFGFTAESYFAMARFLAAHKMF  134

Query  1646  KSAKDMLHQIAC-KDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVF  1470
               A+ ++  +   K   S+ +V  ALV        N  V   L+I Y       DAIQ F
Sbjct  135   AEAQSLIELVVSRKGKNSASSVFVALVAMRGSPMFNFLV-DALMITYTEQGFIPDAIQSF  193

Query  1469  EHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKS  1290
                R  +       C  LL+ ++K   T TVW  Y +++  G   N++++N+L++  CK 
Sbjct  194   RLSRKHKFVVPVRGCGNLLDRMMKLNPTGTVWGFYMEILDAGFPLNVYVFNILMNRFCKE  253

Query  1289  GEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
             G++  A     E+  +G+ P + +FNTLI+ YC+ G   E   ++  ME+    PD+ TY
Sbjct  254   GKISGAQMVFDEIAKRGLKPSVVSFNTLINGYCKMGNSDEGFRLKHNMEKSRARPDVFTY  313

Query  1109  NSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEE  933
             ++LI+S C+E +M  A  LF ++ E+ + PN+V +TTLI G+ R G ID     +  M  
Sbjct  314   SALINSLCKESKMDRAHELFDEMCERGLIPNDVIFTTLIHGHSRSGQIDLMKESYEKMLG  373

Query  932   KGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVS  753
             +GL P +  YN+++  FC+ G +  + K+++ M    + PD +T  TLI+G+C+ GD+ +
Sbjct  374   RGLQPDIVLYNTLVNGFCKNGDLVAARKIVDGMIRGGMRPDKITYTTLIDGFCRGGDVET  433

Query  752   ALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
             AL+++ +M + G+  D   + ALI G CK      A+  + +M+ AG  P    Y+ ++D
Sbjct  434   ALQIRKEMDQNGIELDRVGFSALICGMCKEGRVVDAERALREMLRAGMKPDDVTYTMMMD  493

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILG  393
              +C + + +   KL  E    G+   +  Y  ++  LCK G++  A+     M     + 
Sbjct  494   AFCKKGDVQTGFKLLKEMQSDGHIPSVVTYNVLLNGLCKLGQMKNADMLLDAMLNIGAVP  553

Query  392   DSVVYTSLAYAYFKEGNT  339
             D + Y  L   + +  N 
Sbjct  554   DDITYNILLEGHHRHANA  571


 Score =   168 bits (425),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 152/278 (55%), Gaps = 1/278 (0%)
 Frame = -2

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G   ++  +N L++  C+EG++  A  +F +I K  + P+ V++ TLI+GYC++G+ DE
Sbjct  234   AGFPLNVYVFNILMNRFCKEGKISGAQMVFDEIAKRGLKPSVVSFNTLINGYCKMGNSDE  293

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
               RL   ME+    P V TY++++   C+E +M  + +L ++M E+ + P++V   TLI+
Sbjct  294   GFRLKHNMEKSRARPDVFTYSALINSLCKESKMDRAHELFDEMCERGLIPNDVIFTTLIH  353

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             G+ + G I    +   KML  GL+PD   Y  L++GFCK  D   A++++  MI  G  P
Sbjct  354   GHSRSGQIDLMKESYEKMLGRGLQPDIVLYNTLVNGFCKNGDLVAARKIVDGMIRGGMRP  413

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
                 Y+ L+D +C   + E  +++  E    G  +D   + A+I  +CK G++  AER  
Sbjct  414   DKITYTTLIDGFCRGGDVETALQIRKEMDQNGIELDRVGFSALICGMCKEGRVVDAERAL  473

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
               M    +  D V YT +  A+ K+G+ +    L  EM
Sbjct  474   REMLRAGMKPDDVTYTMMMDAFCKKGDVQTGFKLLKEM  511


 Score =   117 bits (294),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 132/268 (49%), Gaps = 1/268 (0%)
 Frame = -2

Query  1109  NSLIHSHCREGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEE  933
             ++L+ ++  +G + +A++ F+   K K          L+D   ++         +  + +
Sbjct  174   DALMITYTEQGFIPDAIQSFRLSRKHKFVVPVRGCGNLLDRMMKLNPTGTVWGFYMEILD  233

Query  932   KGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVS  753
              G    V  +N ++ +FC+EG++  +  + +++ ++ ++P  V+ NTLINGYCK+G+   
Sbjct  234   AGFPLNVYVFNILMNRFCKEGKISGAQMVFDEIAKRGLKPSVVSFNTLINGYCKMGNSDE  293

Query  752   ALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
               ++K+ M ++  RPD FTY ALI+  CK    +RA E+  +M   G  P+   ++ L+ 
Sbjct  294   GFRLKHNMEKSRARPDVFTYSALINSLCKESKMDRAHELFDEMCERGLIPNDVIFTTLIH  353

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILG  393
              +      + + +  ++  GRG   DI  Y  ++   CK G L  A +    M    +  
Sbjct  354   GHSRSGQIDLMKESYEKMLGRGLQPDIVLYNTLVNGFCKNGDLVAARKIVDGMIRGGMRP  413

Query  392   DSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             D + YT+L   + + G+   A  +  EM
Sbjct  414   DKITYTTLIDGFCRGGDVETALQIRKEM  441


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 97/204 (48%), Gaps = 2/204 (1%)
 Frame = -2

Query  902  NSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLE  723
            ++++  + E+G + ++ +      + K       C  L++   K+    +      ++L+
Sbjct  174  DALMITYTEQGFIPDAIQSFRLSRKHKFVVPVRGCGNLLDRMMKLNPTGTVWGFYMEILD  233

Query  722  AGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAA-GFSPSYCAYSWLVDTYCLQNNNE  546
            AG   + + +  L++ FCK      A +++FD IA  G  PS  +++ L++ YC   N++
Sbjct  234  AGFPLNVYVFNILMNRFCKEGKISGA-QMVFDEIAKRGLKPSVVSFNTLINGYCKMGNSD  292

Query  545  ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLA  366
               +L           D+  Y A+I  LCK  K+D A   F  M ER ++ + V++T+L 
Sbjct  293  EGFRLKHNMEKSRARPDVFTYSALINSLCKESKMDRAHELFDEMCERGLIPNDVIFTTLI  352

Query  365  YAYFKEGNTRAASDLFDEMYKRRL  294
            + + + G      + +++M  R L
Sbjct  353  HGHSRSGQIDLMKESYEKMLGRGL  376



>emb|CAN66818.1| hypothetical protein VITISV_004776 [Vitis vinifera]
Length=1037

 Score =   263 bits (673),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 157/525 (30%), Positives = 276/525 (53%), Gaps = 11/525 (2%)
 Frame = -2

Query  1886  QLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTL--LTLSPCWFWLSWSFFKWVETIP  1713
             +LV  +C +VL    N +   K+    +  I++  L  L L+P     S  FF++V    
Sbjct  42    ELVSRICRLVLLRRCNAI--SKLNFVFSDDIVDAVLRNLRLNPT---ASLGFFQFVSKQQ  96

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIA--CKDFLSSPAVLNALVRSDDDSDVNS  1539
             N+R +++S   +++IL++ + +   +  L+Q+   CK       + + LV    +   + 
Sbjct  97    NFRPNVKSYCKLVHILSRGRMYDETRAYLNQLVDLCKFKDRGNVIWDELVGVYREFAFSP  156

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              VF  +L  Y     T +A+ VF+++  C   P   +C  LLN+LVK G T T    Y++
Sbjct  157   TVFDMILKVYVEKGLTKNALYVFDNMGKCGRIPSLRSCNSLLNNLVKNGETHTAHYVYQQ  216

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MI++G++P++ + +++++A CK G+V++A  F+ +ME  G+ P++ T+++LI+ Y   G 
Sbjct  217   MIRVGIVPDVFMVSIMVNAFCKDGKVDEAAGFVKKMENLGVEPNIVTYHSLINGYVSLGD  276

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VTPNEVTYT  1005
                A  V   M   GV  +++TY  LI  +C++ +M EA ++ + ++E+  + P+E  Y 
Sbjct  277   VEAAKGVLKFMSEKGVSRNVVTYTLLIKGYCKQCKMDEAEKVLRGMQEEAALVPDERAYG  336

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEK  825
              LIDGYCR G ID+A+RL   M   GL   +   NS++  +C+ G + E+  ++ +M + 
Sbjct  337   VLIDGYCRTGKIDDAVRLLDEMLRLGLKTNLFICNSLINGYCKRGEIHEAEGVITRMVDW  396

Query  824   KIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERA  645
              ++PD+ + NTL++GYC+ G    A  + +KML+ G+ P   TY  L+ G C+    + A
Sbjct  397   NLKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDA  456

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRR  465
              ++   M+  G +P    YS L+D      N E    L  +   RG+      +  +I  
Sbjct  457   LQIWHLMMKXGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTMISG  516

Query  464   LCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAA  330
             LCK GK+  AE  F  M++     D + Y +L   Y K  N   A
Sbjct  517   LCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQA  561


 Score =   197 bits (502),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 133/452 (29%), Positives = 217/452 (48%), Gaps = 68/452 (15%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD  A  VL++   + G  D   +   +M++LG+  N+ I N LI+  CK GE+ +A+  
Sbjct  330   PDERAYGVLIDGYCRTGKIDDAVRLLDEMLRLGLKTNLFICNSLINGYCKRGEIHEAEGV  389

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
             ++ M    + PD Y++NTL+  YCR G   EA ++ D+M + G+EP ++TYN+L+   CR
Sbjct  390   ITRMVDWNLKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCR  449

Query  1082  EGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVAT  906
              G   +A++++   +K  V P+EV Y+TL+DG  ++ + + A  L   +  +G      T
Sbjct  450   VGAFDDALQIWHLMMKXGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRIT  509

Query  905   YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKM-  729
             +N+++   C+ G+M E+ ++ ++M +    PD +T  TLI+GYCK  ++  A KVK  M 
Sbjct  510   FNTMISGLCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAME  569

Query  728   -------------------------------LEAGLR---PDSFTYKALIHGFCKAKDTE  651
                                             E G+R   P+  TY ALI G+CK    +
Sbjct  570   REXISPSIEMYNSLISGLFKSRRLVEXTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLD  629

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLV--------------------------DTYCLQNNN  549
             +A    F+M   G S +    S +V                          D  C   ++
Sbjct  630   KAFSSYFEMTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSD  689

Query  548   ---EALVKLADEF--SGRGYCVDISF-YRAIIRRLCKRGKLDCAERFFGMMQEREILGDS  387
                 A+ K+AD    S + + +  +  Y   I  LCK GK+D A RFF M+  +  + D+
Sbjct  690   IRYAAIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDN  749

Query  386   VVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
               Y +L + Y   GN   A  L DEM +R L+
Sbjct  750   FTYCTLIHGYSAAGNVDEAFRLRDEMLRRGLV  781


 Score =   183 bits (464),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 189/374 (51%), Gaps = 2/374 (1%)
 Frame = -2

Query  1424  TVLLNSLVKEGLTDTVWKTYKKMIKLGVL-PNIHIYNVLIHACCKSGEVEKADEFLSEME  1248
             T+L+    K+   D   K  + M +   L P+   Y VLI   C++G+++ A   L EM 
Sbjct  300   TLLIKGYCKQCKMDEAEKVLRGMQEEAALVPDERAYGVLIDGYCRTGKIDDAVRLLDEML  359

Query  1247  FKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMR  1068
               G+  +L+  N+LI+ YC+RG  +EA  V  RM    ++PD  +YN+L+  +CREG   
Sbjct  360   RLGLKTNLFICNSLINGYCKRGEIHEAEGVITRMVDWNLKPDSYSYNTLLDGYCREGHTS  419

Query  1067  EAMRLF-KDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSIL  891
             EA  L  K ++E + P  +TY TL+ G CRVG  D+AL++   M + G+ P    Y+++L
Sbjct  420   EAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDALQIWHLMMKXGVAPDEVGYSTLL  479

Query  890   RKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLR  711
                 +    + ++ L   +  +      +T NT+I+G CK+G +V A ++ +KM + G  
Sbjct  480   DGLFKMENFEGASTLWKDILARGFTKSRITFNTMISGLCKMGKMVEAEEIFDKMKDLGCS  539

Query  710   PDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKL  531
             PD  TY+ LI G+CKA +  +A +V   M     SPS   Y+ L+              L
Sbjct  540   PDGITYRTLIDGYCKASNVGQAFKVKGAMEREXISPSIEMYNSLISGLFKSRRLVEXTDL  599

Query  530   ADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFK  351
               E   RG   +I  Y A+I   CK G LD A   +  M E  +  + ++ +++    ++
Sbjct  600   LTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFEMTENGLSANIIICSTMVSGLYR  659

Query  350   EGNTRAASDLFDEM  309
              G    A+ L  +M
Sbjct  660   LGRIDEANLLMQKM  673


 Score =   179 bits (455),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/455 (27%), Positives = 198/455 (44%), Gaps = 68/455 (15%)
 Frame = -2

Query  1487  DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLI  1308
             DA+Q++  +    + PD    + LL+ L K    +     +K ++  G   +   +N +I
Sbjct  455   DALQIWHLMMKXGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTMI  514

Query  1307  HACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVE  1128
                CK G++ +A+E   +M+  G  PD  T+ TLI  YC+     +A  V+  MER  + 
Sbjct  515   SGLCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAMEREXIS  574

Query  1127  PDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYC-----------  984
             P I  YNSLI    +  R+ E   L  ++  + +TPN VTY  LIDG+C           
Sbjct  575   PSIEMYNSLISGLFKSRRLVEXTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSS  634

Query  983   ------------------------RVGDIDEALRLHSAMEEKG-----------------  927
                                     R+G IDEA  L   M + G                 
Sbjct  635   YFEMTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSDIRYAA  694

Query  926   ---------------LCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNT  792
                            L P    YN  +   C+ G++ ++ +  + +  K   PDN T  T
Sbjct  695   IQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYCT  754

Query  791   LINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAG  612
             LI+GY   G++  A +++++ML  GL P+  TY ALI+G CK+++ +RA+ +   +   G
Sbjct  755   LIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQKG  814

Query  611   FSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAE  432
               P+   Y+ L+D YC   N +A  KL D+    G    +  Y A+I  LCK G ++ + 
Sbjct  815   LFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEGISPSVVTYSALINGLCKHGDIERSM  874

Query  431   RFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAAS  327
             +    M +  +    + Y +L    FK  N    S
Sbjct  875   KLLNQMIKAGVDSKLIEYCTLVQGGFKTSNYNEMS  909


 Score =   178 bits (452),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/326 (31%), Positives = 175/326 (54%), Gaps = 12/326 (4%)
 Frame = -2

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
             ++++ L+     S+R  +   +   + I  + P+      L++   KEG+ D  + +Y +
Sbjct  578   EMYNSLISGLFKSRRLVEXTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFE  637

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             M + G+  NI I + ++    + G +++A+  + +M   G FPD   F        +  +
Sbjct  638   MTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECF-------LKSDI  690

Query  1178  HYEALS-VQDRME---RGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEV  1014
              Y A+  + D ++   +  + P+ I YN  I   C+ G++ +A R F  +  K   P+  
Sbjct  691   RYAAIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNF  750

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             TY TLI GY   G++DEA RL   M  +GL P + TYN+++   C+   +  + +L +++
Sbjct  751   TYCTLIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKL  810

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
              +K + P+ VT NTLI+GYCKIG++ +A K+K+KM+E G+ P   TY ALI+G CK  D 
Sbjct  811   HQKGLFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEGISPSVVTYSALINGLCKHGDI  870

Query  653   ERAKEVIFDMIAAGFSPSYCAYSWLV  576
             ER+ +++  MI AG       Y  LV
Sbjct  871   ERSMKLLNQMIKAGVDSKLIEYCTLV  896


 Score =   168 bits (426),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 115/448 (26%), Positives = 192/448 (43%), Gaps = 68/448 (15%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             +KPD ++   LL+   +EG T   +    KM++ G+ P +  YN L+   C+ G  + A 
Sbjct  398   LKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDAL  457

Query  1268  EFLSEMEFKGIFPD-----------------------------------LYTFNTLISLY  1194
             +    M   G+ PD                                     TFNT+IS  
Sbjct  458   QIWHLMMKXGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTMISGL  517

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNE  1017
             C+ G   EA  + D+M+  G  PD ITY +LI  +C+   + +A ++   + +E ++P+ 
Sbjct  518   CKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAMEREXISPSI  577

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
               Y +LI G  +   + E   L + M  +GL P + TY +++  +C+EG + ++     +
Sbjct  578   EMYNSLISGLFKSRRLVEXTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFE  637

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD----------------  705
             M E  +  + + C+T+++G  ++G I  A  +  KM++ G  PD                
Sbjct  638   MTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSDIRYAAIQK  697

Query  704   ----------------SFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
                             +  Y   I G CK    + A+     +   GF P    Y  L+ 
Sbjct  698   IADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYCTLIH  757

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILG  393
              Y    N +   +L DE   RG   +I  Y A+I  LCK   +D A+R F  + ++ +  
Sbjct  758   GYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQKGLFP  817

Query  392   DSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             + V Y +L   Y K GN  AA  L D+M
Sbjct  818   NVVTYNTLIDGYCKIGNMDAAFKLKDKM  845


 Score =   122 bits (306),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 92/371 (25%), Positives = 163/371 (44%), Gaps = 54/371 (15%)
 Frame = -2

Query  1337  PNIHIYNVLIHACCKSGEVEKADEFLSEM---------------EFKGIFPDLY----TF  1215
             PN+  Y  L+H   +    ++   +L+++               E  G++ +       F
Sbjct  100   PNVKSYCKLVHILSRGRMYDETRAYLNQLVDLCKFKDRGNVIWDELVGVYREFAFSPTVF  159

Query  1214  NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             + ++ +Y  +G+   AL V D M + G  P + + NSL+++  + G    A  +++    
Sbjct  160   DMILKVYVEKGLTKNALYVFDNMGKCGRIPSLRSCNSLLNNLVKNGETHTAHYVYQQ---  216

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
                                            M   G+ P V   + ++  FC++G++ E+
Sbjct  217   -------------------------------MIRVGIVPDVFMVSIMVNAFCKDGKVDEA  245

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
                + +M    +EP+ VT ++LINGY  +GD+ +A  V   M E G+  +  TY  LI G
Sbjct  246   AGFVKKMENLGVEPNIVTYHSLINGYVSLGDVEAAKGVLKFMSEKGVSRNVVTYTLLIKG  305

Query  674   FCKAKDTERAKEVIFDMIA-AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCV  498
             +CK    + A++V+  M   A   P   AY  L+D YC     +  V+L DE    G   
Sbjct  306   YCKQCKMDEAEKVLRGMQEEAALVPDERAYGVLIDGYCRTGKIDDAVRLLDEMLRLGLKT  365

Query  497   DISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLF  318
             ++    ++I   CKRG++  AE     M +  +  DS  Y +L   Y +EG+T  A +L 
Sbjct  366   NLFICNSLINGYCKRGEIHEAEGVITRMVDWNLKPDSYSYNTLLDGYCREGHTSEAFNLC  425

Query  317   DEMYKRRLMVT  285
             D+M +  +  T
Sbjct  426   DKMLQEGIEPT  436


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 120/251 (48%), Gaps = 46/251 (18%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD H C   L S ++      +  +  +  K  +LPN  +YN+ I   CK+G+V+ A  F
Sbjct  680   PD-HEC--FLKSDIRYAAIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRF  736

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
              S +  KG  PD +T+ TLI  Y   G   EA  ++D M R G+ P+I+TYN+LI+  C+
Sbjct  737   FSMLSLKGFVPDNFTYCTLIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCK  796

Query  1082  EGRMREAMRLF------------------------------------KDIKEKVTPNEVT  1011
                +  A RLF                                    K I+E ++P+ VT
Sbjct  797   SENVDRAQRLFHKLHQKGLFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEGISPSVVT  856

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             Y+ LI+G C+ GDI+ +++L + M + G+  ++  Y +++     +G  K S    N+M 
Sbjct  857   YSALINGLCKHGDIERSMKLLNQMIKAGVDSKLIEYCTLV-----QGGFKTSN--YNEMS  909

Query  830   EKKIEPDNVTC  798
             + +    N+ C
Sbjct  910   KPEALKQNMNC  920



>ref|XP_007015298.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007015299.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007015300.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY32917.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY32918.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY32919.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=727

 Score =   259 bits (661),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/469 (30%), Positives = 246/469 (52%), Gaps = 1/469 (0%)
 Frame = -2

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             N++HS  S  +MI++L K +    A+ ++ ++  K  +S   ++ +LV +  +   N  V
Sbjct  108   NFKHSSMSLSAMIHVLVKCRRLSDAQALILRMVRKSGVSRVEIVESLVSTRGNFGSNYSV  167

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             F  L+  Y  +++  +  +VF  LR        +AC  LL  LVK G     W  Y++++
Sbjct  168   FDLLIRTYVQARKLREGSEVFRILRRKSFCISINACNSLLGGLVKIGWVALAWDVYREVV  227

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + GV  N +  N++++A CK  ++     FLSEME KG+  D+ T+NT+I+ YC  G   
Sbjct  228   RAGVEVNAYTLNIMVNALCKDSKISSVKSFLSEMEEKGVHADIVTYNTIINAYCHEGHVE  287

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLI  996
             EA  + + M   G++P + TYN++++  C+ G   +A     ++    ++P+  TY TL+
Sbjct  288   EAFKLMNSMSDKGLKPGLFTYNAIVYGLCKRGNFEKAKEALDEMLHIGLSPDTATYNTLL  347

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
                CR  +I E   + S M  +G  P + +++S++  F   G + ++    N M    + 
Sbjct  348   VESCRKNNISEVEDIFSEMLHRGFVPDLISFSSLIGVFSRNGHLDQALMYFNNMKRAGLV  407

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PDNV    LI+GYC+ G +  ALK++N+MLE G   D  TY A+++G C+ K    A  +
Sbjct  408   PDNVIYTILIDGYCRNGIMSEALKMRNEMLEQGCSMDVVTYNAILNGLCREKMLTEADNL  467

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCK  456
             + +M   G  P +  ++ L+  +C   N +  + L DE + R    DI  Y  +I   CK
Sbjct  468   LHEMAERGVFPDFYTFTTLIHGHCKDGNMKKALSLFDEMTQRNSKPDIVTYNTLIDGFCK  527

Query  455   RGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              G+++ A++ +  M  R+IL + + Y +L   +   G+   A  ++DEM
Sbjct  528   VGEMEKAKQLWVGMISRKILPNHISYGTLINGFCSIGHVSEAFRVWDEM  576


 Score =   235 bits (600),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 128/377 (34%), Positives = 201/377 (53%), Gaps = 1/377 (0%)
 Frame = -2

Query  1418  LLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKG  1239
             ++N+   EG  +  +K    M   G+ P +  YN +++  CK G  EKA E L EM   G
Sbjct  276   IINAYCHEGHVEEAFKLMNSMSDKGLKPGLFTYNAIVYGLCKRGNFEKAKEALDEMLHIG  335

Query  1238  IFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAM  1059
             + PD  T+NTL+   CR+    E   +   M   G  PD+I+++SLI    R G + +A+
Sbjct  336   LSPDTATYNTLLVESCRKNNISEVEDIFSEMLHRGFVPDLISFSSLIGVFSRNGHLDQAL  395

Query  1058  RLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKF  882
               F ++K   + P+ V YT LIDGYCR G + EAL++ + M E+G    V TYN+IL   
Sbjct  396   MYFNNMKRAGLVPDNVIYTILIDGYCRNGIMSEALKMRNEMLEQGCSMDVVTYNAILNGL  455

Query  881   CEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
             C E  + E+  LL++M E+ + PD  T  TLI+G+CK G++  AL + ++M +   +PD 
Sbjct  456   CREKMLTEADNLLHEMAERGVFPDFYTFTTLIHGHCKDGNMKKALSLFDEMTQRNSKPDI  515

Query  701   FTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADE  522
              TY  LI GFCK  + E+AK++   MI+    P++ +Y  L++ +C   +     ++ DE
Sbjct  516   VTYNTLIDGFCKVGEMEKAKQLWVGMISRKILPNHISYGTLINGFCSIGHVSEAFRVWDE  575

Query  521   FSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGN  342
               G G    +    +II+  C+ G    A+ F   M    I+ DS+ Y +L   + KE N
Sbjct  576   MVGNGIKPTLVTCNSIIKGFCRSGDASRADEFLSKMTSEGIIPDSISYNTLINGFVKEEN  635

Query  341   TRAASDLFDEMYKRRLM  291
                A    +EM  + L+
Sbjct  636   MDKAFVWINEMENQGLL  652


 Score =   233 bits (593),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 141/508 (28%), Positives = 254/508 (50%), Gaps = 24/508 (5%)
 Frame = -2

Query  1760  WFWLSWSFFKWV--ETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACK----DFL  1599
             W  L+W  ++ V    +    ++L     M+  L K     S K  L ++  K    D +
Sbjct  215   WVALAWDVYREVVRAGVEVNAYTLNI---MVNALCKDSKISSVKSFLSEMEEKGVHADIV  271

Query  1598  SSPAVLNA------------LVRSDDDSDVNSQVFSWLLIFYANSKRT--WDAIQVFEHL  1461
             +   ++NA            L+ S  D  +   +F++  I Y   KR     A +  + +
Sbjct  272   TYNTIINAYCHEGHVEEAFKLMNSMSDKGLKPGLFTYNAIVYGLCKRGNFEKAKEALDEM  331

Query  1460  RICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEV  1281
                 + PD      LL    ++     V   + +M+  G +P++  ++ LI    ++G +
Sbjct  332   LHIGLSPDTATYNTLLVESCRKNNISEVEDIFSEMLHRGFVPDLISFSSLIGVFSRNGHL  391

Query  1280  EKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSL  1101
             ++A  + + M+  G+ PD   +  LI  YCR G+  EAL +++ M   G   D++TYN++
Sbjct  392   DQALMYFNNMKRAGLVPDNVIYTILIDGYCRNGIMSEALKMRNEMLEQGCSMDVVTYNAI  451

Query  1100  IHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
             ++  CRE  + EA  L  ++ E+ V P+  T+TTLI G+C+ G++ +AL L   M ++  
Sbjct  452   LNGLCREKMLTEADNLLHEMAERGVFPDFYTFTTLIHGHCKDGNMKKALSLFDEMTQRNS  511

Query  923   CPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALK  744
              P + TYN+++  FC+ G M+++ +L   M  +KI P++++  TLING+C IG +  A +
Sbjct  512   KPDIVTYNTLIDGFCKVGEMEKAKQLWVGMISRKILPNHISYGTLINGFCSIGHVSEAFR  571

Query  743   VKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYC  564
             V ++M+  G++P   T  ++I GFC++ D  RA E +  M + G  P   +Y+ L++ + 
Sbjct  572   VWDEMVGNGIKPTLVTCNSIIKGFCRSGDASRADEFLSKMTSEGIIPDSISYNTLINGFV  631

Query  563   LQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSV  384
              + N +      +E   +G   D+  Y  I+   C++G++  AE     M E+ I  D  
Sbjct  632   KEENMDKAFVWINEMENQGLLPDVITYNVILNGFCRQGRMQEAEMVLRKMIEKGIDPDRS  691

Query  383   VYTSLAYAYFKEGNTRAASDLFDEMYKR  300
              YTSL   +  + N +AA    DEM +R
Sbjct  692   TYTSLINGHVTQDNLKAAFQFHDEMVQR  719


 Score =   232 bits (591),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 222/418 (53%), Gaps = 19/418 (5%)
 Frame = -2

Query  1682  SMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALV----RSDDDS---DVNSQV---  1533
             +++Y L K  +F+ AK+ L ++         A  N L+    R ++ S   D+ S++   
Sbjct  310   AIVYGLCKRGNFEKAKEALDEMLHIGLSPDTATYNTLLVESCRKNNISEVEDIFSEMLHR  369

Query  1532  --------FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTV  1377
                     FS L+  ++ +     A+  F +++   + PD    T+L++   + G+    
Sbjct  370   GFVPDLISFSSLIGVFSRNGHLDQALMYFNNMKRAGLVPDNVIYTILIDGYCRNGIMSEA  429

Query  1376  WKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL  1197
              K   +M++ G   ++  YN +++  C+   + +AD  L EM  +G+FPD YTF TLI  
Sbjct  430   LKMRNEMLEQGCSMDVVTYNAILNGLCREKMLTEADNLLHEMAERGVFPDFYTFTTLIHG  489

Query  1196  YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPN  1020
             +C+ G   +ALS+ D M +   +PDI+TYN+LI   C+ G M +A +L+   I  K+ PN
Sbjct  490   HCKDGNMKKALSLFDEMTQRNSKPDIVTYNTLIDGFCKVGEMEKAKQLWVGMISRKILPN  549

Query  1019  EVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLN  840
              ++Y TLI+G+C +G + EA R+   M   G+ P + T NSI++ FC  G    + + L+
Sbjct  550   HISYGTLINGFCSIGHVSEAFRVWDEMVGNGIKPTLVTCNSIIKGFCRSGDASRADEFLS  609

Query  839   QMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAK  660
             +M  + I PD+++ NTLING+ K  ++  A    N+M   GL PD  TY  +++GFC+  
Sbjct  610   KMTSEGIIPDSISYNTLINGFVKEENMDKAFVWINEMENQGLLPDVITYNVILNGFCRQG  669

Query  659   DTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
               + A+ V+  MI  G  P    Y+ L++ +  Q+N +A  +  DE   RG+  D  F
Sbjct  670   RMQEAEMVLRKMIEKGIDPDRSTYTSLINGHVTQDNLKAAFQFHDEMVQRGFVPDDQF  727


 Score =   142 bits (358),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/369 (27%), Positives = 167/369 (45%), Gaps = 38/369 (10%)
 Frame = -2

Query  1295  KSGEVEKADEFLSEMEFKGIFPDLYT-FNTLISLYCRRGMHYEALSVQDRMERGGVEPDI  1119
             KSG V + +   S +  +G F   Y+ F+ LI  Y +     E   V   + R      I
Sbjct  142   KSG-VSRVEIVESLVSTRGNFGSNYSVFDLLIRTYVQARKLREGSEVFRILRRKSFCISI  200

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
                NSL+    + G +  A  +++++ +  V  N  T   +++  C+   I       S 
Sbjct  201   NACNSLLGGLVKIGWVALAWDVYREVVRAGVEVNAYTLNIMVNALCKDSKISSVKSFLSE  260

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             MEEKG+   + TYN+I+  +C EG ++E+ KL+N M +K ++P   T N ++ G CK G+
Sbjct  261   MEEKGVHADIVTYNTIINAYCHEGHVEEAFKLMNSMSDKGLKPGLFTYNAIVYGLCKRGN  320

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCA---  591
                A +  ++ML  GL PD+ TY  L+   C+  +    +++  +M+  GF P   +   
Sbjct  321   FEKAKEALDEMLHIGLSPDTATYNTLLVESCRKNNISEVEDIFSEMLHRGFVPDLISFSS  380

Query  590   --------------------------------YSWLVDTYCLQNNNEALVKLADEFSGRG  507
                                             Y+ L+D YC        +K+ +E   +G
Sbjct  381   LIGVFSRNGHLDQALMYFNNMKRAGLVPDNVIYTILIDGYCRNGIMSEALKMRNEMLEQG  440

Query  506   YCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAAS  327
               +D+  Y AI+  LC+   L  A+     M ER +  D   +T+L + + K+GN + A 
Sbjct  441   CSMDVVTYNAILNGLCREKMLTEADNLLHEMAERGVFPDFYTFTTLIHGHCKDGNMKKAL  500

Query  326   DLFDEMYKR  300
              LFDEM +R
Sbjct  501   SLFDEMTQR  509


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 115/253 (45%), Gaps = 4/253 (2%)
 Frame = -2

Query  911  ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
            + ++ ++R + +  +++E +++   +  K        CN+L+ G  KIG +  A  V  +
Sbjct  166  SVFDLLIRTYVQARKLREGSEVFRILRRKSFCISINACNSLLGGLVKIGWVALAWDVYRE  225

Query  731  MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
            ++ AG+  +++T   +++  CK       K  + +M   G       Y+ +++ YC + +
Sbjct  226  VVRAGVEVNAYTLNIMVNALCKDSKISSVKSFLSEMEEKGVHADIVTYNTIINAYCHEGH  285

Query  551  NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
             E   KL +  S +G    +  Y AI+  LCKRG  + A+     M    +  D+  Y +
Sbjct  286  VEEAFKLMNSMSDKGLKPGLFTYNAIVYGLCKRGNFEKAKEALDEMLHIGLSPDTATYNT  345

Query  371  LAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSLLD---LFWNNVMQR  201
            L     ++ N     D+F EM  R   V   +  S        N  LD   +++NN+ + 
Sbjct  346  LLVESCRKNNISEVEDIFSEMLHRGF-VPDLISFSSLIGVFSRNGHLDQALMYFNNMKRA  404

Query  200  GLISHNVHNSIFL  162
            GL+  NV  +I +
Sbjct  405  GLVPDNVIYTILI  417



>emb|CBI19634.3| unnamed protein product [Vitis vinifera]
Length=839

 Score =   261 bits (666),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 155/523 (30%), Positives = 274/523 (52%), Gaps = 11/523 (2%)
 Frame = -2

Query  1880  VKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTL--LTLSPCWFWLSWSFFKWVETIPNY  1707
             +  +C +VL    N +   K+    +  I++  L  L L+P     S  FF++V    N+
Sbjct  10    ISRICRLVLLRRCNAI--SKLNFVFSDDIVDAVLRNLRLNPTA---SLGFFQFVSKQQNF  64

Query  1706  RHSLQSSWSMIYILTKHKHFKSAKDMLHQIA--CKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             R +++S   +++IL++ + +   +  L+Q+   CK       + + LV    +   +  V
Sbjct  65    RPNVKSYCKLVHILSRGRMYDETRAYLNQLVDLCKFKDRGNVIWDELVGVYREFAFSPTV  124

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             F  +L  Y     T +A+ VF+++  C   P   +C  LLN+LVK G T T    Y++MI
Sbjct  125   FDMILKVYVEKGLTKNALYVFDNMGKCGRIPSLRSCNSLLNNLVKNGETHTAHYVYQQMI  184

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             ++G++P++ + +++++A CK G+V++A  F+ +ME  G+ P++ T+++LI+ Y   G   
Sbjct  185   RVGIVPDVFMVSIMVNAFCKDGKVDEAAGFVKKMENLGVEPNIVTYHSLINGYVSLGDVE  244

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VTPNEVTYTTL  999
              A  V   M   GV  +++TY  LI  +C++ +M EA ++ + ++E+  + P+E  Y  L
Sbjct  245   AAKGVLKFMSEKGVSRNVVTYTLLIKGYCKQCKMDEAEKVLRGMQEEAALVPDERAYGVL  304

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYCR G ID+A+RL   M   GL   +   NS++  +C+ G + E+  ++ +M +  +
Sbjct  305   IDGYCRTGKIDDAVRLLDEMLRLGLKTNLFICNSLINGYCKRGEIHEAEGVITRMVDWNL  364

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
             +PD+ + NTL++GYC+ G    A  + +KML+ G+ P   TY  L+ G C+    + A +
Sbjct  365   KPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDALQ  424

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             +   M+  G +P    YS L+D      N E    L  +   RG+      +  +I  LC
Sbjct  425   IWHLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTMISGLC  484

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAA  330
             K GK+  AE  F  M++     D + Y +L   Y K  N   A
Sbjct  485   KMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQA  527


 Score =   197 bits (502),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 133/452 (29%), Positives = 217/452 (48%), Gaps = 68/452 (15%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD  A  VL++   + G  D   +   +M++LG+  N+ I N LI+  CK GE+ +A+  
Sbjct  296   PDERAYGVLIDGYCRTGKIDDAVRLLDEMLRLGLKTNLFICNSLINGYCKRGEIHEAEGV  355

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
             ++ M    + PD Y++NTL+  YCR G   EA ++ D+M + G+EP ++TYN+L+   CR
Sbjct  356   ITRMVDWNLKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCR  415

Query  1082  EGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVAT  906
              G   +A++++   +K  V P+EV Y+TL+DG  ++ + + A  L   +  +G      T
Sbjct  416   VGAFDDALQIWHLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRIT  475

Query  905   YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKM-  729
             +N+++   C+ G+M E+ ++ ++M +    PD +T  TLI+GYCK  ++  A KVK  M 
Sbjct  476   FNTMISGLCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAME  535

Query  728   -------------------------------LEAGLR---PDSFTYKALIHGFCKAKDTE  651
                                             E G+R   P+  TY ALI G+CK    +
Sbjct  536   REPISPSIEMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLD  595

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLV--------------------------DTYCLQNNN  549
             +A    F+M   G S +    S +V                          D  C   ++
Sbjct  596   KAFSSYFEMTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSD  655

Query  548   ---EALVKLADEF--SGRGYCVDISF-YRAIIRRLCKRGKLDCAERFFGMMQEREILGDS  387
                 A+ K+AD    S + + +  +  Y   I  LCK GK+D A RFF M+  +  + D+
Sbjct  656   IRYAAIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDN  715

Query  386   VVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
               Y +L + Y   GN   A  L DEM +R L+
Sbjct  716   FTYCTLIHGYSAAGNVDEAFRLRDEMLRRGLV  747


 Score =   184 bits (467),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 191/374 (51%), Gaps = 2/374 (1%)
 Frame = -2

Query  1424  TVLLNSLVKEGLTDTVWKTYKKMIKLGVL-PNIHIYNVLIHACCKSGEVEKADEFLSEME  1248
             T+L+    K+   D   K  + M +   L P+   Y VLI   C++G+++ A   L EM 
Sbjct  266   TLLIKGYCKQCKMDEAEKVLRGMQEEAALVPDERAYGVLIDGYCRTGKIDDAVRLLDEML  325

Query  1247  FKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMR  1068
               G+  +L+  N+LI+ YC+RG  +EA  V  RM    ++PD  +YN+L+  +CREG   
Sbjct  326   RLGLKTNLFICNSLINGYCKRGEIHEAEGVITRMVDWNLKPDSYSYNTLLDGYCREGHTS  385

Query  1067  EAMRLF-KDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSIL  891
             EA  L  K ++E + P  +TY TL+ G CRVG  D+AL++   M ++G+ P    Y+++L
Sbjct  386   EAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDALQIWHLMMKRGVAPDEVGYSTLL  445

Query  890   RKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLR  711
                 +    + ++ L   +  +      +T NT+I+G CK+G +V A ++ +KM + G  
Sbjct  446   DGLFKMENFEGASTLWKDILARGFTKSRITFNTMISGLCKMGKMVEAEEIFDKMKDLGCS  505

Query  710   PDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKL  531
             PD  TY+ LI G+CKA +  +A +V   M     SPS   Y+ L+           +  L
Sbjct  506   PDGITYRTLIDGYCKASNVGQAFKVKGAMEREPISPSIEMYNSLISGLFKSRRLVEVTDL  565

Query  530   ADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFK  351
               E   RG   +I  Y A+I   CK G LD A   +  M E  +  + ++ +++    ++
Sbjct  566   LTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFEMTENGLSANIIICSTMVSGLYR  625

Query  350   EGNTRAASDLFDEM  309
              G    A+ L  +M
Sbjct  626   LGRIDEANLLMQKM  639


 Score =   169 bits (429),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/448 (26%), Positives = 193/448 (43%), Gaps = 68/448 (15%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             +KPD ++   LL+   +EG T   +    KM++ G+ P +  YN L+   C+ G  + A 
Sbjct  364   LKPDSYSYNTLLDGYCREGHTSEAFNLCDKMLQEGIEPTVLTYNTLLKGLCRVGAFDDAL  423

Query  1268  EFLSEMEFKGIFPD-----------------------------------LYTFNTLISLY  1194
             +    M  +G+ PD                                     TFNT+IS  
Sbjct  424   QIWHLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTMISGL  483

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNE  1017
             C+ G   EA  + D+M+  G  PD ITY +LI  +C+   + +A ++   + +E ++P+ 
Sbjct  484   CKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAMEREPISPSI  543

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
               Y +LI G  +   + E   L + M  +GL P + TY +++  +C+EG + ++     +
Sbjct  544   EMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFE  603

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD----------------  705
             M E  +  + + C+T+++G  ++G I  A  +  KM++ G  PD                
Sbjct  604   MTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSDIRYAAIQK  663

Query  704   ----------------SFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
                             +  Y   I G CK    + A+     +   GF P    Y  L+ 
Sbjct  664   IADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYCTLIH  723

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILG  393
              Y    N +   +L DE   RG   +I  Y A+I  LCK   +D A+R F  + ++ +  
Sbjct  724   GYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQKGLFP  783

Query  392   DSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             + V Y +L   Y K GN  AA  L D+M
Sbjct  784   NVVTYNTLIDGYCKIGNMDAAFKLKDKM  811


 Score =   160 bits (405),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 177/396 (45%), Gaps = 70/396 (18%)
 Frame = -2

Query  1487  DAIQVFEHLRICR-IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVL  1311
             DA+Q++ HL + R + PD    + LL+ L K    +     +K ++  G   +   +N +
Sbjct  421   DALQIW-HLMMKRGVAPDEVGYSTLLDGLFKMENFEGASTLWKDILARGFTKSRITFNTM  479

Query  1310  IHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGV  1131
             I   CK G++ +A+E   +M+  G  PD  T+ TLI  YC+     +A  V+  MER  +
Sbjct  480   ISGLCKMGKMVEAEEIFDKMKDLGCSPDGITYRTLIDGYCKASNVGQAFKVKGAMEREPI  539

Query  1130  EPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYC----------  984
              P I  YNSLI    +  R+ E   L  ++  + +TPN VTY  LIDG+C          
Sbjct  540   SPSIEMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFS  599

Query  983   -------------------------RVGDIDEALRLHSAMEEKG----------------  927
                                      R+G IDEA  L   M + G                
Sbjct  600   SYFEMTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECFLKSDIRYA  659

Query  926   ----------------LCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCN  795
                             L P    YN  +   C+ G++ ++ +  + +  K   PDN T  
Sbjct  660   AIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYC  719

Query  794   TLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAA  615
             TLI+GY   G++  A +++++ML  GL P+  TY ALI+G CK+++ +RA+ +   +   
Sbjct  720   TLIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQK  779

Query  614   GFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRG  507
             G  P+   Y+ L+D YC   N +A  KL D+    G
Sbjct  780   GLFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEG  815


 Score =   148 bits (373),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 152/282 (54%), Gaps = 12/282 (4%)
 Frame = -2

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
             ++++ L+     S+R  +   +   + I  + P+      L++   KEG+ D  + +Y +
Sbjct  544   EMYNSLISGLFKSRRLVEVTDLLTEMGIRGLTPNIVTYGALIDGWCKEGMLDKAFSSYFE  603

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             M + G+  NI I + ++    + G +++A+  + +M   G FPD   F        +  +
Sbjct  604   MTENGLSANIIICSTMVSGLYRLGRIDEANLLMQKMVDHGFFPDHECF-------LKSDI  656

Query  1178  HYEALS-VQDRME---RGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEV  1014
              Y A+  + D ++   +  + P+ I YN  I   C+ G++ +A R F  +  K   P+  
Sbjct  657   RYAAIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNF  716

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             TY TLI GY   G++DEA RL   M  +GL P + TYN+++   C+   +  + +L +++
Sbjct  717   TYCTLIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKL  776

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRP  708
              +K + P+ VT NTLI+GYCKIG++ +A K+K+KM+E G+ P
Sbjct  777   HQKGLFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEGISP  818


 Score =   130 bits (326),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 103/178 (58%), Gaps = 4/178 (2%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD H C   L S ++      +  +  +  K  +LPN  +YN+ I   CK+G+V+ A  F
Sbjct  646   PD-HEC--FLKSDIRYAAIQKIADSLDESCKTFLLPNNIVYNIAIAGLCKTGKVDDARRF  702

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
              S +  KG  PD +T+ TLI  Y   G   EA  ++D M R G+ P+I+TYN+LI+  C+
Sbjct  703   FSMLSLKGFVPDNFTYCTLIHGYSAAGNVDEAFRLRDEMLRRGLVPNIVTYNALINGLCK  762

Query  1082  EGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
                +  A RLF  + +K + PN VTY TLIDGYC++G++D A +L   M E+G+ P +
Sbjct  763   SENVDRAQRLFHKLHQKGLFPNVVTYNTLIDGYCKIGNMDAAFKLKDKMIEEGISPSI  820


 Score =   124 bits (311),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 102/414 (25%), Positives = 180/414 (43%), Gaps = 56/414 (14%)
 Frame = -2

Query  1337  PNIHIYNVLIHACCKSGEVEKADEFLSEM---------------EFKGIFPDLY----TF  1215
             PN+  Y  L+H   +    ++   +L+++               E  G++ +       F
Sbjct  66    PNVKSYCKLVHILSRGRMYDETRAYLNQLVDLCKFKDRGNVIWDELVGVYREFAFSPTVF  125

Query  1214  NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             + ++ +Y  +G+   AL V D M + G  P + + NSL+++  + G    A  +++    
Sbjct  126   DMILKVYVEKGLTKNALYVFDNMGKCGRIPSLRSCNSLLNNLVKNGETHTAHYVYQQ---  182

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
                                            M   G+ P V   + ++  FC++G++ E+
Sbjct  183   -------------------------------MIRVGIVPDVFMVSIMVNAFCKDGKVDEA  211

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
                + +M    +EP+ VT ++LINGY  +GD+ +A  V   M E G+  +  TY  LI G
Sbjct  212   AGFVKKMENLGVEPNIVTYHSLINGYVSLGDVEAAKGVLKFMSEKGVSRNVVTYTLLIKG  271

Query  674   FCKAKDTERAKEVIFDMIA-AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCV  498
             +CK    + A++V+  M   A   P   AY  L+D YC     +  V+L DE    G   
Sbjct  272   YCKQCKMDEAEKVLRGMQEEAALVPDERAYGVLIDGYCRTGKIDDAVRLLDEMLRLGLKT  331

Query  497   DISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLF  318
             ++    ++I   CKRG++  AE     M +  +  DS  Y +L   Y +EG+T  A +L 
Sbjct  332   NLFICNSLINGYCKRGEIHEAEGVITRMVDWNLKPDSYSYNTLLDGYCREGHTSEAFNLC  391

Query  317   DEMYKRRLMVTlklykslsassKDENSLLDLF--WNNVMQRGLISHNVHNSIFL  162
             D+M +  +  T+  Y +L        +  D    W+ +M+RG+    V  S  L
Sbjct  392   DKMLQEGIEPTVLTYNTLLKGLCRVGAFDDALQIWHLMMKRGVAPDEVGYSTLL  445


 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 0/142 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N+ V++  +     + +  DA + F  L +    PD      L++     G  D  ++  
Sbjct  679   NNIVYNIAIAGLCKTGKVDDARRFFSMLSLKGFVPDNFTYCTLIHGYSAAGNVDEAFRLR  738

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M++ G++PNI  YN LI+  CKS  V++A     ++  KG+FP++ T+NTLI  YC+ 
Sbjct  739   DEMLRRGLVPNIVTYNALINGLCKSENVDRAQRLFHKLHQKGLFPNVVTYNTLIDGYCKI  798

Query  1184  GMHYEALSVQDRMERGGVEPDI  1119
             G    A  ++D+M   G+ P I
Sbjct  799   GNMDAAFKLKDKMIEEGISPSI  820



>ref|XP_010423914.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Camelina sativa]
Length=735

 Score =   259 bits (661),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/544 (28%), Positives = 260/544 (48%), Gaps = 71/544 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++H+  S  +MI++L +      A+  + ++  +  +S   ++NALV +  +   N  
Sbjct  112   PNFKHTSLSLSAMIHVLVRSGRLSDAQSCVLRMIRRSGVSRAEIVNALVSTYSNCGSNDS  171

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +A + F  LR         AC  L+ SLV+ G  +  W  Y+++
Sbjct  172   VFDLLIRTYVQARKLREAHEAFTLLRSKGYTVSIDACNALMGSLVRVGWVELAWGVYQEI  231

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              + GV  N++  N++++A CK G++EK   FLSE++ KG++PD+ T+NTLIS Y  +G+ 
Sbjct  232   SRSGVGINVYTLNIMVNALCKDGKMEKIGTFLSEVQEKGVYPDIVTYNTLISAYSSKGLM  291

Query  1175  YEALSVQDRME-----------------------------------RGGVEPDIITYNSL  1101
              EA  + + M                                    R G+ PD  TY SL
Sbjct  292   EEAFELMNAMPSKGFSPGVYTYNTVINGLCKHGKYGRAKEVFAEMLRSGLSPDSTTYRSL  351

Query  1100  IHSHCREGRMREAMRLFKDIKEK------------------------------------V  1029
             +   C++G   E  ++F D++ +                                    +
Sbjct  352   LMEACKKGDAVETEKIFSDMRSRDIVPDLVCFSSMMSLFARSGNLDKALVYFNSVKDAGL  411

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              P+ V YT LI GYC+ G I EA+ L   M  +G    V TYN+IL   C+   ++E+ K
Sbjct  412   VPDNVIYTILIQGYCKKGMISEAMNLRDEMLRQGCAMDVVTYNTILHGLCKRKMLREADK  471

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L N+M E+ + PD+ T   LI+G+CK+G++ +A+++  KM E  ++ D  TY  L+ GF 
Sbjct  472   LFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIKFDVVTYNTLLDGFG  531

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  D + AKE+  DM++    P+  +YS +V+  C + +     ++ DE   +     + 
Sbjct  532   KVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRVWDEMISKSIKPTVM  591

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                ++I+  C+ G     E F   M     + D + Y +L Y + KE N   A  L  +M
Sbjct  592   ICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKM  651

Query  308   YKRR  297
              +++
Sbjct  652   EEKQ  655


 Score =   193 bits (491),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 109/399 (27%), Positives = 205/399 (51%), Gaps = 4/399 (1%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A +VF  +    + PD      LL    K+G      K +  M    ++P++  ++ ++ 
Sbjct  329   AKEVFAEMLRSGLSPDSTTYRSLLMEACKKGDAVETEKIFSDMRSRDIVPDLVCFSSMMS  388

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
                +SG ++KA  + + ++  G+ PD   +  LI  YC++GM  EA++++D M R G   
Sbjct  389   LFARSGNLDKALVYFNSVKDAGLVPDNVIYTILIQGYCKKGMISEAMNLRDEMLRQGCAM  448

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D++TYN+++H  C+   +REA +LF ++ E+ + P+  T T LIDG+C++G++  A+ L 
Sbjct  449   DVVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELF  508

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKI  768
               M+EK +   V TYN++L  F + G +  + ++   M  ++I P  ++ + ++N  C  
Sbjct  509   KKMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSK  568

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
             G +  A +V ++M+   ++P      ++I G+C++ +    +  +  MI+ GF P   +Y
Sbjct  569   GHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISY  628

Query  587   SWLVDTYCLQNNNE---ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGM  417
             + L+  +  + N      LVK  +E  G     D+  Y +I+   C++ ++  AE     
Sbjct  629   NTLIYGFVKEENMSKAFGLVKKMEEKQGGLVVPDVFTYNSILHGFCRQNQMKEAEVVLRK  688

Query  416   MQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
             M ER +  D   Y+SL   +  + N   A    DEM  R
Sbjct  689   MIERGVEPDRSTYSSLINGFVSQDNLTEAFRFHDEMLLR  727


 Score =   183 bits (465),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 178/353 (50%), Gaps = 4/353 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  +A S     A+  F  ++   + PD    T+L+    K+G+         +M+
Sbjct  383   FSSMMSLFARSGNLDKALVYFNSVKDAGLVPDNVIYTILIQGYCKKGMISEAMNLRDEML  442

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  YN ++H  CK   + +AD+  +EM  +G+FPD YT   LI  +C+ G   
Sbjct  443   RQGCAMDVVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQ  502

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              A+ +  +M+   ++ D++TYN+L+    + G +  A  ++ D +  ++ P  ++Y+ ++
Sbjct  503   NAMELFKKMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMV  562

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +  C  G + EA R+   M  K + P V   NS+++ +C  G   +    L +M  +   
Sbjct  563   NALCSKGHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFV  622

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLE--AGLR-PDSFTYKALIHGFCKAKDTERA  645
             PD ++ NTLI G+ K  ++  A  +  KM E   GL  PD FTY +++HGFC+    + A
Sbjct  623   PDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGGLVVPDVFTYNSILHGFCRQNQMKEA  682

Query  644   KEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             + V+  MI  G  P    YS L++ +  Q+N     +  DE   RG+  D  F
Sbjct  683   EVVLRKMIERGVEPDRSTYSSLINGFVSQDNLTEAFRFHDEMLLRGFSPDDQF  735


 Score =   142 bits (357),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 148/283 (52%), Gaps = 6/283 (2%)
 Frame = -2

Query  1535  VFSWLLIFYANSKRTW--DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYK  1362
             V ++  I +   KR    +A ++F  +    + PD +  T+L++   K G      + +K
Sbjct  450   VVTYNTILHGLCKRKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFK  509

Query  1361  KMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRG  1182
             KM +  +  ++  YN L+    K G+++ A E  ++M  + I P   +++ +++  C +G
Sbjct  510   KMKEKRIKFDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKG  569

Query  1181  MHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLF-KDIKEKVTPNEVTYT  1005
                EA  V D M    ++P ++  NS+I  +CR G   +      K I E   P+ ++Y 
Sbjct  570   HLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYN  629

Query  1004  TLIDGYCRVGDIDEALRLHSAMEEK--GL-CPRVATYNSILRKFCEEGRMKESTKLLNQM  834
             TLI G+ +  ++ +A  L   MEEK  GL  P V TYNSIL  FC + +MKE+  +L +M
Sbjct  630   TLIYGFVKEENMSKAFGLVKKMEEKQGGLVVPDVFTYNSILHGFCRQNQMKEAEVVLRKM  689

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD  705
              E+ +EPD  T ++LING+    ++  A +  ++ML  G  PD
Sbjct  690   IERGVEPDRSTYSSLINGFVSQDNLTEAFRFHDEMLLRGFSPD  732



>ref|XP_009385400.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Musa acuminata subsp. malaccensis]
Length=717

 Score =   258 bits (660),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 137/476 (29%), Positives = 251/476 (53%), Gaps = 2/476 (0%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSD-VNS  1539
             P  R   ++  +MI+   +++    A+ ++ ++  +   S   V+ AL  S D  +   S
Sbjct  96    PGLRLPAETLGTMIHYFVRNRRIAEAQALVLRLVRRRSASRAEVVAALATSYDRCEGPGS  155

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKK  1359
              VF  L+  Y  +++  +A + F  L+   +    +AC +LL  LV+    D     Y +
Sbjct  156   AVFDLLIRTYVQARKPREAAEAFRLLKARGLFVSVNACNLLLAGLVRMDWVDMARDIYGE  215

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             ++++GV PNI+  N++++A CK    ++ + FL EM  +GIFPD+ T NTLI  +CR G 
Sbjct  216   IVEMGVHPNIYTLNIMVNAFCKDRRFDQVNSFLLEMAKRGIFPDVVTHNTLIDAHCRAGH  275

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTT  1002
               E+L +   M   G++PD++TYN++++  C+ G   +A  L  ++ +  + PN  T+  
Sbjct  276   LEESLQLLKSMGDNGLKPDVVTYNAVLNGFCKNGLYDKAKELLGEMLDAGLVPNASTFNI  335

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
              + G+C++G+  EA+R++  M   GL P + +++S++  F ++G M  +      M    
Sbjct  336   FLSGFCKIGNTSEAMRIYDKMVGSGLVPDIVSFSSVIDLFSKKGDMYRALAYFGDMKTIG  395

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + PDNV    LI+G+C+IG I  ALK++++M++ G  PD  TY  +++G CK +    A 
Sbjct  396   LVPDNVIYTMLISGFCRIGLITEALKMRDEMVDHGCLPDIVTYNTILNGICKEQRLSDAD  455

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
             ++  +M+  G SP +C ++ L+D YC     E  ++L D+        DI  Y ++I   
Sbjct  456   KLFHEMVERGISPDFCTFTTLIDGYCKGGLVEKALRLFDKMLESNLKPDIVTYNSLIDGC  515

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             CK G ++     +     R +L + + Y+ L   +  +G    A    DEM + R+
Sbjct  516   CKEGNMERVNELWDDTCRRGMLPNHITYSILIDNHCSKGQVEEAFRFLDEMVENRI  571


 Score =   249 bits (636),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 133/381 (35%), Positives = 211/381 (55%), Gaps = 1/381 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             I PD      L+++  + G  +   +  K M   G+ P++  YN +++  CK+G  +KA 
Sbjct  256   IFPDVVTHNTLIDAHCRAGHLEESLQLLKSMGDNGLKPDVVTYNAVLNGFCKNGLYDKAK  315

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             E L EM   G+ P+  TFN  +S +C+ G   EA+ + D+M   G+ PDI++++S+I   
Sbjct  316   ELLGEMLDAGLVPNASTFNIFLSGFCKIGNTSEAMRIYDKMVGSGLVPDIVSFSSVIDLF  375

Query  1088  CREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
              ++G M  A+  F D+K   + P+ V YT LI G+CR+G I EAL++   M + G  P +
Sbjct  376   SKKGDMYRALAYFGDMKTIGLVPDNVIYTMLISGFCRIGLITEALKMRDEMVDHGCLPDI  435

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYN+IL   C+E R+ ++ KL ++M E+ I PD  T  TLI+GYCK G +  AL++ +K
Sbjct  436   VTYNTILNGICKEQRLSDADKLFHEMVERGISPDFCTFTTLIDGYCKGGLVEKALRLFDK  495

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             MLE+ L+PD  TY +LI G CK  + ER  E+  D    G  P++  YS L+D +C +  
Sbjct  496   MLESNLKPDIVTYNSLIDGCCKEGNMERVNELWDDTCRRGMLPNHITYSILIDNHCSKGQ  555

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
              E   +  DE        ++  Y +II+  C+ G    AE+F   M +  ++ D + Y +
Sbjct  556   VEEAFRFLDEMVENRIAPNVVTYNSIIKGYCRSGDAKKAEKFLEKMIDDSVIPDIITYNT  615

Query  371   LAYAYFKEGNTRAASDLFDEM  309
             L Y + KE     A  L ++M
Sbjct  616   LIYGFVKEEKMHKALHLINKM  636


 Score =   222 bits (566),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 186/350 (53%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  ++     + A+  F  ++   + PD    T+L++   + GL     K   +M+
Sbjct  368   FSSVIDLFSKKGDMYRALAYFGDMKTIGLVPDNVIYTMLISGFCRIGLITEALKMRDEMV  427

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               G LP+I  YN +++  CK   +  AD+   EM  +GI PD  TF TLI  YC+ G+  
Sbjct  428   DHGCLPDIVTYNTILNGICKEQRLSDADKLFHEMVERGISPDFCTFTTLIDGYCKGGLVE  487

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLI  996
             +AL + D+M    ++PDI+TYNSLI   C+EG M     L+ D  +  + PN +TY+ LI
Sbjct  488   KALRLFDKMLESNLKPDIVTYNSLIDGCCKEGNMERVNELWDDTCRRGMLPNHITYSILI  547

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             D +C  G ++EA R    M E  + P V TYNSI++ +C  G  K++ K L +M +  + 
Sbjct  548   DNHCSKGQVEEAFRFLDEMVENRIAPNVVTYNSIIKGYCRSGDAKKAEKFLEKMIDDSVI  607

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD +T NTLI G+ K   +  AL + NKM   G+ PD  +Y  ++  FC+  + + A  V
Sbjct  608   PDIITYNTLIYGFVKEEKMHKALHLINKMENKGVPPDVISYNVILSAFCEQGEMQEADSV  667

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                M++ G  P    Y+ L++ +   +N +   +L DE   RG+  D  F
Sbjct  668   FKRMVSRGVQPDGSTYTTLINGHVAVDNLKEAFRLHDEMLQRGFVPDDKF  717


 Score =   222 bits (566),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/382 (31%), Positives = 213/382 (56%), Gaps = 3/382 (1%)
 Frame = -2

Query  1436  PHACT--VLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             P+A T  + L+   K G T    + Y KM+  G++P+I  ++ +I    K G++ +A  +
Sbjct  328   PNASTFNIFLSGFCKIGNTSEAMRIYDKMVGSGLVPDIVSFSSVIDLFSKKGDMYRALAY  387

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
               +M+  G+ PD   +  LIS +CR G+  EAL ++D M   G  PDI+TYN++++  C+
Sbjct  388   FGDMKTIGLVPDNVIYTMLISGFCRIGLITEALKMRDEMVDHGCLPDIVTYNTILNGICK  447

Query  1082  EGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVAT  906
             E R+ +A +LF ++ E+ ++P+  T+TTLIDGYC+ G +++ALRL   M E  L P + T
Sbjct  448   EQRLSDADKLFHEMVERGISPDFCTFTTLIDGYCKGGLVEKALRLFDKMLESNLKPDIVT  507

Query  905   YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
             YNS++   C+EG M+   +L +    + + P+++T + LI+ +C  G +  A +  ++M+
Sbjct  508   YNSLIDGCCKEGNMERVNELWDDTCRRGMLPNHITYSILIDNHCSKGQVEEAFRFLDEMV  567

Query  725   EAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNE  546
             E  + P+  TY ++I G+C++ D ++A++ +  MI     P    Y+ L+  +  +    
Sbjct  568   ENRIAPNVVTYNSIIKGYCRSGDAKKAEKFLEKMIDDSVIPDIITYNTLIYGFVKEEKMH  627

Query  545   ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLA  366
               + L ++   +G   D+  Y  I+   C++G++  A+  F  M  R +  D   YT+L 
Sbjct  628   KALHLINKMENKGVPPDVISYNVILSAFCEQGEMQEADSVFKRMVSRGVQPDGSTYTTLI  687

Query  365   YAYFKEGNTRAASDLFDEMYKR  300
               +    N + A  L DEM +R
Sbjct  688   NGHVAVDNLKEAFRLHDEMLQR  709


 Score =   187 bits (475),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 115/398 (29%), Positives = 204/398 (51%), Gaps = 3/398 (1%)
 Frame = -2

Query  1337  PNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSV  1158
             P   ++++LI    ++ +  +A E    ++ +G+F  +   N L++   R      A  +
Sbjct  153   PGSAVFDLLIRTYVQARKPREAAEAFRLLKARGLFVSVNACNLLLAGLVRMDWVDMARDI  212

Query  1157  QDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCR  981
                +   GV P+I T N ++++ C++ R  +      ++ K  + P+ VT+ TLID +CR
Sbjct  213   YGEIVEMGVHPNIYTLNIMVNAFCKDRRFDQVNSFLLEMAKRGIFPDVVTHNTLIDAHCR  272

Query  980   VGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVT  801
              G ++E+L+L  +M + GL P V TYN++L  FC+ G   ++ +LL +M +  + P+  T
Sbjct  273   AGHLEESLQLLKSMGDNGLKPDVVTYNAVLNGFCKNGLYDKAKELLGEMLDAGLVPNAST  332

Query  800   CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
              N  ++G+CKIG+   A+++ +KM+ +GL PD  ++ ++I  F K  D  RA     DM 
Sbjct  333   FNIFLSGFCKIGNTSEAMRIYDKMVGSGLVPDIVSFSSVIDLFSKKGDMYRALAYFGDMK  392

Query  620   AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
               G  P    Y+ L+  +C        +K+ DE    G   DI  Y  I+  +CK  +L 
Sbjct  393   TIGLVPDNVIYTMLISGFCRIGLITEALKMRDEMVDHGCLPDIVTYNTILNGICKEQRLS  452

Query  440   CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklyksls  261
              A++ F  M ER I  D   +T+L   Y K G    A  LFD+M +  L   +  Y SL 
Sbjct  453   DADKLFHEMVERGISPDFCTFTTLIDGYCKGGLVEKALRLFDKMLESNLKPDIVTYNSLI  512

Query  260   assKDENSL--LDLFWNNVMQRGLISHNVHNSIFLKLH  153
                  E ++  ++  W++  +RG++ +++  SI +  H
Sbjct  513   DGCCKEGNMERVNELWDDTCRRGMLPNHITYSILIDNH  550



>ref|XP_009148267.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Brassica rapa]
 ref|XP_009148268.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Brassica rapa]
Length=600

 Score =   255 bits (652),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/470 (29%), Positives = 250/470 (53%), Gaps = 4/470 (1%)
 Frame = -2

Query  1745  WSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVR  1566
             ++FFK++ + P +R ++ S ++M   L  HK F  A+ ++  +  +   +S + +     
Sbjct  98    FAFFKFISSQPGFRFTVDSYFAMARFLAVHKMFDEAQSLIALVVSRKGKNSASSVFVSAL  157

Query  1565  SDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
                 SD    +   L++ Y N+    DAIQ F   R  +       C  LL+ ++K   T
Sbjct  158   ETRGSDF---LVDALMMAYTNAGFVPDAIQCFRLSRKHKFTVPIRGCGSLLHRMMKVNPT  214

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
             +TVW  Y +++  G   N++++N+L++  CK G++  A +   E+  + + P + +FNTL
Sbjct  215   ETVWGFYMEILDAGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEITKRSLRPTVVSFNTL  274

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-V  1029
             I+ YC+ G   +   +++RMERG    D+ TY++LI++ C+E +M  A  LF ++ E+ +
Sbjct  275   INGYCKAGNLDKGFRLKERMERGRTRADVFTYSALINALCKENKMDGAHGLFDEMCERGL  334

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              PN+V +TTLI G+ R G ID     +  M  +GL P +  YN+++  FC+ G +  +  
Sbjct  335   IPNDVVFTTLIHGHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGDLVAARN  394

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             +++ M  + + PD VT  TLI+G+C+ GD+ +AL+++ KM + G+  D   + ALI G C
Sbjct  395   VVDGMIHRGLRPDKVTYTTLIDGFCRGGDVDAALEIRKKMDQNGIELDRVGFSALICGMC  454

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K      A+  + +M+ AG  P    Y+ ++D +C + + +   +L  E    G+   + 
Sbjct  455   KEGRVVDAERALREMLRAGMKPDDVIYTMMMDAFCKKGDVQTSFRLLKEMQRDGHVPSVV  514

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
              Y  ++  LCK G++  A+     M    ++ D + +  L   + +  N+
Sbjct  515   TYNVLLNGLCKLGQMKNADMLLDAMLNIGVVPDDITFNILLEGHHRHANS  564


 Score =   166 bits (419),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 153/280 (55%), Gaps = 1/280 (0%)
 Frame = -2

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G   ++  +N L++  C+EG+M +A ++F +I K  + P  V++ TLI+GYC+ G++D+
Sbjct  227   AGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEITKRSLRPTVVSFNTLINGYCKAGNLDK  286

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
               RL   ME       V TY++++   C+E +M  +  L ++M E+ + P++V   TLI+
Sbjct  287   GFRLKERMERGRTRADVFTYSALINALCKENKMDGAHGLFDEMCERGLIPNDVVFTTLIH  346

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             G+ + G I    +   KML  GL+PD   Y  L++GFCK  D   A+ V+  MI  G  P
Sbjct  347   GHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGDLVAARNVVDGMIHRGLRP  406

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
                 Y+ L+D +C   + +A +++  +    G  +D   + A+I  +CK G++  AER  
Sbjct  407   DKVTYTTLIDGFCRGGDVDAALEIRKKMDQNGIELDRVGFSALICGMCKEGRVVDAERAL  466

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
               M    +  D V+YT +  A+ K+G+ + +  L  EM +
Sbjct  467   REMLRAGMKPDDVIYTMMMDAFCKKGDVQTSFRLLKEMQR  506


 Score =   115 bits (289),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 154/346 (45%), Gaps = 5/346 (1%)
 Frame = -2

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS  1161
             LP+  I+        + G     D + +   F  +        +LI+L   R     A S
Sbjct  92    LPHHSIFAFFKFISSQPGFRFTVDSYFAMARFLAVHKMFDEAQSLIALVVSRKGKNSASS  151

Query  1160  V-QDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGY  987
             V    +E  G +      ++L+ ++   G + +A++ F+   K K T       +L+   
Sbjct  152   VFVSALETRGSD---FLVDALMMAYTNAGFVPDAIQCFRLSRKHKFTVPIRGCGSLLHRM  208

Query  986   CRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDN  807
              +V   +     +  + + G    V  +N ++ KFC+EG+M ++ K+ +++ ++ + P  
Sbjct  209   MKVNPTETVWGFYMEILDAGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEITKRSLRPTV  268

Query  806   VTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFD  627
             V+ NTLINGYCK G++    ++K +M     R D FTY ALI+  CK    + A  +  +
Sbjct  269   VSFNTLINGYCKAGNLDKGFRLKERMERGRTRADVFTYSALINALCKENKMDGAHGLFDE  328

Query  626   MIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGK  447
             M   G  P+   ++ L+  +      + + +   +   RG   DI  Y  ++   CK G 
Sbjct  329   MCERGLIPNDVVFTTLIHGHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGD  388

Query  446   LDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             L  A      M  R +  D V YT+L   + + G+  AA ++  +M
Sbjct  389   LVAARNVVDGMIHRGLRPDKVTYTTLIDGFCRGGDVDAALEIRKKM  434


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 81/169 (48%), Gaps = 4/169 (2%)
 Frame = -2

Query  800  CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
            C +L++   K+    +      ++L+AG   + + +  L++ FCK      A++V  ++ 
Sbjct  201  CGSLLHRMMKVNPTETVWGFYMEILDAGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEIT  260

Query  620  AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
                 P+  +++ L++ YC   N +   +L +         D+  Y A+I  LCK  K+D
Sbjct  261  KRSLRPTVVSFNTLINGYCKAGNLDKGFRLKERMERGRTRADVFTYSALINALCKENKMD  320

Query  440  CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             A   F  M ER ++ + VV+T+L + + + G      DL  E Y++ L
Sbjct  321  GAHGLFDEMCERGLIPNDVVFTTLIHGHSRNGRI----DLMKESYQKML  365



>ref|XP_007161634.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris]
 gb|ESW33628.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris]
Length=618

 Score =   256 bits (654),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 152/505 (30%), Positives = 259/505 (51%), Gaps = 12/505 (2%)
 Frame = -2

Query  1805  TSTIINHTLLTL--SPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIY--ILTKHKHFKSA  1638
             T +I++ TL +L  +P    L   F   + T P   HSL  + S +   IL +    K +
Sbjct  54    TPSILSSTLTSLRNNP---QLVLQFLSHLNTHP---HSLDLTTSSLAACILCRLPSPKPS  107

Query  1637  KDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ-VFSWLLIFYANSKRTWDAIQVFEHL  1461
              ++L ++     L++  + + L  S D  D  S  +F  L+  Y   K+  +A++ F  +
Sbjct  108   INLLQRLILSSTLTNTTIFHELALSRDRVDAKSSLIFDLLVRAYCELKKPNEALECFYLM  167

Query  1460  RICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEV  1281
             +   ++P+   C  +L+  +K   T   W  Y +M ++ +  +++ +N++++  CK G++
Sbjct  168   KEKGVEPNIETCNQMLSLFLKLNRTQMAWVLYAEMFRMNIRSSVYTFNIMVNVLCKEGKL  227

Query  1280  EKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSL  1101
             +KA+EF+  ME  G+ P++ T+NT+I  +C RG    A  +   M+  G+EPD  TYNS 
Sbjct  228   KKANEFIGHMEALGVKPNVVTYNTVIHGHCVRGKFQRARVIFQTMKDKGLEPDCYTYNSF  287

Query  1100  IHSHCREGRMREAMRLF-KDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGL  924
             I   C+E R+ EA  L  K ++  + PN VTY  LIDGYC  GD+D+A      M  KG+
Sbjct  288   ISGLCKERRLEEASGLLCKMLEIGLLPNAVTYNALIDGYCNKGDLDKAFAYRDEMISKGV  347

Query  923   CPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALK  744
                + TYN  +     EGRM E+  ++ +M EK ++PD VT N LINGYC+ GD   A  
Sbjct  348   TTSLVTYNLFIHALFMEGRMGEADNMVQEMQEKGMKPDAVTYNILINGYCRCGDAKRAFS  407

Query  743   VKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYC  564
             + ++M+  G++P   TY +LI+   K    + A  +   +   G       ++ L+D +C
Sbjct  408   LLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKEADALFIKIQQEGLLLDTVMFNALIDGHC  467

Query  563   LQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSV  384
                N +   +L ++        D   Y  +++  C+ GK++ A +    M+ R I  D +
Sbjct  468   ANGNIDRAFQLLEQMDNMKVLPDEITYNTLMQGYCREGKVEEARQLLDKMKRRGIKPDHI  527

Query  383   VYTSLAYAYFKEGNTRAASDLFDEM  309
              Y +L   Y K G+ + A  + DEM
Sbjct  528   SYNTLISGYSKRGDMKDAFRVRDEM  552


 Score =   180 bits (456),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 106/378 (28%), Positives = 184/378 (49%), Gaps = 36/378 (10%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRM  1146
             I+++L+ A C+  +  +A E    M+ KG+ P++ T N ++SL+ +      A  +   M
Sbjct  143   IFDLLVRAYCELKKPNEALECFYLMKEKGVEPNIETCNQMLSLFLKLNRTQMAWVLYAEM  202

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDI  969
              R  +   + T+N +++  C+EG++++A      ++   V PN VTY T+I G+C  G  
Sbjct  203   FRMNIRSSVYTFNIMVNVLCKEGKLKKANEFIGHMEALGVKPNVVTYNTVIHGHCVRGKF  262

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
               A  +   M++KGL P   TYNS +   C+E R++E++ LL +M E  + P+ VT N L
Sbjct  263   QRARVIFQTMKDKGLEPDCYTYNSFISGLCKERRLEEASGLLCKMLEIGLLPNAVTYNAL  322

Query  788   INGYCKIGDIVSALKVKNKML-----------------------------------EAGL  714
             I+GYC  GD+  A   +++M+                                   E G+
Sbjct  323   IDGYCNKGDLDKAFAYRDEMISKGVTTSLVTYNLFIHALFMEGRMGEADNMVQEMQEKGM  382

Query  713   RPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVK  534
             +PD+ TY  LI+G+C+  D +RA  ++ +M+  G  P+   Y+ L+     +N  +    
Sbjct  383   KPDAVTYNILINGYCRCGDAKRAFSLLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKEADA  442

Query  533   LADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYF  354
             L  +    G  +D   + A+I   C  G +D A +    M   ++L D + Y +L   Y 
Sbjct  443   LFIKIQQEGLLLDTVMFNALIDGHCANGNIDRAFQLLEQMDNMKVLPDEITYNTLMQGYC  502

Query  353   KEGNTRAASDLFDEMYKR  300
             +EG    A  L D+M +R
Sbjct  503   REGKVEEARQLLDKMKRR  520


 Score =   133 bits (334),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 87/316 (28%), Positives = 151/316 (48%), Gaps = 3/316 (1%)
 Frame = -2

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
             + ++ L+ ++C   +  EA+  F  +KEK V PN  T   ++  + ++     A  L++ 
Sbjct  142   LIFDLLVRAYCELKKPNEALECFYLMKEKGVEPNIETCNQMLSLFLKLNRTQMAWVLYAE  201

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             M    +   V T+N ++   C+EG++K++ + +  M    ++P+ VT NT+I+G+C  G 
Sbjct  202   MFRMNIRSSVYTFNIMVNVLCKEGKLKKANEFIGHMEALGVKPNVVTYNTVIHGHCVRGK  261

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
                A  +   M + GL PD +TY + I G CK +  E A  ++  M+  G  P+   Y+ 
Sbjct  262   FQRARVIFQTMKDKGLEPDCYTYNSFISGLCKERRLEEASGLLCKMLEIGLLPNAVTYNA  321

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQERE  402
             L+D YC + + +      DE   +G    +  Y   I  L   G++  A+     MQE+ 
Sbjct  322   LIDGYCNKGDLDKAFAYRDEMISKGVTTSLVTYNLFIHALFMEGRMGEADNMVQEMQEKG  381

Query  401   ILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSL--LD  228
             +  D+V Y  L   Y + G+ + A  L DEM  + +  TL  Y SL       N +   D
Sbjct  382   MKPDAVTYNILINGYCRCGDAKRAFSLLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKEAD  441

Query  227   LFWNNVMQRGLISHNV  180
               +  + Q GL+   V
Sbjct  442   ALFIKIQQEGLLLDTV  457


 Score =   108 bits (271),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 94/159 (59%), Gaps = 5/159 (3%)
 Frame = -2

Query  1424  TVLLNSLV----KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLS  1257
             TV+ N+L+      G  D  ++  ++M  + VLP+   YN L+   C+ G+VE+A + L 
Sbjct  456   TVMFNALIDGHCANGNIDRAFQLLEQMDNMKVLPDEITYNTLMQGYCREGKVEEARQLLD  515

Query  1256  EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREG  1077
             +M+ +GI PD  ++NTLIS Y +RG   +A  V+D M   G +P I+TYN+LI   C+  
Sbjct  516   KMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEMMTTGFDPTILTYNALIQGLCKNR  575

Query  1076  RMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDE  963
                 A  L K++  K +TP++ TY ++I+   +V D++E
Sbjct  576   EGEHAEELLKEMVSKGITPDDTTYLSIIEAMEKVDDLEE  614


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 92/224 (41%), Gaps = 31/224 (14%)
 Frame = -2

Query  1700  SLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWL  1521
             +L +  S+IY+L K    K A  +  +I  +  L    + NAL+   D    N  +    
Sbjct  420   TLVTYTSLIYVLGKRNRMKEADALFIKIQQEGLLLDTVMFNALI---DGHCANGNIDR--  474

Query  1520  LIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGV  1341
                         A Q+ E +   ++ PD      L+    +EG  +   +   KM + G+
Sbjct  475   ------------AFQLLEQMDNMKVLPDEITYNTLMQGYCREGKVEEARQLLDKMKRRGI  522

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYC--RRGMHYEA  1167
              P+   YN LI    K G+++ A     EM   G  P + T+N LI   C  R G H E 
Sbjct  523   KPDHISYNTLISGYSKRGDMKDAFRVRDEMMTTGFDPTILTYNALIQGLCKNREGEHAEE  582

Query  1166  LSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE  1035
             L  +  M   G+ PD  TY S+I          EAM    D++E
Sbjct  583   LLKE--MVSKGITPDDTTYLSII----------EAMEKVDDLEE  614



>emb|CDX93490.1| BnaA06g05580D [Brassica napus]
Length=600

 Score =   255 bits (652),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/470 (29%), Positives = 250/470 (53%), Gaps = 4/470 (1%)
 Frame = -2

Query  1745  WSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVR  1566
             ++FFK++ + P +R ++ S ++M   L  HK F  A+ ++  +  +   +S + +     
Sbjct  98    FTFFKFISSQPGFRFTVDSYFAMARFLAVHKMFDEAQSLIALVVSRKGKNSASSVFVSAL  157

Query  1565  SDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
                 SD    +   L++ Y N+    DAIQ F   R  +       C  LL+ ++K   T
Sbjct  158   ETRGSDF---LVDALMMAYTNAGFVPDAIQCFRLSRKHKFTVPIRGCGSLLHRMMKVNPT  214

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
             +TVW  Y +++  G   N++++N+L++  CK G++  A +   E+  + + P + +FNTL
Sbjct  215   ETVWGFYMEILDAGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEITKRSLRPTVVSFNTL  274

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-V  1029
             I+ YC+ G   +   +++RMERG    D+ TY++LI++ C+E +M  A  LF ++ E+ +
Sbjct  275   INGYCKAGNLDKGFRLKERMERGRTRADVFTYSALINALCKENKMDGAHGLFDEMCERGL  334

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              PN+V +TTLI G+ R G ID     +  M  +GL P +  YN+++  FC+ G +  +  
Sbjct  335   IPNDVVFTTLIHGHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGDLVAARN  394

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             +++ M  + + PD VT  TLI+G+C+ GD+ +AL+++ KM + G+  D   + ALI G C
Sbjct  395   VVDGMIHRGLRPDKVTYTTLIDGFCRGGDVDAALEIRKKMDQNGIELDRVGFSALICGMC  454

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K      A+  + +M+ AG  P    Y+ ++D +C + + +   +L  E    G+   + 
Sbjct  455   KEGRVVDAERALREMLRAGMKPDDVIYTMMMDAFCKKGDVQTSFRLLKEMQRDGHVPSVV  514

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNT  339
              Y  ++  LCK G++  A+     M    ++ D + Y  L   + +  N+
Sbjct  515   TYNVLLNGLCKLGQMKNADMLLDAMLNIGVVPDDITYNILLEGHHRHVNS  564


 Score =   166 bits (419),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 153/280 (55%), Gaps = 1/280 (0%)
 Frame = -2

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G   ++  +N L++  C+EG+M +A ++F +I K  + P  V++ TLI+GYC+ G++D+
Sbjct  227   AGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEITKRSLRPTVVSFNTLINGYCKAGNLDK  286

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
               RL   ME       V TY++++   C+E +M  +  L ++M E+ + P++V   TLI+
Sbjct  287   GFRLKERMERGRTRADVFTYSALINALCKENKMDGAHGLFDEMCERGLIPNDVVFTTLIH  346

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             G+ + G I    +   KML  GL+PD   Y  L++GFCK  D   A+ V+  MI  G  P
Sbjct  347   GHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGDLVAARNVVDGMIHRGLRP  406

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
                 Y+ L+D +C   + +A +++  +    G  +D   + A+I  +CK G++  AER  
Sbjct  407   DKVTYTTLIDGFCRGGDVDAALEIRKKMDQNGIELDRVGFSALICGMCKEGRVVDAERAL  466

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYK  303
               M    +  D V+YT +  A+ K+G+ + +  L  EM +
Sbjct  467   REMLRAGMKPDDVIYTMMMDAFCKKGDVQTSFRLLKEMQR  506


 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 154/346 (45%), Gaps = 5/346 (1%)
 Frame = -2

Query  1340  LPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS  1161
             LP+  I+        + G     D + +   F  +        +LI+L   R     A S
Sbjct  92    LPHNSIFTFFKFISSQPGFRFTVDSYFAMARFLAVHKMFDEAQSLIALVVSRKGKNSASS  151

Query  1160  V-QDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFK-DIKEKVTPNEVTYTTLIDGY  987
             V    +E  G +      ++L+ ++   G + +A++ F+   K K T       +L+   
Sbjct  152   VFVSALETRGSD---FLVDALMMAYTNAGFVPDAIQCFRLSRKHKFTVPIRGCGSLLHRM  208

Query  986   CRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDN  807
              +V   +     +  + + G    V  +N ++ KFC+EG+M ++ K+ +++ ++ + P  
Sbjct  209   MKVNPTETVWGFYMEILDAGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEITKRSLRPTV  268

Query  806   VTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFD  627
             V+ NTLINGYCK G++    ++K +M     R D FTY ALI+  CK    + A  +  +
Sbjct  269   VSFNTLINGYCKAGNLDKGFRLKERMERGRTRADVFTYSALINALCKENKMDGAHGLFDE  328

Query  626   MIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGK  447
             M   G  P+   ++ L+  +      + + +   +   RG   DI  Y  ++   CK G 
Sbjct  329   MCERGLIPNDVVFTTLIHGHSRNGRIDLMKESYQKMLSRGLQPDIVLYNTLVNGFCKNGD  388

Query  446   LDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             L  A      M  R +  D V YT+L   + + G+  AA ++  +M
Sbjct  389   LVAARNVVDGMIHRGLRPDKVTYTTLIDGFCRGGDVDAALEIRKKM  434


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 81/169 (48%), Gaps = 4/169 (2%)
 Frame = -2

Query  800  CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
            C +L++   K+    +      ++L+AG   + + +  L++ FCK      A++V  ++ 
Sbjct  201  CGSLLHRMMKVNPTETVWGFYMEILDAGYPSNVYVFNILMNKFCKEGKMCDAQKVFDEIT  260

Query  620  AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
                 P+  +++ L++ YC   N +   +L +         D+  Y A+I  LCK  K+D
Sbjct  261  KRSLRPTVVSFNTLINGYCKAGNLDKGFRLKERMERGRTRADVFTYSALINALCKENKMD  320

Query  440  CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             A   F  M ER ++ + VV+T+L + + + G      DL  E Y++ L
Sbjct  321  GAHGLFDEMCERGLIPNDVVFTTLIHGHSRNGRI----DLMKESYQKML  365



>ref|XP_006446275.1| hypothetical protein CICLE_v10017597mg [Citrus clementina]
 gb|ESR59515.1| hypothetical protein CICLE_v10017597mg [Citrus clementina]
Length=732

 Score =   258 bits (659),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 151/535 (28%), Positives = 278/535 (52%), Gaps = 5/535 (1%)
 Frame = -2

Query  1883  LVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE-TIPNY  1707
             LV+ + + + +G+ N+L   +  L+  S II   L  L      +   F  ++    PN 
Sbjct  58    LVEKILLNLKQGNVNSLRSYQFRLN--SVIIVEVLYRLRD-NLQVGQRFIDFIALNFPNV  114

Query  1706  RHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFS  1527
             +HS  S  +MI+ L + +    A+ ++ ++  K  +S   ++++ V +      NS +F 
Sbjct  115   KHSSMSLSAMIHFLVRGRRISDAQALILRMVRKSGVSRLEIVDSFVSTYSPCGSNSLIFD  174

Query  1526  WLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKL  1347
              ++  Y  +++  +  +VF  LR   I    +AC  LL  LVK G  D   + Y ++++ 
Sbjct  175   LVIRTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRS  234

Query  1346  GVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEA  1167
             G+  N++  N++++A CK  +++ A  FL EME KG++PD  T+NTLI+ YCR G   EA
Sbjct  235   GIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEA  294

Query  1166  LSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDG  990
               + + M   G++P + TYNSLI+  C++GR   A  +  + ++  ++P+  TY TL+  
Sbjct  295   FQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVE  354

Query  989   YCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPD  810
              CR  ++ EA  +   M  +G+ P + ++++++  F   G++  +     +M    + PD
Sbjct  355   SCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPD  414

Query  809   NVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF  630
             NV    +INGYC+ G ++ ALK++++MLE G   D  TY ++++G C+AK    A ++  
Sbjct  415   NVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNSILNGLCRAKMLTEADDLFN  474

Query  629   DMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRG  450
             +M+  G  P +  ++ L+  +C   N    + L D  + +    DI  Y  +I   CK G
Sbjct  475   EMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVG  534

Query  449   KLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             +++ A + +  M  R+I  + + Y  L   Y   G+   A  L+ EM  + +  T
Sbjct  535   EMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPT  589


 Score =   239 bits (609),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 132/387 (34%), Positives = 205/387 (53%), Gaps = 1/387 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             + PD      L+N+  +EG  +  ++    M   G+ P +  YN LI+  CK G  ++A 
Sbjct  271   VYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAK  330

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             E L EM   G+ PD  T+NTL+   CR+    EA  +   M R GV PDI+++++LI   
Sbjct  331   EVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIF  390

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
              R G++  A+  F+++K   + P+ V YT +I+GYCR G + EAL++   M EKG    V
Sbjct  391   SRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDV  450

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYNSIL   C    + E+  L N+M E+ + PD  T  TLI+G+CK G++  AL + + 
Sbjct  451   VTYNSILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDI  510

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M +  ++PD  TY  LI GFCK  + E+A ++  DMI+   SP+Y +Y  L++ YC   +
Sbjct  511   MTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGH  570

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
                  +L  E  G+G    +     II+  C+ G    A+ F   M    +  DS+ Y +
Sbjct  571   VTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNT  630

Query  371   LAYAYFKEGNTRAASDLFDEMYKRRLM  291
             L   + +E N   A  L  +M  + L+
Sbjct  631   LINGFVREENMDKAFALVSKMENQGLV  657


 Score =   229 bits (585),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/432 (28%), Positives = 219/432 (51%), Gaps = 36/432 (8%)
 Frame = -2

Query  1487  DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLI  1308
             +A Q+   +    +KP       L+N L K+G  D   +   +M+++G+ P+   YN L+
Sbjct  293   EAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLL  352

Query  1307  HACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL-----------------------  1197
                C+   + +A+E   EM  +G+ PD+ +F+TLI +                       
Sbjct  353   VESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLV  412

Query  1196  ------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL  1053
                         YCR G   EAL ++D M   G   D++TYNS+++  CR   + EA  L
Sbjct  413   PDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNSILNGLCRAKMLTEADDL  472

Query  1052  FKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCE  876
             F ++ E+ V P+  T+TTLI G+C+ G++++AL L   M +K + P + TYN+++  FC+
Sbjct  473   FNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCK  532

Query  875   EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
              G M+++ KL   M  +KI P+ ++   LINGYC +G +  A ++  +M+  G++P   +
Sbjct  533   VGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVS  592

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
                +I G+C++ D  +A E +  M++ G  P   +Y+ L++ +  + N +    L  +  
Sbjct  593   CNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKME  652

Query  515   GRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTR  336
              +G   D+  Y  I+   C++G++  +E     M E+ +  D   YT+L   +  + N +
Sbjct  653   NQGLVPDVITYNVILTGFCRQGRMHDSELILRRMIEKRLNPDRSTYTTLINGHVSQNNLK  712

Query  335   AASDLFDEMYKR  300
              A    DEM +R
Sbjct  713   EAFRFHDEMLQR  724


 Score =   222 bits (566),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 200/350 (57%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+  ++ + +   A+  F  ++   + PD    T+++N   + G      K   +M+
Sbjct  383   FSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEML  442

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G + ++  YN +++  C++  + +AD+  +EM  +G+FPD YTF TLI  +C+ G   
Sbjct  443   EKGCVMDVVTYNSILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMN  502

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +AL++ D M +  ++PDI+TYN+LI   C+ G M +A +L+ D I  K++PN ++Y  LI
Sbjct  503   KALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILI  562

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +GYC +G + EA RL   M  KG+ P + + N+I++ +C  G   ++ + L++M  + ++
Sbjct  563   NGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVD  622

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD+++ NTLING+ +  ++  A  + +KM   GL PD  TY  ++ GFC+      ++ +
Sbjct  623   PDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELI  682

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             +  MI    +P    Y+ L++ +  QNN +   +  DE   RG+  D +F
Sbjct  683   LRRMIEKRLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  732



>ref|XP_011001554.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Populus euphratica]
Length=610

 Score =   255 bits (651),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 138/467 (30%), Positives = 248/467 (53%), Gaps = 1/467 (0%)
 Frame = -2

Query  1742  SFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS  1563
             SFF ++ + P + H++QS  SM++ L  H+  + A+ +LH +  +    S + + A +  
Sbjct  106   SFFDFLSSYPTFSHTVQSYCSMVHFLIAHRMNQQAECLLHFVVSRKGKGSASSVFASILE  165

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
                +  +S VF  L+  Y       DAIQ F   +   +K   + C  LL  ++K     
Sbjct  166   TKGTLASSFVFDALMSVYTEFGYVSDAIQCFRLTKKHNLKIPFNGCKCLLERMIKMSSPM  225

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
                K Y +++  G  PN++ +N+L++  CK G+V+ A     E+   G+ P   +FNTLI
Sbjct  226   VALKFYLEILDSGYPPNVYSFNILMNRLCKEGKVKDAQSIFDEIRKTGLQPTAVSFNTLI  285

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VT  1026
             + YC+ G   E   ++  ME   V PD+ TY++LI   C+  ++ +A  LFK++ ++ + 
Sbjct  286   NGYCKSGNLDEGFRLKMVMEEFRVFPDVFTYSALIDGLCKACQLDDANHLFKEMCDRGLV  345

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             PN+VT+TTLI G C+ G +D AL ++  M  KGL   +  YN+++   C+ G  +E+ K 
Sbjct  346   PNDVTFTTLISGQCKNGRVDLALEIYQQMFTKGLKADLVLYNTLVNGLCKSGYFREARKF  405

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             + +M ++ +  D  T  TL++G CK GD+  AL++K +M++AG++ D+  + A+I G C+
Sbjct  406   VGEMTKRGLRLDKFTYTTLLDGSCKEGDLELALEMKKEMVKAGIQLDNVAFTAIISGLCR  465

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                   A+  + +M+ AG  P    Y+ ++D +C + + +   KL  E    G+   +  
Sbjct  466   DGKIADAERTLREMLRAGLKPDDGTYTMVMDGFCKKGDVKMGFKLLKEMQSDGHIPGVIT  525

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEG  345
             Y  ++  LCK+G++  A+     M    ++ D + Y  L   + K G
Sbjct  526   YNVLMNGLCKQGQVKNADMLLNAMLNLGVVPDDITYNILLQGHCKHG  572


 Score =   164 bits (415),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/426 (26%), Positives = 202/426 (47%), Gaps = 39/426 (9%)
 Frame = -2

Query  1313  LIH-ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALS--------  1161
             L+H    + G+   +  F S +E KG     + F+ L+S+Y   G   +A+         
Sbjct  143   LLHFVVSRKGKGSASSVFASILETKGTLASSFVFDALMSVYTEFGYVSDAIQCFRLTKKH  202

Query  1160  -----------VQDRMER----------------GGVEPDIITYNSLIHSHCREGRMREA  1062
                        + +RM +                 G  P++ ++N L++  C+EG++++A
Sbjct  203   NLKIPFNGCKCLLERMIKMSSPMVALKFYLEILDSGYPPNVYSFNILMNRLCKEGKVKDA  262

Query  1061  MRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRK  885
               +F +I K  + P  V++ TLI+GYC+ G++DE  RL   MEE  + P V TY++++  
Sbjct  263   QSIFDEIRKTGLQPTAVSFNTLINGYCKSGNLDEGFRLKMVMEEFRVFPDVFTYSALIDG  322

Query  884   FCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD  705
              C+  ++ ++  L  +M ++ + P++VT  TLI+G CK G +  AL++  +M   GL+ D
Sbjct  323   LCKACQLDDANHLFKEMCDRGLVPNDVTFTTLISGQCKNGRVDLALEIYQQMFTKGLKAD  382

Query  704   SFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLAD  525
                Y  L++G CK+     A++ + +M   G       Y+ L+D  C + + E  +++  
Sbjct  383   LVLYNTLVNGLCKSGYFREARKFVGEMTKRGLRLDKFTYTTLLDGSCKEGDLELALEMKK  442

Query  524   EFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEG  345
             E    G  +D   + AII  LC+ GK+  AER    M    +  D   YT +   + K+G
Sbjct  443   EMVKAGIQLDNVAFTAIISGLCRDGKIADAERTLREMLRAGLKPDDGTYTMVMDGFCKKG  502

Query  344   NTRAASDLFDEMYKRRLMVTlklykslsassKDENSL--LDLFWNNVMQRGLISHNVHNS  171
             + +    L  EM     +  +  Y  L      +  +   D+  N ++  G++  ++  +
Sbjct  503   DVKMGFKLLKEMQSDGHIPGVITYNVLMNGLCKQGQVKNADMLLNAMLNLGVVPDDITYN  562

Query  170   IFLKLH  153
             I L+ H
Sbjct  563   ILLQGH  568


 Score = 80.1 bits (196),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 77/138 (56%), Gaps = 0/138 (0%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A+++ + +    I+ D  A T +++ L ++G      +T ++M++ G+ P+   Y +++ 
Sbjct  437   ALEMKKEMVKAGIQLDNVAFTAIISGLCRDGKIADAERTLREMLRAGLKPDDGTYTMVMD  496

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               CK G+V+   + L EM+  G  P + T+N L++  C++G    A  + + M   GV P
Sbjct  497   GFCKKGDVKMGFKLLKEMQSDGHIPGVITYNVLMNGLCKQGQVKNADMLLNAMLNLGVVP  556

Query  1124  DIITYNSLIHSHCREGRM  1071
             D ITYN L+  HC+ G++
Sbjct  557   DDITYNILLQGHCKHGKL  574



>gb|KDO54845.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
 gb|KDO54846.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
Length=732

 Score =   258 bits (658),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 151/535 (28%), Positives = 277/535 (52%), Gaps = 5/535 (1%)
 Frame = -2

Query  1883  LVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE-TIPNY  1707
             LV+ + + + +G+ N+L   +  L+  S II   L  L      +   F  ++    PN 
Sbjct  58    LVEKILLNLKQGNVNSLRSYQFRLN--SVIIVEVLYRLRD-NLQVGQRFIDFIALNFPNV  114

Query  1706  RHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFS  1527
             +HS  S  +MI+ L + +    A+ ++ ++  K  +S   ++++ V +      NS +F 
Sbjct  115   KHSSMSLSAMIHFLVRGRRISDAQALILRMVRKSGVSRLEIVDSFVSTYSPCGSNSLIFD  174

Query  1526  WLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKL  1347
              ++  Y  +++  +  +VF  LR   I    +AC  LL  LVK G  D   + Y ++++ 
Sbjct  175   LVIRTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRS  234

Query  1346  GVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEA  1167
             G+  N++  N++++A CK  +++ A  FL EME KG++PD  T+NTLI+ YCR G   EA
Sbjct  235   GIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEA  294

Query  1166  LSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDG  990
               + + M   G++P + TYNSLI+  C++GR   A  +  + ++  ++P+  TY TL+  
Sbjct  295   FQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVE  354

Query  989   YCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPD  810
              CR  ++ EA  +   M  +G+ P + ++++++  F   G++  +     +M    + PD
Sbjct  355   SCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPD  414

Query  809   NVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF  630
             NV    +INGYC+ G ++ ALK++++MLE G   D  TY  +++G C+AK    A ++  
Sbjct  415   NVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFN  474

Query  629   DMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRG  450
             +M+  G  P +  ++ L+  +C   N    + L D  + +    DI  Y  +I   CK G
Sbjct  475   EMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVG  534

Query  449   KLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             +++ A + +  M  R+I  + + Y  L   Y   G+   A  L+ EM  + +  T
Sbjct  535   EMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPT  589


 Score =   238 bits (607),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 131/387 (34%), Positives = 205/387 (53%), Gaps = 1/387 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             + PD      L+N+  +EG  +  ++    M   G+ P +  YN LI+  CK G  ++A 
Sbjct  271   VYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAK  330

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             E L EM   G+ PD  T+NTL+   CR+    EA  +   M R GV PDI+++++LI   
Sbjct  331   EVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIF  390

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
              R G++  A+  F+++K   + P+ V YT +I+GYCR G + EAL++   M EKG    V
Sbjct  391   SRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDV  450

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYN+IL   C    + E+  L N+M E+ + PD  T  TLI+G+CK G++  AL + + 
Sbjct  451   VTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDI  510

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M +  ++PD  TY  LI GFCK  + E+A ++  DMI+   SP+Y +Y  L++ YC   +
Sbjct  511   MTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGH  570

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
                  +L  E  G+G    +     II+  C+ G    A+ F   M    +  DS+ Y +
Sbjct  571   VTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNT  630

Query  371   LAYAYFKEGNTRAASDLFDEMYKRRLM  291
             L   + +E N   A  L  +M  + L+
Sbjct  631   LINGFVREENMDKAFALVSKMENQGLV  657


 Score =   228 bits (580),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/432 (28%), Positives = 219/432 (51%), Gaps = 36/432 (8%)
 Frame = -2

Query  1487  DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLI  1308
             +A Q+   +    +KP       L+N L K+G  D   +   +M+++G+ P+   YN L+
Sbjct  293   EAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLL  352

Query  1307  HACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL-----------------------  1197
                C+   + +A+E   EM  +G+ PD+ +F+TLI +                       
Sbjct  353   VESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLV  412

Query  1196  ------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL  1053
                         YCR G   EAL ++D M   G   D++TYN++++  CR   + EA  L
Sbjct  413   PDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDL  472

Query  1052  FKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCE  876
             F ++ E+ V P+  T+TTLI G+C+ G++++AL L   M +K + P + TYN+++  FC+
Sbjct  473   FNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCK  532

Query  875   EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
              G M+++ KL   M  +KI P+ ++   LINGYC +G +  A ++  +M+  G++P   +
Sbjct  533   VGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVS  592

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
                +I G+C++ D  +A E +  M++ G  P   +Y+ L++ +  + N +    L  +  
Sbjct  593   CNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKME  652

Query  515   GRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTR  336
              +G   D+  Y  I+   C++G++  +E     M E+ +  D   YT+L   +  + N +
Sbjct  653   NQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLK  712

Query  335   AASDLFDEMYKR  300
              A    DEM +R
Sbjct  713   EAFRFHDEMLQR  724


 Score =   227 bits (579),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 202/350 (58%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+  ++ + +   A+  F  ++   + PD    T+++N   + G      K   +M+
Sbjct  383   FSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEML  442

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G + ++  YN +++  C++  + +AD+  +EM  +G+FPD YTF TLI  +C+ G   
Sbjct  443   EKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMN  502

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +AL++ D M +  ++PDI+TYN+LI   C+ G M +A +L+ D I  K++PN ++Y  LI
Sbjct  503   KALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILI  562

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +GYC +G + EA RL   M  KG+ P + + N+I++ +C  G   ++ + L++M  + ++
Sbjct  563   NGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVD  622

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD+++ NTLING+ +  ++  A  + +KM   GL PD  TY  ++ GFC+      ++ +
Sbjct  623   PDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELI  682

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             ++ MI  G +P    Y+ L++ +  QNN +   +  DE   RG+  D +F
Sbjct  683   LWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  732



>ref|XP_009801387.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
 ref|XP_009801388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
 ref|XP_009801389.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
Length=767

 Score =   258 bits (660),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 160/531 (30%), Positives = 265/531 (50%), Gaps = 15/531 (3%)
 Frame = -2

Query  1868  CVIVLKGHWN---NLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHS  1698
              V +LKGH     N L  +      S++++ +         +++W+  +          +
Sbjct  39    AVSILKGHDPIPLNSLSSQFTPQYASSLLSQSQFDKPLVLRFINWARHRQF-------FN  91

Query  1697  LQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPA-VLNALVRSDDDSDVNSQVFSWL  1521
             LQ     I+ILT+ K +K+A+ +   +A K        V   L  +      +S VF  +
Sbjct  92    LQCKCISIHILTRFKLYKTAQSLAEDVAVKSADDKGEFVFLCLKDTYHSCKSSSAVFDLM  151

Query  1520  LIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK---EGLTDTVWKTYKKMIK  1350
             +  Y++ K    A+ VFE  +         +   +L++L++    G  +   K Y  M+ 
Sbjct  152   VKSYSHLKMIDKAMNVFELAKSNGFMLTVLSYNSILDALIRVSRNGSFELAQKFYDDMVN  211

Query  1349  LGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYE  1170
              GV PN++ YN++I   C  G++ K   F  EME  G  P + T+NT+I  YC+ G   E
Sbjct  212   SGVSPNVYTYNIMIRGLCVKGDLNKGLAFFKEMEKCGCLPSVVTYNTIIGAYCKIGKVDE  271

Query  1169  ALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLID  993
             A+ +   M+   +EP ++TYN++I+  CREGRM+E   + KD++ K + P+EVTY TL++
Sbjct  272   AVELLKLMQVRNLEPSVVTYNAIINGLCREGRMKETSEVLKDMRGKGLVPDEVTYNTLVN  331

Query  992   GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEP  813
             GYCR G+  +AL LHS M   GL P V TY S++   C+ G +  + +  +Q+  + + P
Sbjct  332   GYCREGNFHQALVLHSEMLRNGLSPDVVTYTSLINSMCKTGNLHRAMEFFDQLRARGLYP  391

Query  812   DNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
             +  T  TLI G+ + G +  A K+ N+M+ +G  P   TY AL++G C     E A  VI
Sbjct  392   NERTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNALVNGHCALGRMEDALSVI  451

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
              +M   G  P    YS ++  +C  +N E       +   +G   D+  Y ++I+ LC++
Sbjct  452   QEMERRGVVPDVVTYSTMISGFCRNHNLERAFCAKQQMVEKGVSPDVITYSSLIQGLCEQ  511

Query  452   GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
               L  A   F  M    I  D   YT+L  AY  +G+ + A +L +EM  +
Sbjct  512   QSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCLKGDIKGALNLHNEMINK  562


 Score =   237 bits (604),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/471 (29%), Positives = 244/471 (52%), Gaps = 26/471 (6%)
 Frame = -2

Query  1703  HSLQSSWSMIYILTK-HKHFK---SAKDMLHQIACKDF----LSSPAVLNALVRS-----  1563
             HS +SS ++  ++ K + H K    A ++        F    LS  ++L+AL+R      
Sbjct  139   HSCKSSSAVFDLMVKSYSHLKMIDKAMNVFELAKSNGFMLTVLSYNSILDALIRVSRNGS  198

Query  1562  --------DD--DSDVNSQVFSWLLIFYANSKRT--WDAIQVFEHLRICRIKPDPHACTV  1419
                     DD  +S V+  V+++ ++      +      +  F+ +  C   P       
Sbjct  199   FELAQKFYDDMVNSGVSPNVYTYNIMIRGLCVKGDLNKGLAFFKEMEKCGCLPSVVTYNT  258

Query  1418  LLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKG  1239
             ++ +  K G  D   +  K M    + P++  YN +I+  C+ G +++  E L +M  KG
Sbjct  259   IIGAYCKIGKVDEAVELLKLMQVRNLEPSVVTYNAIINGLCREGRMKETSEVLKDMRGKG  318

Query  1238  IFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAM  1059
             + PD  T+NTL++ YCR G  ++AL +   M R G+ PD++TY SLI+S C+ G +  AM
Sbjct  319   LVPDEVTYNTLVNGYCREGNFHQALVLHSEMLRNGLSPDVVTYTSLINSMCKTGNLHRAM  378

Query  1058  RLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKF  882
               F  ++ + + PNE TYTTLI G+ + G ++EA +L + M   G  P + TYN+++   
Sbjct  379   EFFDQLRARGLYPNERTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNALVNGH  438

Query  881   CEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
             C  GRM+++  ++ +M  + + PD VT +T+I+G+C+  ++  A   K +M+E G+ PD 
Sbjct  439   CALGRMEDALSVIQEMERRGVVPDVVTYSTMISGFCRNHNLERAFCAKQQMVEKGVSPDV  498

Query  701   FTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADE  522
              TY +LI G C+ +    A+E+  +M+  G  P    Y+ L+  YCL+ + +  + L +E
Sbjct  499   ITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCLKGDIKGALNLHNE  558

Query  521   FSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSL  369
                +G+  D+  Y  +I  L K+ +   A+R    +   + + +SV Y  L
Sbjct  559   MINKGFFPDVVTYSVLINGLNKQARTREAKRLLFKLLYEQSVPNSVTYDML  609


 Score =   226 bits (576),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/399 (31%), Positives = 208/399 (52%), Gaps = 25/399 (6%)
 Frame = -2

Query  1496  RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYN  1317
             R  +  +V + +R   + PD      L+N   +EG        + +M++ G+ P++  Y 
Sbjct  303   RMKETSEVLKDMRGKGLVPDEVTYNTLVNGYCREGNFHQALVLHSEMLRNGLSPDVVTYT  362

Query  1316  VLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERG  1137
              LI++ CK+G + +A EF  ++  +G++P+  T+ TLI  + ++G   EA  + + M   
Sbjct  363   SLINSMCKTGNLHRAMEFFDQLRARGLYPNERTYTTLIVGFSQQGFMNEAYKLLNEMISS  422

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P I+TYN+L++ HC  GRM +A+ + ++++ + V P+ VTY+T+I G+CR  +++ A
Sbjct  423   GFSPSIVTYNALVNGHCALGRMEDALSVIQEMERRGVVPDVVTYSTMISGFCRNHNLERA  482

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
                   M EKG+ P V TY+S+++  CE+  + E+ +L  +M    I+PD  T  TLI  
Sbjct  483   FCAKQQMVEKGVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGA  542

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
             YC  GDI  AL + N+M+  G  PD  TY  LI+G  K   T  AK ++F ++     P+
Sbjct  543   YCLKGDIKGALNLHNEMINKGFFPDVVTYSVLINGLNKQARTREAKRLLFKLLYEQSVPN  602

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRA--IIRRLCKRGKLDCAERF  426
                Y  L+++                      C D+ F  A  +I+  C +G LD A+R 
Sbjct  603   SVTYDMLIES----------------------CNDLDFKSATDLIKGFCMKGLLDEADRV  640

Query  425   FGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             F +M +++       Y  L + + + GN   A  L+ EM
Sbjct  641   FELMLQKDKKPSEAAYNLLIHGHSRGGNLHRALHLYREM  679


 Score =   189 bits (480),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/365 (31%), Positives = 183/365 (50%), Gaps = 16/365 (4%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A++ F+ LR   + P+    T L+    ++G  +  +K   +MI  G  P+I  YN L++
Sbjct  377   AMEFFDQLRARGLYPNERTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNALVN  436

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               C  G +E A   + EME +G+ PD+ T++T+IS +CR      A   + +M   GV P
Sbjct  437   GHCALGRMEDALSVIQEMERRGVVPDVVTYSTMISGFCRNHNLERAFCAKQQMVEKGVSP  496

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D+ITY+SLI   C +  + EA  LF++ ++  + P++ TYTTLI  YC  GDI  AL LH
Sbjct  497   DVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCLKGDIKGALNLH  556

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVT-------CNTL  789
             + M  KG  P V TY+ ++    ++ R +E+ +LL ++  ++  P++VT       CN L
Sbjct  557   NEMINKGFFPDVVTYSVLINGLNKQARTREAKRLLFKLLYEQSVPNSVTYDMLIESCNDL  616

Query  788   --------INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
                     I G+C  G +  A +V   ML+   +P    Y  LIHG  +  +  RA  + 
Sbjct  617   DFKSATDLIKGFCMKGLLDEADRVFELMLQKDKKPSEAAYNLLIHGHSRGGNLHRALHLY  676

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
              +M++ GF P   +   L+     +  +E L ++     G     D    + I+    K 
Sbjct  677   REMVSFGFVPHTVSLIVLMKELFKEGMSEELHQVIQSTLGSCKLADGELAKGIVDVNYKE  736

Query  452   GKLDC  438
             G +D 
Sbjct  737   GNMDA  741


 Score =   121 bits (303),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 99/388 (26%), Positives = 163/388 (42%), Gaps = 37/388 (10%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN R    +  ++I   ++      A  +L+++    F  S    NALV           
Sbjct  391   PNER----TYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNALVNG---------  437

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
                     +    R  DA+ V + +    + PD    + +++   +    +  +   ++M
Sbjct  438   --------HCALGRMEDALSVIQEMERRGVVPDVVTYSTMISGFCRNHNLERAFCAKQQM  489

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             ++ GV P++  Y+ LI   C+   + +A E   EM   GI PD +T+ TLI  YC +G  
Sbjct  490   VEKGVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTTLIGAYCLKGDI  549

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL-FKDIKEKVTPNEVTY---  1008
               AL++ + M   G  PD++TY+ LI+   ++ R REA RL FK + E+  PN VTY   
Sbjct  550   KGALNLHNEMINKGFFPDVVTYSVLINGLNKQARTREAKRLLFKLLYEQSVPNSVTYDML  609

Query  1007  ------------TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
                         T LI G+C  G +DEA R+   M +K   P  A YN ++      G +
Sbjct  610   IESCNDLDFKSATDLIKGFCMKGLLDEADRVFELMLQKDKKPSEAAYNLLIHGHSRGGNL  669

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
               +  L  +M      P  V+   L+    K G      +V    L +    D    K +
Sbjct  670   HRALHLYREMVSFGFVPHTVSLIVLMKELFKEGMSEELHQVIQSTLGSCKLADGELAKGI  729

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPS  600
             +    K  + +    V+ DM   G  P+
Sbjct  730   VDVNYKEGNMDAVFNVLTDMAKDGLFPN  757


 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 105/256 (41%), Gaps = 3/256 (1%)
 Frame = -2

Query  1052  FKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILR---KF  882
              KD       +   +  ++  Y  +  ID+A+ +    +  G    V +YNSIL    + 
Sbjct  134   LKDTYHSCKSSSAVFDLMVKSYSHLKMIDKAMNVFELAKSNGFMLTVLSYNSILDALIRV  193

Query  881   CEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
                G  + + K  + M    + P+  T N +I G C  GD+   L    +M + G  P  
Sbjct  194   SRNGSFELAQKFYDDMVNSGVSPNVYTYNIMIRGLCVKGDLNKGLAFFKEMEKCGCLPSV  253

Query  701   FTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADE  522
              TY  +I  +CK    + A E++  M      PS   Y+ +++  C +   +   ++  +
Sbjct  254   VTYNTIIGAYCKIGKVDEAVELLKLMQVRNLEPSVVTYNAIINGLCREGRMKETSEVLKD  313

Query  521   FSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGN  342
               G+G   D   Y  ++   C+ G    A      M    +  D V YTSL  +  K GN
Sbjct  314   MRGKGLVPDEVTYNTLVNGYCREGNFHQALVLHSEMLRNGLSPDVVTYTSLINSMCKTGN  373

Query  341   TRAASDLFDEMYKRRL  294
                A + FD++  R L
Sbjct  374   LHRAMEFFDQLRARGL  389



>gb|KHG06670.1| hypothetical protein F383_33889 [Gossypium arboreum]
 gb|KHG20330.1| hypothetical protein F383_25233 [Gossypium arboreum]
Length=611

 Score =   255 bits (651),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 135/471 (29%), Positives = 246/471 (52%), Gaps = 1/471 (0%)
 Frame = -2

Query  1745  WSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVR  1566
             +SFFK++ + P +RH+L S  +M + L  H     A+ +L+ +  +    S + + A V 
Sbjct  78    FSFFKFLSSHPTFRHTLHSYSAMSHFLVAHNMLPQARFLLNFLVSRKGKDSASSIFASVL  137

Query  1565  SDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
                 +     VF  L+I Y +     DAIQ F  +R  +++     C  L + ++K    
Sbjct  138   ETKGTYQCDFVFDSLMIAYTDLGFVSDAIQCFRLVRKHKLRVPFRGCKYLFDRMMKISSP  197

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
                   Y +++  G  PN++ +N+L++  C+ G ++ A     E+  +G+   + +FNTL
Sbjct  198   IVSLGFYMEILDYGFPPNVYSFNILMNKLCREGLIKDAQMVFDEIARRGLHASVVSFNTL  257

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKV  1029
             I+ YC+ G   E   ++  ME  G+ PD+ TY+ LI+  C+E R+ +A  LF+++    +
Sbjct  258   INGYCKSGNLDEGFRLRSAMEEAGIRPDVFTYSVLINGLCKESRLDKANELFEEMCNRGL  317

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              PN+V +T+LIDG C+ G  D A+  +     K   P +  YNS++   C+ G +K + K
Sbjct  318   IPNDVIFTSLIDGMCKNGRTDLAMGTYQQFLTKAFKPDLIMYNSLINGLCKAGDLKGAKK  377

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L+ +M  + ++PD  T   L++G+CK GD+ SAL ++ +M++ G++ D   + ALI G C
Sbjct  378   LIAEMSLRGLKPDKFTYTILLDGFCKEGDMESALGIRVEMIKQGIKLDDVAFTALISGLC  437

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K +    A+  + +M+ AG  P   AY+ ++D +C + +     KL       G+   + 
Sbjct  438   KEERHLDAERALREMLDAGMKPDAAAYTMVMDGFCKKGDVRMGFKLLKLMQSDGHVPGVV  497

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTR  336
              Y  ++  LCK+G+L  A +    M    ++ D++ Y  L   + K+ N +
Sbjct  498   TYNVLMNGLCKQGQLRNANKLLDNMLNLGVVPDTITYNILLDGHCKKANPK  548


 Score =   170 bits (430),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 154/277 (56%), Gaps = 1/277 (0%)
 Frame = -2

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEA  960
             G  P++ ++N L++  CREG +++A  +F +I  + +  + V++ TLI+GYC+ G++DE 
Sbjct  211   GFPPNVYSFNILMNKLCREGLIKDAQMVFDEIARRGLHASVVSFNTLINGYCKSGNLDEG  270

Query  959   LRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLING  780
              RL SAMEE G+ P V TY+ ++   C+E R+ ++ +L  +M  + + P++V   +LI+G
Sbjct  271   FRLRSAMEEAGIRPDVFTYSVLINGLCKESRLDKANELFEEMCNRGLIPNDVIFTSLIDG  330

Query  779   YCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPS  600
              CK G    A+    + L    +PD   Y +LI+G CKA D + AK++I +M   G  P 
Sbjct  331   MCKNGRTDLAMGTYQQFLTKAFKPDLIMYNSLINGLCKAGDLKGAKKLIAEMSLRGLKPD  390

Query  599   YCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFG  420
                Y+ L+D +C + + E+ + +  E   +G  +D   + A+I  LCK  +   AER   
Sbjct  391   KFTYTILLDGFCKEGDMESALGIRVEMIKQGIKLDDVAFTALISGLCKEERHLDAERALR  450

Query  419   MMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              M +  +  D+  YT +   + K+G+ R    L   M
Sbjct  451   EMLDAGMKPDAAAYTMVMDGFCKKGDVRMGFKLLKLM  487


 Score =   169 bits (428),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 161/306 (53%), Gaps = 5/306 (2%)
 Frame = -2

Query  1433  HACTVLLNSLV----KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADE  1266
             HA  V  N+L+    K G  D  ++    M + G+ P++  Y+VLI+  CK   ++KA+E
Sbjct  248   HASVVSFNTLINGYCKSGNLDEGFRLRSAMEEAGIRPDVFTYSVLINGLCKESRLDKANE  307

Query  1265  FLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHC  1086
                EM  +G+ P+   F +LI   C+ G    A+    +      +PD+I YNSLI+  C
Sbjct  308   LFEEMCNRGLIPNDVIFTSLIDGMCKNGRTDLAMGTYQQFLTKAFKPDLIMYNSLINGLC  367

Query  1085  REGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVA  909
             + G ++ A +L  ++  + + P++ TYT L+DG+C+ GD++ AL +   M ++G+     
Sbjct  368   KAGDLKGAKKLIAEMSLRGLKPDKFTYTILLDGFCKEGDMESALGIRVEMIKQGIKLDDV  427

Query  908   TYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKM  729
              + +++   C+E R  ++ + L +M +  ++PD      +++G+CK GD+    K+   M
Sbjct  428   AFTALISGLCKEERHLDAERALREMLDAGMKPDAAAYTMVMDGFCKKGDVRMGFKLLKLM  487

Query  728   LEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNN  549
                G  P   TY  L++G CK      A +++ +M+  G  P    Y+ L+D +C + N 
Sbjct  488   QSDGHVPGVVTYNVLMNGLCKQGQLRNANKLLDNMLNLGVVPDTITYNILLDGHCKKANP  547

Query  548   EALVKL  531
             +   KL
Sbjct  548   KDFGKL  553


 Score =   137 bits (346),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/311 (27%), Positives = 154/311 (50%), Gaps = 8/311 (3%)
 Frame = -2

Query  1223  YTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD  1044
             +  N L+S   R+G    +      +E  G       ++SL+ ++   G + +A++ F+ 
Sbjct  115   FLLNFLVS---RKGKDSASSIFASVLETKGTYQCDFVFDSLMIAYTDLGFVSDAIQCFRL  171

Query  1043  IKE---KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEE  873
             +++   +V      Y  L D   ++     +L  +  + + G  P V ++N ++ K C E
Sbjct  172   VRKHKLRVPFRGCKY--LFDRMMKISSPIVSLGFYMEILDYGFPPNVYSFNILMNKLCRE  229

Query  872   GRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTY  693
             G +K++  + +++  + +    V+ NTLINGYCK G++    ++++ M EAG+RPD FTY
Sbjct  230   GLIKDAQMVFDEIARRGLHASVVSFNTLINGYCKSGNLDEGFRLRSAMEEAGIRPDVFTY  289

Query  692   KALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSG  513
               LI+G CK    ++A E+  +M   G  P+   ++ L+D  C     +  +    +F  
Sbjct  290   SVLINGLCKESRLDKANELFEEMCNRGLIPNDVIFTSLIDGMCKNGRTDLAMGTYQQFLT  349

Query  512   RGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRA  333
             + +  D+  Y ++I  LCK G L  A++    M  R +  D   YT L   + KEG+  +
Sbjct  350   KAFKPDLIMYNSLINGLCKAGDLKGAKKLIAEMSLRGLKPDKFTYTILLDGFCKEGDMES  409

Query  332   ASDLFDEMYKR  300
             A  +  EM K+
Sbjct  410   ALGIRVEMIKQ  420


 Score =   108 bits (270),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 129/281 (46%), Gaps = 38/281 (14%)
 Frame = -2

Query  1559  DDSDVNSQVFSWLLIFYANSK--RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
             +++ +   VF++ ++     K  R   A ++FE +    + P+    T L++ + K G T
Sbjct  278   EEAGIRPDVFTYSVLINGLCKESRLDKANELFEEMCNRGLIPNDVIFTSLIDGMCKNGRT  337

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
             D    TY++ +     P++ +YN LI+  CK+G+++ A + ++EM  +G+ PD +T+  L
Sbjct  338   DLAMGTYQQFLTKAFKPDLIMYNSLINGLCKAGDLKGAKKLIAEMSLRGLKPDKFTYTIL  397

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-----  1041
             +  +C+ G    AL ++  M + G++ D + + +LI   C+E R  +A R  +++     
Sbjct  398   LDGFCKEGDMESALGIRVEMIKQGIKLDDVAFTALISGLCKEERHLDAERALREMLDAGM  457

Query  1040  -------------------------------KEKVTPNEVTYTTLIDGYCRVGDIDEALR  954
                                             +   P  VTY  L++G C+ G +  A +
Sbjct  458   KPDAAAYTMVMDGFCKKGDVRMGFKLLKLMQSDGHVPGVVTYNVLMNGLCKQGQLRNANK  517

Query  953   LHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             L   M   G+ P   TYN +L   C++   K+  KL    G
Sbjct  518   LLDNMLNLGVVPDTITYNILLDGHCKKANPKDFGKLKTSCG  558



>ref|XP_006423135.1| hypothetical protein CICLE_v10030406mg [Citrus clementina]
 ref|XP_006479369.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, 
mitochondrial-like [Citrus sinensis]
 gb|ESR36375.1| hypothetical protein CICLE_v10030406mg [Citrus clementina]
Length=645

 Score =   256 bits (653),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 156/519 (30%), Positives = 260/519 (50%), Gaps = 17/519 (3%)
 Frame = -2

Query  1847  HWNNLLKPKIGLSVTSTIINHTLLTL--SP--CWFWLSWSFFKWVETIPNYRHSLQSSWS  1680
             H+   L PKI    T ++I   LL L  +P   + +++   F+ +  I       ++   
Sbjct  72    HFIKQLAPKI----TPSLITSALLDLHKNPDLAFQFINHLGFRRIRDI-------KTRCF  120

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDV-NSQVFSWLLIFYAN  1503
              I ++++    K    +L +       +   V N L  + D+  + +S VF +LL     
Sbjct  121   AIAVISRLSTSKPTLQLLKETLNSGIATIQVVFNELAVARDELRIRSSTVFDFLLRVCCE  180

Query  1502  SKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHI  1323
              KR  DA + F  ++     P   +C  +L+  VK       W  Y +M ++ +  ++  
Sbjct  181   LKRDDDAFKCFYMMKEKGFVPKIESCNDMLSMFVKLNRPYKAWVLYAEMFRMRIKSSVCT  240

Query  1322  YNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRME  1143
             +N++I+  CK G+++KA +FL  ME  GI P++ T+NT++  YC  G    A  V + M+
Sbjct  241   FNIMINLLCKEGKLQKAKDFLGFMESLGIKPNIVTYNTIVHGYCLSGRIEGARLVLNAMK  300

Query  1142  RGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDID  966
               GV+PD  TY S +   C+EGR+ EA R+ + +KE  + P  VTY TLIDGYC  G+++
Sbjct  301   SRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLE  360

Query  965   EALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLI  786
              A      M ++G+ P  +TYN ++ +   E +M E+  +L +MGEK I PD++T N LI
Sbjct  361   MAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILI  420

Query  785   NGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFS  606
             NGYC+ G+   A  + ++M+  G++P   TY +LI    K      A ++  + +A G  
Sbjct  421   NGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGML  480

Query  605   PSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERF  426
             P    ++ L+D +C   N E    L  E        D   Y  ++   C++GK++ A R 
Sbjct  481   PDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRL  540

Query  425   FGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                M+ R I  D + Y +L   Y K G+ + A  + DEM
Sbjct  541   LDQMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEM  579


 Score =   212 bits (540),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/339 (33%), Positives = 190/339 (56%), Gaps = 3/339 (1%)
 Frame = -2

Query  1586  VLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNS  1407
             VLNA+       D  S  +   +       R  +A ++ E ++   + P       L++ 
Sbjct  295   VLNAMKSRGVQPD--SYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDG  352

Query  1406  LVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPD  1227
                +G  +  +    +M+K G++P    YN+LIH      ++ +AD+ L EM  KGI PD
Sbjct  353   YCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPD  412

Query  1226  LYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFK  1047
               T+N LI+ YCR G   +A S+ D M   G++P ++TY SLI    ++ RM EA +LF+
Sbjct  413   SITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFE  472

Query  1046  DIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEG  870
             +   K + P+ V +  LIDG+C  G+I+ A  L   M+   + P   TYN+++   C +G
Sbjct  473   NFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQG  532

Query  869   RMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYK  690
             +++E+ +LL+QM  + I+PD+++ NTLI+GY K GD+  A +V+++ML  G  P   TY 
Sbjct  533   KVEEARRLLDQMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEMLSVGFNPTRLTYN  592

Query  689   ALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
             ALI G CK ++ + A+E++ +M++ G +P    Y  L++
Sbjct  593   ALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIE  631


 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 129/421 (31%), Positives = 195/421 (46%), Gaps = 36/421 (9%)
 Frame = -2

Query  1523  LLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLG  1344
             +L  +    R + A  ++  +   RIK       +++N L KEG           M  LG
Sbjct  209   MLSMFVKLNRPYKAWVLYAEMFRMRIKSSVCTFNIMINLLCKEGKLQKAKDFLGFMESLG  268

Query  1343  VLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTF-----------------  1215
             + PNI  YN ++H  C SG +E A   L+ M+ +G+ PD YT+                 
Sbjct  269   IKPNIVTYNTIVHGYCLSGRIEGARLVLNAMKSRGVQPDSYTYGSFVSGMCKEGRLEEAS  328

Query  1214  ------------------NTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
                               NTLI  YC +G    A S +D M + G+ P   TYN LIH  
Sbjct  329   RMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHEL  388

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
               E +M EA  + K++ EK + P+ +TY  LI+GYCR G+  +A  LH  M  KG+ P +
Sbjct  389   LMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTM  448

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TY S++    ++ RM E+ +L      K + PD V  N LI+G+C  G+I  A  +  +
Sbjct  449   LTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKE  508

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M    + PD  TY  L+HG C+    E A+ ++  M   G  P + +Y+ L+  Y  + +
Sbjct  509   MDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISYNTLISGYSKRGD  568

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
              +   ++ DE    G+      Y A+I+ LCK  + D AE     M  + I  D   Y S
Sbjct  569   MKDAFRVRDEMLSVGFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFS  628

Query  371   L  369
             L
Sbjct  629   L  629


 Score =   176 bits (446),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 185/378 (49%), Gaps = 36/378 (10%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRM  1146
             +++ L+  CC+    + A +    M+ KG  P + + N ++S++ +    Y+A  +   M
Sbjct  170   VFDFLLRVCCELKRDDDAFKCFYMMKEKGFVPKIESCNDMLSMFVKLNRPYKAWVLYAEM  229

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDI  969
              R  ++  + T+N +I+  C+EG++++A      ++   + PN VTY T++ GYC  G I
Sbjct  230   FRMRIKSSVCTFNIMINLLCKEGKLQKAKDFLGFMESLGIKPNIVTYNTIVHGYCLSGRI  289

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
             + A  + +AM+ +G+ P   TY S +   C+EGR++E++++L QM E  + P  VT NTL
Sbjct  290   EGARLVLNAMKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTL  349

Query  788   INGYCKIGDIVSALKVKNKML-----------------------------------EAGL  714
             I+GYC  G++  A   +++M+                                   E G+
Sbjct  350   IDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGI  409

Query  713   RPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVK  534
              PDS TY  LI+G+C+  + ++A  +  +MI  G  P+   Y+ L+     QN      +
Sbjct  410   VPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQ  469

Query  533   LADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYF  354
             L + F  +G   DI  + A+I   C  G ++ A      M   ++  D V Y +L +   
Sbjct  470   LFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRC  529

Query  353   KEGNTRAASDLFDEMYKR  300
             ++G    A  L D+M +R
Sbjct  530   RQGKVEEARRLLDQMKRR  547


 Score =   130 bits (326),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 149/310 (48%), Gaps = 3/310 (1%)
 Frame = -2

Query  1112  YNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAME  936
             ++ L+   C   R  +A + F  +KEK   P   +   ++  + ++    +A  L++ M 
Sbjct  171   FDFLLRVCCELKRDDDAFKCFYMMKEKGFVPKIESCNDMLSMFVKLNRPYKAWVLYAEMF  230

Query  935   EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
                +   V T+N ++   C+EG+++++   L  M    I+P+ VT NT+++GYC  G I 
Sbjct  231   RMRIKSSVCTFNIMINLLCKEGKLQKAKDFLGFMESLGIKPNIVTYNTIVHGYCLSGRIE  290

Query  755   SALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLV  576
              A  V N M   G++PDS+TY + + G CK    E A  ++  M   G  P+   Y+ L+
Sbjct  291   GARLVLNAMKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLI  350

Query  575   DTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
             D YC + N E      DE   +G     S Y  +I  L    K+  A+     M E+ I+
Sbjct  351   DGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIV  410

Query  395   GDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSLL--DLF  222
              DS+ Y  L   Y + GN + A  L DEM  + +  T+  Y SL      +N ++  D  
Sbjct  411   PDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQL  470

Query  221   WNNVMQRGLI  192
             + N + +G++
Sbjct  471   FENFLAKGML  480


 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 127/277 (46%), Gaps = 18/277 (6%)
 Frame = -2

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANS  1500
             +I+ L   +    A DML ++  K  +      N L+                   Y   
Sbjct  384   LIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILING-----------------YCRC  426

Query  1499  KRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIY  1320
                  A  + + +    I+P     T L+  L K+       + ++  +  G+LP+I ++
Sbjct  427   GNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMF  486

Query  1319  NVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMER  1140
             N LI   C +G +E+A   L EM+   + PD  T+NTL+   CR+G   EA  + D+M+R
Sbjct  487   NALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKR  546

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G++PD I+YN+LI  + + G M++A R+  + +     P  +TY  LI G C+  + D 
Sbjct  547   RGIKPDHISYNTLISGYSKRGDMKDAFRVRDEMLSVGFNPTRLTYNALIQGLCKNQEGDL  606

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKEST  852
             A  L   M  KG+ P   TY S++       +  ES+
Sbjct  607   AEELLREMVSKGITPDDNTYFSLIEGIASVDKAAESS  643



>ref|NP_172439.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|O04491.1|PPR26_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein 
At1g09680 [Arabidopsis thaliana]
 gb|AAB60724.1| F21M12.7 gene product [Arabidopsis thaliana]
 gb|AEE28479.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=607

 Score =   254 bits (650),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/497 (27%), Positives = 258/497 (52%), Gaps = 4/497 (1%)
 Frame = -2

Query  1826  PKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHF  1647
             P + +     +INH  L+L     +   +FFK++ + P +R ++++ + +   L  H+ F
Sbjct  78    PSLSVHHVVDLINHNPLSLPQRSIF---AFFKFISSQPGFRFTVETYFVLARFLAVHEMF  134

Query  1646  KSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFE  1467
               A+ ++  +  +   +S + +   +     + +   +   L+I Y +     DAIQ F 
Sbjct  135   TEAQSLIELVVSRKGKNSASSVFISLVEMRVTPMCGFLVDALMITYTDLGFIPDAIQCFR  194

Query  1466  HLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSG  1287
               R  R       C  LL+ ++K   T T+W  Y +++  G   N++++N+L++  CK G
Sbjct  195   LSRKHRFDVPIRGCGNLLDRMMKLNPTGTIWGFYMEILDAGFPLNVYVFNILMNKFCKEG  254

Query  1286  EVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYN  1107
              +  A +   E+  + + P + +FNTLI+ YC+ G   E   ++ +ME+    PD+ TY+
Sbjct  255   NISDAQKVFDEITKRSLQPTVVSFNTLINGYCKVGNLDEGFRLKHQMEKSRTRPDVFTYS  314

Query  1106  SLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEK  930
             +LI++ C+E +M  A  LF ++ K  + PN+V +TTLI G+ R G+ID     +  M  K
Sbjct  315   ALINALCKENKMDGAHGLFDEMCKRGLIPNDVIFTTLIHGHSRNGEIDLMKESYQKMLSK  374

Query  929   GLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSA  750
             GL P +  YN+++  FC+ G +  +  +++ M  + + PD +T  TLI+G+C+ GD+ +A
Sbjct  375   GLQPDIVLYNTLVNGFCKNGDLVAARNIVDGMIRRGLRPDKITYTTLIDGFCRGGDVETA  434

Query  749   LKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT  570
             L+++ +M + G+  D   + AL+ G CK      A+  + +M+ AG  P    Y+ ++D 
Sbjct  435   LEIRKEMDQNGIELDRVGFSALVCGMCKEGRVIDAERALREMLRAGIKPDDVTYTMMMDA  494

Query  569   YCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
             +C + + +   KL  E    G+   +  Y  ++  LCK G++  A+     M    ++ D
Sbjct  495   FCKKGDAQTGFKLLKEMQSDGHVPSVVTYNVLLNGLCKLGQMKNADMLLDAMLNIGVVPD  554

Query  389   SVVYTSLAYAYFKEGNT  339
              + Y +L   + +  N+
Sbjct  555   DITYNTLLEGHHRHANS  571


 Score =   120 bits (300),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 124/273 (45%), Gaps = 35/273 (13%)
 Frame = -2

Query  1022  NEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLL  843
             N   +  L++ +C+ G+I +A ++   + ++ L P V ++N+++  +C+ G + E  +L 
Sbjct  239   NVYVFNILMNKFCKEGNISDAQKVFDEITKRSLQPTVVSFNTLINGYCKVGNLDEGFRLK  298

Query  842   NQMGEKKIEPDNVTCNTLINGYCK-----------------------------------I  768
             +QM + +  PD  T + LIN  CK                                    
Sbjct  299   HQMEKSRTRPDVFTYSALINALCKENKMDGAHGLFDEMCKRGLIPNDVIFTTLIHGHSRN  358

Query  767   GDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAY  588
             G+I    +   KML  GL+PD   Y  L++GFCK  D   A+ ++  MI  G  P    Y
Sbjct  359   GEIDLMKESYQKMLSKGLQPDIVLYNTLVNGFCKNGDLVAARNIVDGMIRRGLRPDKITY  418

Query  587   SWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQE  408
             + L+D +C   + E  +++  E    G  +D   + A++  +CK G++  AER    M  
Sbjct  419   TTLIDGFCRGGDVETALEIRKEMDQNGIELDRVGFSALVCGMCKEGRVIDAERALREMLR  478

Query  407   REILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
               I  D V YT +  A+ K+G+ +    L  EM
Sbjct  479   AGIKPDDVTYTMMMDAFCKKGDAQTGFKLLKEM  511


 Score =   117 bits (293),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 108/209 (52%), Gaps = 0/209 (0%)
 Frame = -2

Query  935  EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
            + G    V  +N ++ KFC+EG + ++ K+ +++ ++ ++P  V+ NTLINGYCK+G++ 
Sbjct  233  DAGFPLNVYVFNILMNKFCKEGNISDAQKVFDEITKRSLQPTVVSFNTLINGYCKVGNLD  292

Query  755  SALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLV  576
               ++K++M ++  RPD FTY ALI+  CK    + A  +  +M   G  P+   ++ L+
Sbjct  293  EGFRLKHQMEKSRTRPDVFTYSALINALCKENKMDGAHGLFDEMCKRGLIPNDVIFTTLI  352

Query  575  DTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
              +      + + +   +   +G   DI  Y  ++   CK G L  A      M  R + 
Sbjct  353  HGHSRNGEIDLMKESYQKMLSKGLQPDIVLYNTLVNGFCKNGDLVAARNIVDGMIRRGLR  412

Query  395  GDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             D + YT+L   + + G+   A ++  EM
Sbjct  413  PDKITYTTLIDGFCRGGDVETALEIRKEM  441


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 82/168 (49%), Gaps = 0/168 (0%)
 Frame = -2

Query  797  NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
            N L+N +CK G+I  A KV +++ +  L+P   ++  LI+G+CK  + +    +   M  
Sbjct  244  NILMNKFCKEGNISDAQKVFDEITKRSLQPTVVSFNTLINGYCKVGNLDEGFRLKHQMEK  303

Query  617  AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
            +   P    YS L++  C +N  +    L DE   RG   +   +  +I    + G++D 
Sbjct  304  SRTRPDVFTYSALINALCKENKMDGAHGLFDEMCKRGLIPNDVIFTTLIHGHSRNGEIDL  363

Query  437  AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             +  +  M  + +  D V+Y +L   + K G+  AA ++ D M +R L
Sbjct  364  MKESYQKMLSKGLQPDIVLYNTLVNGFCKNGDLVAARNIVDGMIRRGL  411


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/169 (24%), Positives = 81/169 (48%), Gaps = 4/169 (2%)
 Frame = -2

Query  800  CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
            C  L++   K+    +      ++L+AG   + + +  L++ FCK  +   A++V  ++ 
Sbjct  208  CGNLLDRMMKLNPTGTIWGFYMEILDAGFPLNVYVFNILMNKFCKEGNISDAQKVFDEIT  267

Query  620  AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
                 P+  +++ L++ YC   N +   +L  +        D+  Y A+I  LCK  K+D
Sbjct  268  KRSLQPTVVSFNTLINGYCKVGNLDEGFRLKHQMEKSRTRPDVFTYSALINALCKENKMD  327

Query  440  CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             A   F  M +R ++ + V++T+L + + + G      DL  E Y++ L
Sbjct  328  GAHGLFDEMCKRGLIPNDVIFTTLIHGHSRNGEI----DLMKESYQKML  372



>ref|XP_006470579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Citrus sinensis]
Length=752

 Score =   258 bits (658),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/527 (28%), Positives = 274/527 (52%), Gaps = 5/527 (1%)
 Frame = -2

Query  1883  LVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVE-TIPNY  1707
             LV+ + + + +G+ N+L   +  L+  S II   L  L      +   F  ++    PN 
Sbjct  78    LVEKILLNLKQGNVNSLRSYQFRLN--SVIIVEVLYRLRD-NLQVGQRFIDFIALNFPNV  134

Query  1706  RHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFS  1527
             +HS  S  +MI+ L + +    A+ ++ ++  K  +S   ++++ V +      NS +F 
Sbjct  135   KHSSMSLSAMIHFLVRGRRISDAQALILRMVRKSGVSRLEIVDSFVSTYSPCGSNSLIFD  194

Query  1526  WLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKL  1347
              ++  Y  +++  +  +VF  LR   I    +AC  LL  LVK G  D   + Y ++++ 
Sbjct  195   LVIRTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRS  254

Query  1346  GVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEA  1167
             G+  N++  N++++A CK  +++ A  FL EME KG++PD  T+NTLI+ YCR G   EA
Sbjct  255   GIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEA  314

Query  1166  LSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDG  990
               + + M   G++P + TYNSLI+  C++GR   A  +  + ++  ++P+  TY TL+  
Sbjct  315   FQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVE  374

Query  989   YCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPD  810
              CR  ++ EA  +   M  +G+ P + ++++++  F   G++  +     +M    + PD
Sbjct  375   SCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPD  434

Query  809   NVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIF  630
             NV    +INGYC+ G ++ ALK++++MLE G   D  TY  +++G C+AK    A ++  
Sbjct  435   NVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFN  494

Query  629   DMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRG  450
             +M+  G  P +  ++ L+  +C   N    + L D  + +    DI  Y  +I   CK G
Sbjct  495   EMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVG  554

Query  449   KLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             +++ A + +  M  R+I  + + Y  L   Y   G+   A  L+ EM
Sbjct  555   EMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEM  601


 Score =   228 bits (581),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 132/496 (27%), Positives = 235/496 (47%), Gaps = 53/496 (11%)
 Frame = -2

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANS  1500
             M+  L K     SAK  L ++  K         N L+ +                 Y   
Sbjct  266   MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINA-----------------YCRE  308

Query  1499  KRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIY  1320
                 +A Q+   +    +KP       L+N L K+G  D   +   +M+++G+ P+   Y
Sbjct  309   GFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATY  368

Query  1319  NVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL-------------------  1197
             N L+   C+   + +A+E   EM  +G+ PD+ +F+TLI +                   
Sbjct  369   NTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKS  428

Query  1196  ----------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMRE  1065
                             YCR G   EAL ++D M   G   D++TYN++++  CR   + E
Sbjct  429   AGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTE  488

Query  1064  AMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILR  888
             A  LF ++ E+ V P+  T+TTLI G+C+ G++++AL L   M +K + P + TYN+++ 
Sbjct  489   ADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLID  548

Query  887   KFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRP  708
              FC+ G M+++ KL   M  +KI P+ ++   LINGYC +G +  A ++  +M+  G++P
Sbjct  549   GFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGEGIKP  608

Query  707   DSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLA  528
                +   +I G+C++ D  +A E +  M++ G  P   +Y+ L++ +  + N +    L 
Sbjct  609   THVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALV  668

Query  527   DEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKE  348
              +   +G   D+  Y  I+   C++G++  +E     M E+ +  D   YT+L   +  +
Sbjct  669   RKMENQGLVPDVITYNVIMTGFCRQGRMHDSELILRRMIEKGLNPDRSTYTTLINGHVSQ  728

Query  347   GNTRAASDLFDEMYKR  300
              N + A    DEM +R
Sbjct  729   NNLKEAFRFHDEMLQR  744


 Score =   222 bits (566),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 199/350 (57%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS L+  ++ + +   A+  F  ++   + PD    T+++N   + G      K   +M+
Sbjct  403   FSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEML  462

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G + ++  YN +++  C++  + +AD+  +EM  +G+FPD YTF TLI  +C+ G   
Sbjct  463   EKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMN  522

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +AL++ D M +  ++PDI+TYN+LI   C+ G M +A +L+ D I  K++PN ++Y  LI
Sbjct  523   KALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILI  582

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +GYC +G + EA RL   M  +G+ P   + N+I++ +C  G   ++ + L++M  + ++
Sbjct  583   NGYCSMGHVTEAFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGVD  642

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD+++ NTLING+ +  ++  A  +  KM   GL PD  TY  ++ GFC+      ++ +
Sbjct  643   PDSISYNTLINGFVREENMDKAFALVRKMENQGLVPDVITYNVIMTGFCRQGRMHDSELI  702

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             +  MI  G +P    Y+ L++ +  QNN +   +  DE   RG+  D +F
Sbjct  703   LRRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  752


 Score =   203 bits (517),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 115/389 (30%), Positives = 213/389 (55%), Gaps = 7/389 (2%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             ++  ++ LL+     +   +A ++F  +    + PD  + + L+    + G  D     +
Sbjct  364   DTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYF  423

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             ++M   G++P+  +Y ++I+  C++G V +A +   EM  KG   D+ T+NT+++  CR 
Sbjct  424   REMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRA  483

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
              M  EA  + + M   GV PD  T+ +LIH HC++G M +A+ LF  + +K + P+ VTY
Sbjct  484   KMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTY  543

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
              TLIDG+C+VG++++A +L + M  + + P   +Y  ++  +C  G + E+ +L  +M  
Sbjct  544   NTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVG  603

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             + I+P +V+CNT+I GYC+ GD   A +  +KM+  G+ PDS +Y  LI+GF + ++ ++
Sbjct  604   EGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDK  663

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQ---NNNEALVKLADEFSGRGYCVDISFYRA  477
             A  ++  M   G  P    Y+ ++  +C Q   +++E +++   E   +G   D S Y  
Sbjct  664   AFALVRKMENQGLVPDVITYNVIMTGFCRQGRMHDSELILRRMIE---KGLNPDRSTYTT  720

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGD  390
             +I     +  L  A RF   M +R  + D
Sbjct  721   LINGHVSQNNLKEAFRFHDEMLQRGFVPD  749


 Score =   177 bits (449),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 117/442 (26%), Positives = 221/442 (50%), Gaps = 12/442 (3%)
 Frame = -2

Query  1601  LSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACT  1422
             L+S  ++  L R  D+  V  +   ++ + + N K +  ++    H  + R +    A  
Sbjct  101   LNSVIIVEVLYRLRDNLQVGQRFIDFIALNFPNVKHSSMSLSAMIHF-LVRGRRISDAQA  159

Query  1421  VLLNSLVKEGLT-----DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLS  1257
             ++L  + K G++     D+   TY          N  I++++I    ++ ++ +  E   
Sbjct  160   LILRMVRKSGVSRLEIVDSFVSTYSP-----CGSNSLIFDLVIRTYVQARKLREGSEVFR  214

Query  1256  EMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREG  1077
              +  KGI   +   N+L+    + G    A  V   + R G+E ++ T N ++++ C++ 
Sbjct  215   LLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEVVRSGIELNVYTLNIMVNALCKDH  274

Query  1076  RMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYN  900
             ++  A     ++++K V P+ VTY TLI+ YCR G ++EA +L ++M  KGL P V TYN
Sbjct  275   KIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYN  334

Query  899   SILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEA  720
             S++   C++GR   + ++L++M +  + PD  T NTL+   C+  ++  A ++  +M   
Sbjct  335   SLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRR  394

Query  719   GLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEAL  540
             G+ PD  ++  LI  F +    +RA     +M +AG  P    Y+ +++ YC        
Sbjct  395   GVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEA  454

Query  539   VKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYA  360
             +K+ DE   +G  +D+  Y  I+  LC+   L  A+  F  M ER +  D   +T+L + 
Sbjct  455   LKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHG  514

Query  359   YFKEGNTRAASDLFDEMYKRRL  294
             + K+GN   A +LFD M ++ +
Sbjct  515   HCKDGNMNKALNLFDIMTQKSI  536



>ref|XP_002519129.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF43340.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=643

 Score =   255 bits (651),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 160/536 (30%), Positives = 268/536 (50%), Gaps = 11/536 (2%)
 Frame = -2

Query  1901  ANTESQLV---KTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFK  1731
             A+T+S LV   ++L   +    W+  L   +  +++ ++I+ TLL+L       S    +
Sbjct  48    ASTDSPLVITHQSLLDSIQSSQWH--LIKHLAPNLSPSLISATLLSLHKK----SDLALQ  101

Query  1730  WVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDS  1551
             +V  I      +++    + ++++    KS   +L Q           V + L  + D  
Sbjct  102   FVTHIGFKGLDIKTKCLAVAVVSRSPSPKSTLHLLKQTIESRVAGVKDVFHELAITRDRL  161

Query  1550  DVNSQ-VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVW  1374
                S  VF  L+      KR  DA + F+ ++   + P       +L+  +K   T+TVW
Sbjct  162   GTKSSIVFDMLIRACCELKRGDDAFECFDMMKEKGVVPKIETFNAMLSLFLKLNQTETVW  221

Query  1373  KTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY  1194
               Y +M +L +   ++ +N++I+  CK G+++KA +F+  ME  G+ P++ T+NT+I  Y
Sbjct  222   VLYAEMFRLKIKSTVYTFNIMINVLCKEGKLKKAKDFIGSMENLGVKPNVVTYNTVIHGY  281

Query  1193  CRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNE  1017
             C RG    A  V D M+  GVEPD  TY SLI   C+ G++ EA  + + +KE  + P  
Sbjct  282   CSRGRVEGARMVLDIMKNRGVEPDSYTYGSLISGMCKGGKLEEASGILEKMKEIGLLPTA  341

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
             VTY TLIDGYC  GD+ +A      M  + + P V+TYN ++     EG+M E+  ++  
Sbjct  342   VTYNTLIDGYCNKGDLVKAFGYRDEMVRRAILPTVSTYNLLIHALFLEGKMDEADGMIKD  401

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             MG+  I PD++T N LINGYC+ G+   A  + ++M+  G++P   TY +LI+   K   
Sbjct  402   MGDSGIVPDSITYNILINGYCRCGNAKKAFNLHDEMISKGIQPTLVTYTSLIYVLSKRNR  461

Query  656   TERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRA  477
              + A ++   +I  G SP    ++ L+D +C   N +    L  E   R    D   Y  
Sbjct  462   MKAADDLFEKIIREGASPDLIMFNALIDGHCANGNLDRAFALLKEMDKRNIVPDEVTYNT  521

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             +++  C+ GK++ A      M+ R I  D + Y +L   Y K G+   A  + DEM
Sbjct  522   LMQGRCREGKVEEARELLKEMKRRGIRPDHISYNTLISGYSKRGDINDAFTIRDEM  577


 Score =   210 bits (535),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 122/393 (31%), Positives = 194/393 (49%), Gaps = 4/393 (1%)
 Frame = -2

Query  1499  KRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIY  1320
             K+  D I   E+L +   KP+      +++     G  +        M   GV P+ + Y
Sbjct  253   KKAKDFIGSMENLGV---KPNVVTYNTVIHGYCSRGRVEGARMVLDIMKNRGVEPDSYTY  309

Query  1319  NVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMER  1140
               LI   CK G++E+A   L +M+  G+ P   T+NTLI  YC +G   +A   +D M R
Sbjct  310   GSLISGMCKGGKLEEASGILEKMKEIGLLPTAVTYNTLIDGYCNKGDLVKAFGYRDEMVR  369

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDE  963
               + P + TYN LIH+   EG+M EA  + KD+ +  + P+ +TY  LI+GYCR G+  +
Sbjct  370   RAILPTVSTYNLLIHALFLEGKMDEADGMIKDMGDSGIVPDSITYNILINGYCRCGNAKK  429

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
             A  LH  M  KG+ P + TY S++    +  RMK +  L  ++  +   PD +  N LI+
Sbjct  430   AFNLHDEMISKGIQPTLVTYTSLIYVLSKRNRMKAADDLFEKIIREGASPDLIMFNALID  489

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             G+C  G++  A  +  +M +  + PD  TY  L+ G C+    E A+E++ +M   G  P
Sbjct  490   GHCANGNLDRAFALLKEMDKRNIVPDEVTYNTLMQGRCREGKVEEARELLKEMKRRGIRP  549

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
              + +Y+ L+  Y  + +      + DE    G+   +  Y A+I+ LCK  + D AE   
Sbjct  550   DHISYNTLISGYSKRGDINDAFTIRDEMLSIGFNPTLLTYNALIQGLCKNQQGDLAEELL  609

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASD  324
               M  + I  D   Y SL     K  ++  ASD
Sbjct  610   KEMVSKGITPDDSTYFSLIEGIGKVDDSSEASD  642


 Score =   188 bits (477),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 199/404 (49%), Gaps = 6/404 (1%)
 Frame = -2

Query  1496  RTWDAIQVFEHLRICRIKPDPHACTV---LLNSLVKEGLTDTVWKTYKKMIKLGVLPNIH  1326
             R      VF  L I R +    +  V   L+ +  +    D  ++ +  M + GV+P I 
Sbjct  143   RVAGVKDVFHELAITRDRLGTKSSIVFDMLIRACCELKRGDDAFECFDMMKEKGVVPKIE  202

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRM  1146
              +N ++    K  + E      +EM    I   +YTFN +I++ C+ G   +A      M
Sbjct  203   TFNAMLSLFLKLNQTETVWVLYAEMFRLKIKSTVYTFNIMINVLCKEGKLKKAKDFIGSM  262

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VTPNEVTYTTLIDGYCRVGD  972
             E  GV+P+++TYN++IH +C  GR+ E  R+  DI +   V P+  TY +LI G C+ G 
Sbjct  263   ENLGVKPNVVTYNTVIHGYCSRGRV-EGARMVLDIMKNRGVEPDSYTYGSLISGMCKGGK  321

Query  971   IDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNT  792
             ++EA  +   M+E GL P   TYN+++  +C +G + ++    ++M  + I P   T N 
Sbjct  322   LEEASGILEKMKEIGLLPTAVTYNTLIDGYCNKGDLVKAFGYRDEMVRRAILPTVSTYNL  381

Query  791   LINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAG  612
             LI+     G +  A  +   M ++G+ PDS TY  LI+G+C+  + ++A  +  +MI+ G
Sbjct  382   LIHALFLEGKMDEADGMIKDMGDSGIVPDSITYNILINGYCRCGNAKKAFNLHDEMISKG  441

Query  611   FSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAE  432
               P+   Y+ L+     +N  +A   L ++    G   D+  + A+I   C  G LD A 
Sbjct  442   IQPTLVTYTSLIYVLSKRNRMKAADDLFEKIIREGASPDLIMFNALIDGHCANGNLDRAF  501

Query  431   RFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                  M +R I+ D V Y +L     +EG    A +L  EM +R
Sbjct  502   ALLKEMDKRNIVPDEVTYNTLMQGRCREGKVEEARELLKEMKRR  545


 Score =   144 bits (363),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 118/449 (26%), Positives = 210/449 (47%), Gaps = 38/449 (8%)
 Frame = -2

Query  1547  VNSQVFSW------LLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
             +NSQ+ ++      +LI YA+   T   I + +HL    + P+    + L+  +  + L 
Sbjct  7     LNSQLLTYNKLKPSILISYAHFSST--PIPIIDHLHAETLHPNASTDSPLV--ITHQSLL  62

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKS--GEVEKADEFLSEMEFKGIFPDLYTFN  1212
             D++  +   +IK  + PN+     LI A   S   + + A +F++ + FKG+  D+ T  
Sbjct  63    DSIQSSQWHLIK-HLAPNLS--PSLISATLLSLHKKSDLALQFVTHIGFKGL--DIKTKC  117

Query  1211  TLISLYCRRG-----MHYEALSVQDRM--------------ERGGVEPDIITYNSLIHSH  1089
               +++  R       +H    +++ R+              +R G +  I+ ++ LI + 
Sbjct  118   LAVAVVSRSPSPKSTLHLLKQTIESRVAGVKDVFHELAITRDRLGTKSSIV-FDMLIRAC  176

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C   R  +A   F  +KEK V P   T+  ++  + ++   +    L++ M    +   V
Sbjct  177   CELKRGDDAFECFDMMKEKGVVPKIETFNAMLSLFLKLNQTETVWVLYAEMFRLKIKSTV  236

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              T+N ++   C+EG++K++   +  M    ++P+ VT NT+I+GYC  G +  A  V + 
Sbjct  237   YTFNIMINVLCKEGKLKKAKDFIGSMENLGVKPNVVTYNTVIHGYCSRGRVEGARMVLDI  296

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M   G+ PDS+TY +LI G CK    E A  ++  M   G  P+   Y+ L+D YC + +
Sbjct  297   MKNRGVEPDSYTYGSLISGMCKGGKLEEASGILEKMKEIGLLPTAVTYNTLIDGYCNKGD  356

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
                     DE   R     +S Y  +I  L   GK+D A+     M +  I+ DS+ Y  
Sbjct  357   LVKAFGYRDEMVRRAILPTVSTYNLLIHALFLEGKMDEADGMIKDMGDSGIVPDSITYNI  416

Query  371   LAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             L   Y + GN + A +L DEM  + +  T
Sbjct  417   LINGYCRCGNAKKAFNLHDEMISKGIQPT  445


 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 103/192 (54%), Gaps = 1/192 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+   +   R   A  +FE +      PD      L++     G  D  +   K+M 
Sbjct  449   YTSLIYVLSKRNRMKAADDLFEKIIREGASPDLIMFNALIDGHCANGNLDRAFALLKEMD  508

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             K  ++P+   YN L+   C+ G+VE+A E L EM+ +GI PD  ++NTLIS Y +RG   
Sbjct  509   KRNIVPDEVTYNTLMQGRCREGKVEEARELLKEMKRRGIRPDHISYNTLISGYSKRGDIN  568

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLI  996
             +A +++D M   G  P ++TYN+LI   C+  +   A  L K++  K +TP++ TY +LI
Sbjct  569   DAFTIRDEMLSIGFNPTLLTYNALIQGLCKNQQGDLAEELLKEMVSKGITPDDSTYFSLI  628

Query  995   DGYCRVGDIDEA  960
             +G  +V D  EA
Sbjct  629   EGIGKVDDSSEA  640



>ref|XP_002870941.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47200.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=719

 Score =   256 bits (654),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 152/544 (28%), Positives = 260/544 (48%), Gaps = 71/544 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++H+  S  +MI+IL +      A+  + ++  +  +S   ++N+LV +  +   N  
Sbjct  97    PNFKHTSLSLSAMIHILVRSGRLSDAQSCVLRMIRRSGVSRVEIVNSLVSTYSNCGSNDS  156

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  +  +++  +A + F  LR         AC  L+ SLV+ G  +  W+ Y+++
Sbjct  157   VFDLLIRTFVQARKLREAYEAFTLLRSKGYTVSIDACNALIGSLVRIGWVELAWRIYQEI  216

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLY------  1194
              + GV  N++  N++++A CK G++EK   FLSE++ KG++PD+ T+NTLIS Y      
Sbjct  217   SRSGVGVNVYTLNIMVNALCKDGKMEKVGTFLSEVQEKGVYPDIVTYNTLISAYSSQGLM  276

Query  1193  -----------------------------CRRGMHYEALSVQDRMERGGVEPDIITYNSL  1101
                                          C+ G +  A  V   M R G+ PD  TY SL
Sbjct  277   EEAFELMHAMPSKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSL  336

Query  1100  IHSHCREGRMREAMRLFKDIKEK------------------------------------V  1029
             +   C++G   E   +F D++ +                                    +
Sbjct  337   LMEACKKGDAVETENIFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFNSVKEAGL  396

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              P+ V YT LI GYCR G I EA+ L + M ++G    V TYN+IL   C+   + E+ K
Sbjct  397   IPDNVIYTILIQGYCRKGMISEAMNLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADK  456

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L N+M E+ + PD+ T   LI+G+CK+G++ +A+++  KM E  ++ D  TY  L+ GF 
Sbjct  457   LFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIKLDVVTYNTLLDGFG  516

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  D + AKE+  DM++    P+  ++S LV+  C + +     ++ DE   +     + 
Sbjct  517   KVGDIDTAKEIWADMVSKEILPTPISFSILVNALCSKGHLSEAFRVWDEMISKSIKPTVM  576

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                ++I+  C+ G     E F   M     + D + Y +L Y + KE N   A  L  +M
Sbjct  577   ICNSMIKGYCRSGNASDGEIFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKM  636

Query  308   YKRR  297
              +++
Sbjct  637   EEKQ  640


 Score =   191 bits (485),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 114/450 (25%), Positives = 217/450 (48%), Gaps = 40/450 (9%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+  Y++     +A ++   +      P  +    ++N L K G  +   + + +M+
Sbjct  263   YNTLISAYSSQGLMEEAFELMHAMPSKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEML  322

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL--------  1197
             + G+ P+   Y  L+   CK G+  + +   S+M  + + PDL  F++++SL        
Sbjct  323   RSGLSPDSTTYRSLLMEACKKGDAVETENIFSDMRSRDVVPDLVCFSSMMSLFTRSGNLD  382

Query  1196  ---------------------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLI  1098
                                        YCR+GM  EA+++++ M + G   D++TYN+++
Sbjct  383   KALMYFNSVKEAGLIPDNVIYTILIQGYCRKGMISEAMNLRNEMLQQGCAMDVVTYNTIL  442

Query  1097  HSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLC  921
             H  C+   + EA +LF ++ E+ + P+  T T LIDG+C++G++  A+ L   M+EK + 
Sbjct  443   HGLCKRKMLGEADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIK  502

Query  920   PRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKV  741
               V TYN++L  F + G +  + ++   M  K+I P  ++ + L+N  C  G +  A +V
Sbjct  503   LDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISFSILVNALCSKGHLSEAFRV  562

Query  740   KNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCL  561
              ++M+   ++P      ++I G+C++ +    +  +  MI+ GF P   +Y+ L+  +  
Sbjct  563   WDEMISKSIKPTVMICNSMIKGYCRSGNASDGEIFLEKMISEGFVPDCISYNTLIYGFVK  622

Query  560   QNNNE---ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
             + N      LVK  +E  G G   D+  Y +I+   C+  ++  AE     M ER +  D
Sbjct  623   EENMSKAFGLVKKMEEKQG-GLVPDVFTYNSILHGFCRENQMKEAEAVLRKMIERGVNPD  681

Query  389   SVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                YTSL   +  + N   A    DEM +R
Sbjct  682   RSTYTSLINGFVSQDNLTEAFRFHDEMLQR  711


 Score =   185 bits (469),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/352 (28%), Positives = 179/352 (51%), Gaps = 3/352 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  +  S     A+  F  ++   + PD    T+L+    ++G+         +M+
Sbjct  368   FSSMMSLFTRSGNLDKALMYFNSVKEAGLIPDNVIYTILIQGYCRKGMISEAMNLRNEML  427

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  YN ++H  CK   + +AD+  +EM  +G+FPD YT   LI  +C+ G   
Sbjct  428   QQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQ  487

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              A+ +  +M+   ++ D++TYN+L+    + G +  A  ++ D + +++ P  ++++ L+
Sbjct  488   NAMELFKKMKEKRIKLDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISFSILV  547

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +  C  G + EA R+   M  K + P V   NS+++ +C  G   +    L +M  +   
Sbjct  548   NALCSKGHLSEAFRVWDEMISKSIKPTVMICNSMIKGYCRSGNASDGEIFLEKMISEGFV  607

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLE--AGLRPDSFTYKALIHGFCKAKDTERAK  642
             PD ++ NTLI G+ K  ++  A  +  KM E   GL PD FTY +++HGFC+    + A+
Sbjct  608   PDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGGLVPDVFTYNSILHGFCRENQMKEAE  667

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              V+  MI  G +P    Y+ L++ +  Q+N     +  DE   RG+  D  F
Sbjct  668   AVLRKMIERGVNPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQRGFSPDDKF  719



>ref|XP_010936986.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, 
mitochondrial [Elaeis guineensis]
Length=639

 Score =   254 bits (650),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/533 (29%), Positives = 267/533 (50%), Gaps = 14/533 (3%)
 Frame = -2

Query  1880  VKTLCVIVLKGHWNNL--LKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNY  1707
             V ++   VL+  W +L  L P +   + S ++ H  L  SP           ++  +  +
Sbjct  52    VDSIAASVLRSQWTSLDHLLPTLSPPLVSAVLLH--LRCSPDLIP------PFLHRLGLH  103

Query  1706  RHSLQSSWSMIYILTKHKHFKSAKDMLHQ-IACKDFLSSPAVLNALVRSDDD-SDVNSQV  1533
             R  L+S      +L   +    A ++L + I+   F SS    NAL  + ++    N Q+
Sbjct  104   RLDLRSLSIAASLLCSLRPPSPAINLLKEAISTGHFDSSQKFFNALSAAGEELKPSNPQL  163

Query  1532  -FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
              F  LL  Y +S +  +A+ VF  ++     P   +C  LL++ +K   T+  W  + +M
Sbjct  164   AFDLLLRAYLDSGKIQEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLFAEM  223

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              ++ +  ++  +N++I+  CK G+++KA  F+  ME  G+ P + T+NT+I  +C RG  
Sbjct  224   FRMRIPSSVVTFNIMINVLCKEGKLKKAKAFIQVMESSGVQPTVVTYNTIIQGHCSRGKV  283

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTL  999
                L +   M++ G++PD  TY +LI   C+EGR+ +A  +F ++ E+ + P+ V Y TL
Sbjct  284   QMGLEMLGVMKKKGIKPDAYTYGTLISGMCKEGRVDDASVMFDEMLERGLVPSAVNYNTL  343

Query  998   IDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKI  819
             IDGYC  G +D A +    M  KG+ P + TYN ++     EGR +E+  L+ +M  K++
Sbjct  344   IDGYCNKGKLDVAFQYRDEMLRKGIEPTLCTYNLLVHALFMEGRNEEANALIKEMEVKRM  403

Query  818   EPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKE  639
              PD +T N LINGYCK G+I  A  +  +ML  G++P   TY +LI+  CK      A  
Sbjct  404   VPDAITYNILINGYCKEGNINKAFDLFEEMLRKGVQPTMVTYTSLIYVLCKRSRVTEADR  463

Query  638   VIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLC  459
             +  ++   G  P     + L+D +C   N     +L  E   +    D   Y  ++R LC
Sbjct  464   MFKEVTEKGLYPDLVMCNALIDGHCANGNMGRAFELLKEMESKRLAPDEVTYNTLMRGLC  523

Query  458   KRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
               G+++ A +    M  R +  D + Y +L   Y + G+ + A  + DEM  +
Sbjct  524   LLGEVEEARKLIDEMNRRGVKPDLISYNTLISGYSRRGDVKDAFKVRDEMLSK  576


 Score =   174 bits (440),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/394 (28%), Positives = 198/394 (50%), Gaps = 8/394 (2%)
 Frame = -2

Query  1457  ICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLG--VLP-NIHI-YNVLIHACCKS  1290
             +C ++P P     LL   +  G  D+  K +  +   G  + P N  + +++L+ A   S
Sbjct  117   LCSLRP-PSPAINLLKEAISTGHFDSSQKFFNALSAAGEELKPSNPQLAFDLLLRAYLDS  175

Query  1289  GEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
             G++++A +    M+     P + + N L+S + +     +A  +   M R  +   ++T+
Sbjct  176   GKIQEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLFAEMFRMRIPSSVVTF  235

Query  1109  NSLIHSHCREGRMREAMRLFKDIKEK--VTPNEVTYTTLIDGYCRVGDIDEALRLHSAME  936
             N +I+  C+EG++++A + F  + E   V P  VTY T+I G+C  G +   L +   M+
Sbjct  236   NIMINVLCKEGKLKKA-KAFIQVMESSGVQPTVVTYNTIIQGHCSRGKVQMGLEMLGVMK  294

Query  935   EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
             +KG+ P   TY +++   C+EGR+ +++ + ++M E+ + P  V  NTLI+GYC  G + 
Sbjct  295   KKGIKPDAYTYGTLISGMCKEGRVDDASVMFDEMLERGLVPSAVNYNTLIDGYCNKGKLD  354

Query  755   SALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLV  576
              A + +++ML  G+ P   TY  L+H        E A  +I +M      P    Y+ L+
Sbjct  355   VAFQYRDEMLRKGIEPTLCTYNLLVHALFMEGRNEEANALIKEMEVKRMVPDAITYNILI  414

Query  575   DTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
             + YC + N      L +E   +G    +  Y ++I  LCKR ++  A+R F  + E+ + 
Sbjct  415   NGYCKEGNINKAFDLFEEMLRKGVQPTMVTYTSLIYVLCKRSRVTEADRMFKEVTEKGLY  474

Query  395   GDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
              D V+  +L   +   GN   A +L  EM  +RL
Sbjct  475   PDLVMCNALIDGHCANGNMGRAFELLKEMESKRL  508


 Score =   168 bits (426),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/323 (30%), Positives = 163/323 (50%), Gaps = 36/323 (11%)
 Frame = -2

Query  1496  RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYN  1317
             R  DA  +F+ +    + P       L++    +G  D  ++   +M++ G+ P +  YN
Sbjct  317   RVDDASVMFDEMLERGLVPSAVNYNTLIDGYCNKGKLDVAFQYRDEMLRKGIEPTLCTYN  376

Query  1316  VLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERG  1137
             +L+HA    G  E+A+  + EME K + PD  T+N LI+ YC+ G   +A  + + M R 
Sbjct  377   LLVHALFMEGRNEEANALIKEMEVKRMVPDAITYNILINGYCKEGNINKAFDLFEEMLRK  436

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-------------------------  1032
             GV+P ++TY SLI+  C+  R+ EA R+FK++ EK                         
Sbjct  437   GVQPTMVTYTSLIYVLCKRSRVTEADRMFKEVTEKGLYPDLVMCNALIDGHCANGNMGRA  496

Query  1031  -----------VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRK  885
                        + P+EVTY TL+ G C +G+++EA +L   M  +G+ P + +YN+++  
Sbjct  497   FELLKEMESKRLAPDEVTYNTLMRGLCLLGEVEEARKLIDEMNRRGVKPDLISYNTLISG  556

Query  884   FCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPD  705
             +   G +K++ K+ ++M  K   P  +T N LI G CK G+   A  +  +M+  G+ PD
Sbjct  557   YSRRGDVKDAFKVRDEMLSKGFNPTLLTYNALIQGLCKNGEGGHAEGLLKEMVSKGITPD  616

Query  704   SFTYKALIHGFCKAKDTERAKEV  636
               TY +LI G    +D  + + V
Sbjct  617   DSTYISLIEGLSNGEDDVKNENV  639


 Score =   129 bits (325),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 140/279 (50%), Gaps = 1/279 (0%)
 Frame = -2

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
             + ++ L+ ++   G+++EA+ +F  +K+    P   +   L+  + +    ++A  L + 
Sbjct  163   LAFDLLLRAYLDSGKIQEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLFAE  222

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             M    +   V T+N ++   C+EG++K++   +  M    ++P  VT NT+I G+C  G 
Sbjct  223   MFRMRIPSSVVTFNIMINVLCKEGKLKKAKAFIQVMESSGVQPTVVTYNTIIQGHCSRGK  282

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
             +   L++   M + G++PD++TY  LI G CK    + A  +  +M+  G  PS   Y+ 
Sbjct  283   VQMGLEMLGVMKKKGIKPDAYTYGTLISGMCKEGRVDDASVMFDEMLERGLVPSAVNYNT  342

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQERE  402
             L+D YC +   +   +  DE   +G    +  Y  ++  L   G+ + A      M+ + 
Sbjct  343   LIDGYCNKGKLDVAFQYRDEMLRKGIEPTLCTYNLLVHALFMEGRNEEANALIKEMEVKR  402

Query  401   ILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLMVT  285
             ++ D++ Y  L   Y KEGN   A DLF+EM ++ +  T
Sbjct  403   MVPDAITYNILINGYCKEGNINKAFDLFEEMLRKGVQPT  441


 Score =   107 bits (268),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 97/182 (53%), Gaps = 1/182 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+       R  +A ++F+ +    + PD   C  L++     G     ++  K+M 
Sbjct  445   YTSLIYVLCKRSRVTEADRMFKEVTEKGLYPDLVMCNALIDGHCANGNMGRAFELLKEME  504

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
                + P+   YN L+   C  GEVE+A + + EM  +G+ PDL ++NTLIS Y RRG   
Sbjct  505   SKRLAPDEVTYNTLMRGLCLLGEVEEARKLIDEMNRRGVKPDLISYNTLISGYSRRGDVK  564

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLI  996
             +A  V+D M   G  P ++TYN+LI   C+ G    A  L K++  K +TP++ TY +LI
Sbjct  565   DAFKVRDEMLSKGFNPTLLTYNALIQGLCKNGEGGHAEGLLKEMVSKGITPDDSTYISLI  624

Query  995   DG  990
             +G
Sbjct  625   EG  626



>gb|KCW69399.1| hypothetical protein EUGRSUZ_F02875 [Eucalyptus grandis]
Length=581

 Score =   253 bits (645),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/478 (30%), Positives = 242/478 (51%), Gaps = 19/478 (4%)
 Frame = -2

Query  1742  SFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRS  1563
             +FF +V   PN+R ++    +M + L  +  F  A+ ++  +  +    S + L   +  
Sbjct  95    AFFNFVSAQPNFRLAVGCCCAMAHFLCSNGMFTEAQSVISLVVSRKGKDSASSLFCSLLE  154

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
                +  +  VF  L+I YA++    DAIQ F  +R   +      C  LL+ ++K    +
Sbjct  155   TRSAHRSVFVFDALIIAYADADYMPDAIQCFRLMRKRNLPVPFRGCGHLLHRMLKNSSPE  214

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
               W  Y +++  G   NI+ +N+L+    K G+V+ A     EM  +G+ P + +FNTLI
Sbjct  215   AAWGFYMEILNAGYPANIYSFNILMSRFGKVGKVKSARLLFDEMPKRGLAPSIVSFNTLI  274

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VT  1026
             S YC+ G   E   ++  ME+ G + D+ TY++LI+  C+E RM +A  L K++ EK V 
Sbjct  275   SGYCKVGDLEEGFGLKGVMEKSGFQADVFTYSTLINGLCKESRMEDANLLLKEMSEKGVV  334

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             PN V +TTLID                  +  G+ P + TYN+++   C  G +KE+ KL
Sbjct  335   PNYVIFTTLID------------------QHTGVRPDLVTYNALINGHCRVGDLKEARKL  376

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             + +M    + PD +T  TLI+G CK GD+ SAL ++ +M+E G+  D+  + ALI G CK
Sbjct  377   VEEMKSIGLNPDKITYTTLIDGICKEGDMESALDIRKEMVEKGIELDNIAFTALISGLCK  436

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
             A  T  A+ V+ +M+  G  P    Y+ ++D +C + + +   +L  E    G+   +  
Sbjct  437   AGRTVDAERVLREMLKVGIRPDDATYTMIMDGFCKKGDTKMGFQLLKEMQSDGHVPGVVT  496

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDE  312
             Y  ++  LCK+G++  A+     M    ++ D + Y  L   + K GN      + DE
Sbjct  497   YNVLMNGLCKQGQMKNAKMLLDAMMNLGVVPDDITYNILLDGHCKHGNFVNIGKIRDE  554


 Score =   108 bits (269),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/277 (25%), Positives = 134/277 (48%), Gaps = 23/277 (8%)
 Frame = -2

Query  1121  IITYNSLIHSHCREGRMREAMRLFKDIKEKVTPNEVTYTT---LIDGYCRVGDIDEALRL  951
             +  +++LI ++     M +A++ F+ ++++  P  V +     L+    +    + A   
Sbjct  162   VFVFDALIIAYADADYMPDAIQCFRLMRKRNLP--VPFRGCGHLLHRMLKNSSPEAAWGF  219

Query  950   HSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCK  771
             +  +   G    + ++N ++ +F + G++K +  L ++M ++ + P  V+ NTLI+GYCK
Sbjct  220   YMEILNAGYPANIYSFNILMSRFGKVGKVKSARLLFDEMPKRGLAPSIVSFNTLISGYCK  279

Query  770   IGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCA  591
             +GD+     +K  M ++G + D FTY  LI+G CK    E A  ++ +M   G  P+Y  
Sbjct  280   VGDLEEGFGLKGVMEKSGFQADVFTYSTLINGLCKESRMEDANLLLKEMSEKGVVPNYVI  339

Query  590   YSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQ  411
             ++ L+D +                   G   D+  Y A+I   C+ G L  A +    M+
Sbjct  340   FTTLIDQHT------------------GVRPDLVTYNALINGHCRVGDLKEARKLVEEMK  381

Query  410   EREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                +  D + YT+L     KEG+  +A D+  EM ++
Sbjct  382   SIGLNPDKITYTTLIDGICKEGDMESALDIRKEMVEK  418


 Score =   105 bits (261),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/227 (30%), Positives = 107/227 (47%), Gaps = 4/227 (2%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             ++PD      L+N   + G      K  ++M  +G+ P+   Y  LI   CK G++E A 
Sbjct  350   VRPDLVTYNALINGHCRVGDLKEARKLVEEMKSIGLNPDKITYTTLIDGICKEGDMESAL  409

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             +   EM  KGI  D   F  LIS  C+ G   +A  V   M + G+ PD  TY  ++   
Sbjct  410   DIRKEMVEKGIELDNIAFTALISGLCKAGRTVDAERVLREMLKVGIRPDDATYTMIMDGF  469

Query  1088  CREGRMREAMRLFKDIK-EKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C++G  +   +L K+++ +   P  VTY  L++G C+ G +  A  L  AM   G+ P  
Sbjct  470   CKKGDTKMGFQLLKEMQSDGHVPGVVTYNVLMNGLCKQGQMKNAKMLLDAMMNLGVVPDD  529

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCK  771
              TYN +L   C+ G      K+ +   EK +  D  +  +L+N   K
Sbjct  530   ITYNILLDGHCKHGNFVNIGKIRD---EKGLVQDYASYTSLVNELAK  573



>ref|XP_006856131.1| hypothetical protein AMTR_s00059p00156460 [Amborella trichopoda]
 gb|ERN17598.1| hypothetical protein AMTR_s00059p00156460 [Amborella trichopoda]
Length=962

 Score =   259 bits (663),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 160/542 (30%), Positives = 284/542 (52%), Gaps = 19/542 (4%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTL--LTLSPCWFWLSWSFFKWVE  1722
             T++QL++TLC I++      +    +    +  +++  L  L L P     S +FFK  +
Sbjct  54    TQTQLIETLCRILILNRLEAI--SHLSFDFSDELVDGVLRKLRLRPVA---SLNFFKIAQ  108

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIA------CKDFLSSPAVLNALVRSD  1560
                 +R +      +I+IL++ K F  A+  L+++       C D L    V   L+   
Sbjct  109   QQQKFRPNSLCYCKIIHILSRAKMFSEARQYLNELVSFSTSKCSDSL----VFYELLDVF  164

Query  1559  DDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDT  1380
              +   +  VF  L   YA       A+ VF+++      P   +C  ++++L+++    T
Sbjct  165   KEFSFSPTVFDMLFKLYAEKCMLGKALHVFDNMGKFGFSPSLRSCNSIISALIRKNENHT  224

Query  1379  VWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLIS  1200
             V+  +++M ++ + P+++ Y ++++A  K G++ KA E L EME KG  P+L T+N+LI+
Sbjct  225   VFHVFEQMQRIRIFPDVYTYTMVVNAYSKDGKMCKAVELLEEMERKGYEPNLVTYNSLIN  284

Query  1199  LYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK--VT  1026
              Y   G    AL V   + + G+EP +IT+N LI  +CREG+M EA +L +++KEK  + 
Sbjct  285   GYSNLGETKAALRVFYLISQRGLEPSVITFNLLIKGYCREGKMIEAEKLLREMKEKYSLV  344

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             P+EV Y T+++GYC +  +++A+R+   M   GL   + T N++L  FC+ G + E+ +L
Sbjct  345   PDEVVYGTILNGYCLISKLEDAIRVQDEMLGSGLKANIVTSNTLLNGFCKIGMLNEAKQL  404

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
             +  M  + + PD+ + NTL+NG+CK    + A  + ++ML  G+ P + TY  LI G  +
Sbjct  405   IRDMEIRGLVPDSYSYNTLLNGFCKEKRFMEAFNLCDEMLSRGVEPTALTYNTLIKGLFR  464

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
               D + + ++   M   G +P     S L+D +      E   KL +     G+  +   
Sbjct  465   VGDIDESLKLWQMMRERGINPDEVTLSTLLDGFLKLGKFEEAWKLWERMLVLGHAKNQVT  524

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMY  306
             +  +I  LCK+GKL  AE     M+   IL DS+ Y +L   Y +E N   A ++ +EM 
Sbjct  525   FNTMINGLCKKGKLCEAEELLDRMRNSGILPDSITYRTLIDGYCREKNMVKALEVREEME  584

Query  305   KR  300
             ++
Sbjct  585   RK  586


 Score =   210 bits (534),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 131/470 (28%), Positives = 223/470 (47%), Gaps = 71/470 (15%)
 Frame = -2

Query  1487  DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLI  1308
             +++++++ +R   I PD    + LL+  +K G  +  WK +++M+ LG   N   +N +I
Sbjct  470   ESLKLWQMMRERGINPDEVTLSTLLDGFLKLGKFEEAWKLWERMLVLGHAKNQVTFNTMI  529

Query  1307  HACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVE  1128
             +  CK G++ +A+E L  M   GI PD  T+ TLI  YCR     +AL V++ MER G++
Sbjct  530   NGLCKKGKLCEAEELLDRMRNSGILPDSITYRTLIDGYCREKNMVKALEVREEMERKGIK  589

Query  1127  P-----------------------------------DIITYNSLIHSHCREGRMREAMRL  1053
             P                                   +I+TY +LI   C+EGR+  A  +
Sbjct  590   PAIEMYNSLVGGLFSCGRSSQVKDVMADMEKRGLNPNIVTYGALIDGWCKEGRLDRAFSV  649

Query  1052  FKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEA---------------------------L  957
             + ++ E   TPN +  +TL+ G  R+G IDEA                           +
Sbjct  650   YFEMAEMGFTPNLIICSTLLSGLYRLGKIDEANMVLQKMLGIDLSLGDAHYGSFVELQSV  709

Query  956   RLHSAMEEK--------GLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVT  801
              L+S M  K         L P +  YN +L   C+ GR++++ +  +++ ++   PDN T
Sbjct  710   NLNSQMTVKIRGLTNGGNLLPNLIVYNVVLDGLCKSGRVEDAKRTFSELLKRGFIPDNFT  769

Query  800   CNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMI  621
               TLI+G    G+I  A  ++++ML  G+ P+   Y ALI+G CK+ + ERA  +   + 
Sbjct  770   YCTLIHGCSLAGNINEAFMLRDEMLSMGIVPNIAIYNALINGLCKSGNLERAIRLFNKLC  829

Query  620   AAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLD  441
               G  P+   Y+ L+D YC     +  +KL  +    G    +  Y  +I  LC++G  +
Sbjct  830   MKGLVPNVITYNTLMDGYCKAGKIDDALKLKSKMMEEGISPSVITYSVLINGLCQKGDTE  889

Query  440   CAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
              A+     M E  +  + V Y++L   Y + G+    S L+DEM+ + L+
Sbjct  890   AAKSLLHQMGEMGVDPNFVTYSTLVQGYIQSGDMGQISKLYDEMHIKGLL  939


 Score =   179 bits (455),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/394 (28%), Positives = 194/394 (49%), Gaps = 1/394 (0%)
 Frame = -2

Query  1487  DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLI  1308
             +A Q+   + I  + PD ++   LLN   KE      +    +M+  GV P    YN LI
Sbjct  400   EAKQLIRDMEIRGLVPDSYSYNTLLNGFCKEKRFMEAFNLCDEMLSRGVEPTALTYNTLI  459

Query  1307  HACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVE  1128
                 + G+++++ +    M  +GI PD  T +TL+  + + G   EA  + +RM   G  
Sbjct  460   KGLFRVGDIDESLKLWQMMRERGINPDEVTLSTLLDGFLKLGKFEEAWKLWERMLVLGHA  519

Query  1127  PDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRL  951
              + +T+N++I+  C++G++ EA  L   ++   + P+ +TY TLIDGYCR  ++ +AL +
Sbjct  520   KNQVTFNTMINGLCKKGKLCEAEELLDRMRNSGILPDSITYRTLIDGYCREKNMVKALEV  579

Query  950   HSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCK  771
                ME KG+ P +  YNS++      GR  +   ++  M ++ + P+ VT   LI+G+CK
Sbjct  580   REEMERKGIKPAIEMYNSLVGGLFSCGRSSQVKDVMADMEKRGLNPNIVTYGALIDGWCK  639

Query  770   IGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCA  591
              G +  A  V  +M E G  P+      L+ G  +    + A  V+  M+    S     
Sbjct  640   EGRLDRAFSVYFEMAEMGFTPNLIICSTLLSGLYRLGKIDEANMVLQKMLGIDLSLGDAH  699

Query  590   YSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQ  411
             Y   V+   +  N++  VK+    +G     ++  Y  ++  LCK G+++ A+R F  + 
Sbjct  700   YGSFVELQSVNLNSQMTVKIRGLTNGGNLLPNLIVYNVVLDGLCKSGRVEDAKRTFSELL  759

Query  410   EREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             +R  + D+  Y +L +     GN   A  L DEM
Sbjct  760   KRGFIPDNFTYCTLIHGCSLAGNINEAFMLRDEM  793


 Score =   143 bits (361),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 100/386 (26%), Positives = 166/386 (43%), Gaps = 71/386 (18%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             +S  +  L+  Y   K    A++V E +    IKP       L+  L   G +  V    
Sbjct  556   DSITYRTLIDGYCREKNMVKALEVREEMERKGIKPAIEMYNSLVGGLFSCGRSSQVKDVM  615

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
               M K G+ PNI  Y  LI   CK G +++A     EM   G  P+L   +TL+S   R 
Sbjct  616   ADMEKRGLNPNIVTYGALIDGWCKEGRLDRAFSVYFEMAEMGFTPNLIICSTLLSGLYRL  675

Query  1184  GMHYEALSVQDRM-----------------------------------ERGGVEPDIITY  1110
             G   EA  V  +M                                     G + P++I Y
Sbjct  676   GKIDEANMVLQKMLGIDLSLGDAHYGSFVELQSVNLNSQMTVKIRGLTNGGNLLPNLIVY  735

Query  1109  NSLIHSHCREGRMREAMRLFKDIKEK----------------------------------  1032
             N ++   C+ GR+ +A R F ++ ++                                  
Sbjct  736   NVVLDGLCKSGRVEDAKRTFSELLKRGFIPDNFTYCTLIHGCSLAGNINEAFMLRDEMLS  795

Query  1031  --VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKE  858
               + PN   Y  LI+G C+ G+++ A+RL + +  KGL P V TYN+++  +C+ G++ +
Sbjct  796   MGIVPNIAIYNALINGLCKSGNLERAIRLFNKLCMKGLVPNVITYNTLMDGYCKAGKIDD  855

Query  857   STKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIH  678
             + KL ++M E+ I P  +T + LING C+ GD  +A  + ++M E G+ P+  TY  L+ 
Sbjct  856   ALKLKSKMMEEGISPSVITYSVLINGLCQKGDTEAAKSLLHQMGEMGVDPNFVTYSTLVQ  915

Query  677   GFCKAKDTERAKEVIFDMIAAGFSPS  600
             G+ ++ D  +  ++  +M   G  P 
Sbjct  916   GYIQSGDMGQISKLYDEMHIKGLLPG  941


 Score =   134 bits (336),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 116/212 (55%), Gaps = 1/212 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N  V++ +L     S R  DA + F  L      PD      L++     G  +  +   
Sbjct  731   NLIVYNVVLDGLCKSGRVEDAKRTFSELLKRGFIPDNFTYCTLIHGCSLAGNINEAFMLR  790

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M+ +G++PNI IYN LI+  CKSG +E+A    +++  KG+ P++ T+NTL+  YC+ 
Sbjct  791   DEMLSMGIVPNIAIYNALINGLCKSGNLERAIRLFNKLCMKGLVPNVITYNTLMDGYCKA  850

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTY  1008
             G   +AL ++ +M   G+ P +ITY+ LI+  C++G    A  L   + E  V PN VTY
Sbjct  851   GKIDDALKLKSKMMEEGISPSVITYSVLINGLCQKGDTEAAKSLLHQMGEMGVDPNFVTY  910

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             +TL+ GY + GD+ +  +L+  M  KGL P V
Sbjct  911   STLVQGYIQSGDMGQISKLYDEMHIKGLLPGV  942


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 74/152 (49%), Gaps = 0/152 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N  +++ L+     S     AI++F  L +  + P+      L++   K G  D   K  
Sbjct  801   NIAIYNALINGLCKSGNLERAIRLFNKLCMKGLVPNVITYNTLMDGYCKAGKIDDALKLK  860

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              KM++ G+ P++  Y+VLI+  C+ G+ E A   L +M   G+ P+  T++TL+  Y + 
Sbjct  861   SKMMEEGISPSVITYSVLINGLCQKGDTEAAKSLLHQMGEMGVDPNFVTYSTLVQGYIQS  920

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
             G   +   + D M   G+ P ++ + +   S+
Sbjct  921   GDMGQISKLYDEMHIKGLLPGVLDHETTSQSN  952



>ref|XP_009614927.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630-like 
[Nicotiana tomentosiformis]
Length=606

 Score =   253 bits (646),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 142/484 (29%), Positives = 261/484 (54%), Gaps = 6/484 (1%)
 Frame = -2

Query  1742  SFFKWVE---TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSP-AVLNA  1575
             SFFK+++   ++ + R +L++  ++   L + + F  AK++L+ +A  D L  P + + +
Sbjct  67    SFFKFLQKDLSLTHQRPNLEAHIALALRLLEARKFAEAKNILYDVAAADGLRKPFSEIAS  126

Query  1574  LVRSDD-DSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK  1398
             LV  ++ +  V  ++   L   Y ++ R  +A +VFE++R    + D  +C V L ++ +
Sbjct  127   LVGENNVEHKVMGKMLDMLFRVYVDNIRFEEAREVFEYMRNGGFELDDRSCMVYLLAMKR  186

Query  1397  EGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYT  1218
                 D++++ ++KM++  V   ++   ++I   CK GEV KA + + EM  KG+ P+ YT
Sbjct  187   RKQYDSLFEFFEKMVEYDVKITVYTMTMVIDGLCKVGEVNKARKLMDEMISKGVKPNEYT  246

Query  1217  FNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK  1038
             +NTL+  Y ++        +   M++ GV  D+ +Y  LI  +   G + +  RLF+ IK
Sbjct  247   YNTLLDAYMKKSDFVAVKEILRLMKKDGVNLDVTSYTLLIDGYSNFGNLEDVERLFRKIK  306

Query  1037  EK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMK  861
             EK + P+   Y+++I GYC++GD+ +A  +   M E+GL P   TY +++   C+ G+M+
Sbjct  307   EKGIEPDVHLYSSMISGYCKLGDVKKAFSVFDEMVERGLVPNAHTYGALINGLCKSGQMQ  366

Query  860   ESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALI  681
              +  LLN+M  K I+ + V  NT+++GYCK G++    +++  M   G   D + Y  + 
Sbjct  367   AAEVLLNEMQSKGIDVNRVIFNTMMDGYCKQGNMDEVWRLQRIMEGKGHEADVYVYNIIA  426

Query  680   HGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYC  501
              G C+    E AK  +F M+  G +P+  AY+ L+D YC + N     +   E   +G  
Sbjct  427   TGLCRLDRHEEAKTWLFSMVDRGVAPNEVAYTTLIDIYCKEGNFVEAKRALREMESKGVK  486

Query  500   VDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDL  321
              + + Y A+I   CK+G +  A +   +M+ + ++ D   YTSL +     G    A  L
Sbjct  487   PNTATYNAVIDGYCKKGLMKEAYKLRILMESKGLIPDVYTYTSLVHGECISGKVDDALKL  546

Query  320   FDEM  309
             F+EM
Sbjct  547   FNEM  550


 Score =   219 bits (559),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 192/347 (55%), Gaps = 3/347 (1%)
 Frame = -2

Query  1607  DFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHA  1428
             DF++   +L  + +   + DV S  ++ L+  Y+N     D  ++F  ++   I+PD H 
Sbjct  259   DFVAVKEILRLMKKDGVNLDVTS--YTLLIDGYSNFGNLEDVERLFRKIKEKGIEPDVHL  316

Query  1427  CTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEME  1248
              + +++   K G     +  + +M++ G++PN H Y  LI+  CKSG+++ A+  L+EM+
Sbjct  317   YSSMISGYCKLGDVKKAFSVFDEMVERGLVPNAHTYGALINGLCKSGQMQAAEVLLNEMQ  376

Query  1247  FKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMR  1068
              KGI  +   FNT++  YC++G   E   +Q  ME  G E D+  YN +    CR  R  
Sbjct  377   SKGIDVNRVIFNTMMDGYCKQGNMDEVWRLQRIMEGKGHEADVYVYNIIATGLCRLDRHE  436

Query  1067  EAMR-LFKDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSIL  891
             EA   LF  +   V PNEV YTTLID YC+ G+  EA R    ME KG+ P  ATYN+++
Sbjct  437   EAKTWLFSMVDRGVAPNEVAYTTLIDIYCKEGNFVEAKRALREMESKGVKPNTATYNAVI  496

Query  890   RKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLR  711
               +C++G MKE+ KL   M  K + PD  T  +L++G C  G +  ALK+ N+M   GL 
Sbjct  497   DGYCKKGLMKEAYKLRILMESKGLIPDVYTYTSLVHGECISGKVDDALKLFNEMPTEGLA  556

Query  710   PDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT  570
             P+  TY A+I G  K   ++ A  +  +MI AG +P   AYS LV +
Sbjct  557   PNVVTYTAIISGLSKEGRSDEAFRLYDEMIEAGLTPDAAAYSALVGS  603


 Score = 85.5 bits (210),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 93/188 (49%), Gaps = 0/188 (0%)
 Frame = -2

Query  851  KLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGF  672
            +   +M E  ++    T   +I+G CK+G++  A K+ ++M+  G++P+ +TY  L+  +
Sbjct  195  EFFEKMVEYDVKITVYTMTMVIDGLCKVGEVNKARKLMDEMISKGVKPNEYTYNTLLDAY  254

Query  671  CKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDI  492
             K  D    KE++  M   G +    +Y+ L+D Y    N E + +L  +   +G   D+
Sbjct  255  MKKSDFVAVKEILRLMKKDGVNLDVTSYTLLIDGYSNFGNLEDVERLFRKIKEKGIEPDV  314

Query  491  SFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDE  312
              Y ++I   CK G +  A   F  M ER ++ ++  Y +L     K G  +AA  L +E
Sbjct  315  HLYSSMISGYCKLGDVKKAFSVFDEMVERGLVPNAHTYGALINGLCKSGQMQAAEVLLNE  374

Query  311  MYKRRLMV  288
            M  + + V
Sbjct  375  MQSKGIDV  382


 Score = 79.7 bits (195),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 100/202 (50%), Gaps = 0/202 (0%)
 Frame = -2

Query  896  ILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAG  717
            + R + +  R +E+ ++   M     E D+ +C   +    +     S  +   KM+E  
Sbjct  145  LFRVYVDNIRFEEAREVFEYMRNGGFELDDRSCMVYLLAMKRRKQYDSLFEFFEKMVEYD  204

Query  716  LRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALV  537
            ++   +T   +I G CK  +  +A++++ +MI+ G  P+   Y+ L+D Y  +++  A+ 
Sbjct  205  VKITVYTMTMVIDGLCKVGEVNKARKLMDEMISKGVKPNEYTYNTLLDAYMKKSDFVAVK  264

Query  536  KLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAY  357
            ++       G  +D++ Y  +I      G L+  ER F  ++E+ I  D  +Y+S+   Y
Sbjct  265  EILRLMKKDGVNLDVTSYTLLIDGYSNFGNLEDVERLFRKIKEKGIEPDVHLYSSMISGY  324

Query  356  FKEGNTRAASDLFDEMYKRRLM  291
             K G+ + A  +FDEM +R L+
Sbjct  325  CKLGDVKKAFSVFDEMVERGLV  346



>ref|XP_004491249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X1 [Cicer arietinum]
 ref|XP_004491250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X2 [Cicer arietinum]
 ref|XP_004491251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X3 [Cicer arietinum]
 ref|XP_004491252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X4 [Cicer arietinum]
 ref|XP_004491253.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X5 [Cicer arietinum]
 ref|XP_004491254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
isoform X6 [Cicer arietinum]
Length=707

 Score =   255 bits (651),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 145/482 (30%), Positives = 255/482 (53%), Gaps = 3/482 (1%)
 Frame = -2

Query  1727  VETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSD  1548
             ++T+ +   +   + SM++ L + K+   A+ +L +I  K  +S   V+++LV  + +S+
Sbjct  85    IQTVASTSPNPTVTASMVHFLVQAKNLAEAQSLLLRIIRKSGVSRAEVIDSLV--NHNSN  142

Query  1547  VNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKT  1368
             +N  VF  L+  Y  +++  +  + F  LR        +AC  LL  +VK G  D  WK 
Sbjct  143   LNVVVFDLLIRTYVQARKLREGSEAFRILRERGFCASINACNALLGGIVKVGWVDLAWKI  202

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
             Y+  ++ G   N++  N++++A CK G++++   F+S ME KGI+PD+ T+NTLI+ YCR
Sbjct  203   YEDFVRSGNSVNVYTLNIMVNALCKDGKLDRVGVFMSGMEEKGIYPDIVTYNTLINAYCR  262

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVT  1011
             RG+  EA  + D M   G++P I TYN+LI+  C+EG    A  +  + +   + P+  T
Sbjct  263   RGLVSEAFQLMDSMAGKGLKPGIFTYNALINGLCKEGSYERAKCVLDEMLGIGLCPDAAT  322

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             +  L+   CR  D+ EA ++ + M   G+ P + +++SI+  F   G +  + +   +M 
Sbjct  323   FNPLLVESCRKEDVCEAEKVFNEMLGCGVVPDLISFSSIVGVFSRNGDLGRALEYFEKMK  382

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
                + PD V    LINGYCK GD+  ALK++N+M+E     D  TY  L++G C+ K   
Sbjct  383   GVGLVPDTVIYTILINGYCKNGDVTGALKMRNEMVERSCVMDVVTYNTLLNGLCRRKMLV  442

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAII  471
              A E+  +M+  G  P +   + L+  YC   N    + L +  + R    D+  Y  ++
Sbjct  443   DADELFKEMVERGVFPDFYTLTTLIHGYCKDGNMTKALSLFETMTLRSLKPDVVTYNTLM  502

Query  470   RRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
                CK G+++ A+  +  M  REI  + + ++ L   +   G    A  L+DEM ++ + 
Sbjct  503   DGFCKIGEMEKAKELWCDMISREIFPNFISFSILINGFCSLGLVSEAFRLWDEMKEKGIK  562

Query  290   VT  285
              T
Sbjct  563   PT  564


 Score =   216 bits (551),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/350 (33%), Positives = 193/350 (55%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  ++ +     A++ FE ++   + PD    T+L+N   K G      K   +M+
Sbjct  358   FSSIVGVFSRNGDLGRALEYFEKMKGVGLVPDTVIYTILINGYCKNGDVTGALKMRNEMV  417

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             +   + ++  YN L++  C+   +  ADE   EM  +G+FPD YT  TLI  YC+ G   
Sbjct  418   ERSCVMDVVTYNTLLNGLCRRKMLVDADELFKEMVERGVFPDFYTLTTLIHGYCKDGNMT  477

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +ALS+ + M    ++PD++TYN+L+   C+ G M +A  L+ D I  ++ PN ++++ LI
Sbjct  478   KALSLFETMTLRSLKPDVVTYNTLMDGFCKIGEMEKAKELWCDMISREIFPNFISFSILI  537

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +G+C +G + EA RL   M+EKG+ P + T N+I++ +   G + ++   LN+M  + + 
Sbjct  538   NGFCSLGLVSEAFRLWDEMKEKGIKPTLVTCNTIIKGYLRAGNVSKANDFLNKMVLEGVR  597

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD VT NTLING+ K  +   A  + + M E GL PD  TY A++ GFC+    + A+ +
Sbjct  598   PDCVTYNTLINGFLKEENFDRAFYLISNMEEQGLLPDLITYNAILSGFCRQGRMQEAEML  657

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                MI  G +P    Y+ L++ Y   +N +   ++ DE   RG+  D  F
Sbjct  658   SRKMIDKGINPDRSTYTLLINGYVSNDNLKEAFRVHDEMLQRGFVPDDKF  707


 Score =   214 bits (545),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 127/387 (33%), Positives = 196/387 (51%), Gaps = 1/387 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             I PD      L+N+  + GL    ++    M   G+ P I  YN LI+  CK G  E+A 
Sbjct  246   IYPDIVTYNTLINAYCRRGLVSEAFQLMDSMAGKGLKPGIFTYNALINGLCKEGSYERAK  305

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
               L EM   G+ PD  TFN L+   CR+    EA  V + M   GV PD+I+++S++   
Sbjct  306   CVLDEMLGIGLCPDAATFNPLLVESCRKEDVCEAEKVFNEMLGCGVVPDLISFSSIVGVF  365

Query  1088  CREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
              R G +  A+  F+ +K   + P+ V YT LI+GYC+ GD+  AL++ + M E+     V
Sbjct  366   SRNGDLGRALEYFEKMKGVGLVPDTVIYTILINGYCKNGDVTGALKMRNEMVERSCVMDV  425

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYN++L   C    + ++ +L  +M E+ + PD  T  TLI+GYCK G++  AL +   
Sbjct  426   VTYNTLLNGLCRRKMLVDADELFKEMVERGVFPDFYTLTTLIHGYCKDGNMTKALSLFET  485

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M    L+PD  TY  L+ GFCK  + E+AKE+  DMI+    P++ ++S L++ +C    
Sbjct  486   MTLRSLKPDVVTYNTLMDGFCKIGEMEKAKELWCDMISREIFPNFISFSILINGFCSLGL  545

Query  551   NEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTS  372
                  +L DE   +G    +     II+   + G +  A  F   M    +  D V Y +
Sbjct  546   VSEAFRLWDEMKEKGIKPTLVTCNTIIKGYLRAGNVSKANDFLNKMVLEGVRPDCVTYNT  605

Query  371   LAYAYFKEGNTRAASDLFDEMYKRRLM  291
             L   + KE N   A  L   M ++ L+
Sbjct  606   LINGFLKEENFDRAFYLISNMEEQGLL  632


 Score =   209 bits (532),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 119/386 (31%), Positives = 207/386 (54%), Gaps = 1/386 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             ++  F+ LL+     +   +A +VF  +  C + PD  + + ++    + G      + +
Sbjct  319   DAATFNPLLVESCRKEDVCEAEKVFNEMLGCGVVPDLISFSSIVGVFSRNGDLGRALEYF  378

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             +KM  +G++P+  IY +LI+  CK+G+V  A +  +EM  +    D+ T+NTL++  CRR
Sbjct  379   EKMKGVGLVPDTVIYTILINGYCKNGDVTGALKMRNEMVERSCVMDVVTYNTLLNGLCRR  438

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTY  1008
              M  +A  +   M   GV PD  T  +LIH +C++G M +A+ LF+ +    + P+ VTY
Sbjct  439   KMLVDADELFKEMVERGVFPDFYTLTTLIHGYCKDGNMTKALSLFETMTLRSLKPDVVTY  498

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
              TL+DG+C++G++++A  L   M  + + P   +++ ++  FC  G + E+ +L ++M E
Sbjct  499   NTLMDGFCKIGEMEKAKELWCDMISREIFPNFISFSILINGFCSLGLVSEAFRLWDEMKE  558

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             K I+P  VTCNT+I GY + G++  A    NKM+  G+RPD  TY  LI+GF K ++ +R
Sbjct  559   KGIKPTLVTCNTIIKGYLRAGNVSKANDFLNKMVLEGVRPDCVTYNTLINGFLKEENFDR  618

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             A  +I +M   G  P    Y+ ++  +C Q   +    L+ +   +G   D S Y  +I 
Sbjct  619   AFYLISNMEEQGLLPDLITYNAILSGFCRQGRMQEAEMLSRKMIDKGINPDRSTYTLLIN  678

Query  467   RLCKRGKLDCAERFFGMMQEREILGD  390
                    L  A R    M +R  + D
Sbjct  679   GYVSNDNLKEAFRVHDEMLQRGFVPD  704


 Score =   197 bits (502),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 207/383 (54%), Gaps = 5/383 (1%)
 Frame = -2

Query  1436  PHACT---VLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADE  1266
             P A T   +L+ S  KE + +   K + +M+  GV+P++  ++ ++    ++G++ +A E
Sbjct  318   PDAATFNPLLVESCRKEDVCEA-EKVFNEMLGCGVVPDLISFSSIVGVFSRNGDLGRALE  376

Query  1265  FLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHC  1086
             +  +M+  G+ PD   +  LI+ YC+ G    AL +++ M       D++TYN+L++  C
Sbjct  377   YFEKMKGVGLVPDTVIYTILINGYCKNGDVTGALKMRNEMVERSCVMDVVTYNTLLNGLC  436

Query  1085  REGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVA  909
             R   + +A  LFK++ E+ V P+  T TTLI GYC+ G++ +AL L   M  + L P V 
Sbjct  437   RRKMLVDADELFKEMVERGVFPDFYTLTTLIHGYCKDGNMTKALSLFETMTLRSLKPDVV  496

Query  908   TYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKM  729
             TYN+++  FC+ G M+++ +L   M  ++I P+ ++ + LING+C +G +  A ++ ++M
Sbjct  497   TYNTLMDGFCKIGEMEKAKELWCDMISREIFPNFISFSILINGFCSLGLVSEAFRLWDEM  556

Query  728   LEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNN  549
              E G++P   T   +I G+ +A +  +A + +  M+  G  P    Y+ L++ +  + N 
Sbjct  557   KEKGIKPTLVTCNTIIKGYLRAGNVSKANDFLNKMVLEGVRPDCVTYNTLINGFLKEENF  616

Query  548   EALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSL  369
             +    L      +G   D+  Y AI+   C++G++  AE     M ++ I  D   YT L
Sbjct  617   DRAFYLISNMEEQGLLPDLITYNAILSGFCRQGRMQEAEMLSRKMIDKGINPDRSTYTLL  676

Query  368   AYAYFKEGNTRAASDLFDEMYKR  300
                Y    N + A  + DEM +R
Sbjct  677   INGYVSNDNLKEAFRVHDEMLQR  699



>ref|XP_006287148.1| hypothetical protein CARUB_v10000318mg [Capsella rubella]
 gb|EOA20046.1| hypothetical protein CARUB_v10000318mg [Capsella rubella]
Length=729

 Score =   255 bits (652),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 151/543 (28%), Positives = 261/543 (48%), Gaps = 71/543 (13%)
 Frame = -2

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             N++H+  S  +MI+IL +      A+  + ++  +  +S   ++NALV +  +   N  V
Sbjct  108   NFKHTSLSLSAMIHILVRSGRLSDAQGCVLRMIRRSGVSRVEIVNALVSTYSNCGSNDSV  167

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             F  L+  Y  +++  +A + F  LR         AC  L+ SLV+ G  +  W  Y+++ 
Sbjct  168   FDLLIRTYVQARKLREAHEAFSLLRSKGYTVSIDACNALIGSLVRIGWVELAWGVYQEIS  227

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + GV  N+   N++++A CK G++EK   FLS+++ KG++PD+ T+NTLIS Y  +G+  
Sbjct  228   RSGVGINVFTLNIMVNALCKDGKMEKIGTFLSQVKEKGVYPDIVTYNTLISAYSSKGLME  287

Query  1172  EALSVQDRME-----------------------------------RGGVEPDIITYNSLI  1098
             EA  + D M                                    R G+ PD  TY SL+
Sbjct  288   EAFELMDAMPSKGFSPGVYTFNTVINGLCKHGRYERAKEVFAEMLRSGLSPDSTTYRSLL  347

Query  1097  HSHCREGRMREAMRLFKDIK------------------------------------EKVT  1026
                C++G   E  ++F D++                                      ++
Sbjct  348   MEACKKGDAVETEKIFSDMRCRDIVPDLVCFSSVMSLSARSGNLDKALVYFHSVKDAGLS  407

Query  1025  PNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL  846
             P+ V YT LI GYC+ G I EA+ L + M  +G    V TYN+IL   C++  ++E+ KL
Sbjct  408   PDNVIYTILIQGYCKKGMISEAMNLRNDMLRQGCAMDVVTYNTILHGLCKQKMLREADKL  467

Query  845   LNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCK  666
              N+M E+ + PD+ T   LI+G+CK+G++ +A+++  KM E  ++ D  TY  L+ GF K
Sbjct  468   FNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIKLDVVTYNTLLDGFGK  527

Query  665   AKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
               D + AKE+  DM++    P+  +YS +V+  C + +     ++ DE + +     +  
Sbjct  528   VGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRVWDEMTSKSIKPTVMI  587

Query  485   YRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMY  306
               ++I+  C+ G     E F   M     + D + Y +L Y + KE N   A  L  +M 
Sbjct  588   CNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKME  647

Query  305   KRR  297
             +++
Sbjct  648   EKQ  650


 Score =   194 bits (494),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/450 (26%), Positives = 220/450 (49%), Gaps = 40/450 (9%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+  Y++     +A ++ + +      P  +    ++N L K G  +   + + +M+
Sbjct  273   YNTLISAYSSKGLMEEAFELMDAMPSKGFSPGVYTFNTVINGLCKHGRYERAKEVFAEML  332

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISL--------  1197
             + G+ P+   Y  L+   CK G+  + ++  S+M  + I PDL  F++++SL        
Sbjct  333   RSGLSPDSTTYRSLLMEACKKGDAVETEKIFSDMRCRDIVPDLVCFSSVMSLSARSGNLD  392

Query  1196  ---------------------------YCRRGMHYEALSVQDRMERGGVEPDIITYNSLI  1098
                                        YC++GM  EA+++++ M R G   D++TYN+++
Sbjct  393   KALVYFHSVKDAGLSPDNVIYTILIQGYCKKGMISEAMNLRNDMLRQGCAMDVVTYNTIL  452

Query  1097  HSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLC  921
             H  C++  +REA +LF ++ E+ + P+  T T LIDG+C++G++  A+ L   M+EK + 
Sbjct  453   HGLCKQKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIK  512

Query  920   PRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKV  741
               V TYN++L  F + G +  + ++   M  ++I P  ++ + ++N  C  G +  A +V
Sbjct  513   LDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRV  572

Query  740   KNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCL  561
              ++M    ++P      ++I G+C++ +    +  +  MI+ GF P   +Y+ L+  +  
Sbjct  573   WDEMTSKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVK  632

Query  560   QNNNE---ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
             + N      LVK  +E  G G   D+  Y  I+   C++ ++  AE     M ER I  D
Sbjct  633   EENMSKAFGLVKKMEEKQG-GLVPDVFTYNTILHGFCRQNQMKEAEVVLRKMIERGIEPD  691

Query  389   SVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                YTSL   +  + N   A    DEM +R
Sbjct  692   RSTYTSLINGFVSQDNLTEAFRFHDEMLQR  721


 Score =   187 bits (474),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 175/352 (50%), Gaps = 3/352 (1%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++   A S     A+  F  ++   + PD    T+L+    K+G+          M+
Sbjct  378   FSSVMSLSARSGNLDKALVYFHSVKDAGLSPDNVIYTILIQGYCKKGMISEAMNLRNDML  437

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G   ++  YN ++H  CK   + +AD+  +EM  +G+FPD YT   LI  +C+ G   
Sbjct  438   RQGCAMDVVTYNTILHGLCKQKMLREADKLFNEMTERGLFPDSYTLTILIDGHCKLGNLQ  497

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              A+ +  +M+   ++ D++TYN+L+    + G +  A  ++ D +  ++ P  ++Y+ ++
Sbjct  498   NAMELFKKMKEKRIKLDVVTYNTLLDGFGKVGDIDTAKEIWADMVSREILPTPISYSIMV  557

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +  C  G + EA R+   M  K + P V   NS+++ +C  G   +    L +M  +   
Sbjct  558   NALCSKGHLSEAFRVWDEMTSKSIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFV  617

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLE--AGLRPDSFTYKALIHGFCKAKDTERAK  642
             PD ++ NTLI G+ K  ++  A  +  KM E   GL PD FTY  ++HGFC+    + A+
Sbjct  618   PDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGGLVPDVFTYNTILHGFCRQNQMKEAE  677

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
              V+  MI  G  P    Y+ L++ +  Q+N     +  DE   RG+  D  F
Sbjct  678   VVLRKMIERGIEPDRSTYTSLINGFVSQDNLTEAFRFHDEMLQRGFSPDDQF  729


 Score =   149 bits (376),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 94/314 (30%), Positives = 162/314 (52%), Gaps = 7/314 (2%)
 Frame = -2

Query  1631  MLHQIACKDFLSSPA--VLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLR  1458
             +L Q  CK  + S A  + N ++R     DV +  ++ +L      K   +A ++F  + 
Sbjct  415   ILIQGYCKKGMISEAMNLRNDMLRQGCAMDVVT--YNTILHGLCKQKMLREADKLFNEMT  472

Query  1457  ICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVE  1278
                + PD +  T+L++   K G      + +KKM +  +  ++  YN L+    K G+++
Sbjct  473   ERGLFPDSYTLTILIDGHCKLGNLQNAMELFKKMKEKRIKLDVVTYNTLLDGFGKVGDID  532

Query  1277  KADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLI  1098
              A E  ++M  + I P   +++ +++  C +G   EA  V D M    ++P ++  NS+I
Sbjct  533   TAKEIWADMVSREILPTPISYSIMVNALCSKGHLSEAFRVWDEMTSKSIKPTVMICNSMI  592

Query  1097  HSHCREGRMREAMRLF-KDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEK--G  927
               +CR G   +      K I E   P+ ++Y TLI G+ +  ++ +A  L   MEEK  G
Sbjct  593   KGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVKEENMSKAFGLVKKMEEKQGG  652

Query  926   LCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSAL  747
             L P V TYN+IL  FC + +MKE+  +L +M E+ IEPD  T  +LING+    ++  A 
Sbjct  653   LVPDVFTYNTILHGFCRQNQMKEAEVVLRKMIERGIEPDRSTYTSLINGFVSQDNLTEAF  712

Query  746   KVKNKMLEAGLRPD  705
             +  ++ML+ G  PD
Sbjct  713   RFHDEMLQRGFSPD  726



>ref|XP_008776298.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
 ref|XP_008776299.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
 ref|XP_008776300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
 ref|XP_008776301.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
Length=609

 Score =   253 bits (645),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 137/464 (30%), Positives = 245/464 (53%), Gaps = 1/464 (0%)
 Frame = -2

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANS  1500
             MI+I  +++    A+ ++ ++  +   S   ++ AL+ +      N  VF  L+  Y  +
Sbjct  1     MIHICIRNQRTSDAQSLILRMVRRRGTSRSDIVGALLSTYGRFGSNPSVFDLLIRTYVQA  60

Query  1499  KRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIY  1320
             ++  +A + F  L+  R     +AC  LL  LV+ G  D   + YK+++ +G   N++  
Sbjct  61    RKLREASEAFRVLKARRQSVSVNACNSLLAGLVRVGWVDMALEIYKEVVGMGTELNVYTL  120

Query  1319  NVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMER  1140
             N++++A CK G  E A  FLSEME KG+F D+ T+NTL+   CR G   EAL + + M  
Sbjct  121   NIMVNALCKDGRFEDAALFLSEMEKKGLFADIVTYNTLVDACCRNGHLEEALELLNSMVG  180

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G++PD+ TYN++++  C+ G+ + A  L  ++    + PN  T    +   C+ G++ E
Sbjct  181   KGLKPDVRTYNAVLNGFCKNGKYKRAQELLGEMMAGGLVPNASTSNIFLGRLCKEGNVKE  240

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
             A R+++ M  +GL P + +++S++  F ++G M  + +   +M    + PDNV    LI 
Sbjct  241   AARIYNEMLHRGLAPDMVSFSSMIGLFAKKGYMNRALEYFKEMKAAGLVPDNVIYTMLIG  300

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             G+CKI  I  ALK++++M++ G  PD  TY  +++G CK +    A E+  +M   G +P
Sbjct  301   GFCKISLISEALKMRDEMVDHGCMPDVVTYNTILNGMCKEQRLPEADELFSEMTERGVAP  360

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
              +C ++ L+   C     E  + L D    +    DI  Y  +I  LCK G ++ A   +
Sbjct  361   DFCTFTTLIHGSCKNGCIEKALNLFDMMLEKNLKPDIVTYNTLIDGLCKEGDMEKANELW  420

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
               M  R IL + + Y+ L   +  +G    A   +DEM +++++
Sbjct  421   DDMCNRGILPNLITYSILIDYHCSKGQVGKAFGYWDEMMEKKIL  464


 Score =   221 bits (563),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 126/430 (29%), Positives = 224/430 (52%), Gaps = 3/430 (1%)
 Frame = -2

Query  1586  VLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNS  1407
             +LN++V      DV  + ++ +L  +  + +   A ++   +    + P+     + L  
Sbjct  174   LLNSMVGKGLKPDV--RTYNAVLNGFCKNGKYKRAQELLGEMMAGGLVPNASTSNIFLGR  231

Query  1406  LVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPD  1227
             L KEG      + Y +M+  G+ P++  ++ +I    K G + +A E+  EM+  G+ PD
Sbjct  232   LCKEGNVKEAARIYNEMLHRGLAPDMVSFSSMIGLFAKKGYMNRALEYFKEMKAAGLVPD  291

Query  1226  LYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFK  1047
                +  LI  +C+  +  EAL ++D M   G  PD++TYN++++  C+E R+ EA  LF 
Sbjct  292   NVIYTMLIGGFCKISLISEALKMRDEMVDHGCMPDVVTYNTILNGMCKEQRLPEADELFS  351

Query  1046  DIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEG  870
             ++ E+ V P+  T+TTLI G C+ G I++AL L   M EK L P + TYN+++   C+EG
Sbjct  352   EMTERGVAPDFCTFTTLIHGSCKNGCIEKALNLFDMMLEKNLKPDIVTYNTLIDGLCKEG  411

Query  869   RMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYK  690
              M+++ +L + M  + I P+ +T + LI+ +C  G +  A    ++M+E  + P+  TY 
Sbjct  412   DMEKANELWDDMCNRGILPNLITYSILIDYHCSKGQVGKAFGYWDEMMEKKILPNIATYN  471

Query  689   ALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGR  510
             ++I G+C+  D  +A+E +  MI     P    Y+ L+  +  +   +    L ++   +
Sbjct  472   SIIKGYCRLGDASKAEEFLQKMIQERVFPDRITYNTLIHGFVKEERMQEAFALLNKMDDK  531

Query  509   GYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAA  330
             G   D+  Y  II   C++GK+  A+  F  M  R I  D   YT+L   +    N + A
Sbjct  532   GVLPDVITYNVIITGFCEQGKMQEADWVFKRMANRGIQPDRSTYTTLVNGFVAADNLKDA  591

Query  329   SDLFDEMYKR  300
               L DEM +R
Sbjct  592   FRLHDEMLQR  601


 Score =   216 bits (549),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 187/350 (53%), Gaps = 1/350 (0%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             FS ++  +A       A++ F+ ++   + PD    T+L+    K  L     K   +M+
Sbjct  260   FSSMIGLFAKKGYMNRALEYFKEMKAAGLVPDNVIYTMLIGGFCKISLISEALKMRDEMV  319

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               G +P++  YN +++  CK   + +ADE  SEM  +G+ PD  TF TLI   C+ G   
Sbjct  320   DHGCMPDVVTYNTILNGMCKEQRLPEADELFSEMTERGVAPDFCTFTTLIHGSCKNGCIE  379

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTTLI  996
             +AL++ D M    ++PDI+TYN+LI   C+EG M +A  L+ D+    + PN +TY+ LI
Sbjct  380   KALNLFDMMLEKNLKPDIVTYNTLIDGLCKEGDMEKANELWDDMCNRGILPNLITYSILI  439

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             D +C  G + +A      M EK + P +ATYNSI++ +C  G   ++ + L +M ++++ 
Sbjct  440   DYHCSKGQVGKAFGYWDEMMEKKILPNIATYNSIIKGYCRLGDASKAEEFLQKMIQERVF  499

Query  815   PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
             PD +T NTLI+G+ K   +  A  + NKM + G+ PD  TY  +I GFC+    + A  V
Sbjct  500   PDRITYNTLIHGFVKEERMQEAFALLNKMDDKGVLPDVITYNVIITGFCEQGKMQEADWV  559

Query  635   IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISF  486
                M   G  P    Y+ LV+ +   +N +   +L DE   RG+  D  F
Sbjct  560   FKRMANRGIQPDRSTYTTLVNGFVAADNLKDAFRLHDEMLQRGFVPDDKF  609


 Score =   179 bits (454),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 114/398 (29%), Positives = 200/398 (50%), Gaps = 5/398 (1%)
 Frame = -2

Query  1334  NIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQ  1155
             N  ++++LI    ++ ++ +A E    ++ +     +   N+L++   R G    AL + 
Sbjct  46    NPSVFDLLIRTYVQARKLREASEAFRVLKARRQSVSVNACNSLLAGLVRVGWVDMALEIY  105

Query  1154  DRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRV  978
               +   G E ++ T N ++++ C++GR  +A     ++++K +  + VTY TL+D  CR 
Sbjct  106   KEVVGMGTELNVYTLNIMVNALCKDGRFEDAALFLSEMEKKGLFADIVTYNTLVDACCRN  165

Query  977   GDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
             G ++EAL L ++M  KGL P V TYN++L  FC+ G+ K + +LL +M    + P+  T 
Sbjct  166   GHLEEALELLNSMVGKGLKPDVRTYNAVLNGFCKNGKYKRAQELLGEMMAGGLVPNASTS  225

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             N  +   CK G++  A ++ N+ML  GL PD  ++ ++I  F K     RA E   +M A
Sbjct  226   NIFLGRLCKEGNVKEAARIYNEMLHRGLAPDMVSFSSMIGLFAKKGYMNRALEYFKEMKA  285

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDC  438
             AG  P    Y+ L+  +C  +     +K+ DE    G   D+  Y  I+  +CK  +L  
Sbjct  286   AGLVPDNVIYTMLIGGFCKISLISEALKMRDEMVDHGCMPDVVTYNTILNGMCKEQRLPE  345

Query  437   AERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL---MVTlklyks  267
             A+  F  M ER +  D   +T+L +   K G    A +LFD M ++ L   +VT      
Sbjct  346   ADELFSEMTERGVAPDFCTFTTLIHGSCKNGCIEKALNLFDMMLEKNLKPDIVTYNTLID  405

Query  266   lsassKDENSLLDLFWNNVMQRGLISHNVHNSIFLKLH  153
                   D     +L W+++  RG++ + +  SI +  H
Sbjct  406   GLCKEGDMEKANEL-WDDMCNRGILPNLITYSILIDYH  442



>gb|KCW55237.1| hypothetical protein EUGRSUZ_I01171 [Eucalyptus grandis]
Length=557

 Score =   251 bits (640),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 140/431 (32%), Positives = 226/431 (52%), Gaps = 16/431 (4%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   F+ L+  +  +     A+  F  +      P+      L+N+  K G  D  ++  
Sbjct  9     NVFTFNVLMRGFCGAGNLEMALHFFHDMEKHGCLPNVVTYNTLINAYCKSGRMDEAYELL  68

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             + M   G+ PN+  YNV+I+  C+ G++++  E L+EM   G  PD  T+NTLI+ YC+ 
Sbjct  69    RSMSLKGLEPNVISYNVIINGLCREGKMKETSEVLNEMSRMGFVPDEVTYNTLINGYCKD  128

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
             G  ++AL +   M R G+ P+++TY SLI+S C+   +  AM  F  +  + + PN++TY
Sbjct  129   GNFHQALVLHAEMVRNGLSPNVVTYTSLINSMCKARNLNRAMEFFDQMHVRGLCPNQMTY  188

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTL+DG+ + G + EA ++   M  KG  P + TYN+++   C  GRM+E+  L+ QMG 
Sbjct  189   TTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTYNALINGHCFLGRMEEALGLIRQMGH  248

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             K I PD V+ +T+I+G+CK GD+  AL++K +M+E G+ PD+ TY +LI GFC  +    
Sbjct  249   KGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGFCGQRRLTE  308

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             A E+   M   G  P    Y+ L+D  C + N +    L DE   +G+  D+  Y  +I 
Sbjct  309   ACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTYSVLIN  368

Query  467   RLCKRGKLDCAERFFGMMQEREILGDSVVYTSL-----------AYAYFK----EGNTRA  333
              L K+ +   A+R    +   E +   V Y +L           A A  K    +G  + 
Sbjct  369   GLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIETCTNVDFKSALALLKGFCMKGLMKE  428

Query  332   ASDLFDEMYKR  300
             A  + D M +R
Sbjct  429   ADQVLDSMLER  439


 Score =   237 bits (604),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 195/357 (55%), Gaps = 1/357 (0%)
 Frame = -2

Query  1358  MIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM  1179
             MIK GV PN+  +NVL+   C +G +E A  F  +ME  G  P++ T+NTLI+ YC+ G 
Sbjct  1     MIKCGVSPNVFTFNVLMRGFCGAGNLEMALHFFHDMEKHGCLPNVVTYNTLINAYCKSGR  60

Query  1178  HYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVTYTT  1002
               EA  +   M   G+EP++I+YN +I+  CREG+M+E   +  ++ +    P+EVTY T
Sbjct  61    MDEAYELLRSMSLKGLEPNVISYNVIINGLCREGKMKETSEVLNEMSRMGFVPDEVTYNT  120

Query  1001  LIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK  822
             LI+GYC+ G+  +AL LH+ M   GL P V TY S++   C+   +  + +  +QM  + 
Sbjct  121   LINGYCKDGNFHQALVLHAEMVRNGLSPNVVTYTSLINSMCKARNLNRAMEFFDQMHVRG  180

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             + P+ +T  TL++G+ + G +  A K+ ++M   G  P   TY ALI+G C     E A 
Sbjct  181   LCPNQMTYTTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTYNALINGHCFLGRMEEAL  240

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
              +I  M   G SP   +YS ++  +C   + E  ++L  E   RG   D   Y ++I   
Sbjct  241   GLIRQMGHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGF  300

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
             C + +L  A   F  M +  ++ D   YT+L  A   EGN + A DL DEM ++  +
Sbjct  301   CGQRRLTEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFL  357


 Score =   213 bits (542),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/450 (28%), Positives = 214/450 (48%), Gaps = 60/450 (13%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   ++ L+  Y  S R  +A ++   + +  ++P+  +  V++N L +EG      +  
Sbjct  44    NVVTYNTLINAYCKSGRMDEAYELLRSMSLKGLEPNVISYNVIINGLCREGKMKETSEVL  103

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSG----------------------------------  1287
              +M ++G +P+   YN LI+  CK G                                  
Sbjct  104   NEMSRMGFVPDEVTYNTLINGYCKDGNFHQALVLHAEMVRNGLSPNVVTYTSLINSMCKA  163

Query  1286  -EVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
               + +A EF  +M  +G+ P+  T+ TL+  + ++G+  EA  + D M   G  P I+TY
Sbjct  164   RNLNRAMEFFDQMHVRGLCPNQMTYTTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTY  223

Query  1109  NSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEE  933
             N+LI+ HC  GRM EA+ L + +  K ++P+ V+Y+T+I G+C+ GD++ AL L   M E
Sbjct  224   NALINGHCFLGRMEEALGLIRQMGHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIE  283

Query  932   KGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVS  753
             +G+ P   TY S++  FC + R+ E+ +L  QM +  + PD  T  TLI+  C  G+I +
Sbjct  284   RGIEPDAITYTSLILGFCGQRRLTEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKT  343

Query  752   ALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVD  573
             A  + ++M++ G  PD  TY  LI+G  K   T  AK ++  +      P    Y  L++
Sbjct  344   AFDLHDEMIQKGFLPDVVTYSVLINGLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIE  403

Query  572   TYCLQNNNEALVKLADEFSGRGYCVDISFYR--AIIRRLCKRGKLDCAERFFGMMQEREI  399
             T                      C ++ F    A+++  C +G +  A++    M ER  
Sbjct  404   T----------------------CTNVDFKSALALLKGFCMKGLMKEADQVLDSMLERNH  441

Query  398   LGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                  VY  + + + K GN + A +L+ EM
Sbjct  442   RPSEAVYNVIIHGHCKGGNIQKAFNLYKEM  471


 Score =   207 bits (527),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/423 (29%), Positives = 207/423 (49%), Gaps = 18/423 (4%)
 Frame = -2

Query  1574  LVRSDDDSDVNSQVFSWLLIFYA--NSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             L+RS     +   V S+ +I        +  +  +V   +      PD      L+N   
Sbjct  67    LLRSMSLKGLEPNVISYNVIINGLCREGKMKETSEVLNEMSRMGFVPDEVTYNTLINGYC  126

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K+G        + +M++ G+ PN+  Y  LI++ CK+  + +A EF  +M  +G+ P+  
Sbjct  127   KDGNFHQALVLHAEMVRNGLSPNVVTYTSLINSMCKARNLNRAMEFFDQMHVRGLCPNQM  186

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI  1041
             T+ TL+  + ++G+  EA  + D M   G  P I+TYN+LI+ HC  GRM EA+ L + +
Sbjct  187   TYTTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTYNALINGHCFLGRMEEALGLIRQM  246

Query  1040  KEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
               K ++P+ V+Y+T+I G+C+ GD++ AL L   M E+G+ P   TY S++  FC + R+
Sbjct  247   GHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGFCGQRRL  306

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
              E+ +L  QM +  + PD  T  TLI+  C  G+I +A  + ++M++ G  PD  TY  L
Sbjct  307   TEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTYSVL  366

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT---------------YCLQNNN  549
             I+G  K   T  AK ++  +      P    Y  L++T               +C++   
Sbjct  367   INGLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIETCTNVDFKSALALLKGFCMKGLM  426

Query  548   EALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSL  369
             +   ++ D    R +    + Y  II   CK G +  A   +  M    ++  +V  T+L
Sbjct  427   KEADQVLDSMLERNHRPSEAVYNVIIHGHCKGGNIQKAFNLYKEMMLAGLVPHTVTVTAL  486

Query  368   AYA  360
               A
Sbjct  487   IKA  489


 Score =   174 bits (442),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 118/422 (28%), Positives = 196/422 (46%), Gaps = 55/422 (13%)
 Frame = -2

Query  1613  CKD--FLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKP  1440
             CKD  F  +  +   +VR+    +V +  ++ L+     ++    A++ F+ + +  + P
Sbjct  126   CKDGNFHQALVLHAEMVRNGLSPNVVT--YTSLINSMCKARNLNRAMEFFDQMHVRGLCP  183

Query  1439  DPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFL  1260
             +    T L++   ++GL    +K   +M   G  P I  YN LI+  C  G +E+A   +
Sbjct  184   NQMTYTTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTYNALINGHCFLGRMEEALGLI  243

Query  1259  SEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCRE  1080
              +M  KGI PD+ +++T+IS +C+ G    AL ++  M   G+EPD ITY SLI   C +
Sbjct  244   RQMGHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGFCGQ  303

Query  1079  GRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATY  903
              R+ EA  LF+ + +  + P+E TYTTLID  C  G+I  A  LH  M +KG  P V TY
Sbjct  304   RRLTEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTY  363

Query  902   N--------------------------------------------------SILRKFCEE  873
             +                                                  ++L+ FC +
Sbjct  364   SVLINGLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIETCTNVDFKSALALLKGFCMK  423

Query  872   GRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTY  693
             G MKE+ ++L+ M E+   P     N +I+G+CK G+I  A  +  +M+ AGL P + T 
Sbjct  424   GLMKEADQVLDSMLERNHRPSEAVYNVIIHGHCKGGNIQKAFNLYKEMMLAGLVPHTVTV  483

Query  692   KALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSG  513
              ALI    + +  ++  EVI + + +           LVD    + N +A+  +  E + 
Sbjct  484   TALIKALHEREMNDKLSEVIHNTMKSCKLADAEVAKVLVDINHKEGNMDAVFNVLSEMAK  543

Query  512   RG  507
              G
Sbjct  544   DG  545


 Score = 97.8 bits (242),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 89/368 (24%), Positives = 147/368 (40%), Gaps = 70/368 (19%)
 Frame = -2

Query  1649  FKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVF  1470
              K A  +L ++  K F  +    NAL+        N   F           R  +A+ + 
Sbjct  201   LKEAYKILDEMTHKGFSPTIVTYNALI--------NGHCFLG---------RMEEALGLI  243

Query  1469  EHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKS  1290
               +    I PD  + + +++   K G  +   +  ++MI+ G+ P+   Y  LI   C  
Sbjct  244   RQMGHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGFCGQ  303

Query  1289  GEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
               + +A E   +M   G+ PD +T+ TLI   C  G    A  + D M + G  PD++TY
Sbjct  304   RRLTEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTY  363

Query  1109  NSLIHSHCREGRMREAMRLF-KDIKEKVTPNEVTYTTLID--------------------  993
             + LI+   ++ R REA RL  K    +  P +VTY TLI+                    
Sbjct  364   SVLINGLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIETCTNVDFKSALALLKGFCMK  423

Query  992   ------------------------------GYCRVGDIDEALRLHSAMEEKGLCPRVATY  903
                                           G+C+ G+I +A  L+  M   GL P   T 
Sbjct  424   GLMKEADQVLDSMLERNHRPSEAVYNVIIHGHCKGGNIQKAFNLYKEMMLAGLVPHTVTV  483

Query  902   NSILRKFCE-EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
              ++++   E E   K S  + N M   K+  D      L++   K G++ +   V ++M 
Sbjct  484   TALIKALHEREMNDKLSEVIHNTMKSCKL-ADAEVAKVLVDINHKEGNMDAVFNVLSEMA  542

Query  725   EAGLRPDS  702
             + GL P+S
Sbjct  543   KDGLLPNS  550



>ref|NP_195731.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9LFC5.1|PP360_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g01110 
[Arabidopsis thaliana]
 emb|CAB69839.1| putative protein [Arabidopsis thaliana]
 gb|AAO64186.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00399.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90300.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=729

 Score =   255 bits (651),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 151/540 (28%), Positives = 257/540 (48%), Gaps = 71/540 (13%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++H+  S  +MI+IL +      A+  L ++  +  +S   ++N+L  +  +   N  
Sbjct  107   PNFKHTSLSLSAMIHILVRSGRLSDAQSCLLRMIRRSGVSRLEIVNSLDSTFSNCGSNDS  166

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF  L+  Y  +++  +A + F  LR         AC  L+ SLV+ G  +  W  Y+++
Sbjct  167   VFDLLIRTYVQARKLREAHEAFTLLRSKGFTVSIDACNALIGSLVRIGWVELAWGVYQEI  226

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              + GV  N++  N++++A CK G++EK   FLS+++ KG++PD+ T+NTLIS Y  +G+ 
Sbjct  227   SRSGVGINVYTLNIMVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYSSKGLM  286

Query  1175  YEALSVQDRME-----------------------------------RGGVEPDIITYNSL  1101
              EA  + + M                                    R G+ PD  TY SL
Sbjct  287   EEAFELMNAMPGKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSL  346

Query  1100  IHSHCREGRMREAMRLFKDIKEK------------------------------------V  1029
             +   C++G + E  ++F D++ +                                    +
Sbjct  347   LMEACKKGDVVETEKVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFNSVKEAGL  406

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
              P+ V YT LI GYCR G I  A+ L + M ++G    V TYN+IL   C+   + E+ K
Sbjct  407   IPDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADK  466

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             L N+M E+ + PD+ T   LI+G+CK+G++ +A+++  KM E  +R D  TY  L+ GF 
Sbjct  467   LFNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFG  526

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             K  D + AKE+  DM++    P+  +YS LV+  C + +     ++ DE   +     + 
Sbjct  527   KVGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVM  586

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
                ++I+  C+ G     E F   M     + D + Y +L Y + +E N   A  L  +M
Sbjct  587   ICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVREENMSKAFGLVKKM  646


 Score =   184 bits (466),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/442 (25%), Positives = 212/442 (48%), Gaps = 27/442 (6%)
 Frame = -2

Query  1736  FKWVETIPN--YRHSLQSSWSMIYILTKHKHFKSAKDMLHQI------------------  1617
             F+ +  +P   +   + +  ++I  L KH  ++ AK++  ++                  
Sbjct  290   FELMNAMPGKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSLLME  349

Query  1616  ACK--DFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIK  1443
             ACK  D + +  V + +   D   D+    FS ++  +  S     A+  F  ++   + 
Sbjct  350   ACKKGDVVETEKVFSDMRSRDVVPDL--VCFSSMMSLFTRSGNLDKALMYFNSVKEAGLI  407

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD    T+L+    ++G+         +M++ G   ++  YN ++H  CK   + +AD+ 
Sbjct  408   PDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADKL  467

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
              +EM  + +FPD YT   LI  +C+ G    A+ +  +M+   +  D++TYN+L+    +
Sbjct  468   FNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGK  527

Query  1082  EGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVAT  906
              G +  A  ++ D + +++ P  ++Y+ L++  C  G + EA R+   M  K + P V  
Sbjct  528   VGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVMI  587

Query  905   YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
              NS+++ +C  G   +    L +M  +   PD ++ NTLI G+ +  ++  A  +  KM 
Sbjct  588   CNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVREENMSKAFGLVKKME  647

Query  725   E--AGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             E   GL PD FTY +++HGFC+    + A+ V+  MI  G +P    Y+ +++ +  Q+N
Sbjct  648   EEQGGLVPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVNPDRSTYTCMINGFVSQDN  707

Query  551   NEALVKLADEFSGRGYCVDISF  486
                  ++ DE   RG+  D  F
Sbjct  708   LTEAFRIHDEMLQRGFSPDDKF  729


 Score =   177 bits (449),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/450 (25%), Positives = 213/450 (47%), Gaps = 40/450 (9%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             ++ L+  Y++     +A ++   +      P  +    ++N L K G  +   + + +M+
Sbjct  273   YNTLISAYSSKGLMEEAFELMNAMPGKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEML  332

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
             + G+ P+   Y  L+   CK G+V + ++  S+M  + + PDL  F++++SL+ R G   
Sbjct  333   RSGLSPDSTTYRSLLMEACKKGDVVETEKVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLD  392

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
             +AL   + ++  G+ PD + Y  LI  +CR+G +  AM L  + +++    + VTY T++
Sbjct  393   KALMYFNSVKEAGLIPDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTIL  452

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
              G C+   + EA +L + M E+ L P   T   ++   C+ G ++ + +L  +M EK+I 
Sbjct  453   HGLCKRKMLGEADKLFNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIR  512

Query  815   PDNVTCNTLINGYCKIGDI-----------------------------------VSALKV  741
              D VT NTL++G+ K+GDI                                     A +V
Sbjct  513   LDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRV  572

Query  740   KNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCL  561
              ++M+   ++P      ++I G+C++ +    +  +  MI+ GF P   +Y+ L+  +  
Sbjct  573   WDEMISKNIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVR  632

Query  560   QNNNE---ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
             + N      LVK  +E  G G   D+  Y +I+   C++ ++  AE     M ER +  D
Sbjct  633   EENMSKAFGLVKKMEEEQG-GLVPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVNPD  691

Query  389   SVVYTSLAYAYFKEGNTRAASDLFDEMYKR  300
                YT +   +  + N   A  + DEM +R
Sbjct  692   RSTYTCMINGFVSQDNLTEAFRIHDEMLQR  721



>ref|XP_010272059.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nelumbo nucifera]
Length=760

 Score =   255 bits (652),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 146/468 (31%), Positives = 254/468 (54%), Gaps = 6/468 (1%)
 Frame = -2

Query  1676  IYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDS----DVNSQVFSWLLIFY  1509
             ++ LT+ K +K+A+ +  ++   +  S  AV +++      +    + +S VF  L+  Y
Sbjct  92    LHSLTRFKLYKTAQTLAEELVSHEVDSYAAVGSSVFECFKSTYHLCNSSSSVFDLLVKAY  151

Query  1508  ANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK-EGLTDTVWKTYKKMIKLGVLPN  1332
             A+     +A+ V    +     P   +   +L+++ + +G  ++  + Y +MI+  V PN
Sbjct  152   AHLNMIREALDVINLAKSSGFVPGVLSYNSVLDAIFRSKGSVESAEELYGEMIRSNVSPN  211

Query  1331  IHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQD  1152
             ++ YN+LI      G++EKA +  SEME KG  P++ T NTL+  YC+ G   EA  V +
Sbjct  212   VYSYNILIRGFVGVGKLEKALDVFSEMERKGCVPNVVTLNTLVDAYCKLGKINEAFRVFE  271

Query  1151  RMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVG  975
              + + G++P++I+YN +I+  CREGRM+E   + +++  K + P++VTY TL+ GYC+ G
Sbjct  272   SISQRGLQPNLISYNVVINGLCREGRMKETGDVLEEMNRKGLLPDKVTYNTLVSGYCKEG  331

Query  974   DIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCN  795
             +  +AL +H+ M  KGL P V TY +++   C+ G +  + + L+QM  + + P+  T  
Sbjct  332   NAHQALVIHAEMMRKGLYPNVVTYTALINSMCKAGNLNRAMEFLDQMRIRGLCPNERTYT  391

Query  794   TLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAA  615
             TLI+G+ K G +  A +  N+M E+G  P   TY  LI+G C     + A  VI DM+  
Sbjct  392   TLIDGFAKQGLLDKAYQFLNEMTESGFSPSIVTYNTLINGHCILGRLDEALGVIQDMVVK  451

Query  614   GFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCA  435
             G +P   +YS ++  +C   + E   ++  E   +G   D   Y A+++ LC + +L  A
Sbjct  452   GLNPDVVSYSTVITGFCRNQDLEKAFQMKQEMVRKGVSPDAITYSALVQGLCDQRRLAEA  511

Query  434   ERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
                F  M    +  D VVYT+L   Y  EG+ + A  L DEM ++  +
Sbjct  512   CDLFHEMLCIGLSPDEVVYTTLINGYCIEGDVKKALHLHDEMIQKGFL  559


 Score =   249 bits (637),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 148/539 (27%), Positives = 264/539 (49%), Gaps = 74/539 (14%)
 Frame = -2

Query  1703  HSLQSSWSMIYILTK-HKHF---KSAKDMLHQIACKDF----LSSPAVLNALVRSDDD--  1554
             H   SS S+  +L K + H    + A D+++      F    LS  +VL+A+ RS     
Sbjct  135   HLCNSSSSVFDLLVKAYAHLNMIREALDVINLAKSSGFVPGVLSYNSVLDAIFRSKGSVE  194

Query  1553  -----------SDVNSQVFSW--LLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLL  1413
                        S+V+  V+S+  L+  +    +   A+ VF  +      P+      L+
Sbjct  195   SAEELYGEMIRSNVSPNVYSYNILIRGFVGVGKLEKALDVFSEMERKGCVPNVVTLNTLV  254

Query  1412  NSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIF  1233
             ++  K G  +  ++ ++ + + G+ PN+  YNV+I+  C+ G +++  + L EM  KG+ 
Sbjct  255   DAYCKLGKINEAFRVFESISQRGLQPNLISYNVVINGLCREGRMKETGDVLEEMNRKGLL  314

Query  1232  PDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL  1053
             PD  T+NTL+S YC+ G  ++AL +   M R G+ P+++TY +LI+S C+ G +  AM  
Sbjct  315   PDKVTYNTLVSGYCKEGNAHQALVIHAEMMRKGLYPNVVTYTALINSMCKAGNLNRAMEF  374

Query  1052  FKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCE  876
                ++ + + PNE TYTTLIDG+ + G +D+A +  + M E G  P + TYN+++   C 
Sbjct  375   LDQMRIRGLCPNERTYTTLIDGFAKQGLLDKAYQFLNEMTESGFSPSIVTYNTLINGHCI  434

Query  875   EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
              GR+ E+  ++  M  K + PD V+ +T+I G+C+  D+  A ++K +M+  G+ PD+ T
Sbjct  435   LGRLDEALGVIQDMVVKGLNPDVVSYSTVITGFCRNQDLEKAFQMKQEMVRKGVSPDAIT  494

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
             Y AL+ G C  +    A ++  +M+  G SP    Y+ L++ YC++ + +  + L DE  
Sbjct  495   YSALVQGLCDQRRLAEACDLFHEMLCIGLSPDEVVYTTLINGYCIEGDVKKALHLHDEMI  554

Query  515   GRGYCVDISFYR------------------------------------------------  480
              +G+  D+  Y                                                 
Sbjct  555   QKGFLPDVVTYNVLINGLSKQARTKEAKKLLFRLIYEESIPNDITYDTLMGHCSNAEFKS  614

Query  479   --AIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
               A+I+  C +G ++ A+R F  M +R    +   Y  + + + + GN R A DL++EM
Sbjct  615   VLALIKGFCMKGLMNEADRVFKSMSQRNWKPNEAAYNIIIHGHCRGGNIRKALDLYNEM  673


 Score =   189 bits (480),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/334 (31%), Positives = 183/334 (55%), Gaps = 16/334 (5%)
 Frame = -2

Query  1484  AIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIH  1305
             A++  + +RI  + P+    T L++   K+GL D  ++   +M + G  P+I  YN LI+
Sbjct  371   AMEFLDQMRIRGLCPNERTYTTLIDGFAKQGLLDKAYQFLNEMTESGFSPSIVTYNTLIN  430

Query  1304  ACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEP  1125
               C  G +++A   + +M  KG+ PD+ +++T+I+ +CR     +A  ++  M R GV P
Sbjct  431   GHCILGRLDEALGVIQDMVVKGLNPDVVSYSTVITGFCRNQDLEKAFQMKQEMVRKGVSP  490

Query  1124  DIITYNSLIHSHCREGRMREAMRLFKDIK-EKVTPNEVTYTTLIDGYCRVGDIDEALRLH  948
             D ITY++L+   C + R+ EA  LF ++    ++P+EV YTTLI+GYC  GD+ +AL LH
Sbjct  491   DAITYSALVQGLCDQRRLAEACDLFHEMLCIGLSPDEVVYTTLINGYCIEGDVKKALHLH  550

Query  947   SAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL-------  789
               M +KG  P V TYN ++    ++ R KE+ KLL ++  ++  P+++T +TL       
Sbjct  551   DEMIQKGFLPDVVTYNVLINGLSKQARTKEAKKLLFRLIYEESIPNDITYDTLMGHCSNA  610

Query  788   --------INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
                     I G+C  G +  A +V   M +   +P+   Y  +IHG C+  +  +A ++ 
Sbjct  611   EFKSVLALIKGFCMKGLMNEADRVFKSMSQRNWKPNEAAYNIIIHGHCRGGNIRKALDLY  670

Query  632   FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKL  531
              +M+ +GF P+      L+ +   +  +E + K+
Sbjct  671   NEMVTSGFVPNTITAIALIKSLFNEGMSEQMSKV  704


 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/312 (26%), Positives = 143/312 (46%), Gaps = 18/312 (6%)
 Frame = -2

Query  1589  AVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLN  1410
              V+  +V    + DV S  +S ++  +  ++    A Q+ + +    + PD    + L+ 
Sbjct  443   GVIQDMVVKGLNPDVVS--YSTVITGFCRNQDLEKAFQMKQEMVRKGVSPDAITYSALVQ  500

Query  1409  SLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFP  1230
              L  +         + +M+ +G+ P+  +Y  LI+  C  G+V+KA     EM  KG  P
Sbjct  501   GLCDQRRLAEACDLFHEMLCIGLSPDEVVYTTLINGYCIEGDVKKALHLHDEMIQKGFLP  560

Query  1229  DLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNS---------------LIH  1095
             D+ T+N LI+   ++    EA  +  R+      P+ ITY++               LI 
Sbjct  561   DVVTYNVLINGLSKQARTKEAKKLLFRLIYEESIPNDITYDTLMGHCSNAEFKSVLALIK  620

Query  1094  SHCREGRMREAMRLFKDIKEKV-TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCP  918
               C +G M EA R+FK + ++   PNE  Y  +I G+CR G+I +AL L++ M   G  P
Sbjct  621   GFCMKGLMNEADRVFKSMSQRNWKPNEAAYNIIIHGHCRGGNIRKALDLYNEMVTSGFVP  680

Query  917   RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
                T  ++++    EG  ++ +K++  + +    PD      L+      G++     V 
Sbjct  681   NTITAIALIKSLFNEGMSEQMSKVIQNILKLCRLPDGEITKALVKINHNEGNMNEVFDVL  740

Query  737   NKMLEAGLRPDS  702
               M + GL P+S
Sbjct  741   TIMAKDGLLPNS  752



>ref|XP_008790235.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Phoenix dactylifera]
Length=952

 Score =   258 bits (658),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 158/542 (29%), Positives = 286/542 (53%), Gaps = 21/542 (4%)
 Frame = -2

Query  1895  TESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTL--LTLSPCWFWLSWSFFKWVE  1722
             + S+L+  LC I+    ++ +   K+    +  I++  L  L L P        FF+   
Sbjct  33    SRSELLDRLCRILTLERFHAV--SKLPFEFSDDILDAVLVRLRLDP---GACLGFFRIAS  87

Query  1721  TIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPA-------VLNALVRS  1563
                 +R + +S   +++IL++ + F  A+  L     KD ++ P+       V + LVR 
Sbjct  88    KQQYFRPNARSHCKIVHILSRGRMFDEARGYL-----KDLVTVPSDRSSVSYVFDELVRV  142

Query  1562  DDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTD  1383
                   +  VF  LL  YA      +A+ VF+++     KP   +C  LL+SLVK G + 
Sbjct  143   YKLFSFSPTVFDMLLKVYAEGGSVKEALFVFDNMGKYGCKPSSRSCNSLLSSLVKCGESR  202

Query  1382  TVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI  1203
             T    +++M + G+LP++   +++++A CK G+++KA +F+ EME KG   +L T+++LI
Sbjct  203   TTAHVFEQMARAGILPDVFTVSIMVNAYCKDGKIQKASDFVLEMERKGFEVNLVTYHSLI  262

Query  1202  SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK--EKV  1029
             + YC  G    A+ V   M   G+ P+++T   LI  +C+EG+++EA R+  ++K    +
Sbjct  263   NGYCSLGQTETAVRVFRSMSERGISPNVVTCTLLIKGYCKEGKVQEAERVLNNMKVVAGL  322

Query  1028  TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTK  849
             + +EV Y  L++ YC++G +D+A+R+   M   G+   V   N+++  +C+ GR++E+ K
Sbjct  323   SADEVAYGVLVNAYCQMGKMDDAIRIRDEMSGMGIKANVVICNALINGYCKLGRIREAEK  382

Query  848   LLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFC  669
             ++++M    ++PD  + NTL++G+CK G +  A ++   ML+ G+     TY  L  GF 
Sbjct  383   IVDEMENGYLKPDAYSYNTLLDGFCKEGLMSKAFEICYMMLQKGIEVTVLTYNTLFKGFS  442

Query  668   KAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDIS  489
             +    + A ++ F M+  G +P+  + S ++D +    + E  +KL  +   RG+     
Sbjct  443   QGGAMDDALKLWFLMLKRGVAPNEISCSTMLDGFFKAGDIERALKLWKDILARGFAKSQI  502

Query  488   FYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
              Y  +I  LCK GK+  AE     M +     DSV Y +L   Y K G+ + A ++ DEM
Sbjct  503   TYNTVINGLCKVGKMVEAEEILRKMVDWGCFPDSVTYRTLIDGYCKVGDMQKALNVRDEM  562

Query  308   YK  303
              K
Sbjct  563   EK  564


 Score =   214 bits (544),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 128/468 (27%), Positives = 242/468 (52%), Gaps = 6/468 (1%)
 Frame = -2

Query  1568  RSDDDSDVNSQVFSWLLIF--YANSKRTWDAIQVFEHLRICR-IKPDPHACTVLLNSLVK  1398
             RS  +  ++  V +  L+   Y    +  +A +V  ++++   +  D  A  VL+N+  +
Sbjct  279   RSMSERGISPNVVTCTLLIKGYCKEGKVQEAERVLNNMKVVAGLSADEVAYGVLVNAYCQ  338

Query  1397  EGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYT  1218
              G  D   +   +M  +G+  N+ I N LI+  CK G + +A++ + EME   + PD Y+
Sbjct  339   MGKMDDAIRIRDEMSGMGIKANVVICNALINGYCKLGRIREAEKIVDEMENGYLKPDAYS  398

Query  1217  FNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL-FKDI  1041
             +NTL+  +C+ G+  +A  +   M + G+E  ++TYN+L     + G M +A++L F  +
Sbjct  399   YNTLLDGFCKEGLMSKAFEICYMMLQKGIEVTVLTYNTLFKGFSQGGAMDDALKLWFLML  458

Query  1040  KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMK  861
             K  V PNE++ +T++DG+ + GDI+ AL+L   +  +G      TYN+++   C+ G+M 
Sbjct  459   KRGVAPNEISCSTMLDGFFKAGDIERALKLWKDILARGFAKSQITYNTVINGLCKVGKMV  518

Query  860   ESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALI  681
             E+ ++L +M +    PD+VT  TLI+GYCK+GD+  AL V+++M + G  P    + +LI
Sbjct  519   EAEEILRKMVDWGCFPDSVTYRTLIDGYCKVGDMQKALNVRDEMEKLGFSPSIEMFNSLI  578

Query  680   HGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYC  501
              G  K+K +    +++  M   G +P+   Y  L+  +C +   +   +   E +G+G  
Sbjct  579   TGLFKSKTSGWVNDLLVGMQEKGLAPNIVTYGALIAGWCKEGIMDKAFEAYFEMTGKGLT  638

Query  500   VDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDL  321
              +I    A++  L ++GK+D A      M +  +L D  V+   +       +    ++L
Sbjct  639   PNIFICTALVSGLYRQGKIDEANVLLQKMVDINMLPDYEVFNKSSDCSANNPSMHKIANL  698

Query  320   FDEMYKRRLMVTlklykslsassKDENSLLD--LFWNNVMQRGLISHN  183
              DE  K  +     +Y  +         +LD  + + +++QRG +  N
Sbjct  699   LDETTKENIQPNNIMYNVVICGLCKSGRILDAKILFASLLQRGFVPDN  746


 Score =   197 bits (500),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/322 (32%), Positives = 169/322 (52%), Gaps = 1/322 (0%)
 Frame = -2

Query  1448  IKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKAD  1269
             + P+      L+    KEG+ D  ++ Y +M   G+ PNI I   L+    + G++++A+
Sbjct  602   LAPNIVTYGALIAGWCKEGIMDKAFEAYFEMTGKGLTPNIFICTALVSGLYRQGKIDEAN  661

Query  1268  EFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSH  1089
               L +M    + PD   FN            ++  ++ D   +  ++P+ I YN +I   
Sbjct  662   VLLQKMVDINMLPDYEVFNKSSDCSANNPSMHKIANLLDETTKENIQPNNIMYNVVICGL  721

Query  1088  CREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRV  912
             C+ GR+ +A  LF  + ++   P+  TY TLI G+   G++DEA  L   M ++GL P +
Sbjct  722   CKSGRILDAKILFASLLQRGFVPDNFTYCTLIHGFSASGNVDEAFVLRDEMMKRGLIPNI  781

Query  911   ATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNK  732
              TYNS++   C+ G +  +  L +++  K + P+ VT NTLI+GYCK G I  A K+K K
Sbjct  782   VTYNSLINGLCKSGNLDRAVNLFHKLHSKGVTPNVVTFNTLIDGYCKSGKITEAFKLKQK  841

Query  731   MLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNN  552
             M+E G+ P   TY  LI+G C   DTE A +++  M+ +G  P+Y  YS LV  Y    +
Sbjct  842   MMEEGISPTVVTYTTLINGLCSQGDTEAAIKILDQMVESGVDPNYVTYSTLVQGYIRCMD  901

Query  551   NEALVKLADEFSGRGYCVDISF  486
                + KL +E   RG    ++F
Sbjct  902   MHQISKLYEEMHIRGLFPAVAF  923


 Score =   190 bits (482),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 219/471 (46%), Gaps = 36/471 (8%)
 Frame = -2

Query  1613  CKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDP  1434
             CK+ L S A     +      +V    ++ L   ++      DA++++  +    + P+ 
Sbjct  407   CKEGLMSKAFEICYMMLQKGIEVTVLTYNTLFKGFSQGGAMDDALKLWFLMLKRGVAPNE  466

Query  1433  HACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSE  1254
              +C+ +L+   K G  +   K +K ++  G   +   YN +I+  CK G++ +A+E L +
Sbjct  467   ISCSTMLDGFFKAGDIERALKLWKDILARGFAKSQITYNTVINGLCKVGKMVEAEEILRK  526

Query  1253  MEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGR  1074
             M   G FPD  T+ TLI  YC+ G   +AL+V+D ME+ G  P I  +NSLI    +   
Sbjct  527   MVDWGCFPDSVTYRTLIDGYCKVGDMQKALNVRDEMEKLGFSPSIEMFNSLITGLFKSKT  586

Query  1073  MREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNS  897
                   L   ++EK + PN VTY  LI G+C+ G +D+A   +  M  KGL P +    +
Sbjct  587   SGWVNDLLVGMQEKGLAPNIVTYGALIAGWCKEGIMDKAFEAYFEMTGKGLTPNIFICTA  646

Query  896   ILRKFCEEGRMKESTKLLNQM-----------------------------------GEKK  822
             ++     +G++ E+  LL +M                                    ++ 
Sbjct  647   LVSGLYRQGKIDEANVLLQKMVDINMLPDYEVFNKSSDCSANNPSMHKIANLLDETTKEN  706

Query  821   IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAK  642
             I+P+N+  N +I G CK G I+ A  +   +L+ G  PD+FTY  LIHGF  + + + A 
Sbjct  707   IQPNNIMYNVVICGLCKSGRILDAKILFASLLQRGFVPDNFTYCTLIHGFSASGNVDEAF  766

Query  641   EVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRL  462
              +  +M+  G  P+   Y+ L++  C   N +  V L  +   +G   ++  +  +I   
Sbjct  767   VLRDEMMKRGLIPNIVTYNSLINGLCKSGNLDRAVNLFHKLHSKGVTPNVVTFNTLIDGY  826

Query  461   CKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             CK GK+  A +    M E  I    V YT+L      +G+T AA  + D+M
Sbjct  827   CKSGKITEAFKLKQKMMEEGISPTVVTYTTLINGLCSQGDTEAAIKILDQM  877


 Score =   172 bits (435),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 119/422 (28%), Positives = 204/422 (48%), Gaps = 7/422 (2%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N  + + L+  Y    R  +A ++ + +    +KPD ++   LL+   KEGL    ++  
Sbjct  360   NVVICNALINGYCKLGRIREAEKIVDEMENGYLKPDAYSYNTLLDGFCKEGLMSKAFEIC  419

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
               M++ G+   +  YN L     + G ++ A +    M  +G+ P+  + +T++  + + 
Sbjct  420   YMMLQKGIEVTVLTYNTLFKGFSQGGAMDDALKLWFLMLKRGVAPNEISCSTMLDGFFKA  479

Query  1184  GMHYEALSV-QDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVT  1011
             G    AL + +D + RG  +  I TYN++I+  C+ G+M EA  + + + +    P+ VT
Sbjct  480   GDIERALKLWKDILARGFAKSQI-TYNTVINGLCKVGKMVEAEEILRKMVDWGCFPDSVT  538

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             Y TLIDGYC+VGD+ +AL +   ME+ G  P +  +NS++    +         LL  M 
Sbjct  539   YRTLIDGYCKVGDMQKALNVRDEMEKLGFSPSIEMFNSLITGLFKSKTSGWVNDLLVGMQ  598

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
             EK + P+ VT   LI G+CK G +  A +   +M   GL P+ F   AL+ G  +    +
Sbjct  599   EKGLAPNIVTYGALIAGWCKEGIMDKAFEAYFEMTGKGLTPNIFICTALVSGLYRQGKID  658

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNE--ALVKLADEFSGRGYCVDISFYRA  477
              A  ++  M+     P Y  ++   D  C  NN     +  L DE +      +   Y  
Sbjct  659   EANVLLQKMVDINMLPDYEVFNKSSD--CSANNPSMHKIANLLDETTKENIQPNNIMYNV  716

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRR  297
             +I  LCK G++  A+  F  + +R  + D+  Y +L + +   GN   A  L DEM KR 
Sbjct  717   VICGLCKSGRILDAKILFASLLQRGFVPDNFTYCTLIHGFSASGNVDEAFVLRDEMMKRG  776

Query  296   LM  291
             L+
Sbjct  777   LI  778


 Score =   152 bits (385),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 104/419 (25%), Positives = 184/419 (44%), Gaps = 71/419 (17%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD      L++   K G          +M KLG  P+I ++N LI    KS      ++ 
Sbjct  534   PDSVTYRTLIDGYCKVGDMQKALNVRDEMEKLGFSPSIEMFNSLITGLFKSKTSGWVNDL  593

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
             L  M+ KG+ P++ T+  LI+ +C+ G+  +A      M   G+ P+I    +L+    R
Sbjct  594   LVGMQEKGLAPNIVTYGALIAGWCKEGIMDKAFEAYFEMTGKGLTPNIFICTALVSGLYR  653

Query  1082  EGRMREAMRLFKDI------------------------------------KEKVTPNEVT  1011
             +G++ EA  L + +                                    KE + PN + 
Sbjct  654   QGKIDEANVLLQKMVDINMLPDYEVFNKSSDCSANNPSMHKIANLLDETTKENIQPNNIM  713

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             Y  +I G C+ G I +A  L +++ ++G  P   TY +++  F   G + E+  L ++M 
Sbjct  714   YNVVICGLCKSGRILDAKILFASLLQRGFVPDNFTYCTLIHGFSASGNVDEAFVLRDEMM  773

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
             ++ + P+ VT N+LING CK G++  A+ + +K+   G+ P+  T+  LI G+CK+    
Sbjct  774   KRGLIPNIVTYNSLINGLCKSGNLDRAVNLFHKLHSKGVTPNVVTFNTLIDGYCKSGKIT  833

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAII  471
              A ++   M+  G SP+   Y+ L++  C Q + EA +K+ D+                 
Sbjct  834   EAFKLKQKMMEEGISPTVVTYTTLINGLCSQGDTEAAIKILDQ-----------------  876

Query  470   RRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
                               M E  +  + V Y++L   Y +  +    S L++EM+ R L
Sbjct  877   ------------------MVESGVDPNYVTYSTLVQGYIRCMDMHQISKLYEEMHIRGL  917


 Score =   134 bits (337),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 115/213 (54%), Gaps = 1/213 (0%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N+ +++ ++     S R  DA  +F  L      PD      L++     G  D  +   
Sbjct  710   NNIMYNVVICGLCKSGRILDAKILFASLLQRGFVPDNFTYCTLIHGFSASGNVDEAFVLR  769

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M+K G++PNI  YN LI+  CKSG +++A     ++  KG+ P++ TFNTLI  YC+ 
Sbjct  770   DEMMKRGLIPNIVTYNSLINGLCKSGNLDRAVNLFHKLHSKGVTPNVVTFNTLIDGYCKS  829

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
             G   EA  ++ +M   G+ P ++TY +LI+  C +G    A+++   + E  V PN VTY
Sbjct  830   GKITEAFKLKQKMMEEGISPTVVTYTTLINGLCSQGDTEAAIKILDQMVESGVDPNYVTY  889

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVA  909
             +TL+ GY R  D+ +  +L+  M  +GL P VA
Sbjct  890   STLVQGYIRCMDMHQISKLYEEMHIRGLFPAVA  922



>gb|KEH30569.1| PPR containing plant-like protein [Medicago truncatula]
Length=583

 Score =   251 bits (640),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/541 (28%), Positives = 274/541 (51%), Gaps = 7/541 (1%)
 Frame = -2

Query  1904  GANTESQLVKTLCVIVLKGHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWV  1725
             G   +S  + T+  ++ K HW+ L KP + ++  +T I+  L         L   FFKW 
Sbjct  12    GPILQSLSIPTISELLSKQHWSEL-KPHLRVTKPATFIDQLLNAGVDSELVLR--FFKWS  68

Query  1724  ETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDV  1545
             +      + L+ +  +++ L   K +   +  L      +  +  +V ++L+        
Sbjct  69    QKEYRLSYGLEPTSKVLHFLANSKRYSKVRSFLDSFVKNEKHTVSSVFHSLLLDGGRPGA  128

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
              + +   L++ Y  +     A + F   +    K    +C  LL++LVKE     V   Y
Sbjct  129   TALIIDMLVLAYVKNLELHCAYEAFTRAKDYGFKLSQTSCNPLLSALVKENKIGDVEYVY  188

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             K+MIK  +  N++ +N+ I+  C++G++ KA++ + +M+  GI P + T+NTL+  YC+R
Sbjct  189   KEMIKRRIHTNLNTFNIFINGLCRAGKLNKAEDAIEDMKAWGISPKVVTYNTLVDGYCKR  248

Query  1184  GMH---YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNE  1017
             G     Y+A +    M    + P+ +T+N+LI   C++  +  A + F+++ K+ + PN 
Sbjct  249   GSAGKMYKAEAFMKEMLANKICPNEVTFNTLIDGFCKDENVAAAKKAFEEMQKQGLKPNI  308

Query  1016  VTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQ  837
             VTY +LI+G C  G ++EA+ L   M   GL P + TYN+++  FC++  MKE+TK+L+ 
Sbjct  309   VTYNSLINGLCNNGKLEEAIDLWDKMVGLGLKPNIVTYNALINGFCKKKMMKEATKVLDD  368

Query  836   MGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKD  657
             + ++++ P+ +T NT+I+ YCK G +     + + MLE G+ P+  TYK LI G C+ +D
Sbjct  369   VSKQELVPNVITFNTMIDAYCKEGMMEEGFSLCSSMLEEGILPNVSTYKCLIAGLCRKQD  428

Query  656   TERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRA  477
              + AKE++ +M   G       Y+ L+D  C  + +    KL +E    G   +   Y  
Sbjct  429   LQAAKELLNEMENKGLKGDVVTYNILIDGLCKNDKSRNAEKLLNEMFNLGLKPNHVTYNT  488

Query  476   IIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRR  297
             ++   C  GKL  A      M++     + V Y  L   Y K     AA+ L +EM ++ 
Sbjct  489   LMDGYCMEGKLKAALNVRKRMEKERKQPNVVTYNVLIKGYCKINKLEAANGLLNEMLEKG  548

Query  296   L  294
             L
Sbjct  549   L  549


 Score = 99.0 bits (245),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 111/234 (47%), Gaps = 6/234 (3%)
 Frame = -2

Query  983  RVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNV  804
            ++GD++    ++  M ++ +   + T+N  +   C  G++ ++   +  M    I P  V
Sbjct  180  KIGDVE---YVYKEMIKRRIHTNLNTFNIFINGLCRAGKLNKAEDAIEDMKAWGISPKVV  236

Query  803  TCNTLINGYCK---IGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVI  633
            T NTL++GYCK    G +  A     +ML   + P+  T+  LI GFCK ++   AK+  
Sbjct  237  TYNTLVDGYCKRGSAGKMYKAEAFMKEMLANKICPNEVTFNTLIDGFCKDENVAAAKKAF  296

Query  632  FDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKR  453
             +M   G  P+   Y+ L++  C     E  + L D+  G G   +I  Y A+I   CK+
Sbjct  297  EEMQKQGLKPNIVTYNSLINGLCNNGKLEEAIDLWDKMVGLGLKPNIVTYNALINGFCKK  356

Query  452  GKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
              +  A +    + ++E++ + + + ++  AY KEG       L   M +  ++
Sbjct  357  KMMKEATKVLDDVSKQELVPNVITFNTMIDAYCKEGMMEEGFSLCSSMLEEGIL  410



>ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g39710-like [Cucumis sativus]
Length=749

 Score =   254 bits (649),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 145/487 (30%), Positives = 251/487 (52%), Gaps = 5/487 (1%)
 Frame = -2

Query  1751  LSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDF-LSSPAVLNA  1575
             L   F  W  +   +  S Q     ++ILT++K +K+A+ +  ++       +   +   
Sbjct  63    LVLKFLDWARSQQFF--SFQCKCLALHILTRYKLYKTAQSLAEEVVVNTVDETGEDLFQC  120

Query  1574  LVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKE  1395
             L  S      +S VF  ++   A       A+ +    +     P   +   +L+++++ 
Sbjct  121   LKNSYYQCKSSSAVFDLVVKSCARVNLINKALSIVNLAKSYGFMPGVLSYNAILDAVIRT  180

Query  1394  GLTDTVWK-TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYT  1218
               +  + +  +K+M++ GV PN++ YN+LI   C +G +E    F  EME  G  P++ T
Sbjct  181   KQSVKIAEGIFKEMVESGVSPNVYTYNILIRGFCTAGNLEMGLXFFGEMERNGCLPNVVT  240

Query  1217  FNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-  1041
             +NT+I  YC+     EA  +   M   G+ P++I+YN +I+  CREG+M+E   + +++ 
Sbjct  241   YNTIIDAYCKLRKIGEAFKLLRLMALKGLNPNLISYNVVINGLCREGQMKETSEILEEMS  300

Query  1040  KEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMK  861
             K +  P+ VT+ TLI+GYC VG+  +AL LH+ M + GL P V TY +++   C+ G + 
Sbjct  301   KRRYVPDRVTFNTLINGYCNVGNFHQALVLHAEMVKNGLSPNVVTYTTLINSMCKAGNLN  360

Query  860   ESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALI  681
              + + L+QM ++ + P+  T  TLI+G+ + G +  A ++  +M+E G  P   TY ALI
Sbjct  361   RAMEFLDQMRDRGLHPNGRTYTTLIDGFSQQGFLKQAYQIMKEMVENGFTPTIITYNALI  420

Query  680   HGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYC  501
             +G C     E A  ++ +MI  GF P   +YS ++  +C     E   +L  E   +G  
Sbjct  421   NGHCILGRMEDASGLLQEMIERGFIPDVVSYSTIISGFCRNQELEKAFQLKVEMVAKGIS  480

Query  500   VDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDL  321
              D++ Y ++I+ LCK+ +L      F  M    +  D V YTSL  AY  EG+   A  L
Sbjct  481   PDVATYSSLIQGLCKQRRLGEVCDLFQEMLSLGLPPDEVTYTSLINAYCIEGDLDKALRL  540

Query  320   FDEMYKR  300
              DEM ++
Sbjct  541   HDEMIQK  547


 Score =   224 bits (571),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 120/427 (28%), Positives = 227/427 (53%), Gaps = 16/427 (4%)
 Frame = -2

Query  1601  LSSPAVLNALVRSDD-------------DSDVNSQVFSWLLIF--YANSKRTWDAIQVFE  1467
             LS  A+L+A++R+               +S V+  V+++ ++   +  +      +  F 
Sbjct  168   LSYNAILDAVIRTKQSVKIAEGIFKEMVESGVSPNVYTYNILIRGFCTAGNLEMGLXFFG  227

Query  1466  HLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSG  1287
              +      P+      ++++  K       +K  + M   G+ PN+  YNV+I+  C+ G
Sbjct  228   EMERNGCLPNVVTYNTIIDAYCKLRKIGEAFKLLRLMALKGLNPNLISYNVVINGLCREG  287

Query  1286  EVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYN  1107
             ++++  E L EM  +   PD  TFNTLI+ YC  G  ++AL +   M + G+ P+++TY 
Sbjct  288   QMKETSEILEEMSKRRYVPDRVTFNTLINGYCNVGNFHQALVLHAEMVKNGLSPNVVTYT  347

Query  1106  SLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEK  930
             +LI+S C+ G +  AM     ++++ + PN  TYTTLIDG+ + G + +A ++   M E 
Sbjct  348   TLINSMCKAGNLNRAMEFLDQMRDRGLHPNGRTYTTLIDGFSQQGFLKQAYQIMKEMVEN  407

Query  929   GLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSA  750
             G  P + TYN+++   C  GRM++++ LL +M E+   PD V+ +T+I+G+C+  ++  A
Sbjct  408   GFTPTIITYNALINGHCILGRMEDASGLLQEMIERGFIPDVVSYSTIISGFCRNQELEKA  467

Query  749   LKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT  570
              ++K +M+  G+ PD  TY +LI G CK +      ++  +M++ G  P    Y+ L++ 
Sbjct  468   FQLKVEMVAKGISPDVATYSSLIQGLCKQRRLGEVCDLFQEMLSLGLPPDEVTYTSLINA  527

Query  569   YCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGD  390
             YC++ + +  ++L DE   +G+  DI  Y  +I    K+ +   A+R    +   E + +
Sbjct  528   YCIEGDLDKALRLHDEMIQKGFSPDIVTYNVLINGFNKQSRTKEAKRLLLKLLYEESVPN  587

Query  389   SVVYTSL  369
              + Y +L
Sbjct  588   EITYNTL  594


 Score =   219 bits (558),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/393 (31%), Positives = 206/393 (52%), Gaps = 25/393 (6%)
 Frame = -2

Query  1478  QVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHAC  1299
             ++ E +   R  PD      L+N     G        + +M+K G+ PN+  Y  LI++ 
Sbjct  294   EILEEMSKRRYVPDRVTFNTLINGYCNVGNFHQALVLHAEMVKNGLSPNVVTYTTLINSM  353

Query  1298  CKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDI  1119
             CK+G + +A EFL +M  +G+ P+  T+ TLI  + ++G   +A  +   M   G  P I
Sbjct  354   CKAGNLNRAMEFLDQMRDRGLHPNGRTYTTLIDGFSQQGFLKQAYQIMKEMVENGFTPTI  413

Query  1118  ITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSA  942
             ITYN+LI+ HC  GRM +A  L +++ E+   P+ V+Y+T+I G+CR  ++++A +L   
Sbjct  414   ITYNALINGHCILGRMEDASGLLQEMIERGFIPDVVSYSTIISGFCRNQELEKAFQLKVE  473

Query  941   MEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGD  762
             M  KG+ P VATY+S+++  C++ R+ E   L  +M    + PD VT  +LIN YC  GD
Sbjct  474   MVAKGISPDVATYSSLIQGLCKQRRLGEVCDLFQEMLSLGLPPDEVTYTSLINAYCIEGD  533

Query  761   IVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSW  582
             +  AL++ ++M++ G  PD  TY  LI+GF K   T+ AK ++  ++     P+   Y+ 
Sbjct  534   LDKALRLHDEMIQKGFSPDIVTYNVLINGFNKQSRTKEAKRLLLKLLYEESVPNEITYNT  593

Query  581   LVDTYCLQNNNEALVKLADEFSGRGYCVDISFYR--AIIRRLCKRGKLDCAERFFGMMQE  408
             L+D                       C ++ F    A+++  C +G ++ A+R    M +
Sbjct  594   LIDN----------------------CNNLEFKSALALMKGFCMKGLMNEADRVLESMLQ  631

Query  407   REILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
             +    +  VY  + + + K GN   A +L+ EM
Sbjct  632   KGYKLNEEVYNVIIHGHSKVGNIEKAYNLYKEM  664


 Score =   117 bits (292),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/314 (27%), Positives = 145/314 (46%), Gaps = 16/314 (5%)
 Frame = -2

Query  1496  RTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYN  1317
             R  DA  + + +      PD  + + +++   +    +  ++   +M+  G+ P++  Y+
Sbjct  428   RMEDASGLLQEMIERGFIPDVVSYSTIISGFCRNQELEKAFQLKVEMVAKGISPDVATYS  487

Query  1316  VLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERG  1137
              LI   CK   + +  +   EM   G+ PD  T+ +LI+ YC  G   +AL + D M + 
Sbjct  488   SLIQGLCKQRRLGEVCDLFQEMLSLGLPPDEVTYTSLINAYCIEGDLDKALRLHDEMIQK  547

Query  1136  GVEPDIITYNSLIHSHCREGRMREAMRLF-KDIKEKVTPNEVTYTTLID-----------  993
             G  PDI+TYN LI+   ++ R +EA RL  K + E+  PNE+TY TLID           
Sbjct  548   GFSPDIVTYNVLINGFNKQSRTKEAKRLLLKLLYEESVPNEITYNTLIDNCNNLEFKSAL  607

Query  992   ----GYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEK  825
                 G+C  G ++EA R+  +M +KG       YN I+    + G ++++  L  +M   
Sbjct  608   ALMKGFCMKGLMNEADRVLESMLQKGYKLNEEVYNVIIHGHSKVGNIEKAYNLYKEMLHS  667

Query  824   KIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERA  645
                P +VT   L       G  V   ++ +  L++    ++   K LI    K  + +  
Sbjct  668   GFAPHSVTIMALAKSLYHEGKEVELNQLLDYTLKSCRITEAALAKVLIGINSKEGNMDAV  727

Query  644   KEVIFDMIAAGFSP  603
               V+ DM  +G  P
Sbjct  728   FNVLKDMALSGLLP  741


 Score = 95.1 bits (235),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 107/234 (46%), Gaps = 7/234 (3%)
 Frame = -2

Query  983  RVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKL----LNQMGEKKIE  816
            RV  I++AL + +  +  G  P V +YN+IL       R K+S K+      +M E  + 
Sbjct  144  RVNLINKALSIVNLAKSYGFMPGVLSYNAILDAVI---RTKQSVKIAEGIFKEMVESGVS  200

Query  815  PDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEV  636
            P+  T N LI G+C  G++   L    +M   G  P+  TY  +I  +CK +    A ++
Sbjct  201  PNVYTYNILIRGFCTAGNLEMGLXFFGEMERNGCLPNVVTYNTIIDAYCKLRKIGEAFKL  260

Query  635  IFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCK  456
            +  M   G +P+  +Y+ +++  C +   +   ++ +E S R Y  D   +  +I   C 
Sbjct  261  LRLMALKGLNPNLISYNVVINGLCREGQMKETSEILEEMSKRRYVPDRVTFNTLINGYCN  320

Query  455  RGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
             G    A      M +  +  + V YT+L  +  K GN   A +  D+M  R L
Sbjct  321  VGNFHQALVLHAEMVKNGLSPNVVTYTTLINSMCKAGNLNRAMEFLDQMRDRGL  374


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 118/292 (40%), Gaps = 49/292 (17%)
 Frame = -2

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
             +S L+      +R  +   +F+ +    + PD    T L+N+   EG  D   + + +MI
Sbjct  486   YSSLIQGLCKQRRLGEVCDLFQEMLSLGLPPDEVTYTSLINAYCIEGDLDKALRLHDEMI  545

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLI----------  1203
             + G  P+I  YNVLI+   K    ++A   L ++ ++   P+  T+NTLI          
Sbjct  546   QKGFSPDIVTYNVLINGFNKQSRTKEAKRLLLKLLYEESVPNEITYNTLIDNCNNLEFKS  605

Query  1202  -----SLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIK  1038
                    +C +G+  EA  V + M + G + +   YN +IH H + G + +A  L+K++ 
Sbjct  606   ALALMKGFCMKGLMNEADRVLESMLQKGYKLNEEVYNVIIHGHSKVGNIEKAYNLYKEM-  664

Query  1037  EKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKE  858
                                         LHS     G  P   T  ++ +    EG+  E
Sbjct  665   ----------------------------LHS-----GFAPHSVTIMALAKSLYHEGKEVE  691

Query  857   STKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
               +LL+   +     +      LI    K G++ +   V   M  +GL P S
Sbjct  692   LNQLLDYTLKSCRITEAALAKVLIGINSKEGNMDAVFNVLKDMALSGLLPYS  743



>gb|EYU35942.1| hypothetical protein MIMGU_mgv1a002651mg [Erythranthe guttata]
Length=650

 Score =   252 bits (644),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/492 (30%), Positives = 247/492 (50%), Gaps = 34/492 (7%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQ  1536
             PN++HS  S    +++L   K    A+ ++ ++  +   S   ++++L  +      N  
Sbjct  96    PNFKHSSLSLSGAVHVLVSSKRISDAQSLILRMIRRSGASRIEIVDSLFGTYAKCGSNLY  155

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
             VF   +  Y  +++  +A++ F  L +  I    +AC  LL  L + G  D   + + +M
Sbjct  156   VFDLFVRTYVQARKFREAVEAFRLLDLRNIDVSINACNSLLGGLGRIGWVDLAREVFDEM  215

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
             I      N +  N++++  CK G++E+A  FL+EME +GIF D+ T+NTLI+ Y R G  
Sbjct  216   ITRRTDLNAYTLNIMVNVFCKDGKIERAKGFLTEMEERGIFADIVTYNTLINAYSREGNI  275

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREG---------------------------  1077
              E L     M    +EP ++TYNS+++  C+ G                           
Sbjct  276   EEGLETMRLMRDKNLEPSLLTYNSIVNGLCKNGHYARAKGVLNEMVQNGLCPDTYSSVIG  335

Query  1076  ---RMREAMRL---FKDIKEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCP  918
                R+ +  R+   +KD++ K + P+++ YT LI G+ R G I EA+ +   M  +G   
Sbjct  336   YFSRIGDLGRMIGYYKDMQSKGLIPDKIVYTILIGGFSRHGAIAEAMNVRDEMVTRGCQL  395

Query  917   RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
              V TYN++L   C+E  + E+  L N+M E+ + PD  T  TLINGYCK GD+  AL + 
Sbjct  396   DVVTYNTLLNGLCKEHMLCEADALFNEMVERGVFPDFCTYTTLINGYCKKGDMDRALDLF  455

Query  737   NKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQ  558
               ML+  L+PD+ TY  LI GFC+  +  RA  +  DMI+   +P+Y  Y  L++ +C  
Sbjct  456   ESMLQRNLKPDAVTYNTLIDGFCRVGEMGRAINLRDDMISKKINPNYITYGTLMNGFCNG  515

Query  557   NNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVY  378
                    KL +E   +G   +I    ++++  C+ G+LD    F   M+ R +  D V Y
Sbjct  516   GYLPDAFKLWNEMVDKGIEPNIVICNSLVKGYCRNGELDKGFEFLSKMKSRGVHPDCVTY  575

Query  377   TSLAYAYFKEGN  342
              +L + + KE N
Sbjct  576   NTLIHGFMKEEN  587


 Score =   190 bits (483),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/377 (30%), Positives = 194/377 (51%), Gaps = 26/377 (7%)
 Frame = -2

Query  1712  NYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQV  1533
             N   SL +  S++  L K+ H+  AK                VLN +V++    D  S V
Sbjct  289   NLEPSLLTYNSIVNGLCKNGHYARAK---------------GVLNEMVQNGLCPDTYSSV  333

Query  1532  FSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMI  1353
               +    ++        I  ++ ++   + PD    T+L+    + G          +M+
Sbjct  334   IGY----FSRIGDLGRMIGYYKDMQSKGLIPDKIVYTILIGGFSRHGAIAEAMNVRDEMV  389

Query  1352  KLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHY  1173
               G   ++  YN L++  CK   + +AD   +EM  +G+FPD  T+ TLI+ YC++G   
Sbjct  390   TRGCQLDVVTYNTLLNGLCKEHMLCEADALFNEMVERGVFPDFCTYTTLINGYCKKGDMD  449

Query  1172  EALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLI  996
              AL + + M +  ++PD +TYN+LI   CR G M  A+ L  D I +K+ PN +TY TL+
Sbjct  450   RALDLFESMLQRNLKPDAVTYNTLIDGFCRVGEMGRAINLRDDMISKKINPNYITYGTLM  509

Query  995   DGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIE  816
             +G+C  G + +A +L + M +KG+ P +   NS+++ +C  G + +  + L++M  + + 
Sbjct  510   NGFCNGGYLPDAFKLWNEMVDKGIEPNIVICNSLVKGYCRNGELDKGFEFLSKMKSRGVH  569

Query  815   PDNVTCNTLINGY------CKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
             PD VT NTLI+G+      CK+G +  A  +  KM++ G+ PD  T+ +LI+GF   ++ 
Sbjct  570   PDCVTYNTLIHGFMKEENFCKLGRMQEADTIYRKMIKGGISPDRSTFTSLINGFVSQENL  629

Query  653   ERAKEVIFDMIAAGFSP  603
             + A     +M+  GF P
Sbjct  630   KEAFRFHDEMLRRGFVP  646


 Score =   117 bits (294),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 114/219 (52%), Gaps = 7/219 (3%)
 Frame = -2

Query  1442  PDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEF  1263
             PD    T L+N   K+G  D     ++ M++  + P+   YN LI   C+ GE+ +A   
Sbjct  430   PDFCTYTTLINGYCKKGDMDRALDLFESMLQRNLKPDAVTYNTLIDGFCRVGEMGRAINL  489

Query  1262  LSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCR  1083
               +M  K I P+  T+ TL++ +C  G   +A  + + M   G+EP+I+  NSL+  +CR
Sbjct  490   RDDMISKKINPNYITYGTLMNGFCNGGYLPDAFKLWNEMVDKGIEPNIVICNSLVKGYCR  549

Query  1082  EGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGY------CRVGDIDEALRLHSAMEEKGL  924
              G + +       +K + V P+ VTY TLI G+      C++G + EA  ++  M + G+
Sbjct  550   NGELDKGFEFLSKMKSRGVHPDCVTYNTLIHGFMKEENFCKLGRMQEADTIYRKMIKGGI  609

Query  923   CPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDN  807
              P  +T+ S++  F  +  +KE+ +  ++M  +   PD+
Sbjct  610   SPDRSTFTSLINGFVSQENLKEAFRFHDEMLRRGFVPDD  648



>emb|CDO97115.1| unnamed protein product [Coffea canephora]
Length=647

 Score =   252 bits (643),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 154/510 (30%), Positives = 258/510 (51%), Gaps = 10/510 (2%)
 Frame = -2

Query  1823  KIGLSVTSTIINHTLLTL--SPCWFWLSWSFFKWVETIPNYRHSLQSSWSMIYILTKHKH  1650
             ++  S+T  +I+ T L+L  SP    L  +F K++   P   + L+     I IL++   
Sbjct  73    QVSSSLTPKLISCTFLSLRSSP---DLILNFIKYLS--PQCLN-LECYCLAISILSRRPS  126

Query  1649  FKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLI-FYANSKRTWDAIQV  1473
              K A +++  + C        +   LV + +   ++S +   LLI      K+  +A + 
Sbjct  127   PKQATELIKTVICSRIARISDIFYGLVGARERLKISSSILLDLLIRALCELKKGDEAFEC  186

Query  1472  FEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCK  1293
             F+ ++   + P    C  +L+  +K   T   W  Y +M ++ +   +  +N++++  CK
Sbjct  187   FKMMQGMNVLPKIETCNDILSLFLKLNRTQMAWIVYAEMFRMRINSGLRTFNIMVNLLCK  246

Query  1292  SGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIIT  1113
              G++++A EF+ +ME  G  P++ T+NT+I  YC +G   EA  V + M   G+EPD  T
Sbjct  247   EGKLKRAKEFIRQMEGFGFKPNVVTYNTVIHGYCLKGDLEEANKVLESMISKGLEPDTYT  306

Query  1112  YNSLIHSHCREGRMREAMRLF-KDIKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAME  936
             Y SLI   C+E R+ EA   F K ++  + P  VTY TLIDGYC  GD+  A      M 
Sbjct  307   YGSLISGMCKERRVDEASAHFVKMMEAGLAPTAVTYNTLIDGYCNKGDLKRAFSYKDEMI  366

Query  935   EKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIV  756
             +KG+ P V+TYN ++     EG + E+  LL +M EK + PD +T N LING+C+ G+  
Sbjct  367   KKGVMPTVSTYNLLIHALLLEGTIGEADNLLKEMQEKGMLPDAITYNILINGHCRAGNAK  426

Query  755   SALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLV  576
              A  + ++M   G++P   TY +LIH   K    + A ++  +++  G  P    ++ L+
Sbjct  427   KAFSLHDEMFSKGIQPSRVTYTSLIHVLGKRNRMKEADDLYANILRRGVLPDLIVFNVLI  486

Query  575   DTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREIL  396
             D +C   N E    L +E        D   Y  +IR  C+ GK++ A   F  M+ + I 
Sbjct  487   DGHCANGNMERAFLLLEEMDKMKVTPDEVTYNTLIRGYCREGKVEEARELFARMKGQGIE  546

Query  395   GDSVVYTSLAYAYFKEGNTRAASDLFDEMY  306
              D + Y +L   Y   G+ + A  + DEM+
Sbjct  547   PDHITYNTLISGYSGRGDVKDAFRVRDEMF  576


 Score =   171 bits (434),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/388 (28%), Positives = 191/388 (49%), Gaps = 5/388 (1%)
 Frame = -2

Query  1445  KPDPHACTVLLNSLV---KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEK  1275
             +P P   T L+ +++      ++D  +       +L +  +I + ++LI A C+  + ++
Sbjct  124   RPSPKQATELIKTVICSRIARISDIFYGLVGARERLKISSSI-LLDLLIRALCELKKGDE  182

Query  1274  ADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIH  1095
             A E    M+   + P + T N ++SL+ +      A  V   M R  +   + T+N +++
Sbjct  183   AFECFKMMQGMNVLPKIETCNDILSLFLKLNRTQMAWIVYAEMFRMRINSGLRTFNIMVN  242

Query  1094  SHCREGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCP  918
               C+EG+++ A    + ++     PN VTY T+I GYC  GD++EA ++  +M  KGL P
Sbjct  243   LLCKEGKLKRAKEFIRQMEGFGFKPNVVTYNTVIHGYCLKGDLEEANKVLESMISKGLEP  302

Query  917   RVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVK  738
                TY S++   C+E R+ E++    +M E  + P  VT NTLI+GYC  GD+  A   K
Sbjct  303   DTYTYGSLISGMCKERRVDEASAHFVKMMEAGLAPTAVTYNTLIDGYCNKGDLKRAFSYK  362

Query  737   NKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQ  558
             ++M++ G+ P   TY  LIH          A  ++ +M   G  P    Y+ L++ +C  
Sbjct  363   DEMIKKGVMPTVSTYNLLIHALLLEGTIGEADNLLKEMQEKGMLPDAITYNILINGHCRA  422

Query  557   NNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVY  378
              N +    L DE   +G       Y ++I  L KR ++  A+  +  +  R +L D +V+
Sbjct  423   GNAKKAFSLHDEMFSKGIQPSRVTYTSLIHVLGKRNRMKEADDLYANILRRGVLPDLIVF  482

Query  377   TSLAYAYFKEGNTRAASDLFDEMYKRRL  294
               L   +   GN   A  L +EM K ++
Sbjct  483   NVLIDGHCANGNMERAFLLLEEMDKMKV  510


 Score =   105 bits (263),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 101/188 (54%), Gaps = 1/188 (1%)
 Frame = -2

Query  1535  VFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKM  1356
              ++ L+       R  +A  ++ ++    + PD     VL++     G  +  +   ++M
Sbjct  446   TYTSLIHVLGKRNRMKEADDLYANILRRGVLPDLIVFNVLIDGHCANGNMERAFLLLEEM  505

Query  1355  IKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMH  1176
              K+ V P+   YN LI   C+ G+VE+A E  + M+ +GI PD  T+NTLIS Y  RG  
Sbjct  506   DKMKVTPDEVTYNTLIRGYCREGKVEEARELFARMKGQGIEPDHITYNTLISGYSGRGDV  565

Query  1175  YEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTL  999
              +A  V+D M   G  P ++TYN+LI   C++G+   A +L K+ + + +TP++ TY +L
Sbjct  566   KDAFRVRDEMFSLGFNPTLLTYNALIQGLCKKGKGDLAEQLLKEMVSQGITPDDSTYISL  625

Query  998   IDGYCRVG  975
             I+G    G
Sbjct  626   IEGIGNAG  633


 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 113/250 (45%), Gaps = 2/250 (1%)
 Frame = -2

Query  896  ILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAG  717
            ++R  CE  +  E+ +    M    + P   TCN +++ + K+     A  V  +M    
Sbjct  170  LIRALCELKKGDEAFECFKMMQGMNVLPKIETCNDILSLFLKLNRTQMAWIVYAEMFRMR  229

Query  716  LRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALV  537
            +     T+  +++  CK    +RAKE I  M   GF P+   Y+ ++  YCL+ + E   
Sbjct  230  INSGLRTFNIMVNLLCKEGKLKRAKEFIRQMEGFGFKPNVVTYNTVIHGYCLKGDLEEAN  289

Query  536  KLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAY  357
            K+ +    +G   D   Y ++I  +CK  ++D A   F  M E  +   +V Y +L   Y
Sbjct  290  KVLESMISKGLEPDTYTYGSLISGMCKERRVDEASAHFVKMMEAGLAPTAVTYNTLIDGY  349

Query  356  FKEGNTRAASDLFDEMYKRRLMVTlklykslsassKDENSL--LDLFWNNVMQRGLISHN  183
              +G+ + A    DEM K+ +M T+  Y  L  +   E ++   D     + ++G++   
Sbjct  350  CNKGDLKRAFSYKDEMIKKGVMPTVSTYNLLIHALLLEGTIGEADNLLKEMQEKGMLPDA  409

Query  182  VHNSIFLKLH  153
            +  +I +  H
Sbjct  410  ITYNILINGH  419


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 69/279 (25%), Positives = 109/279 (39%), Gaps = 28/279 (10%)
 Frame = -2

Query  1850  GHWNNLLKPKIGLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSLQSS----W  1683
             G  +NLLK      +    I + +L    C    +   F   + +  +   +Q S     
Sbjct  391   GEADNLLKEMQEKGMLPDAITYNILINGHCRAGNAKKAFSLHDEM--FSKGIQPSRVTYT  448

Query  1682  SMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYAN  1503
             S+I++L K    K A D+   I  +  L    V N L+   D    N            N
Sbjct  449   SLIHVLGKRNRMKEADDLYANILRRGVLPDLIVFNVLI---DGHCAN-----------GN  494

Query  1502  SKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHI  1323
              +R   A  + E +   ++ PD      L+    +EG  +   + + +M   G+ P+   
Sbjct  495   MER---AFLLLEEMDKMKVTPDEVTYNTLIRGYCREGKVEEARELFARMKGQGIEPDHIT  551

Query  1322  YNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRME  1143
             YN LI      G+V+ A     EM   G  P L T+N LI   C++G    A  +   M 
Sbjct  552   YNTLISGYSGRGDVKDAFRVRDEMFSLGFNPTLLTYNALIQGLCKKGKGDLAEQLLKEMV  611

Query  1142  RGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEKVT  1026
               G+ PD  TY SLI      G  +      K I+++V+
Sbjct  612   SQGITPDDSTYISLIEGIGNAGSFKG-----KSIQDEVS  645



>ref|XP_007219118.1| hypothetical protein PRUPE_ppa015795mg, partial [Prunus persica]
 gb|EMJ20317.1| hypothetical protein PRUPE_ppa015795mg, partial [Prunus persica]
Length=512

 Score =   248 bits (634),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 242/458 (53%), Gaps = 1/458 (0%)
 Frame = -2

Query  1679  MIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANS  1500
             MI++L + +    A+ ++ ++  K  +S   V+++LV +  +   +S VF  L+  Y  +
Sbjct  1     MIHLLVRGRRVSDAQALILRMVRKSGVSRVEVVDSLVSTYSNCGSSSLVFDLLVRTYVQA  60

Query  1499  KRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIY  1320
             ++  +  +VF+  R        +AC  LL  LVK G  D  W+ Y  ++  G+  N++  
Sbjct  61    RKLREGFEVFQLFRSKGFCVSINACNSLLGGLVKVGWVDLAWQVYGDVVSSGIQLNVYTL  120

Query  1319  NVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMER  1140
             N++++A CK  +++    FLS+ME KG+F D+ T+NTLI+ YC+ G+  EA  +++ M  
Sbjct  121   NIMVNALCKDRKIDSVKSFLSDMEEKGVFSDIVTYNTLINAYCQEGLLEEAFQLKNSMSC  180

Query  1139  GGVEPDIITYNSLIHSHCREGRMREAMR-LFKDIKEKVTPNEVTYTTLIDGYCRVGDIDE  963
              G+ P++ TYN++I+  C+ G    A   L++ +   ++P+  TY TL+   CR  DI E
Sbjct  181   KGLRPEVFTYNAIINGLCKVGNYARAKEILYEMLNNGLSPDTTTYNTLLVESCRKDDISE  240

Query  962   ALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLIN  783
             A  + + M  +G+ P + +++S++  F   G +  +      M +    PDNV    LI+
Sbjct  241   AEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHALVYFRDMKKAGWVPDNVIYTILIH  300

Query  782   GYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSP  603
             GYC+ G ++ ALK++++MLE G   D  T+  +++G C+ K    A E+  +M+  G  P
Sbjct  301   GYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCREKMLSDADELFNEMVERGVFP  360

Query  602   SYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFF  423
              +  ++ L+  Y    N    + L +  + R    DI  Y  +I   CK G++D A+  +
Sbjct  361   DFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDIVTYNTLIDGFCKVGEMDKAKELW  420

Query  422   GMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEM  309
               M  R IL + + Y  L   +   G+   A  L+D+M
Sbjct  421   ADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQM  458


 Score =   221 bits (562),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/355 (34%), Positives = 192/355 (54%), Gaps = 1/355 (0%)
 Frame = -2

Query  1418  LLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKG  1239
             L+N+  +EGL +  ++    M   G+ P +  YN +I+  CK G   +A E L EM   G
Sbjct  158   LINAYCQEGLLEEAFQLKNSMSCKGLRPEVFTYNAIINGLCKVGNYARAKEILYEMLNNG  217

Query  1238  IFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAM  1059
             + PD  T+NTL+   CR+    EA  + + M   GV PD+++++SLI    R G +  A+
Sbjct  218   LSPDTTTYNTLLVESCRKDDISEAEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHAL  277

Query  1058  RLFKDIKEKV-TPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKF  882
               F+D+K+    P+ V YT LI GYCR G + EAL+L   M E+G    V T+N+IL   
Sbjct  278   VYFRDMKKAGWVPDNVIYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGL  337

Query  881   CEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDS  702
             C E  + ++ +L N+M E+ + PD  T  TLI+GY K G++  +L +   M +  ++PD 
Sbjct  338   CREKMLSDADELFNEMVERGVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDI  397

Query  701   FTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADE  522
              TY  LI GFCK  + ++AKE+  DM++    P++ +Y  L++ +C   +     +L D+
Sbjct  398   VTYNTLIDGFCKVGEMDKAKELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQ  457

Query  521   FSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAY  357
                 G    +     +I+  C+ G    A+ F G M  + I+ DS+ Y +L   Y
Sbjct  458   MIEEGIKPTLVTCNTVIKGYCRSGNTTKADEFLGKMVSKGIVPDSITYNTLINGY  512


 Score =   162 bits (409),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/345 (28%), Positives = 172/345 (50%), Gaps = 1/345 (0%)
 Frame = -2

Query  1325  IYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRM  1146
             ++++L+    ++ ++ +  E       KG    +   N+L+    + G    A  V   +
Sbjct  49    VFDLLVRTYVQARKLREGFEVFQLFRSKGFCVSINACNSLLGGLVKVGWVDLAWQVYGDV  108

Query  1145  ERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTYTTLIDGYCRVGDI  969
                G++ ++ T N ++++ C++ ++        D++EK V  + VTY TLI+ YC+ G +
Sbjct  109   VSSGIQLNVYTLNIMVNALCKDRKIDSVKSFLSDMEEKGVFSDIVTYNTLINAYCQEGLL  168

Query  968   DEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTL  789
             +EA +L ++M  KGL P V TYN+I+   C+ G    + ++L +M    + PD  T NTL
Sbjct  169   EEAFQLKNSMSCKGLRPEVFTYNAIINGLCKVGNYARAKEILYEMLNNGLSPDTTTYNTL  228

Query  788   INGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGF  609
             +   C+  DI  A  + N+M   G+ PD  ++ +LI  F +    + A     DM  AG+
Sbjct  229   LVESCRKDDISEAEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHALVYFRDMKKAGW  288

Query  608   SPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAER  429
              P    Y+ L+  YC        +KL DE   +G  +D+  +  I+  LC+   L  A+ 
Sbjct  289   VPDNVIYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCREKMLSDADE  348

Query  428   FFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRL  294
              F  M ER +  D   +T+L + Y K GN   + +LF+ M KR +
Sbjct  349   LFNEMVERGVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNI  393


 Score =   104 bits (259),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 118/254 (46%), Gaps = 34/254 (13%)
 Frame = -2

Query  1709  YRHSLQSSW---SMIYILTKHKH---------FKSAKDMLHQIACKDFLSSPAVLNALVR  1566
             +R   ++ W   ++IY +  H +          K   +ML Q    D ++   +LN L R
Sbjct  280   FRDMKKAGWVPDNVIYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCR  339

Query  1565  SDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLT  1386
                                   K   DA ++F  +    + PD +  T L++   K G  
Sbjct  340   E---------------------KMLSDADELFNEMVERGVFPDFYTFTTLIHGYSKHGNM  378

Query  1385  DTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTL  1206
                   ++ M K  + P+I  YN LI   CK GE++KA E  ++M  + I P+  ++  L
Sbjct  379   TKSLNLFEAMTKRNIKPDIVTYNTLIDGFCKVGEMDKAKELWADMVSRRILPNHISYGIL  438

Query  1205  ISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMR-LFKDIKEKV  1029
             I+ +C  G  +EA  + D+M   G++P ++T N++I  +CR G   +A   L K + + +
Sbjct  439   INGFCSTGHVHEAFRLWDQMIEEGIKPTLVTCNTVIKGYCRSGNTTKADEFLGKMVSKGI  498

Query  1028  TPNEVTYTTLIDGY  987
              P+ +TY TLI+GY
Sbjct  499   VPDSITYNTLINGY  512



>ref|XP_004288599.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   250 bits (638),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/481 (30%), Positives = 254/481 (53%), Gaps = 10/481 (2%)
 Frame = -2

Query  1715  PNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFL-SSPAVLNALVRSDDDSDVNS  1539
             P +RH++ S  +M + L+  + F  A  +L  +  +    S+ +V  +L+ +      ++
Sbjct  63    PTFRHTIHSYSTMAHFLSSRQMFPQAHSLLRLVVSRTGKGSASSVFASLLHTRGTHLPSN  122

Query  1538  QVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTV---WKT  1368
              VF  L+  Y +     DAI  F  LR   ++    AC  LL++++K   T TV   W  
Sbjct  123   YVFHALMNSYTDCGFVGDAIHCFRLLRKHGLRMPFQACAHLLHNMLKFD-TPTVLVSWGF  181

Query  1367  YKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCR  1188
                ++  G  PN++ +NVL+H  CK G + +A +   E+  +G+ P + +FNTLI+ YC+
Sbjct  182   LLDILDSGFPPNVYNFNVLMHKMCKQGLIREAHKVFDEIGNRGLNPTVVSFNTLINGYCK  241

Query  1187  RGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KEKVTPNEVT  1011
                  +   +++ ME   V PD+ TY+ LIH  C+EGR+  A  LF ++    + PN+V 
Sbjct  242   CRNLEQGFKLKEDMEGRAVWPDLFTYSVLIHGLCKEGRLDGANELFHEMCARGLVPNDVI  301

Query  1010  YTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMG  831
             +T LIDG C+ G +D AL  +  M  +G+ P + TYN+++   C+   MKE+ KL+ +M 
Sbjct  302   FTNLIDGLCKNGKLDLALETYQKMLGRGIKPDIVTYNTLINGLCKVRDMKEAWKLVVEMN  361

Query  830   EKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTE  651
              K  +PD +T  TLI+  CK G++ SA++++ +M++  +  D+  + ALI GFC+     
Sbjct  362   TKGFKPDKITYTTLIDACCKEGELESAIEIRKQMIKDEITLDNVAFTALISGFCREGRII  421

Query  650   RAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAII  471
              A++++ +M+ AG  P    Y+ ++D +C + +     KL  E    G    +  Y  ++
Sbjct  422   EAEKMLREMLKAGMKPDDATYTMVIDGFCKKGDVNIGFKLLKEMQADGRIPSVVTYNVLM  481

Query  470   RRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFDEMYKRRLM  291
               LCK+G++  A      M    ++ D + Y  L   + K GN     D F++++  + +
Sbjct  482   NGLCKQGQMKNANMLLNAMINVGVVPDDITYNILLEGHCKHGN----PDDFEKLWSEKGL  537

Query  290   V  288
             V
Sbjct  538   V  538



>ref|XP_010028496.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Eucalyptus grandis]
 ref|XP_010028497.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Eucalyptus grandis]
 ref|XP_010028498.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Eucalyptus grandis]
 ref|XP_010028500.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Eucalyptus grandis]
 ref|XP_010028501.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Eucalyptus grandis]
 ref|XP_010028502.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Eucalyptus grandis]
Length=750

 Score =   254 bits (649),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 149/488 (31%), Positives = 250/488 (51%), Gaps = 5/488 (1%)
 Frame = -2

Query  1745  WSFFKWVETIPNYRHSLQSSWSMIYILTKHKHFKSAKDMLHQIAC-KDFLSSPAVLNALV  1569
              +F +W +  P+     +     ++ILT+ K +K+A+ +   +A   D  +   V   L 
Sbjct  65    LNFLRWAK--PHGFFGPRCKCLALHILTRFKLYKTAQAVAEDLALGTDDETGNLVFTYLK  122

Query  1568  RSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVK-EG  1392
              S D  + +S VF  +   Y++      A+++    +     P   +   +L+++++   
Sbjct  123   ESHDQCNSSSAVFDLVAKSYSHVNMADKALRMVNFAKSHGFMPGVLSYNSILDAMIRCRQ  182

Query  1391  LTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFN  1212
                 V + Y  MIK GV PN+  +NVL+   C +G +E A  F  +ME  G  P++ T+N
Sbjct  183   PVKLVEEVYGDMIKCGVSPNVFTFNVLMRGFCGAGNLEMALHFFHDMEKHGCLPNVVTYN  242

Query  1211  TLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI-KE  1035
             TLI+ YC+ G   EA  +   M   G+EP++I+YN +I+  CREG+M+E   +  ++ + 
Sbjct  243   TLINAYCKSGRMDEAYELLRSMSLKGLEPNVISYNVIINGLCREGKMKETSEVLNEMSRM  302

Query  1034  KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKES  855
                P+EVTY TLI+GYC+ G+  +AL LH+ M   GL P V TY S++   C+   +  +
Sbjct  303   GFVPDEVTYNTLINGYCKDGNFHQALVLHAEMVRNGLSPNVVTYTSLINSMCKARNLNRA  362

Query  854   TKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHG  675
              +  +QM  + + P+ +T  TL++G+ + G +  A K+ ++M   G  P   TY ALI+G
Sbjct  363   MEFFDQMHVRGLCPNQMTYTTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTYNALING  422

Query  674   FCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVD  495
              C     E A  +I  M   G SP   +YS ++  +C   + E  ++L  E   RG   D
Sbjct  423   HCFLGRMEEALGLIRQMGHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPD  482

Query  494   ISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTRAASDLFD  315
                Y ++I   C + +L  A   F  M +  ++ D   YT+L  A   EGN + A DL D
Sbjct  483   AITYTSLILGFCGQRRLTEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHD  542

Query  314   EMYKRRLM  291
             EM ++  +
Sbjct  543   EMIQKGFL  550


 Score =   252 bits (643),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 148/480 (31%), Positives = 244/480 (51%), Gaps = 18/480 (4%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   F+ L+  +  +     A+  F  +      P+      L+N+  K G  D  ++  
Sbjct  202   NVFTFNVLMRGFCGAGNLEMALHFFHDMEKHGCLPNVVTYNTLINAYCKSGRMDEAYELL  261

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
             + M   G+ PN+  YNV+I+  C+ G++++  E L+EM   G  PD  T+NTLI+ YC+ 
Sbjct  262   RSMSLKGLEPNVISYNVIINGLCREGKMKETSEVLNEMSRMGFVPDEVTYNTLINGYCKD  321

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKEK-VTPNEVTY  1008
             G  ++AL +   M R G+ P+++TY SLI+S C+   +  AM  F  +  + + PN++TY
Sbjct  322   GNFHQALVLHAEMVRNGLSPNVVTYTSLINSMCKARNLNRAMEFFDQMHVRGLCPNQMTY  381

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGE  828
             TTL+DG+ + G + EA ++   M  KG  P + TYN+++   C  GRM+E+  L+ QMG 
Sbjct  382   TTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTYNALINGHCFLGRMEEALGLIRQMGH  441

Query  827   KKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTER  648
             K I PD V+ +T+I+G+CK GD+  AL++K +M+E G+ PD+ TY +LI GFC  +    
Sbjct  442   KGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGFCGQRRLTE  501

Query  647   AKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRGYCVDISFYRAIIR  468
             A E+   M   G  P    Y+ L+D  C + N +    L DE   +G+  D+  Y  +I 
Sbjct  502   ACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTYSVLIN  561

Query  467   RLCKRGKLDCAERFFGMMQEREILGDSVVYTSL-----------AYAYFK----EGNTRA  333
              L K+ +   A+R    +   E +   V Y +L           A A  K    +G  + 
Sbjct  562   GLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIETCTNVDFKSALALLKGFCMKGLMKE  621

Query  332   ASDLFDEMYKRRLMVTlklykslsassKDENSLLDLF--WNNVMQRGLISHNVHNSIFLK  159
             A  + D M +R    +  +Y  +        ++   F  +  +M  GL+ H V  +  +K
Sbjct  622   ADQVLDSMLERNHRPSEAVYNVIIHGHCKGGNIQKAFNLYKEMMLAGLVPHTVTVTALIK  681


 Score =   208 bits (530),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/423 (29%), Positives = 207/423 (49%), Gaps = 18/423 (4%)
 Frame = -2

Query  1574  LVRSDDDSDVNSQVFSWLLIFYA--NSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLV  1401
             L+RS     +   V S+ +I        +  +  +V   +      PD      L+N   
Sbjct  260   LLRSMSLKGLEPNVISYNVIINGLCREGKMKETSEVLNEMSRMGFVPDEVTYNTLINGYC  319

Query  1400  KEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLY  1221
             K+G        + +M++ G+ PN+  Y  LI++ CK+  + +A EF  +M  +G+ P+  
Sbjct  320   KDGNFHQALVLHAEMVRNGLSPNVVTYTSLINSMCKARNLNRAMEFFDQMHVRGLCPNQM  379

Query  1220  TFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDI  1041
             T+ TL+  + ++G+  EA  + D M   G  P I+TYN+LI+ HC  GRM EA+ L + +
Sbjct  380   TYTTLVDGFSQQGLLKEAYKILDEMTHKGFSPTIVTYNALINGHCFLGRMEEALGLIRQM  439

Query  1040  KEK-VTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRM  864
               K ++P+ V+Y+T+I G+C+ GD++ AL L   M E+G+ P   TY S++  FC + R+
Sbjct  440   GHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGFCGQRRL  499

Query  863   KESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKAL  684
              E+ +L  QM +  + PD  T  TLI+  C  G+I +A  + ++M++ G  PD  TY  L
Sbjct  500   TEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTYSVL  559

Query  683   IHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDT---------------YCLQNNN  549
             I+G  K   T  AK ++  +      P    Y  L++T               +C++   
Sbjct  560   INGLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIETCTNVDFKSALALLKGFCMKGLM  619

Query  548   EALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSL  369
             +   ++ D    R +    + Y  II   CK G +  A   +  M    ++  +V  T+L
Sbjct  620   KEADQVLDSMLERNHRPSEAVYNVIIHGHCKGGNIQKAFNLYKEMMLAGLVPHTVTVTAL  679

Query  368   AYA  360
               A
Sbjct  680   IKA  682


 Score =   175 bits (443),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/397 (28%), Positives = 184/397 (46%), Gaps = 51/397 (13%)
 Frame = -2

Query  1544  NSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTY  1365
             N   ++ L+     ++    A++ F+ + +  + P+    T L++   ++GL    +K  
Sbjct  342   NVVTYTSLINSMCKARNLNRAMEFFDQMHVRGLCPNQMTYTTLVDGFSQQGLLKEAYKIL  401

Query  1364  KKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRR  1185
              +M   G  P I  YN LI+  C  G +E+A   + +M  KGI PD+ +++T+IS +C+ 
Sbjct  402   DEMTHKGFSPTIVTYNALINGHCFLGRMEEALGLIRQMGHKGISPDVVSYSTIISGFCKH  461

Query  1184  GMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLFKDIKE-KVTPNEVTY  1008
             G    AL ++  M   G+EPD ITY SLI   C + R+ EA  LF+ + +  + P+E TY
Sbjct  462   GDLERALELKQEMIERGIEPDAITYTSLILGFCGQRRLTEACELFQQMSQMGLVPDEFTY  521

Query  1007  TTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYN------------------------  900
             TTLID  C  G+I  A  LH  M +KG  P V TY+                        
Sbjct  522   TTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTYSVLINGLNKQARTREAKRLLLKLFY  581

Query  899   --------------------------SILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTC  798
                                       ++L+ FC +G MKE+ ++L+ M E+   P     
Sbjct  582   NESVPGDVTYDTLIETCTNVDFKSALALLKGFCMKGLMKEADQVLDSMLERNHRPSEAVY  641

Query  797   NTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIA  618
             N +I+G+CK G+I  A  +  +M+ AGL P + T  ALI    + +  ++  EVI + + 
Sbjct  642   NVIIHGHCKGGNIQKAFNLYKEMMLAGLVPHTVTVTALIKALHEREMNDKLSEVIHNTMK  701

Query  617   AGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFSGRG  507
             +           LVD    + N +A+  +  E +  G
Sbjct  702   SCKLADAEVAKVLVDINHKEGNMDAVFNVLSEMAKDG  738


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 89/368 (24%), Positives = 147/368 (40%), Gaps = 70/368 (19%)
 Frame = -2

Query  1649  FKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSWLLIFYANSKRTWDAIQVF  1470
              K A  +L ++  K F  +    NAL+        N   F           R  +A+ + 
Sbjct  394   LKEAYKILDEMTHKGFSPTIVTYNALI--------NGHCFLG---------RMEEALGLI  436

Query  1469  EHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLIHACCKS  1290
               +    I PD  + + +++   K G  +   +  ++MI+ G+ P+   Y  LI   C  
Sbjct  437   RQMGHKGISPDVVSYSTIISGFCKHGDLERALELKQEMIERGIEPDAITYTSLILGFCGQ  496

Query  1289  GEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITY  1110
               + +A E   +M   G+ PD +T+ TLI   C  G    A  + D M + G  PD++TY
Sbjct  497   RRLTEACELFQQMSQMGLVPDEFTYTTLIDAQCAEGNIKTAFDLHDEMIQKGFLPDVVTY  556

Query  1109  NSLIHSHCREGRMREAMRLF-KDIKEKVTPNEVTYTTLID--------------------  993
             + LI+   ++ R REA RL  K    +  P +VTY TLI+                    
Sbjct  557   SVLINGLNKQARTREAKRLLLKLFYNESVPGDVTYDTLIETCTNVDFKSALALLKGFCMK  616

Query  992   ------------------------------GYCRVGDIDEALRLHSAMEEKGLCPRVATY  903
                                           G+C+ G+I +A  L+  M   GL P   T 
Sbjct  617   GLMKEADQVLDSMLERNHRPSEAVYNVIIHGHCKGGNIQKAFNLYKEMMLAGLVPHTVTV  676

Query  902   NSILRKFCE-EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
              ++++   E E   K S  + N M   K+  D      L++   K G++ +   V ++M 
Sbjct  677   TALIKALHEREMNDKLSEVIHNTMKSCKLA-DAEVAKVLVDINHKEGNMDAVFNVLSEMA  735

Query  725   EAGLRPDS  702
             + GL P+S
Sbjct  736   KDGLLPNS  743



>ref|XP_010099493.1| hypothetical protein L484_000446 [Morus notabilis]
 gb|EXC44867.1| hypothetical protein L484_000446 [Morus notabilis]
Length=789

 Score =   254 bits (650),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 159/562 (28%), Positives = 276/562 (49%), Gaps = 45/562 (8%)
 Frame = -2

Query  1862  IVLKGHWNNLLKPKI----GLSVTSTIINHTLLTLSPCWFWLSWSFFKWVETIPNYRHSL  1695
             IV +  W++   PKI      ++   +++  L+ L   + +L+   FKWV     +RH+ 
Sbjct  111   IVEQDQWHD---PKIVNLFDSAIAPILVSRFLVELKE-YPFLALKLFKWVRNRTGFRHTA  166

Query  1694  QSSWSMIYILTKHKHFKSAKDMLHQIACKD-FLSSPAVLNALVRSDDDSDVNSQVFSWLL  1518
             +S   +++IL   + F  A  +L ++   +  L    V + L  + +       VF  L 
Sbjct  167   ESYCILVHILFYARMFFDANGVLRELVSSNRVLPGCDVFDVLWSTRNVCVPGFGVFDALF  226

Query  1517  IFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVL  1338
                       +A Q F  +R   + P P +C   L+ L K G  D   K +K M+  G+ 
Sbjct  227   SVLVELGMLEEANQCFLKMRKFHVLPKPRSCNAFLHRLSKLGKVDMSRKFFKDMVAAGIA  286

Query  1337  PNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSV  1158
             P++  YN++I+  CK G++++A     EM+ +G+ PD+ T+N+LI  + + G   EA+ +
Sbjct  287   PSVFTYNIMINYLCKEGDMDEARSLFEEMKHRGLIPDIVTYNSLIDGFGKVGNMDEAICI  346

Query  1157  QDRMERGGVEPDIITYNSLIH-----------------------------------SHCR  1083
              ++M+  G EPDIIT+N+LI+                                   + C+
Sbjct  347   FEKMKDVGCEPDIITFNALINCFGKSQRLPRALEFLHELRNHGLKPNVVTYSTLIDAFCK  406

Query  1082  EGRMREAMRLFKDIKE-KVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVAT  906
             EG MREA++ F D++   + PNE TYT+L+D  C+ G++ EAL+L + M + G+   +  
Sbjct  407   EGMMREALKFFVDMRRVGLFPNEYTYTSLVDANCKAGNLTEALKLTNEMLQAGINLNIVG  466

Query  905   YNSILRKFCEEGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKML  726
             Y+++L   CE+GRMKE+ K+  +M +  + P+    ++L++GY K      A +   +M 
Sbjct  467   YSALLNCLCEDGRMKEAEKVFMEMLKAGVTPNLQVYSSLVHGYVKAKKTEKAFQTLKEME  526

Query  725   EAGLRPDSFTYKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNE  546
             E  ++PD   Y  +I G C     E ++ V+ +M + G + ++  Y+ L+D Y       
Sbjct  527   EKKIKPDLLLYGTIIWGLCSQNKLEESELVVNEMRSRGLNANHFIYTTLMDAYFKAGKTT  586

Query  545   ALVKLADEFSGRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLA  366
               + L  E    G  V++  Y A+I  LCKRG ++ A  +F  M    +  +  VYT+L 
Sbjct  587   EALLLLQEMHYYGIEVNVVTYCALIDGLCKRGLVEEATDYFDRMVSIGLQPNVAVYTALI  646

Query  365   YAYFKEGNTRAASDLFDEMYKR  300
                 K     AA  LFDEM ++
Sbjct  647   DGLCKNNRIEAAKKLFDEMLEK  668


 Score =   194 bits (494),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 122/435 (28%), Positives = 214/435 (49%), Gaps = 36/435 (8%)
 Frame = -2

Query  1487  DAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLGVLPNIHIYNVLI  1308
             +AI +FE ++    +PD      L+N   K        +   ++   G+ PN+  Y+ LI
Sbjct  342   EAICIFEKMKDVGCEPDIITFNALINCFGKSQRLPRALEFLHELRNHGLKPNVVTYSTLI  401

Query  1307  HACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVE  1128
              A CK G + +A +F  +M   G+FP+ YT+ +L+   C+ G   EAL + + M + G+ 
Sbjct  402   DAFCKEGMMREALKFFVDMRRVGLFPNEYTYTSLVDANCKAGNLTEALKLTNEMLQAGIN  461

Query  1127  PDIITYNSLIHSHCREGRMREAMRLFKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRL  951
              +I+ Y++L++  C +GRM+EA ++F + +K  VTPN   Y++L+ GY +    ++A + 
Sbjct  462   LNIVGYSALLNCLCEDGRMKEAEKVFMEMLKAGVTPNLQVYSSLVHGYVKAKKTEKAFQT  521

Query  950   HSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQMGEKK-----------------  822
                MEEK + P +  Y +I+   C + +++ES  ++N+M  +                  
Sbjct  522   LKEMEEKKIKPDLLLYGTIIWGLCSQNKLEESELVVNEMRSRGLNANHFIYTTLMDAYFK  581

Query  821   ------------------IEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
                               IE + VT   LI+G CK G +  A    ++M+  GL+P+   
Sbjct  582   AGKTTEALLLLQEMHYYGIEVNVVTYCALIDGLCKRGLVEEATDYFDRMVSIGLQPNVAV  641

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
             Y ALI G CK    E AK++  +M+  G SP   AY+ L+D      + +  + L +   
Sbjct  642   YTALIDGLCKNNRIEAAKKLFDEMLEKGISPDRTAYTTLIDGNLKHGHLQEALTLKNRMI  701

Query  515   GRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTR  336
               G  +D+  Y ++I    + G++  A+ +   M  + IL D ++   L   Y++ GN  
Sbjct  702   EMGMELDLYAYTSLIWGFSQFGQVQQAKTWLDEMIGKGILPDEILCVCLLRKYYELGNVV  761

Query  335   AASDLFDEMYKRRLM  291
              A +L DE+ KR L+
Sbjct  762   EADELRDELVKRGLI  776


 Score =   162 bits (411),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/314 (31%), Positives = 157/314 (50%), Gaps = 1/314 (0%)
 Frame = -2

Query  1232  PDLYTFNTLISLYCRRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRL  1053
             P    F+ L S+    GM  EA     +M +  V P   + N+ +H   + G++  + + 
Sbjct  217   PGFGVFDALFSVLVELGMLEEANQCFLKMRKFHVLPKPRSCNAFLHRLSKLGKVDMSRKF  276

Query  1052  FKD-IKEKVTPNEVTYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCE  876
             FKD +   + P+  TY  +I+  C+ GD+DEA  L   M+ +GL P + TYNS++  F +
Sbjct  277   FKDMVAAGIAPSVFTYNIMINYLCKEGDMDEARSLFEEMKHRGLIPDIVTYNSLIDGFGK  336

Query  875   EGRMKESTKLLNQMGEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFT  696
              G M E+  +  +M +   EPD +T N LIN + K   +  AL+  +++   GL+P+  T
Sbjct  337   VGNMDEAICIFEKMKDVGCEPDIITFNALINCFGKSQRLPRALEFLHELRNHGLKPNVVT  396

Query  695   YKALIHGFCKAKDTERAKEVIFDMIAAGFSPSYCAYSWLVDTYCLQNNNEALVKLADEFS  516
             Y  LI  FCK      A +   DM   G  P+   Y+ LVD  C   N    +KL +E  
Sbjct  397   YSTLIDAFCKEGMMREALKFFVDMRRVGLFPNEYTYTSLVDANCKAGNLTEALKLTNEML  456

Query  515   GRGYCVDISFYRAIIRRLCKRGKLDCAERFFGMMQEREILGDSVVYTSLAYAYFKEGNTR  336
               G  ++I  Y A++  LC+ G++  AE+ F  M +  +  +  VY+SL + Y K   T 
Sbjct  457   QAGINLNIVGYSALLNCLCEDGRMKEAEKVFMEMLKAGVTPNLQVYSSLVHGYVKAKKTE  516

Query  335   AASDLFDEMYKRRL  294
              A     EM ++++
Sbjct  517   KAFQTLKEMEEKKI  530


 Score =   136 bits (342),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 160/323 (50%), Gaps = 1/323 (0%)
 Frame = -2

Query  1550  DVNSQVFSWLLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWK  1371
             ++N   +S LL       R  +A +VF  +    + P+    + L++  VK   T+  ++
Sbjct  461   NLNIVGYSALLNCLCEDGRMKEAEKVFMEMLKAGVTPNLQVYSSLVHGYVKAKKTEKAFQ  520

Query  1370  TYKKMIKLGVLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYC  1191
             T K+M +  + P++ +Y  +I   C   ++E+++  ++EM  +G+  + + + TL+  Y 
Sbjct  521   TLKEMEEKKIKPDLLLYGTIIWGLCSQNKLEESELVVNEMRSRGLNANHFIYTTLMDAYF  580

Query  1190  RRGMHYEALSVQDRMERGGVEPDIITYNSLIHSHCREGRMREAMRLF-KDIKEKVTPNEV  1014
             + G   EAL +   M   G+E +++TY +LI   C+ G + EA   F + +   + PN  
Sbjct  581   KAGKTTEALLLLQEMHYYGIEVNVVTYCALIDGLCKRGLVEEATDYFDRMVSIGLQPNVA  640

Query  1013  TYTTLIDGYCRVGDIDEALRLHSAMEEKGLCPRVATYNSILRKFCEEGRMKESTKLLNQM  834
              YT LIDG C+   I+ A +L   M EKG+ P    Y +++    + G ++E+  L N+M
Sbjct  641   VYTALIDGLCKNNRIEAAKKLFDEMLEKGISPDRTAYTTLIDGNLKHGHLQEALTLKNRM  700

Query  833   GEKKIEPDNVTCNTLINGYCKIGDIVSALKVKNKMLEAGLRPDSFTYKALIHGFCKAKDT  654
              E  +E D     +LI G+ + G +  A    ++M+  G+ PD      L+  + +  + 
Sbjct  701   IEMGMELDLYAYTSLIWGFSQFGQVQQAKTWLDEMIGKGILPDEILCVCLLRKYYELGNV  760

Query  653   ERAKEVIFDMIAAGFSPSYCAYS  585
               A E+  +++  G     C Y+
Sbjct  761   VEADELRDELVKRGLIKGACTYA  783



>gb|KDP23384.1| hypothetical protein JCGZ_23217 [Jatropha curcas]
Length=598

 Score =   251 bits (640),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/535 (29%), Positives = 276/535 (52%), Gaps = 9/535 (2%)
 Frame = -2

Query  1880  VKTLCVIVLKGHWNNLLKPKIGLSVTSTI-INHTLLTLSPCWFWLSWSFFKWVETIPNYR  1704
             + T+  +V K HW+ L   +  L  TS I + H LL+ S     L+  +  W +      
Sbjct  35    IPTIADLVAKQHWSEL---RTRLKNTSPITLLHQLLS-SEVDPELTLRYLTWSKKELKLS  90

Query  1703  HSLQSSWSMIYILTKHKHFKSAKDMLHQIACKDFLSSPAVLNALVRSDDDSDVNSQVFSW  1524
             HSL+ ++ +++ L   K + + +  L      +     ++ +A+    D    NS +   
Sbjct  91    HSLELTFRILHSLAYTKKYSNIRSFLDNFVKNENYPVSSIFHAISVGGDSFCANSIIVDM  150

Query  1523  LLIFYANSKRTWDAIQVFEHLRICRIKPDPHACTVLLNSLVKEGLTDTVWKTYKKMIKLG  1344
             LL+ Y  + +T    + F+       K    +C  LL++LVK+     +   Y +MIK  
Sbjct  151   LLLAYVKNLKTHFGFETFKRAGDYGFKLSVISCNPLLSALVKDREIGDMEFVYNEMIKRR  210

Query  1343  VLPNIHIYNVLIHACCKSGEVEKADEFLSEMEFKGIFPDLYTFNTLISLYCRRGM---HY  1173
             + P++  +N++I+  CK+G++ KA + + +M+  G+  ++ T+NTLI  YC+ G     Y
Sbjct  211   IHPSLISF