BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11946_g1_i1 len=831 path=[1:0-653 655:654-830]

Length=831
                                                                      Score     E

ref|XP_009612879.1|  PREDICTED: umecyanin-like                          131   2e-33   
ref|XP_006358286.1|  PREDICTED: blue copper protein-like                130   7e-33   
ref|XP_009794604.1|  PREDICTED: umecyanin-like                          129   1e-32   
ref|XP_004242774.2|  PREDICTED: umecyanin-like                          126   1e-31   
ref|XP_010687951.1|  PREDICTED: umecyanin-like                          116   1e-27   
ref|XP_006475880.1|  PREDICTED: cucumber peeling cupredoxin-like        112   2e-26   
ref|XP_006450883.1|  hypothetical protein CICLE_v10009458mg             113   3e-26   
ref|XP_010050044.1|  PREDICTED: umecyanin-like                          110   6e-26   
gb|KCW45088.1|  hypothetical protein EUGRSUZ_L01304                     110   9e-26   
ref|XP_010040577.1|  PREDICTED: umecyanin-like                          110   1e-25   
ref|XP_009780504.1|  PREDICTED: blue copper protein-like                113   2e-25   
ref|XP_011078396.1|  PREDICTED: cucumber peeling cupredoxin             111   3e-25   
ref|XP_010040575.1|  PREDICTED: umecyanin-like                          108   4e-25   
ref|XP_009794603.1|  PREDICTED: blue copper protein-like                111   4e-25   
ref|XP_010250146.1|  PREDICTED: umecyanin-like                          108   4e-25   
emb|CDP10430.1|  unnamed protein product                                108   5e-25   
ref|XP_007013490.1|  Early nodulin-like protein 14, putative            107   1e-24   
gb|KDO80188.1|  hypothetical protein CISIN_1g031882mg                   106   1e-24   
ref|XP_011017784.1|  PREDICTED: umecyanin-like                          106   3e-24   
ref|XP_010323300.1|  PREDICTED: cucumber peeling cupredoxin-like        106   9e-24   
emb|CAN66124.1|  hypothetical protein VITISV_023425                     105   1e-23   Vitis vinifera
ref|XP_009602388.1|  PREDICTED: umecyanin-like                          104   1e-23   
ref|XP_002265643.1|  PREDICTED: cucumber peeling cupredoxin-like        105   1e-23   Vitis vinifera
ref|XP_009612878.1|  PREDICTED: blue copper protein-like                106   1e-23   
ref|XP_010323477.1|  PREDICTED: stellacyanin-like                       103   2e-23   
ref|XP_009612880.1|  PREDICTED: blue copper protein-like                107   2e-23   
gb|KDP32428.1|  hypothetical protein JCGZ_13353                         103   2e-23   
ref|XP_007013489.1|  Cupredoxin superfamily protein, putative iso...    104   3e-23   
emb|CDP10429.1|  unnamed protein product                                105   3e-23   
emb|CDP10432.1|  unnamed protein product                                107   3e-23   
gb|KCW44224.1|  hypothetical protein EUGRSUZ_L02351                     103   3e-23   
emb|CAN69318.1|  hypothetical protein VITISV_032660                     103   4e-23   Vitis vinifera
ref|XP_010041622.1|  PREDICTED: umecyanin-like                          103   4e-23   
ref|XP_010051716.1|  PREDICTED: umecyanin-like                          103   6e-23   
gb|AFK40462.1|  unknown                                                 103   7e-23   
ref|XP_007013488.1|  Cupredoxin superfamily protein, putative iso...    104   7e-23   
ref|XP_002265604.2|  PREDICTED: blue copper protein                     105   8e-23   Vitis vinifera
gb|ADV57640.1|  copper binding protein 5                                103   9e-23   
ref|XP_002266874.1|  PREDICTED: cucumber peeling cupredoxin-like ...    102   1e-22   Vitis vinifera
ref|XP_004508477.1|  PREDICTED: blue copper protein-like                105   1e-22   
ref|XP_002325213.2|  hypothetical protein POPTR_0018s12950g             102   1e-22   Populus trichocarpa [western balsam poplar]
emb|CAN66123.1|  hypothetical protein VITISV_023424                     104   2e-22   Vitis vinifera
ref|XP_010687952.1|  PREDICTED: umecyanin                               101   2e-22   
emb|CBI36327.3|  unnamed protein product                                106   2e-22   
ref|XP_011084101.1|  PREDICTED: blue copper protein-like                104   3e-22   
gb|KCW80136.1|  hypothetical protein EUGRSUZ_C01480                     100   3e-22   
emb|CDO98154.1|  unnamed protein product                                102   3e-22   
gb|KHG26692.1|  Blue copper                                             101   4e-22   
ref|XP_010050033.1|  PREDICTED: umecyanin-like                          101   4e-22   
emb|CAJ77497.1|  putative dicyanin blue copper protein precursor        100   5e-22   Solanum tuberosum [potatoes]
ref|XP_007013486.1|  Copper binding protein 5, putative                 102   5e-22   
ref|XP_007155023.1|  hypothetical protein PHAVU_003G166700g             103   5e-22   
gb|KHG03442.1|  Blue copper                                             100   5e-22   
ref|XP_010050032.1|  PREDICTED: umecyanin-like                          100   5e-22   
ref|XP_010048057.1|  PREDICTED: umecyanin-like                          100   6e-22   
ref|NP_001234429.1|  dicyanin precursor                                 102   7e-22   
gb|KCW80159.1|  hypothetical protein EUGRSUZ_C01507                     100   7e-22   
ref|XP_010541720.1|  PREDICTED: umecyanin-like                          100   8e-22   
ref|XP_010050043.1|  PREDICTED: early nodulin-like protein 2            102   8e-22   
ref|XP_003609366.1|  Blue copper protein                                102   8e-22   
ref|XP_007157642.1|  hypothetical protein PHAVU_002G086900g             100   9e-22   
ref|XP_010042302.1|  PREDICTED: stellacyanin-like                       100   1e-21   
ref|XP_007155014.1|  hypothetical protein PHAVU_003G165800g             102   1e-21   
ref|XP_010048016.1|  PREDICTED: blue copper protein-like                101   1e-21   
ref|XP_008362898.1|  PREDICTED: mavicyanin-like                       99.8    1e-21   
ref|XP_011017785.1|  PREDICTED: cucumber peeling cupredoxin-like        100   1e-21   
ref|XP_010047948.1|  PREDICTED: blue copper protein-like                101   2e-21   
ref|XP_010048017.1|  PREDICTED: umecyanin-like                        99.0    2e-21   
ref|XP_006358288.1|  PREDICTED: blue copper protein-like                101   2e-21   
ref|XP_008242795.1|  PREDICTED: cucumber peeling cupredoxin-like        100   2e-21   
ref|XP_010048045.1|  PREDICTED: umecyanin-like                        99.0    2e-21   
gb|KCW80120.1|  hypothetical protein EUGRSUZ_C01450                   99.0    2e-21   
ref|XP_008344079.1|  PREDICTED: umecyanin-like                        99.8    2e-21   
ref|XP_010254442.1|  PREDICTED: blue copper protein                     101   2e-21   
ref|XP_002308977.2|  hypothetical protein POPTR_0006s06650g           98.2    2e-21   Populus trichocarpa [western balsam poplar]
gb|KCW79988.1|  hypothetical protein EUGRSUZ_C01322                   98.6    3e-21   
ref|XP_010051537.1|  PREDICTED: blue copper protein-like                100   3e-21   
gb|KHG25750.1|  Blue copper -like protein                             98.2    3e-21   
ref|XP_007155024.1|  hypothetical protein PHAVU_003G166800g             100   3e-21   
ref|XP_004303303.1|  PREDICTED: cucumber peeling cupredoxin-like      98.2    3e-21   
ref|XP_004235961.1|  PREDICTED: cucumber peeling cupredoxin-like      98.2    4e-21   
ref|XP_002527192.1|  Cucumber peeling cupredoxin, putative            99.4    4e-21   Ricinus communis
ref|XP_010050635.1|  PREDICTED: blue copper protein-like              99.8    5e-21   
ref|XP_010040578.1|  PREDICTED: mucin-5AC-like                          101   5e-21   
ref|XP_007135755.1|  hypothetical protein PHAVU_010G155900g           97.8    5e-21   
ref|XP_003542629.1|  PREDICTED: blue copper protein-like                100   5e-21   
ref|XP_010939704.1|  PREDICTED: blue copper protein-like              97.4    6e-21   
gb|KCW45091.1|  hypothetical protein EUGRSUZ_L01306                     100   8e-21   
ref|XP_009364011.1|  PREDICTED: mavicyanin-like                       97.4    9e-21   
ref|XP_006358287.1|  PREDICTED: blue copper protein-like              99.4    1e-20   
ref|XP_010250147.1|  PREDICTED: cucumber peeling cupredoxin-like      98.2    1e-20   
gb|ACL51760.1|  putative phytocyanin                                  97.4    1e-20   Pinus pinaster [cluster pine]
ref|XP_002527195.1|  Cucumber peeling cupredoxin, putative            97.1    1e-20   Ricinus communis
emb|CAN60010.1|  hypothetical protein VITISV_018635                   95.9    1e-20   Vitis vinifera
gb|KCW80147.1|  hypothetical protein EUGRSUZ_C01491                   98.2    1e-20   
gb|KHN21265.1|  Blue copper protein                                   97.1    1e-20   
ref|XP_002285305.1|  PREDICTED: umecyanin                             95.9    1e-20   Vitis vinifera
ref|XP_003527180.1|  PREDICTED: blue copper protein-like              96.7    2e-20   
ref|XP_006364216.1|  PREDICTED: cucumber peeling cupredoxin-like      96.7    2e-20   
ref|XP_006358285.1|  PREDICTED: blue copper protein-like              97.4    2e-20   
gb|ACL51761.1|  putative phytocyanin                                  96.7    2e-20   Pinus ponderosa [Pacific ponderosa pine]
gb|ACL51762.1|  putative phytocyanin                                  96.7    2e-20   Pinus resinosa [Canadian red pine]
ref|XP_010050590.1|  PREDICTED: blue copper protein-like              97.4    2e-20   
gb|ACL51759.1|  putative phytocyanin                                  96.3    3e-20   Pinus nigra [Austrian pine]
gb|ACJ70298.1|  putative phytocyanin                                  96.3    3e-20   Pinus sylvestris [Scotch pine]
gb|ACJ70301.1|  putative phytocyanin                                  96.3    3e-20   Pinus sylvestris [Scotch pine]
gb|ACG40270.1|  blue copper protein precursor                         95.5    3e-20   Zea mays [maize]
ref|XP_008337273.1|  PREDICTED: blue copper protein-like              98.2    3e-20   
ref|XP_011020150.1|  PREDICTED: umecyanin-like                        95.5    3e-20   
ref|XP_004235960.1|  PREDICTED: cucumber peeling cupredoxin-like      95.9    4e-20   
ref|NP_001130720.1|  uncharacterized protein LOC100191824 precursor   95.5    4e-20   Zea mays [maize]
ref|XP_009368872.1|  PREDICTED: blue copper protein-like              96.3    4e-20   
ref|XP_009368873.1|  PREDICTED: umecyanin-like                        95.5    5e-20   
ref|XP_006475877.1|  PREDICTED: blue copper protein-like              95.5    5e-20   
ref|XP_006450890.1|  hypothetical protein CICLE_v10009575mg           95.5    5e-20   
gb|ACJ70311.1|  putative phytocyanin                                  95.1    7e-20   Pinus sylvestris [Scotch pine]
gb|KDP30272.1|  hypothetical protein JCGZ_17054                       96.7    9e-20   
ref|XP_007204490.1|  hypothetical protein PRUPE_ppa019594mg           93.6    1e-19   
ref|XP_002285304.1|  PREDICTED: blue copper protein                   95.9    1e-19   Vitis vinifera
ref|XP_008456879.1|  PREDICTED: mucin-1-like                          96.3    1e-19   
ref|XP_004136088.1|  PREDICTED: cucumber peeling cupredoxin-like      94.0    1e-19   
ref|XP_010051715.1|  PREDICTED: umecyanin-like                        93.2    1e-19   
gb|KCW80158.1|  hypothetical protein EUGRSUZ_C01506                   95.5    1e-19   
ref|XP_010535261.1|  PREDICTED: cucumber peeling cupredoxin-like      93.6    2e-19   
ref|XP_010050639.1|  PREDICTED: cucumber peeling cupredoxin-like      94.7    2e-19   
gb|KHG25749.1|  Blue copper                                           93.6    2e-19   
ref|XP_010103730.1|  Blue copper protein                              95.1    2e-19   
ref|XP_004287292.1|  PREDICTED: uncharacterized protein LOC101313542  95.5    2e-19   
gb|AAF75824.1|AF101788_1  phytocyanin homolog                         93.6    3e-19   Pinus taeda
gb|ACJ70316.1|  putative phytocyanin                                  93.6    3e-19   Pinus sylvestris [Scotch pine]
ref|XP_002517636.1|  Blue copper protein precursor, putative          93.6    3e-19   Ricinus communis
ref|XP_010247602.1|  PREDICTED: umecyanin-like                        92.4    4e-19   
emb|CAN60011.1|  hypothetical protein VITISV_018636                   94.4    4e-19   Vitis vinifera
gb|AFK42629.1|  unknown                                               92.8    4e-19   
ref|XP_004303302.1|  PREDICTED: blue copper protein-like              93.2    4e-19   
gb|KEH16093.1|  plastocyanin-like domain protein                      92.8    4e-19   
ref|XP_009364056.1|  PREDICTED: mavicyanin-like                       91.7    5e-19   
gb|ABK23833.1|  unknown                                               92.4    6e-19   Picea sitchensis
ref|XP_008242791.1|  PREDICTED: mavicyanin-like                       92.0    6e-19   
ref|XP_004159419.1|  PREDICTED: uncharacterized protein LOC101231385  94.4    6e-19   
ref|XP_008361224.1|  PREDICTED: blue copper protein-like              92.8    6e-19   
gb|KHN15077.1|  Stellacyanin                                          91.7    7e-19   
ref|XP_003550819.1|  PREDICTED: stellacyanin-like                     91.3    8e-19   
ref|XP_009624895.1|  PREDICTED: mucin-2-like                          95.9    1e-18   
gb|KEH30268.1|  plastocyanin-like domain protein                      90.9    1e-18   
ref|XP_002308109.2|  hypothetical protein POPTR_0006s06640g           92.8    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008461119.1|  PREDICTED: uncharacterized protein LOC103499800  94.4    1e-18   
ref|XP_006842049.1|  hypothetical protein AMTR_s00078p00022690        90.5    2e-18   
ref|XP_008389837.1|  PREDICTED: mavicyanin-like                       90.1    2e-18   
ref|XP_004139303.1|  PREDICTED: blue copper protein-like              91.3    2e-18   
ref|XP_009364055.1|  PREDICTED: umecyanin-like                        90.1    2e-18   
ref|XP_008779708.1|  PREDICTED: cucumber peeling cupredoxin-like      90.5    2e-18   
ref|XP_008777839.1|  PREDICTED: cucumber peeling cupredoxin-like      91.3    2e-18   
ref|XP_002527191.1|  Cucumber peeling cupredoxin, putative            89.7    2e-18   Ricinus communis
ref|XP_006659514.1|  PREDICTED: blue copper protein-like              90.1    2e-18   
ref|XP_009411216.1|  PREDICTED: cucumber peeling cupredoxin-like      89.0    3e-18   
ref|XP_011074212.1|  PREDICTED: blue copper protein                   90.5    3e-18   
ref|XP_008389848.1|  PREDICTED: mavicyanin-like                       89.7    3e-18   
ref|XP_004507625.1|  PREDICTED: early nodulin-like protein 2-like     91.3    3e-18   
ref|XP_008358046.1|  PREDICTED: mavicyanin-like                       89.7    3e-18   
ref|XP_009763449.1|  PREDICTED: cucumber peeling cupredoxin-like      90.5    4e-18   
gb|EYU36477.1|  hypothetical protein MIMGU_mgv1a014161mg              90.1    4e-18   
gb|KCW80132.1|  hypothetical protein EUGRSUZ_C01472                   89.0    4e-18   
ref|XP_010026035.1|  PREDICTED: blue copper protein                   90.1    4e-18   
ref|XP_004287293.1|  PREDICTED: uncharacterized protein LOC101313831  91.3    5e-18   
ref|XP_008457411.1|  PREDICTED: blue copper protein-like              91.3    6e-18   
ref|XP_010050631.1|  PREDICTED: uncharacterized protein LOC104439242  92.8    7e-18   
ref|XP_002282262.2|  PREDICTED: LOW QUALITY PROTEIN: blue copper ...  91.3    7e-18   Vitis vinifera
gb|EYU18255.1|  hypothetical protein MIMGU_mgv1a009144mg              91.3    7e-18   
gb|EYU18254.1|  hypothetical protein MIMGU_mgv1a009144mg              90.5    7e-18   
emb|CBI28220.3|  unnamed protein product                              90.5    8e-18   
ref|XP_011020151.1|  PREDICTED: uclacyanin-3-like                     90.5    8e-18   
ref|XP_008354500.1|  PREDICTED: umecyanin-like                        88.2    9e-18   
ref|XP_011016343.1|  PREDICTED: blue copper protein-like              90.1    9e-18   
ref|XP_006826439.1|  hypothetical protein AMTR_s00004p00170860        89.4    1e-17   
ref|XP_007204796.1|  hypothetical protein PRUPE_ppa018102mg           89.4    1e-17   
ref|XP_011087502.1|  PREDICTED: umecyanin-like                        87.8    1e-17   
ref|XP_003549750.2|  PREDICTED: blue copper protein-like              89.4    1e-17   
ref|NP_001236879.1|  uncharacterized protein LOC100305545 precursor   88.2    1e-17   
gb|KHN37985.1|  Blue copper protein                                   88.2    1e-17   
ref|XP_009595673.1|  PREDICTED: cucumber peeling cupredoxin-like      89.0    1e-17   
ref|XP_011101849.1|  PREDICTED: mavicyanin-like                       88.2    1e-17   
ref|XP_006364217.1|  PREDICTED: cucumber peeling cupredoxin-like      88.2    1e-17   
ref|XP_007155021.1|  hypothetical protein PHAVU_003G166500g           87.8    2e-17   
ref|XP_009368875.1|  PREDICTED: cucumber peeling cupredoxin-like      87.8    2e-17   
ref|XP_009599506.1|  PREDICTED: cucumber peeling cupredoxin-like      88.2    2e-17   
ref|XP_008242790.1|  PREDICTED: cucumber peeling cupredoxin           88.6    2e-17   
ref|XP_004139413.1|  PREDICTED: uncharacterized protein LOC101206368  89.7    2e-17   
dbj|BAI52948.1|  blue copper protein precursor                        87.4    2e-17   Citrullus lanatus subsp. vulgaris
ref|XP_002299749.2|  hypothetical protein POPTR_0001s19280g           88.2    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_008228689.1|  PREDICTED: cucumber peeling cupredoxin-like      88.2    2e-17   
ref|XP_008358045.1|  PREDICTED: umecyanin-like                        87.8    2e-17   
ref|XP_009365430.1|  PREDICTED: cucumber peeling cupredoxin-like      88.2    3e-17   
ref|XP_004953983.1|  PREDICTED: blue copper protein-like              88.2    3e-17   
emb|CDY45100.1|  BnaA02g04760D                                        87.0    3e-17   
gb|KGN60691.1|  hypothetical protein Csa_2G006860                     89.7    3e-17   
ref|XP_002527193.1|  Early nodulin 16 precursor, putative             89.0    3e-17   Ricinus communis
gb|KHG26691.1|  Blue copper -like protein                             88.2    3e-17   
ref|XP_006655916.1|  PREDICTED: blue copper protein-like              87.4    3e-17   
ref|XP_006346595.1|  PREDICTED: cucumber peeling cupredoxin-like      86.7    4e-17   
ref|XP_009782681.1|  PREDICTED: cucumber peeling cupredoxin-like      87.0    4e-17   
ref|XP_007202499.1|  hypothetical protein PRUPE_ppa010678mg           87.8    4e-17   
ref|NP_001267496.1|  cucumber peeling cupredoxin-like precursor       86.7    4e-17   
ref|XP_008786863.1|  PREDICTED: stellacyanin-like                     86.7    5e-17   
ref|XP_009364010.1|  PREDICTED: blue copper protein-like              88.2    5e-17   
ref|XP_008652820.1|  PREDICTED: mavicyanin                            85.9    5e-17   
gb|ACG34757.1|  blue copper protein precursor                         85.9    5e-17   Zea mays [maize]
ref|XP_006450889.1|  hypothetical protein CICLE_v10010527mg           88.2    6e-17   
ref|XP_009595672.1|  PREDICTED: cucumber peeling cupredoxin-like      86.3    6e-17   
ref|XP_002285309.1|  PREDICTED: umecyanin-like                        86.3    6e-17   Vitis vinifera
ref|XP_004139412.1|  PREDICTED: uncharacterized protein LOC101206131  87.8    6e-17   
ref|XP_006476115.1|  PREDICTED: blue copper protein-like              88.2    7e-17   
gb|KGN60693.1|  hypothetical protein Csa_2G006880                     88.2    7e-17   
ref|XP_008461121.1|  PREDICTED: cucumber peeling cupredoxin-like      86.3    7e-17   
ref|XP_008242860.1|  PREDICTED: mavicyanin-like                       85.9    7e-17   
ref|XP_007013487.1|  Early nodulin 16, putative                       87.8    7e-17   
ref|XP_006421527.1|  hypothetical protein CICLE_v10005962mg           86.3    8e-17   
gb|KDO80195.1|  hypothetical protein CISIN_1g018026mg                 86.7    9e-17   
ref|XP_004288796.1|  PREDICTED: cucumber peeling cupredoxin-like      85.1    9e-17   
ref|XP_008352254.1|  PREDICTED: cucumber peeling cupredoxin-like      85.5    9e-17   
ref|XP_011020152.1|  PREDICTED: cucumber peeling cupredoxin-like      85.5    9e-17   
ref|XP_010922520.1|  PREDICTED: cucumber peeling cupredoxin-like      86.7    1e-16   
gb|AAB24588.1|  cupredoxin, CPC=type I copper protein                 84.7    1e-16   
ref|XP_004159418.1|  PREDICTED: uncharacterized protein LOC101231160  89.4    1e-16   
ref|XP_009624033.1|  PREDICTED: cucumber peeling cupredoxin-like      85.9    1e-16   
ref|XP_007202576.1|  hypothetical protein PRUPE_ppa011524mg           85.9    1e-16   
ref|XP_006490062.1|  PREDICTED: blue copper protein-like              85.5    1e-16   
ref|XP_009760367.1|  PREDICTED: cucumber peeling cupredoxin-like      85.9    1e-16   
pdb|1JER|A  Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0              84.3    1e-16   
ref|XP_004237949.1|  PREDICTED: blue copper protein                   85.1    1e-16   
ref|XP_002460378.1|  hypothetical protein SORBIDRAFT_02g027260        84.7    1e-16   Sorghum bicolor [broomcorn]
ref|XP_008456869.1|  PREDICTED: cucumber peeling cupredoxin-like      85.9    1e-16   
ref|XP_008385451.1|  PREDICTED: blue copper protein-like              86.7    2e-16   
ref|XP_006450887.1|  hypothetical protein CICLE_v10008731mg           87.4    2e-16   
ref|XP_006421531.1|  hypothetical protein CICLE_v10006656mg           85.5    2e-16   
ref|XP_009126430.1|  PREDICTED: blue copper protein-like              85.9    2e-16   
ref|NP_001168456.1|  uncharacterized protein LOC100382230 precursor   85.5    2e-16   Zea mays [maize]
ref|XP_008354498.1|  PREDICTED: blue copper protein-like              86.7    2e-16   
ref|XP_008242792.1|  PREDICTED: mavicyanin-like                       84.7    2e-16   
dbj|BAJ97976.1|  predicted protein                                    85.5    2e-16   
ref|XP_008389824.1|  PREDICTED: mavicyanin-like                       84.3    2e-16   
emb|CBI28221.3|  unnamed protein product                              85.5    2e-16   
sp|P29602.3|CPC_CUCSA  RecName: Full=Cucumber peeling cupredoxin;...  83.6    2e-16   Cucumis sativus [cucumbers]
ref|XP_004287291.1|  PREDICTED: stellacyanin-like                     84.3    2e-16   
ref|XP_007013491.1|  Uncharacterized protein isoform 1                84.0    2e-16   
ref|XP_002452517.1|  hypothetical protein SORBIDRAFT_04g027290        85.1    2e-16   Sorghum bicolor [broomcorn]
emb|CDP10431.1|  unnamed protein product                              86.7    2e-16   
ref|XP_002971821.1|  hypothetical protein SELMODRAFT_19117            82.4    3e-16   
ref|XP_004163555.1|  PREDICTED: blue copper protein-like              84.7    3e-16   
ref|XP_010942621.1|  PREDICTED: mavicyanin-like                       84.3    3e-16   
ref|XP_002325211.2|  hypothetical protein POPTR_0018s12930g           85.1    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008461124.1|  PREDICTED: cucumber peeling cupredoxin-like      84.0    4e-16   
ref|XP_004986348.1|  PREDICTED: umecyanin-like                        82.8    4e-16   
ref|XP_009364053.1|  PREDICTED: mavicyanin-like                       83.6    4e-16   
ref|XP_007203664.1|  hypothetical protein PRUPE_ppa027003mg           83.6    4e-16   
ref|XP_002972342.1|  hypothetical protein SELMODRAFT_27488            82.4    4e-16   
ref|XP_010687949.1|  PREDICTED: cucumber peeling cupredoxin-like      84.3    4e-16   
ref|XP_004288794.1|  PREDICTED: early nodulin-like protein 1-like     82.4    4e-16   
ref|XP_009409321.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.8    4e-16   
ref|XP_010524439.1|  PREDICTED: uclacyanin-2                          84.0    5e-16   
gb|KEH27018.1|  plastocyanin-like domain protein                      83.6    5e-16   
ref|XP_009586697.1|  PREDICTED: blue copper protein-like              84.0    5e-16   
ref|XP_004163554.1|  PREDICTED: cucumber peeling cupredoxin-like      83.2    5e-16   
ref|XP_008346622.1|  PREDICTED: umecyanin-like                        84.0    6e-16   
ref|XP_004136087.1|  PREDICTED: cucumber peeling cupredoxin-like      83.6    6e-16   
ref|XP_010101008.1|  Blue copper protein                              83.6    6e-16   
ref|XP_006490063.1|  PREDICTED: blue copper protein-like              84.0    6e-16   
gb|KGN45268.1|  hypothetical protein Csa_7G432500                     83.6    7e-16   
ref|XP_003602882.1|  Blue copper protein                              84.0    7e-16   
gb|KDO40616.1|  hypothetical protein CISIN_1g039191mg                 84.0    7e-16   
ref|XP_004163553.1|  PREDICTED: uncharacterized LOC101207314          84.7    7e-16   
gb|KDP30271.1|  hypothetical protein JCGZ_17053                       82.8    7e-16   
gb|KDO80194.1|  hypothetical protein CISIN_1g018026mg                 85.1    7e-16   
gb|EMT01699.1|  Blue copper protein                                   82.8    7e-16   
gb|AFK33414.1|  unknown                                               83.6    7e-16   
ref|XP_009381441.1|  PREDICTED: mavicyanin-like                       83.6    8e-16   
ref|XP_008366480.1|  PREDICTED: umecyanin-like                        82.8    8e-16   
gb|KDO48548.1|  hypothetical protein CISIN_1g040203mg                 83.6    8e-16   
ref|XP_008373963.1|  PREDICTED: cucumber peeling cupredoxin-like      83.6    8e-16   
ref|XP_008778314.1|  PREDICTED: mavicyanin-like                       82.8    8e-16   
ref|XP_008352253.1|  PREDICTED: umecyanin-like                        82.4    8e-16   
ref|XP_010662600.1|  PREDICTED: mavicyanin-like                       82.4    9e-16   
ref|NP_001057157.1|  Os06g0218600                                     83.2    9e-16   
gb|KHN22113.1|  Stellacyanin                                          84.7    9e-16   
ref|XP_006427286.1|  hypothetical protein CICLE_v10027232mg           83.2    9e-16   
gb|EAZ00173.1|  hypothetical protein OsI_22178                        83.2    9e-16   
ref|XP_010654797.1|  PREDICTED: cucumber peeling cupredoxin-like ...  82.4    1e-15   
gb|KDP37082.1|  hypothetical protein JCGZ_06138                       83.2    1e-15   
ref|XP_004957076.1|  PREDICTED: blue copper protein-like              82.0    1e-15   
ref|XP_002325209.2|  hypothetical protein POPTR_0018s12900g           82.0    1e-15   
ref|XP_011073611.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   86.3    1e-15   
gb|KDO48549.1|  hypothetical protein CISIN_1g036938mg                 83.2    1e-15   
ref|XP_006427285.1|  hypothetical protein CICLE_v10027144mg           82.8    2e-15   
sp|Q41001.1|BCP_PEA  RecName: Full=Blue copper protein; Flags: Pr...  82.4    2e-15   
ref|XP_004973723.1|  PREDICTED: blue copper protein-like              82.0    2e-15   
ref|XP_006842048.1|  hypothetical protein AMTR_s00078p00022070        82.0    2e-15   
ref|XP_010050041.1|  PREDICTED: blue copper protein-like              84.0    2e-15   
ref|XP_003602846.1|  Blue copper protein                              82.0    2e-15   
ref|XP_009770624.1|  PREDICTED: blue copper protein-like              82.4    2e-15   
gb|ACJ84190.1|  unknown                                               82.0    2e-15   
gb|ACJ83835.1|  unknown                                               82.0    2e-15   
gb|ACJ85992.1|  unknown                                               82.0    2e-15   
ref|XP_003602855.1|  Blue copper protein                              82.4    2e-15   
ref|NP_001152236.1|  blue copper protein precursor                    82.4    2e-15   
ref|XP_006421526.1|  hypothetical protein CICLE_v10006935mg           82.4    2e-15   
gb|KDP40154.1|  hypothetical protein JCGZ_02152                       82.0    2e-15   
ref|NP_001062071.1|  Os08g0482700                                     81.6    2e-15   
ref|XP_009365429.1|  PREDICTED: umecyanin-like                        82.0    2e-15   
ref|XP_009364007.1|  PREDICTED: umecyanin-like                        81.3    2e-15   
gb|KDP30273.1|  hypothetical protein JCGZ_17055                       83.6    3e-15   
ref|XP_007018695.1|  Cupredoxin superfamily protein, putative         80.9    3e-15   
ref|XP_006465483.1|  PREDICTED: cucumber peeling cupredoxin-like      82.4    3e-15   
ref|XP_008242793.1|  PREDICTED: early nodulin-like protein 1          81.3    3e-15   
gb|KCW79983.1|  hypothetical protein EUGRSUZ_C01313                   81.3    3e-15   
ref|XP_008219351.1|  PREDICTED: blue copper protein                   81.6    3e-15   
ref|XP_008242796.1|  PREDICTED: blue copper protein-like              81.3    3e-15   
ref|XP_009368874.1|  PREDICTED: stellacyanin-like                     81.3    3e-15   
ref|NP_001062070.1|  Os08g0482600                                     81.3    3e-15   
gb|KHN15076.1|  Blue copper protein                                   82.4    3e-15   
ref|NP_001063431.1|  Os09g0469300                                     80.5    3e-15   
ref|NP_001238405.1|  uncharacterized protein LOC100527593 precursor   82.0    3e-15   
ref|XP_006465482.1|  PREDICTED: blue copper protein-like              82.0    3e-15   
ref|XP_004308173.1|  PREDICTED: blue copper protein-like              82.0    4e-15   
ref|XP_010104273.1|  Blue copper protein                              81.3    4e-15   
ref|XP_008443977.1|  PREDICTED: umecyanin-like                        81.3    4e-15   
ref|XP_011017788.1|  PREDICTED: umecyanin-like                        80.5    4e-15   
ref|XP_002285736.1|  PREDICTED: blue copper protein-like              81.3    4e-15   
emb|CBI19206.3|  unnamed protein product                              81.3    4e-15   
emb|CAN70380.1|  hypothetical protein VITISV_002167                   80.1    4e-15   
ref|XP_010103732.1|  Blue copper protein                              82.4    5e-15   
ref|XP_006660724.1|  PREDICTED: blue copper protein-like              80.1    5e-15   
gb|EYU21648.1|  hypothetical protein MIMGU_mgv1a013921mg              81.3    5e-15   
ref|XP_004152622.1|  PREDICTED: blue copper protein-like              81.3    5e-15   
ref|XP_008646293.1|  PREDICTED: blue copper protein-like              81.6    5e-15   
ref|XP_009398997.1|  PREDICTED: mavicyanin-like                       80.5    5e-15   
ref|XP_009355692.1|  PREDICTED: umecyanin-like                        80.5    5e-15   
gb|KCW80118.1|  hypothetical protein EUGRSUZ_C01445                   80.1    6e-15   
ref|XP_003574652.1|  PREDICTED: blue copper protein-like              80.5    6e-15   
ref|XP_008374007.1|  PREDICTED: cucumber peeling cupredoxin-like      81.3    6e-15   
emb|CDY35824.1|  BnaC09g37560D                                        80.5    6e-15   
ref|XP_003591670.1|  Blue copper protein                              81.3    6e-15   
ref|XP_010051720.1|  PREDICTED: stellacyanin-like                     79.7    6e-15   
ref|XP_009364058.1|  PREDICTED: early nodulin-like protein 1          80.1    6e-15   
ref|XP_004135850.1|  PREDICTED: uncharacterized protein LOC101207314  83.6    6e-15   
ref|NP_001149576.1|  blue copper protein precursor                    80.9    7e-15   
emb|CDX92480.1|  BnaA10g15190D                                        80.5    7e-15   
ref|XP_008364805.1|  PREDICTED: early nodulin-like protein 1          80.1    7e-15   
ref|XP_009368870.1|  PREDICTED: blue copper protein-like              82.0    8e-15   
ref|XP_006372163.1|  hypothetical protein POPTR_0018s12910g           80.9    8e-15   
ref|XP_010048014.1|  PREDICTED: umecyanin-like                        80.1    8e-15   
ref|XP_007155022.1|  hypothetical protein PHAVU_003G166600g           80.9    9e-15   
ref|XP_006653637.1|  PREDICTED: blue copper protein-like              79.0    9e-15   
ref|XP_011017787.1|  PREDICTED: umecyanin-like                        79.7    9e-15   
gb|KCW79977.1|  hypothetical protein EUGRSUZ_C01304                   80.1    9e-15   
ref|XP_007226416.1|  hypothetical protein PRUPE_ppa023338mg           79.7    9e-15   
gb|KDP30270.1|  hypothetical protein JCGZ_17052                       79.7    1e-14   
gb|KDP28869.1|  hypothetical protein JCGZ_14640                       80.1    1e-14   
gb|KCW80119.1|  hypothetical protein EUGRSUZ_C01446                   79.7    1e-14   
ref|XP_004503645.1|  PREDICTED: mavicyanin-like                       78.6    1e-14   
ref|XP_008242794.1|  PREDICTED: uncharacterized protein LOC103341094  82.8    1e-14   
ref|XP_010933589.1|  PREDICTED: stellacyanin                          79.7    1e-14   
ref|XP_010048015.1|  PREDICTED: umecyanin-like                        79.3    1e-14   
ref|XP_007136283.1|  hypothetical protein PHAVU_009G033500g           79.7    1e-14   
ref|XP_010670421.1|  PREDICTED: basic blue protein-like               79.7    1e-14   
gb|KDP29124.1|  hypothetical protein JCGZ_16513                       78.2    1e-14   
ref|XP_009364009.1|  PREDICTED: flocculation protein FLO11-like i...  82.0    1e-14   
ref|NP_001236244.1|  uncharacterized protein LOC100306522 precursor   79.3    1e-14   
ref|XP_007202286.1|  hypothetical protein PRUPE_ppa009089mg           81.3    1e-14   
ref|XP_009364008.1|  PREDICTED: uclacyanin-3-like isoform X1          82.0    1e-14   
ref|XP_006598181.1|  PREDICTED: cucumber peeling cupredoxin-like      79.0    2e-14   
ref|XP_009120827.1|  PREDICTED: umecyanin                             79.0    2e-14   
ref|XP_011032393.1|  PREDICTED: mavicyanin-like                       79.3    2e-14   
ref|XP_010250148.1|  PREDICTED: umecyanin-like                        79.3    2e-14   
ref|XP_011081177.1|  PREDICTED: blue copper protein-like              79.3    2e-14   
gb|EMT21853.1|  Blue copper protein                                   78.6    2e-14   
gb|EPS65671.1|  hypothetical protein M569_09108                       78.2    2e-14   
dbj|BAJ98291.1|  predicted protein                                    78.6    2e-14   
gb|AFW79257.1|  hypothetical protein ZEAMMB73_640156                  79.0    2e-14   
ref|XP_006827928.1|  hypothetical protein AMTR_s00008p00175510        79.0    2e-14   
gb|AFK39061.1|  unknown                                               79.0    2e-14   
gb|KDP29128.1|  hypothetical protein JCGZ_16517                       77.4    2e-14   
ref|XP_008232712.1|  PREDICTED: mavicyanin-like isoform X2            77.4    2e-14   
ref|XP_004150037.1|  PREDICTED: blue copper protein-like              79.0    2e-14   
ref|XP_011017789.1|  PREDICTED: umecyanin-like                        78.2    3e-14   
ref|XP_004501685.1|  PREDICTED: blue copper protein-like              79.0    3e-14   
ref|XP_002527190.1|  Blue copper protein precursor, putative          78.2    3e-14   
ref|XP_004963582.1|  PREDICTED: cucumber peeling cupredoxin-like      77.8    3e-14   
ref|XP_009132835.1|  PREDICTED: blue copper protein-like              79.7    3e-14   
gb|EMT30815.1|  hypothetical protein F775_42920                       77.0    3e-14   
gb|KCW83086.1|  hypothetical protein EUGRSUZ_B00045                   78.6    3e-14   
ref|XP_010050584.1|  PREDICTED: umecyanin-like                        78.2    4e-14   
ref|XP_010676350.1|  PREDICTED: umecyanin-like                        78.2    4e-14   
ref|XP_006433913.1|  hypothetical protein CICLE_v10002591mg           78.6    4e-14   
ref|XP_009386042.1|  PREDICTED: stellacyanin                          78.2    4e-14   
ref|XP_010923547.1|  PREDICTED: mavicyanin-like                       78.6    4e-14   
ref|XP_003564080.1|  PREDICTED: blue copper protein-like              78.6    4e-14   
ref|XP_010048056.1|  PREDICTED: umecyanin-like                        77.8    4e-14   
gb|KFK26265.1|  hypothetical protein AALP_AA8G224600                  78.6    4e-14   
ref|XP_004305675.1|  PREDICTED: uncharacterized protein LOC101308788  79.3    4e-14   
gb|KDP29125.1|  hypothetical protein JCGZ_16514                       76.6    4e-14   
ref|XP_010481229.1|  PREDICTED: mavicyanin-like                       77.4    4e-14   
ref|XP_007141217.1|  hypothetical protein PHAVU_008G177100g           78.6    4e-14   
ref|XP_008647896.1|  PREDICTED: blue copper protein isoform X1        78.6    5e-14   
gb|EMT20724.1|  Blue copper protein                                   77.4    5e-14   
ref|XP_009391330.1|  PREDICTED: blue copper protein-like              77.8    5e-14   
ref|XP_009418919.1|  PREDICTED: mavicyanin-like                       78.2    5e-14   
ref|XP_008373105.1|  PREDICTED: blue copper protein                   77.8    5e-14   
ref|XP_004287296.1|  PREDICTED: blue copper protein-like              78.2    5e-14   
gb|EPS60310.1|  hypothetical protein M569_14493                       77.0    5e-14   
gb|KHG05659.1|  Blue copper                                           77.8    6e-14   
ref|XP_006363305.1|  PREDICTED: blue copper protein-like              77.8    6e-14   
ref|XP_008344390.1|  PREDICTED: basic blue protein-like               76.3    6e-14   
ref|XP_010687950.1|  PREDICTED: umecyanin-like                        77.4    6e-14   
gb|KHN27753.1|  Cucumber peeling cupredoxin                           77.4    6e-14   
ref|XP_008354497.1|  PREDICTED: early nodulin-like protein 1          77.4    6e-14   
ref|XP_008385428.1|  PREDICTED: early nodulin-like protein 1          77.4    6e-14   
ref|XP_009760606.1|  PREDICTED: mavicyanin-like                       77.8    6e-14   
ref|XP_011012352.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  81.3    7e-14   
ref|XP_007023186.1|  Glycosyl hydrolase superfamily protein           81.3    7e-14   
ref|XP_009771215.1|  PREDICTED: stellacyanin-like                     77.4    7e-14   
ref|XP_009379303.1|  PREDICTED: blue copper protein-like              76.3    7e-14   
gb|KHN15075.1|  Blue copper protein                                   79.7    7e-14   
ref|XP_008645872.1|  PREDICTED: umecyanin-like                        77.0    8e-14   
ref|XP_006372162.1|  hypothetical protein POPTR_0018s12890g           77.0    8e-14   
ref|XP_006473004.1|  PREDICTED: blue copper protein-like              77.4    8e-14   
ref|XP_010266815.1|  PREDICTED: blue copper protein-like              77.4    8e-14   
emb|CDY19128.1|  BnaA04g18680D                                        78.2    8e-14   
ref|XP_003576631.1|  PREDICTED: blue copper protein-like              76.6    9e-14   
ref|XP_010536254.1|  PREDICTED: umecyanin                             77.4    9e-14   
ref|NP_001234979.1|  uncharacterized protein LOC100305666 precursor   77.4    1e-13   
emb|CDY10770.1|  BnaA05g11660D                                        77.4    1e-13   
pdb|1X9R|A  Chain A, Umecyanin From Horse Raddish- Crystal Struct...  75.5    1e-13   
ref|XP_004299681.1|  PREDICTED: blue copper protein-like              77.0    1e-13   
gb|AAB34409.1|  umecyanin                                             75.5    1e-13   
sp|P42849.1|UMEC_ARMRU  RecName: Full=Umecyanin; Short=UMC            75.5    1e-13   
ref|XP_004308433.1|  PREDICTED: blue copper protein-like              75.5    1e-13   
gb|AAC64163.1|  blue copper protein                                   75.1    1e-13   
ref|XP_002466248.1|  hypothetical protein SORBIDRAFT_01g004320        77.0    1e-13   
emb|CDY65457.1|  BnaC03g71950D                                        77.8    1e-13   
ref|XP_010513470.1|  PREDICTED: mavicyanin-like                       76.3    1e-13   
gb|KHG25479.1|  Blue copper                                           76.3    1e-13   
ref|XP_007216148.1|  hypothetical protein PRUPE_ppa015115mg           77.0    1e-13   
ref|XP_008337274.1|  PREDICTED: blue copper protein-like              78.2    2e-13   
ref|XP_002274104.1|  PREDICTED: umecyanin                             75.9    2e-13   
ref|XP_002961951.1|  hypothetical protein SELMODRAFT_27978            74.7    2e-13   
dbj|BAF01024.1|  uclacyanin I - like predicted GPI-anchored protein   77.4    2e-13   
gb|KHG11741.1|  hypothetical protein F383_14857                       75.1    2e-13   
ref|NP_180789.1|  uclacyanin 1                                        77.4    2e-13   
gb|KDP41427.1|  hypothetical protein JCGZ_15834                       76.3    2e-13   
ref|XP_011016865.1|  PREDICTED: blue copper protein-like              76.3    2e-13   
ref|XP_009405058.1|  PREDICTED: mavicyanin-like                       76.3    2e-13   
ref|XP_006578311.1|  PREDICTED: blue copper protein-like              76.6    2e-13   
ref|XP_004508478.1|  PREDICTED: blue copper protein-like              76.3    2e-13   
ref|XP_006580542.1|  PREDICTED: early nodulin-like protein 1-like     74.7    2e-13   
ref|XP_002983241.1|  hypothetical protein SELMODRAFT_117792           74.7    2e-13   
ref|XP_008362376.1|  PREDICTED: blue copper protein-like              75.9    2e-13   
ref|XP_003565891.1|  PREDICTED: cucumber peeling cupredoxin-like      75.9    2e-13   
ref|XP_002961322.1|  hypothetical protein SELMODRAFT_29265            73.9    3e-13   
ref|XP_010675754.1|  PREDICTED: blue copper protein-like              75.9    3e-13   
ref|XP_003570597.1|  PREDICTED: blue copper protein-like              76.3    3e-13   
ref|XP_009373387.1|  PREDICTED: blue copper protein-like              75.9    3e-13   
gb|EYU29386.1|  hypothetical protein MIMGU_mgv1a024489mg              75.5    3e-13   
gb|KEH21186.1|  plastocyanin-like domain protein                      74.7    3e-13   
ref|XP_002517215.1|  Mavicyanin, putative                             75.9    3e-13   
ref|XP_004136086.1|  PREDICTED: blue copper protein-like              76.3    3e-13   
gb|EYU41504.1|  hypothetical protein MIMGU_mgv1a014825mg              75.5    3e-13   
ref|XP_008461122.1|  PREDICTED: cucumber peeling cupredoxin-like      76.3    3e-13   
ref|XP_006400590.1|  hypothetical protein EUTSA_v10014739mg           75.9    3e-13   
ref|XP_010109721.1|  Basic blue protein                               74.3    3e-13   
ref|XP_008456887.1|  PREDICTED: umecyanin-like                        75.1    3e-13   
ref|XP_010052796.1|  PREDICTED: mavicyanin-like                       75.5    3e-13   
ref|XP_011016866.1|  PREDICTED: blue copper protein-like              75.5    3e-13   
ref|XP_008461120.1|  PREDICTED: cucumber peeling cupredoxin-like      75.9    4e-13   
ref|XP_008444862.1|  PREDICTED: blue copper protein-like              75.9    4e-13   
ref|XP_004964956.1|  PREDICTED: blue copper protein-like              75.9    4e-13   
ref|XP_010510046.1|  PREDICTED: blue copper protein-like              76.3    5e-13   
gb|AAG01535.1|AF291179_1  stellacyanin-like protein CASLP1 precursor  75.1    5e-13   
ref|XP_006375159.1|  hypothetical protein POPTR_0014s04850g           75.1    5e-13   
ref|XP_006487069.1|  PREDICTED: mavicyanin-like                       75.1    6e-13   
ref|XP_010248962.1|  PREDICTED: mavicyanin                            74.7    6e-13   
ref|XP_004139411.1|  PREDICTED: blue copper protein-like              74.7    6e-13   
ref|XP_010029008.1|  PREDICTED: mavicyanin                            74.7    6e-13   
ref|XP_004981347.1|  PREDICTED: mavicyanin-like                       75.1    6e-13   
ref|XP_003527167.1|  PREDICTED: blue copper protein-like              74.3    6e-13   
ref|XP_002463056.1|  hypothetical protein SORBIDRAFT_02g036870        74.7    6e-13   
ref|XP_004308431.1|  PREDICTED: mavicyanin-like                       73.6    6e-13   
gb|EEE60145.1|  hypothetical protein OsJ_13039                        75.1    6e-13   
ref|NP_001173680.1|  Os03g0807500                                     75.1    6e-13   
ref|XP_006338690.1|  PREDICTED: blue copper protein-like              74.3    7e-13   
ref|XP_010042391.1|  PREDICTED: mavicyanin-like                       74.3    7e-13   
gb|EEC76381.1|  hypothetical protein OsI_13993                        75.1    7e-13   
ref|XP_008805908.1|  PREDICTED: blue copper protein-like              74.3    8e-13   
ref|XP_002460764.1|  hypothetical protein SORBIDRAFT_02g034540        73.9    8e-13   
ref|XP_008385439.1|  PREDICTED: blue copper protein-like              77.0    8e-13   
ref|XP_002436721.1|  hypothetical protein SORBIDRAFT_10g007520        74.7    8e-13   
ref|XP_010469615.1|  PREDICTED: blue copper protein                   75.5    9e-13   
ref|XP_002879301.1|  hypothetical protein ARALYDRAFT_902122           74.3    9e-13   
ref|XP_008786371.1|  PREDICTED: stellacyanin                          74.3    9e-13   
ref|XP_004247371.1|  PREDICTED: mavicyanin                            74.3    1e-12   
sp|P00302.1|STEL_TOXVR  RecName: Full=Stellacyanin                    72.4    1e-12   



>ref|XP_009612879.1| PREDICTED: umecyanin-like [Nicotiana tomentosiformis]
Length=183

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 83/119 (70%), Gaps = 2/119 (2%)
 Frame = +2

Query  179  ELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNT  358
            +LL+V  +F          +YTVGDS GW TP  G  T++ WANQH FV GDIL FNFN+
Sbjct  12   KLLLVCLMFACVFEVSVGRTYTVGDSFGWQTPPAGALTFSNWANQHTFVVGDILEFNFNS  71

Query  359  GLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTVHCSQGQKLTVNV  532
            G+HT AT  NKND+DSCNAAN  + + N PA   L++TG +YF CT+HC+QGQKL VNV
Sbjct  72   GVHT-ATRVNKNDFDSCNAANPIDNETNGPARFTLDTTGDYYFICTIHCNQGQKLAVNV  129



>ref|XP_006358286.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=191

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 2/102 (2%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
             T+Y VGDS GW TP NG  T++ WANQH FV GDIL FNFN+G+HT AT  NKN +DSC
Sbjct  33   GTTYIVGDSLGWQTPPNGVVTFSNWANQHTFVVGDILEFNFNSGVHT-ATRVNKNAFDSC  91

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTVHCSQGQKLTVNV  532
            NAAN  + + N PA   LN+TG +YF CT+HC+QGQKLTVNV
Sbjct  92   NAANPIDNETNGPAKFTLNTTGDYYFICTIHCNQGQKLTVNV  133



>ref|XP_009794604.1| PREDICTED: umecyanin-like [Nicotiana sylvestris]
Length=183

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +2

Query  179  ELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNT  358
            +LL+V  +F          +YTVGDS GW TP  G  T++ WANQ  FV GDIL FNFN+
Sbjct  12   KLLLVCLMFACVFEVSVGRTYTVGDSFGWQTPPAGALTFSNWANQQTFVVGDILEFNFNS  71

Query  359  GLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTVHCSQGQKLTVNV  532
            G+HT AT  NKND+DSCNAAN  + + N PA   L++TG +YF CT+HC+QGQKL VNV
Sbjct  72   GVHT-ATKVNKNDFDSCNAANPIDDETNGPARFTLDTTGDYYFICTIHCNQGQKLMVNV  129



>ref|XP_004242774.2| PREDICTED: umecyanin-like [Solanum lycopersicum]
Length=182

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGD+ GW TP NG  TY+ WANQH FV GDIL FNFN+G+HT AT  NKN +DSCNA
Sbjct  29   TYIVGDNLGWQTPPNGVVTYSNWANQHTFVVGDILEFNFNSGVHT-ATRVNKNAFDSCNA  87

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTVHCSQGQKLTVNV  532
            AN  + + N PA   LN+TG +YF CT+HC+QGQKLTVNV
Sbjct  88   ANPIDNETNGPAKFTLNTTGDYYFICTIHCNQGQKLTVNV  127



>ref|XP_010687951.1| PREDICTED: umecyanin-like [Beta vulgaris subsp. vulgaris]
Length=184

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            +++AK + +L+ +T+ +    NV AT + VGD++GWN P +  +TY++WA++H F  GDI
Sbjct  7    EMVAKYLVVLLAITLLVWGNYNVSATEFVVGDAAGWNVP-DSPTTYSSWASEHNFSIGDI  65

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF +G HTVA V NK  +++CN  +  ++ + SP+ +PL   G  +F CT+  HCS 
Sbjct  66   LVFNFTSGSHTVALV-NKTAFETCNTDDTISVTSQSPSKVPLQEIGQLHFICTIGAHCSS  124

Query  509  GQKLTVNV  532
            GQKLT+NV
Sbjct  125  GQKLTINV  132



>ref|XP_006475880.1| PREDICTED: cucumber peeling cupredoxin-like [Citrus sinensis]
Length=184

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 15/153 (10%)
 Frame = +2

Query  95   PHHLLIHNTAQG*PEPFEHH*KIMAKMME---LLVVMTVFLSAVSNVDATSYTVGDSSGW  265
            P   L     QG  +P EH  ++ +K++    L+VV  +F +A     A +YTVGD  GW
Sbjct  14   PKRFLRPKLEQG--QPVEHTEQMGSKLVLFGFLVVVPAIFDAAA----AETYTVGDEMGW  67

Query  266  NTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN--AANANIQNN  439
             TP +G + Y+ WA++ +F  GD +VFN+ TG H+VA V+ K DYD C   + +  I   
Sbjct  68   TTPPSGAAAYSTWASKQKFHFGDTIVFNW-TGSHSVAEVS-KADYDKCRTKSPDGEIHET  125

Query  440  SPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            SPA+  LNS G HYF CTV  HC +GQK+T+N+
Sbjct  126  SPANYTLNSNGTHYFICTVDSHCDRGQKVTINI  158



>ref|XP_006450883.1| hypothetical protein CICLE_v10009458mg [Citrus clementina]
 gb|ESR64123.1| hypothetical protein CICLE_v10009458mg [Citrus clementina]
Length=214

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 15/153 (10%)
 Frame = +2

Query  95   PHHLLIHNTAQG*PEPFEHH*KIMAKMME---LLVVMTVFLSAVSNVDATSYTVGDSSGW  265
            P   L     QG  +P EH  ++ +K++    L+VV  +F +A     A +YTVGD  GW
Sbjct  44   PKRFLRPKLEQG--QPVEHTEQMGSKLVLFGFLVVVPAIFDAAA----AETYTVGDEMGW  97

Query  266  NTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN--AANANIQNN  439
             TP +G + Y+ WA++ +F  GD +VFN+ TG H+VA V+ K DYD C   + +  I   
Sbjct  98   TTPPSGAAAYSTWASKKKFHFGDTIVFNW-TGSHSVAEVS-KADYDKCRTKSPDGEIHET  155

Query  440  SPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            SPA+  LNS G HYF CTV  HC +GQK+T+N+
Sbjct  156  SPANYTLNSNGTHYFICTVDSHCDRGQKVTINI  188



>ref|XP_010050044.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
 gb|KCW82880.1| hypothetical protein EUGRSUZ_C04250 [Eucalyptus grandis]
Length=167

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 75/127 (59%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M   M +LV+M    +A+    A TS+ VGDS GW  P  G   Y+ WA    FV GD L
Sbjct  1    MVSKMNMLVLMVFLGAAMRGCRAQTSHVVGDSLGWVVPPGGPIAYSTWAGNQTFVVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VF F TG H VA V  K  YD C++ +  ++Q   PASI LN +G H++ CT+  HCS G
Sbjct  61   VFTFTTGAHDVAEV-TKAAYDGCSSTSPISLQTTGPASIRLNQSGEHFYICTIGSHCSLG  119

Query  512  QKLTVNV  532
            QKLT+NV
Sbjct  120  QKLTINV  126



>gb|KCW45088.1| hypothetical protein EUGRSUZ_L01304 [Eucalyptus grandis]
Length=167

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M   M +LV+M    +A+    A TS+ VGDS GW  P  G   Y+ WA    FV GD L
Sbjct  1    MVSKMNMLVLMVFLGAAIRGCSAQTSHVVGDSLGWVVPPGGPIAYSTWAGNQTFVVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VF F TG H VA V  K  YD C++ +  ++Q   PASI LN +G H++ CT+  HCS G
Sbjct  61   VFTFTTGAHDVAEV-TKAAYDGCSSTSPISLQTTGPASIRLNQSGEHFYICTIGSHCSLG  119

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  120  QKLAINV  126



>ref|XP_010040577.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
Length=167

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M   M +LV+M    +A+    A TS+ VGDS GW  P  G   Y+ WA    FV GD L
Sbjct  1    MVSKMNMLVLMVFLGAAIRGCSAQTSHVVGDSLGWVVPPGGPIAYSTWAGNQTFVVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VF F TG H VA V  K  YD C++ +  ++Q   PASI LN +G H++ CT+  HCS G
Sbjct  61   VFTFTTGAHDVAEV-TKAAYDGCSSTSPISLQTTGPASIRLNQSGEHFYICTIGSHCSLG  119

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  120  QKLAINV  126



>ref|XP_009780504.1| PREDICTED: blue copper protein-like [Nicotiana sylvestris]
Length=351

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYT--VGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + +LV   +F +A+ +V     T  VGD+  W+ P+ G + YT WA++  F  GDI
Sbjct  1    MARKL-ILVTFAIFATALLHVSMAQQTHIVGDALAWSVPNGGAAAYTTWASRKTFAVGDI  59

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF TGLH+VA V +K ++DSCN AN  +I  N P +I L S G HY+ CT+  HC+ 
Sbjct  60   LVFNFTTGLHSVAEV-SKANFDSCNTANPISISTNGPTNITLRSAGSHYYLCTLPSHCTL  118

Query  509  GQKLTVNV  532
            GQKL +NV
Sbjct  119  GQKLAINV  126


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 62/103 (60%), Gaps = 5/103 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDS-TYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            ++TVG + GWN P+ G    Y  WAN   F  GD LVFNF  G H VA V +K  YDSCN
Sbjct  187  TFTVGGNMGWNVPTTGGPNAYQTWANGKSFKVGDTLVFNFVNGRHNVAVV-SKAAYDSCN  245

Query  413  AANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              +  N  +  PA+I L ++G +Y+ CT   HCS GQKL +NV
Sbjct  246  TTSPINTISTGPATITLTNSGENYYMCTFPSHCSLGQKLAINV  288



>ref|XP_011078396.1| PREDICTED: cucumber peeling cupredoxin [Sesamum indicum]
Length=249

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = +2

Query  203  FLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATV  382
            F   V N DA +Y VGDS GW  P  G   Y+ WA+QH+F  GD+LVFNF+TGLH  A V
Sbjct  20   FGQLVGNADAATYVVGDSLGWTIPPGGPVAYSTWASQHEFKVGDVLVFNFSTGLHDAAYV  79

Query  383  NNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              K  YD C++ +   +    PAS  LNSTG H++ CT   HCS GQKL +NV
Sbjct  80   -TKAGYDGCSSNSPIALATVGPASFTLNSTGEHHYICTFGQHCSLGQKLAINV  131



>ref|XP_010040575.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
 gb|KCW45089.1| hypothetical protein EUGRSUZ_L01304 [Eucalyptus grandis]
Length=167

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 73/127 (57%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M   M +LV M    +A+    A TS+ VGDS GW  P  G   Y+ WA    FV GD L
Sbjct  1    MVSKMNMLVSMVFLGAAIRGCSAQTSHVVGDSLGWVVPPGGPIAYSTWAGNQTFVVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VF F TG H VA V  K  YD C++ +  ++Q   PASI LN +G H++ CT+  HCS G
Sbjct  61   VFTFTTGAHDVAEV-TKAAYDGCSSTSPISLQTTGPASIRLNQSGEHFYICTIGSHCSLG  119

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  120  QKLAINV  126



>ref|XP_009794603.1| PREDICTED: blue copper protein-like [Nicotiana sylvestris]
Length=262

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  LVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGL  364
            LV++ + ++    + A  + VGDS+GW  PS G STYT WA+Q  F  GD LVFNF TG 
Sbjct  12   LVLVAILVALPGKITAVDHVVGDSNGWGIPSGGPSTYTNWASQRTFKVGDTLVFNFATGA  71

Query  365  HTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            H VA V  K+ +DSC++     +    PA+I LNSTG  YF CT   HCS GQKL +NV
Sbjct  72   HDVAKV-TKSAFDSCSSTGPVTLITVGPANITLNSTGTEYFICTFGQHCSAGQKLAINV  129



>ref|XP_010250146.1| PREDICTED: umecyanin-like [Nelumbo nucifera]
Length=182

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 9/131 (7%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV----SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTG  331
            MA   +LL  + V + AV    S   +T++ VGDS GW  P  G   Y+ WA+ + F+ G
Sbjct  1    MAARTDLLGCLLVAIVAVLLHPSAAQSTTHVVGDSLGWRIPPGGPIAYSTWASSNTFMVG  60

Query  332  DILVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--H  499
            DILVFNF TG H VA V  K D+D+C+ ++   ++Q   PA I LNS G HY+ CT   H
Sbjct  61   DILVFNFTTGQHDVAEV-TKTDFDNCDGSSTIGSVQTTGPARITLNSQGQHYYICTFNGH  119

Query  500  CSQGQKLTVNV  532
            C+ GQKL +NV
Sbjct  120  CAVGQKLAINV  130



>emb|CDP10430.1| unnamed protein product [Coffea canephora]
Length=179

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 5/121 (4%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            +ME+LVV    L  V  + AT+Y VGD+ GW  PS G + Y+ WA QH FV GD LVF+F
Sbjct  10   VMEILVVAAATL-VVHTLAATTYHVGDTFGWQVPSGGYN-YSNWATQHTFVAGDSLVFDF  67

Query  353  NTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTVHCSQGQKLTVN  529
             TG HT A V  +N YD+CN AN  + Q N PA+  L + G  Y+ CT+HCSQGQKL V+
Sbjct  68   TTGAHTAAQV-VQNAYDNCNTANPISNQVNGPATFTL-AAGTSYYVCTIHCSQGQKLAVS  125

Query  530  V  532
            V
Sbjct  126  V  126



>ref|XP_007013490.1| Early nodulin-like protein 14, putative [Theobroma cacao]
 gb|EOY31109.1| Early nodulin-like protein 14, putative [Theobroma cacao]
Length=161

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 76/130 (58%), Gaps = 9/130 (7%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDST-YTAWANQHQFVTGD  334
            ++   ++ LL+V   FL      D   YTVGD  GW+ P N  S  Y +WAN+ +F  GD
Sbjct  5    RVGLSLIGLLIVAMTFLEGAIAAD---YTVGDDYGWDVPPNNSSDFYASWANRFEFKIGD  61

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANANIQ--NNSPASIPLNSTGVHYFFCTV--HC  502
            + VFN+ TG HT A V NK D+DSCN + A I+    +   +P+   G HYF CTV  HC
Sbjct  62   VAVFNW-TGDHTAAQVTNKADFDSCNKSGAGIRLIGEAGVRVPITWEGFHYFICTVHTHC  120

Query  503  SQGQKLTVNV  532
             QGQK+ +NV
Sbjct  121  EQGQKVALNV  130



>gb|KDO80188.1| hypothetical protein CISIN_1g031882mg [Citrus sinensis]
Length=151

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 10/121 (8%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            L+VV  +F +A     A +YTVGD  GW TP +G + Y+ WA++ +F  GD +VFN+ TG
Sbjct  11   LVVVPAIFDAAA----AETYTVGDEMGWTTPPSGAAAYSTWASKQKFHFGDTIVFNW-TG  65

Query  362  LHTVATVNNKNDYDSCN--AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVN  529
             H+VA V+ K DYD C   + +  I   SPA+  LNS G HYF CTV  HC +GQK+T+N
Sbjct  66   SHSVAEVS-KADYDKCRTKSPDGEIHETSPANYTLNSNGTHYFICTVDSHCDRGQKVTIN  124

Query  530  V  532
            +
Sbjct  125  I  125



>ref|XP_011017784.1| PREDICTED: umecyanin-like [Populus euphratica]
Length=178

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 83/126 (66%), Gaps = 8/126 (6%)
 Frame = +2

Query  173  MMELLVVMTVFLSA---VSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M   LVV  V  +A   + +  AT Y VGDS+GW  PS+  S Y++WA+   FV GD L 
Sbjct  1    MGSTLVVFVVLGAASLLLHSSKATEYEVGDSTGWQAPSD-SSFYSSWASGKNFVVGDTLK  59

Query  344  FNFNTGLHTVATVNNKNDYDSCN-AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            F F+ G+H VATV+ ++DYD+CN A+ +N+  + PA+I LN+TG  Y+FCT   HC++GQ
Sbjct  60   FTFSAGVHDVATVS-ESDYDNCNVASQSNVLTSGPATITLNATGNQYYFCTFSNHCTRGQ  118

Query  515  KLTVNV  532
            KL + V
Sbjct  119  KLAITV  124



>ref|XP_010323300.1| PREDICTED: cucumber peeling cupredoxin-like [Solanum lycopersicum]
Length=238

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = +2

Query  161  IMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            ++ KM   LV+MT+  +   N+ A  + VGD+ GW  PS G  TY  W +   F  GD L
Sbjct  1    MVTKMNIALVLMTILAALPGNIVAVDHIVGDTMGWTIPSGGPITYANWTSGRTFRVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VFNF +G H VA V  K+ YDSC++ N  ++    PA+I LNSTG  YF CT   HC+ G
Sbjct  61   VFNFASGAHDVAKV-TKSAYDSCSSTNPISLITVGPANITLNSTGSEYFICTFGQHCNAG  119

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  120  QKLAINV  126



>emb|CAN66124.1| hypothetical protein VITISV_023425 [Vitis vinifera]
Length=211

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 85/129 (66%), Gaps = 8/129 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA++M + V++ V L+A+ +  A  T + VGD++GW  P  G +TYT+WA+  QFV GD 
Sbjct  1    MARLMSMAVIVVV-LAAMLHYSAAQTVHVVGDNTGWTVPQGGAATYTSWASGRQFVVGDT  59

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T +H VA + +K  +D+C+ ++   NI    PA+I L + G HY+ CT+  HC+
Sbjct  60   LVFNFATNVHDVAEL-SKESFDACDFSSTIGNIITTGPANITLATAGNHYYVCTIGSHCT  118

Query  506  QGQKLTVNV  532
             GQKL ++V
Sbjct  119  SGQKLAISV  127



>ref|XP_009602388.1| PREDICTED: umecyanin-like [Nicotiana tomentosiformis]
Length=151

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 76/123 (62%), Gaps = 5/123 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M K++EL   + VF   ++   A +Y VG + GW  P  G++ Y  WA +  F +GD LV
Sbjct  1    MEKVLELFSCIVVFALVINYAAAETYNVGGNLGWTVPPGGEADYQNWAAKQNFKSGDTLV  60

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQK  517
            F + TG+HTVA V +K DY+ C+  N +IQ  SP +I ++ TG HYF CT+  HCS GQK
Sbjct  61   FTW-TGMHTVAYV-SKEDYEKCSTTN-HIQGTSPVTISISGTGPHYFICTIGKHCSLGQK  117

Query  518  LTV  526
            + +
Sbjct  118  MNI  120



>ref|XP_002265643.1| PREDICTED: cucumber peeling cupredoxin-like [Vitis vinifera]
Length=212

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 85/129 (66%), Gaps = 8/129 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA++M + V++ V L+A+ +  A  T + VGD++GW  P  G +TYT+WA+  QFV GD 
Sbjct  1    MARLMSMAVIVVV-LAAMLHYSAAQTVHVVGDNTGWTVPQGGAATYTSWASGRQFVVGDT  59

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T +H VA + +K  +D+C+ ++   NI    PA+I L + G HY+ CT+  HC+
Sbjct  60   LVFNFATNVHDVAEL-SKESFDACDFSSTIGNIITTGPANITLATAGNHYYVCTIGSHCT  118

Query  506  QGQKLTVNV  532
             GQKL ++V
Sbjct  119  SGQKLAISV  127



>ref|XP_009612878.1| PREDICTED: blue copper protein-like [Nicotiana tomentosiformis]
Length=262

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  221  NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
             + A  + VGDSSGW  PS G STY  WA+Q  F  GD LVFNF TG H VA V  K+ Y
Sbjct  24   KITAVDHVVGDSSGWGIPSGGPSTYANWASQRTFGVGDTLVFNFATGAHDVAKV-TKSAY  82

Query  401  DSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            DSC++     +    PA+I LNSTG  YF CT   HCS GQKL +NV
Sbjct  83   DSCSSTGPVTLITVGPANITLNSTGTEYFICTFGQHCSAGQKLAINV  129



>ref|XP_010323477.1| PREDICTED: stellacyanin-like [Solanum lycopersicum]
Length=137

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 81/129 (63%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV---SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA+ +  LVV+   L A+    ++   ++ VGD+ GW  P+ G ++Y+ WA +  FV  D
Sbjct  1    MARKLSTLVVVGAILFALIQHVSMAQQTHVVGDTLGWTVPNGGAASYSTWAARKTFVVDD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            ILVFNF +G H+VA V +K  +DSCN ++  +I  N P +I L+S G HY+ CT   HC+
Sbjct  61   ILVFNFRSGSHSVAEV-SKGAFDSCNTSSPISISTNGPTNITLSSAGSHYYLCTFPSHCT  119

Query  506  QGQKLTVNV  532
             GQKL +NV
Sbjct  120  LGQKLAINV  128



>ref|XP_009612880.1| PREDICTED: blue copper protein-like [Nicotiana tomentosiformis]
Length=340

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYT--VGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + L     +F +A+ +V     T  VGD+  W  P+ G + YT W ++  F  GDI
Sbjct  1    MARKLNL-ATFAIFAAALLHVTMAQQTHVVGDALAWTVPNGGAAAYTTWTSRKTFAVGDI  59

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF TGLH+VA V +K  +DSCN AN  +I  N P +I L S G HY+ CT+  HC+ 
Sbjct  60   LVFNFTTGLHSVAEV-SKAAFDSCNTANPISISTNGPTNITLRSAGSHYYLCTLPSHCTL  118

Query  509  GQKLTVNV  532
            GQKL +NV
Sbjct  119  GQKLAINV  126


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = +2

Query  224  VDATSYTVGDSSGWNTPSNGDS-TYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
            V A +YTVG + GWN P+ G    Y  WAN   F  GD LVFNF  G H VA V +K  Y
Sbjct  172  VAAQTYTVGGNMGWNVPTTGGPNAYQTWANGKSFKVGDTLVFNFVNGRHNVAMV-SKAAY  230

Query  401  DSCNAANANIQNNS-PASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            DSCN  +     N+ PA I L ++G +Y+ CT   HCS GQKL + V
Sbjct  231  DSCNTTSTINTINTGPARITLTNSGENYYMCTFPSHCSLGQKLAIKV  277



>gb|KDP32428.1| hypothetical protein JCGZ_13353 [Jatropha curcas]
Length=173

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 5/123 (4%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            M  +  V+ + L A+   +   Y VG   GW  PSN  + Y +WA+ H F TGDIL+FNF
Sbjct  3    MRNVATVVAMLLLALHKTECAVYVVGGGGGWQNPSN-STHYASWASSHNFSTGDILMFNF  61

Query  353  NTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
             TG+H VATV   + YD+CN AN  NI NN P ++ LN+TG+HY+ CT   HCS GQKL 
Sbjct  62   VTGVHDVATVT-MDAYDNCNTANPLNIINNGPTNVTLNTTGMHYYICTFPGHCSTGQKLA  120

Query  524  VNV  532
            VNV
Sbjct  121  VNV  123



>ref|XP_007013489.1| Cupredoxin superfamily protein, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY31108.1| Cupredoxin superfamily protein, putative isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M + + ++ + T+ ++A+  S+   T+Y VGD+ GW  P  G   YT WA    F  GD 
Sbjct  1    MGRRLNIVFLATIAIAAMLQSSSAQTAYVVGDALGWAIPPGGAVAYTTWAANKTFRVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF++G H VA V   N +D+CN+AN  +  +N PA+  LN TG HYF C    HCS 
Sbjct  61   LVFNFSSGSHDVARVTRAN-FDACNSANPLLLLSNGPANFTLNETGDHYFLCAFPGHCSA  119

Query  509  GQKLTVNV  532
            GQ+L +NV
Sbjct  120  GQRLAINV  127



>emb|CDP10429.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 74/122 (61%), Gaps = 7/122 (6%)
 Frame = +2

Query  176  MELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFN  355
            + LLV++   +  + N DA ++ VGDS GW  PS G S Y  WA+Q  F  GDILVFNF 
Sbjct  10   VPLLVILAAAI--LGNTDAATHVVGDSLGWTIPS-GSSVYPNWASQQTFKVGDILVFNFA  66

Query  356  TGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
            TG H VA V  K  YD C ++N  ++Q   PA I L S G  YF CT   HCS GQKLTV
Sbjct  67   TGAHDVAVV-PKASYDGCTSSNPISLQTVGPARINLTSPGQAYFICTFGQHCSLGQKLTV  125

Query  527  NV  532
            +V
Sbjct  126  SV  127



>emb|CDP10432.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 61/102 (60%), Gaps = 3/102 (3%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN-  412
            +Y VGDS GW  P  G   Y  WA    F+ GDILVFNF TG H VA V +K  YDSCN 
Sbjct  153  TYVVGDSLGWTVPPGGSIAYRTWAAGKTFMVGDILVFNFTTGAHDVAVVTSKAAYDSCNT  212

Query  413  AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +A     N  PA I L + G H++ CT+  HCS GQKL +NV
Sbjct  213  SATGTTINTGPARITLTTAGEHFYICTIPRHCSHGQKLAINV  254


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +2

Query  221  NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
            +V   ++ VGDS GW  P  G   YT WA    F  GD+L+FNF TGLH VA V ++  +
Sbjct  22   SVAQRTHVVGDSLGWTIPPGGAVAYTTWAASQTFTVGDVLLFNFTTGLHDVAQV-SRTSF  80

Query  401  DSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            D CN+A+  ++  N PA++ LN+TG HY+ CT   HC+ G KL +NV
Sbjct  81   DGCNSASPISLVRNGPANVTLNTTGEHYYICTFSGHCNAGMKLAINV  127



>gb|KCW44224.1| hypothetical protein EUGRSUZ_L02351, partial [Eucalyptus grandis]
Length=173

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = +2

Query  176  MELLVVMTV-FLSAVSNVDATSYTVGDSSGW-NTPSNGDSTYTAWANQHQFVTGDILVFN  349
            + +LVVM V  L  + + +A +YTVGDS+GW N  + G S Y++WA+ + F  GDILVFN
Sbjct  12   VRVLVVMAVELLVMLRSAEAATYTVGDSTGWTNVVNGGASFYSSWASGNTFNVGDILVFN  71

Query  350  FNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQGQKL  520
            F +G H VA V +++D+ SCN  +   +  N P + PLN+TG  YF CT   HCSQGQKL
Sbjct  72   FVSGQHDVAIV-SESDFSSCNTGSPITLLTNPPVNYPLNTTGTVYFICTHDSHCSQGQKL  130

Query  521  TVNV  532
            +V V
Sbjct  131  SVTV  134



>emb|CAN69318.1| hypothetical protein VITISV_032660 [Vitis vinifera]
Length=174

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 86/129 (67%), Gaps = 8/129 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+++ + V++ V L+A+ +  A  T + VGD++GW  P  G +TYT+WA+  QFV GD 
Sbjct  1    MARLISMAVIVAV-LAAMLHYSAAQTVHVVGDNTGWTVPQGGAATYTSWASGKQFVVGDT  59

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T +H VA + +K  +D+C+ ++   +I    PA+I L +TG HY+ CT+  HC+
Sbjct  60   LVFNFATNVHDVAEL-SKESFDACDFSSTIGSIITTGPANITLATTGNHYYVCTIGSHCT  118

Query  506  QGQKLTVNV  532
             GQKL ++V
Sbjct  119  FGQKLAISV  127



>ref|XP_010041622.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
Length=193

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = +2

Query  176  MELLVVMTV-FLSAVSNVDATSYTVGDSSGW-NTPSNGDSTYTAWANQHQFVTGDILVFN  349
            + +LVVM V  L  + + +A +YTVGDS+GW N  + G S Y++WA+ + F  GDILVFN
Sbjct  12   VRVLVVMAVELLVMLRSAEAATYTVGDSTGWTNVVNGGASFYSSWASGNTFNVGDILVFN  71

Query  350  FNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQGQKL  520
            F +G H VA V +++D+ SCN  +   +  N P + PLN+TG  YF CT   HCSQGQKL
Sbjct  72   FVSGQHDVAIV-SESDFSSCNTGSPITLLTNPPVNYPLNTTGTVYFICTHDSHCSQGQKL  130

Query  521  TVNV  532
            +V V
Sbjct  131  SVTV  134



>ref|XP_010051716.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
Length=179

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 76/139 (55%), Gaps = 17/139 (12%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI-  337
            M   M +LV+M    + +    A TS+ +GDS GW  P  G   Y+ WA    FV GD  
Sbjct  1    MVSKMNMLVLMVFLGATIWGCSAQTSHVIGDSLGWVVPPGGPIAYSTWAGNQTFVVGDTN  60

Query  338  -----------LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHY  481
                        VFNF TG H VA V  K  YDSC++ +  ++Q   PASIPLN +G H+
Sbjct  61   CNEHSKCFHFHAVFNFTTGAHDVAEV-TKVAYDSCSSMSPISLQTTGPASIPLNQSGEHF  119

Query  482  FFCTV--HCSQGQKLTVNV  532
            + CTV  HCS GQKLT+NV
Sbjct  120  YICTVGSHCSLGQKLTINV  138



>gb|AFK40462.1| unknown [Medicago truncatula]
Length=229

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNV-----DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVT  328
            MAK   +LV   V L+  +N+       T + VGD++GW  P+NG S YT WA+   F  
Sbjct  1    MAKNFNVLVF--VLLAVAANLFHGSFAQTRHVVGDTTGWTIPTNGASFYTNWASNKTFTV  58

Query  329  GDILVFNFNTGLHTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--H  499
            GD LVFN+ +G H VA V  K  YDSCN AN      NSPA++ LN TG   F C V  H
Sbjct  59   GDTLVFNYASGQHDVAKV-TKTAYDSCNGANTLFTLTNSPATVTLNETGQQNFLCAVPGH  117

Query  500  CSQGQKLTVNV  532
            CS GQKL++NV
Sbjct  118  CSAGQKLSINV  128



>ref|XP_007013488.1| Cupredoxin superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31107.1| Cupredoxin superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=261

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M + + ++ + T+ ++A+  S+   T+Y VGD+ GW  P  G   YT WA    F  GD 
Sbjct  1    MGRRLNIVFLATIAIAAMLQSSSAQTAYVVGDALGWAIPPGGAVAYTTWAANKTFRVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF++G H VA V   N +D+CN+AN  +  +N PA+  LN TG HYF C    HCS 
Sbjct  61   LVFNFSSGSHDVARVTRAN-FDACNSANPLLLLSNGPANFTLNETGDHYFLCAFPGHCSA  119

Query  509  GQKLTVNV  532
            GQ+L +NV
Sbjct  120  GQRLAINV  127



>ref|XP_002265604.2| PREDICTED: blue copper protein [Vitis vinifera]
Length=320

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = +2

Query  161  IMAKMMELLVVMTVFLSAVS---NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTG  331
            +MA+ M ++ VM V  + ++       T + VGDS GW  P NG + YT+WA+  QF+ G
Sbjct  1    MMARFMCMVGVMIVVAATLTVNFAAAQTVHVVGDSLGWTVPPNGAAAYTSWASNKQFMVG  60

Query  332  DILVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--H  499
            DILVFNF T  H V  + +K  +D+CN +N   +I    PA+I LN+TG HY+ CT+  H
Sbjct  61   DILVFNFATNEHDVVEL-SKESFDACNYSNPIGSIITTGPANITLNATGNHYYICTIGRH  119

Query  500  CSQGQKLTVNV  532
            C+ GQKL + V
Sbjct  120  CTSGQKLAITV  130



>gb|ADV57640.1| copper binding protein 5 [Gossypium hirsutum]
Length=200

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 74/128 (58%), Gaps = 7/128 (5%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            KI   M  L VV+    + + + +  +YTVGDS+GW  P+N D  Y  WA+   FV GD+
Sbjct  4    KITMAMAALFVVLAA--NVLQSTNGATYTVGDSTGWRVPANNDF-YDDWADNKAFVVGDV  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF TG H VA V  +  YD+C  AN  +  +  PA I LN TG  YF C V  HCS 
Sbjct  61   LVFNFTTGQHDVAEV-TETAYDACTTANTISTVSTGPARITLNRTGEFYFICAVPGHCSG  119

Query  509  GQKLTVNV  532
            GQKL V V
Sbjct  120  GQKLNVEV  127



>ref|XP_002266874.1| PREDICTED: cucumber peeling cupredoxin-like isoform X1 [Vitis 
vinifera]
Length=174

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 85/129 (66%), Gaps = 8/129 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+++ + V++ V L+A+ +  A  T + VGD++GW  P  G +TYT+WA+  QFV GD 
Sbjct  1    MARLISMAVIVAV-LAAMLHYSAAQTVHVVGDNTGWTVPQGGAATYTSWASGKQFVVGDT  59

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T +H VA + +K  +D+C+ ++   +I    PA+I L + G HY+ CT+  HC+
Sbjct  60   LVFNFATNVHDVAEL-SKESFDACDFSSTIGSIITTGPANITLATAGNHYYVCTIGSHCT  118

Query  506  QGQKLTVNV  532
             GQKL ++V
Sbjct  119  SGQKLAISV  127



>ref|XP_004508477.1| PREDICTED: blue copper protein-like [Cicer arietinum]
Length=361

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + +++ M + ++ +   +V  T + VGD++GW  PSNG S Y  WA+   F  GD 
Sbjct  1    MARNLNVVIFMVLTVANLLDGSVAQTKHVVGDATGWTIPSNGASFYVNWASNKTFTVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQ  508
            LVFNF  G H VA V  K+D DSCN A   ++  N PAS+ L  TG  YF CT   HCS 
Sbjct  61   LVFNFANGQHDVAKV-TKSDSDSCNGAKTISLLTNGPASVTLKETGQQYFICTFGTHCSL  119

Query  509  GQKLTVNV  532
            GQKL++NV
Sbjct  120  GQKLSINV  127


 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  239  YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNAA  418
            YTVGD +GW  P+NG S YT WA+   F  GD+LVFNF    H V  V  K  YDSCN+A
Sbjct  189  YTVGDINGWTIPANGASAYTTWASGKSFKVGDVLVFNFAFTTHNVEEVT-KAKYDSCNSA  247

Query  419  NANIQ-NNSPASIPLNSTGVHYFFC--TVHCSQGQKLTVNV  532
            +     +  P  I LN TG HYF C  + HCS GQKL++NV
Sbjct  248  SPIATFSKPPVRITLNKTGTHYFICGFSGHCSAGQKLSINV  288



>ref|XP_002325213.2| hypothetical protein POPTR_0018s12950g [Populus trichocarpa]
 gb|EEF03778.2| hypothetical protein POPTR_0018s12950g [Populus trichocarpa]
Length=182

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 5/105 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
             AT Y VGDS+GW  PS+  S Y+ WA+   F  GD L F F+T +H VATV+ K+DYD+
Sbjct  22   KATEYEVGDSTGWQAPSD-TSFYSNWASGKTFTVGDTLTFTFSTTVHDVATVS-KSDYDN  79

Query  407  CN-AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            CN A+ +N+    PA+I LN+TG  Y+FCT+  HC++GQKL + V
Sbjct  80   CNIASQSNVLTVGPATITLNATGNQYYFCTLSNHCTRGQKLAITV  124



>emb|CAN66123.1| hypothetical protein VITISV_023424 [Vitis vinifera]
Length=319

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 80/130 (62%), Gaps = 8/130 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVS---NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA+ M ++ VM V  + ++       T + VGDS GW  P NG + YT+WA+  QF+ GD
Sbjct  1    MARFMCMVGVMIVVAATLTVNFAAAQTVHVVGDSLGWTVPPNGAAAYTSWASNKQFMVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HC  502
            ILVFNF T  H V  + +K  +D+CN +N   +I    PA+I LN+TG HY+ CT+  HC
Sbjct  61   ILVFNFATNEHDVVEL-SKESFDACNYSNPIGSIITTGPANITLNATGNHYYICTIGRHC  119

Query  503  SQGQKLTVNV  532
            + GQKL + V
Sbjct  120  TSGQKLAITV  129



>ref|XP_010687952.1| PREDICTED: umecyanin [Beta vulgaris subsp. vulgaris]
Length=169

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            M ++ +V  V +  +  + A +  VGD++ W  P + +  YT+WA +H F  GD+LVF F
Sbjct  1    MAKMFIVAAVIIMVMKGITAETINVGDANRWINPPSPE-LYTSWAAEHTFAVGDVLVFQF  59

Query  353  NTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
             T  HTVA V     YD+C+A NA I    P  I LN  G  +F CTV  HC  GQK  +
Sbjct  60   TTNFHTVAMVTEAG-YDACDAGNAVIHTEGPTEITLNRPGEFFFICTVGTHCDNGQKFAI  118

Query  527  NV  532
            NV
Sbjct  119  NV  120



>emb|CBI36327.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 82/132 (62%), Gaps = 8/132 (6%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVS---NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVT  328
            ++MA+ M ++ VM V  + ++       T + VGDS GW  P NG + YT+WA+  QF+ 
Sbjct  357  QMMARFMCMVGVMIVVAATLTVNFAAAQTVHVVGDSLGWTVPPNGAAAYTSWASNKQFMV  416

Query  329  GDILVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--  496
            GDILVFNF T  H V  + +K  +D+CN +N   +I    PA+I LN+TG HY+ CT+  
Sbjct  417  GDILVFNFATNEHDVVEL-SKESFDACNYSNPIGSIITTGPANITLNATGNHYYICTIGR  475

Query  497  HCSQGQKLTVNV  532
            HC+ GQKL + V
Sbjct  476  HCTSGQKLAITV  487


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 85/129 (66%), Gaps = 8/129 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+++ + V++ V L+A+ +  A  T + VGD++GW  P  G +TYT+WA+  QFV GD 
Sbjct  1    MARLISMAVIVAV-LAAMLHYSAAQTVHVVGDNTGWTVPQGGAATYTSWASGKQFVVGDT  59

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T +H VA + +K  +D+C+ ++   +I    PA+I L + G HY+ CT+  HC+
Sbjct  60   LVFNFATNVHDVAEL-SKESFDACDFSSTIGSIITTGPANITLATAGNHYYVCTIGSHCT  118

Query  506  QGQKLTVNV  532
             GQKL ++V
Sbjct  119  SGQKLAISV  127


 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 5/104 (5%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T + VGD++GW  P  G +TYT+WA+  QFV GD LVFNF T +H VA + +K  +D+C+
Sbjct  174  TVHVVGDNTGWTVPQGGAATYTSWASGRQFVVGDTLVFNFATNVHDVAEL-SKESFDACD  232

Query  413  AAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             ++   NI    PA+I L + G HY+ CT+  HC+ GQKL ++V
Sbjct  233  FSSTIGNIITTGPANITLATAGNHYYVCTIGSHCTSGQKLAISV  276



>ref|XP_011084101.1| PREDICTED: blue copper protein-like [Sesamum indicum]
Length=360

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M    +++  MT+ L+A+ N  +  T++ VGDS GW  P  G+  Y  WA    F  GD+
Sbjct  1    MEGRWKVVAFMTLVLAAMLNSSSAQTTHVVGDSLGWLVPPGGEVAYRTWAASRTFTVGDV  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF TG+H  A V +K  YDSCN+++  ++  N PA+I L + G H+F CT   HC  
Sbjct  61   LVFNFTTGIHDAAEV-SKTAYDSCNSSSPISMYTNGPATITLTTAGEHHFICTFNRHCDL  119

Query  509  GQKLTVNV  532
            GQKL +NV
Sbjct  120  GQKLAINV  127


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            AT++TVGD  GW  P  G   Y  WA    F+ GDILVFNF  G H V  V  + ++DSC
Sbjct  173  ATTFTVGDGLGWLVPPGGPIAYETWARGKPFMVGDILVFNFTNGAHDVVEV-TRAEFDSC  231

Query  410  N--AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            N           SPA I L S G HY+ CT   HC+ GQKL +NV
Sbjct  232  NVSTTTITPITTSPARITLTSAGDHYYICTFSQHCNFGQKLAINV  276



>gb|KCW80136.1| hypothetical protein EUGRSUZ_C01480 [Eucalyptus grandis]
Length=166

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+   TY+ WA+QH F  GDILVF+F++ 
Sbjct  10   LLGVVVAFLSCA---EATNYTVGGSEGWKIPSSA-GTYSDWASQHTFEVGDILVFDFDSS  65

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + V  V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  66   DNDVGDV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  124



>emb|CDO98154.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 73/122 (60%), Gaps = 7/122 (6%)
 Frame = +2

Query  185  LVVMTVFLSAVSNVDATS--YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNT  358
            +VV   F +A+    AT+  Y VGDS GW  P NG + YT WA+   F  GDILVFNF T
Sbjct  7    MVVFCAFSAAMLQQGATAEVYVVGDSIGWAIPQNGAAAYTNWASGKNFKVGDILVFNFVT  66

Query  359  GLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
              H V  V  K  YD+CN+ NA   +  N PA++ L+STG HYF CT   HC  GQKL +
Sbjct  67   NQHDVQQV-PKASYDACNSNNAIGGMITNGPANVTLSSTGAHYFICTFNGHCKAGQKLAI  125

Query  527  NV  532
            +V
Sbjct  126  SV  127



>gb|KHG26692.1| Blue copper [Gossypium arboreum]
Length=208

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 74/128 (58%), Gaps = 7/128 (5%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            KI   M  L VV+    + + + +  +YTVGDS+GW  P+N D  Y  WA+   FV GD+
Sbjct  4    KITMAMAALFVVLAA--NVLQSTNGATYTVGDSTGWKVPTNNDF-YDDWADNKIFVVGDV  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF TG H VA V  +  YD+CN AN  +  +  PA I LN TG  YF C    HCS 
Sbjct  61   LVFNFTTGQHDVAEV-TETAYDACNTANTISTVSTGPARITLNRTGDFYFICAFPGHCSG  119

Query  509  GQKLTVNV  532
            GQKL V V
Sbjct  120  GQKLNVEV  127



>ref|XP_010050033.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
 gb|KCW82870.1| hypothetical protein EUGRSUZ_C04239 [Eucalyptus grandis]
Length=193

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 81/124 (65%), Gaps = 6/124 (5%)
 Frame = +2

Query  176  MELLVVMTV-FLSAVSNVDATSYTVGDSSGW-NTPSNGDSTYTAWANQHQFVTGDILVFN  349
            + +LVVM V  L  + + +A +YTVG S+GW N  + G S Y++WA+ + F  GDILVFN
Sbjct  12   VRVLVVMAVELLVMLRSAEAATYTVGGSTGWTNVVNGGASFYSSWASGNTFNVGDILVFN  71

Query  350  FNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQGQKL  520
            F +G H VA V +++D+ SCN  +   +  N P + PLN+TG  YF CT   HCSQGQKL
Sbjct  72   FVSGQHDVAIV-SESDFSSCNTGSPITLLTNPPVNYPLNTTGTVYFICTHDSHCSQGQKL  130

Query  521  TVNV  532
            +V V
Sbjct  131  SVTV  134



>emb|CAJ77497.1| putative dicyanin blue copper protein precursor [Solanum tuberosum]
Length=160

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 76/129 (59%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV---SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA+ +  LVV    L A+    ++   ++ VGD+  W  P+ G ++Y+ WA    F  GD
Sbjct  1    MARKLSTLVVFGAILFALLQHVSMAQQTHVVGDTLNWTVPNGGAASYSTWAAGKTFAVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            I+VFNF TG H+VA V +K  +DSCN ++  +I  N P  I L S G HY+ CT   HC+
Sbjct  61   IIVFNFRTGSHSVAEV-SKGAFDSCNTSSPISISTNGPTDITLTSAGSHYYLCTFPSHCT  119

Query  506  QGQKLTVNV  532
             GQKL +NV
Sbjct  120  LGQKLAINV  128



>ref|XP_007013486.1| Copper binding protein 5, putative [Theobroma cacao]
 gb|EOY31105.1| Copper binding protein 5, putative [Theobroma cacao]
Length=254

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 75/129 (58%), Gaps = 6/129 (5%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAV-SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            + MA+ + +  +  V  + V  +  A +YTVG+S+GW  P N D  Y  W +   FV GD
Sbjct  82   RKMARQISIAALFVVLAAVVLQSTYAATYTVGNSTGWRIPPNTDF-YDNWTDDTNFVVGD  140

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANANI-QNNSPASIPLNSTGVHYFFCTV--HCS  505
            ILVF+F TG+H VA V  +  YD+C   NA   +   PA I LN+TG HYF CT   HC+
Sbjct  141  ILVFDFTTGIHDVAGV-TETAYDACTTTNAIFTETTGPARIRLNTTGEHYFICTFSNHCA  199

Query  506  QGQKLTVNV  532
             GQKL V V
Sbjct  200  SGQKLKVEV  208



>ref|XP_007155023.1| hypothetical protein PHAVU_003G166700g [Phaseolus vulgaris]
 gb|ESW27017.1| hypothetical protein PHAVU_003G166700g [Phaseolus vulgaris]
Length=344

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 74/126 (59%), Gaps = 5/126 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA+ +  LV+  V      +   T + VGDS+GW  PS G +TYT WA+   F  GD LV
Sbjct  1    MARSL-FLVLFAVATLLHGSAAQTRHVVGDSTGWTIPSGGAATYTTWASDKTFTVGDTLV  59

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNS-PASIPLNSTGVHYFFCT--VHCSQGQ  514
            FNF  G H VA V  K+ YD+CNAA       S PAS+ LN +G  Y+ C+   HCS GQ
Sbjct  60   FNFTNGRHDVAKV-TKSAYDACNAATTLFTLTSGPASVVLNQSGEQYYICSFGTHCSLGQ  118

Query  515  KLTVNV  532
            KLT+NV
Sbjct  119  KLTINV  124


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            ++TVGD+SGW  PSNG + YT+WA+   F  GDILVFN+ +  H V  V  +N +DSCN+
Sbjct  177  TFTVGDTSGWIVPSNGAAAYTSWASGKTFKVGDILVFNYQSNTHNVEEVTKEN-FDSCNS  235

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +        PA + L  +G HYF C    HC  GQKL +NV
Sbjct  236  TSPLKTYTTPPARVTLTKSGAHYFICGFQGHCPAGQKLAINV  277



>gb|KHG03442.1| Blue copper [Gossypium arboreum]
Length=167

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 67/122 (55%), Gaps = 4/122 (3%)
 Frame = +2

Query  176  MELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFN  355
            M +  V  V  S ++   +T+YTVGDS+GW  P++  + Y  WA+   FV GD L+FNF 
Sbjct  7    MAMAAVFVVLASTLTTYASTTYTVGDSTGWQVPTSNSNLYDDWADNKTFVVGDDLLFNFI  66

Query  356  TGLHTVATVNNKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
            TG H VA V     YD+C N    +  N  P  I L  TG HYF CT   HC  GQKL V
Sbjct  67   TGEHDVAEVTEPG-YDACTNTDTISTDNKGPVKITLKRTGDHYFICTYAGHCPAGQKLKV  125

Query  527  NV  532
             V
Sbjct  126  QV  127



>ref|XP_010050032.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
Length=177

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            L VV+      + +V+ATSY VG S+GW+TP+NG S Y++W +   F  GD LVFNF  G
Sbjct  15   LAVVVVEIWWMLRSVEATSYVVGGSTGWSTPANGASFYSSWESGITFRVGDDLVFNFIDG  74

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQGQKLTVNV  532
             H+VA V +++DY++CN A+   + +NSP +  LN+T   YF CT   HC QGQKL V V
Sbjct  75   QHSVAVV-SQSDYNNCNTASPIQLFSNSPVNYMLNTTATIYFICTHDSHCLQGQKLAVTV  133



>ref|XP_010048057.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
Length=176

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+  S Y+ WA+QH F  GDILVF+F++ 
Sbjct  10   LLGVVVAFLSCT---EATNYTVGGSEGWKIPSSAGS-YSDWASQHTFEVGDILVFDFDSS  65

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + V  V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  66   DNDVGDV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  124



>ref|NP_001234429.1| dicyanin precursor [Solanum lycopersicum]
 gb|AAF66242.1|AF243180_1 dicyanin [Solanum lycopersicum]
Length=332

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 79/129 (61%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSN---VDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA+ +  LVV    L A+     +   ++ VGD+ GW  P+ G ++Y+ WA    FV GD
Sbjct  1    MARKLSSLVVFGSILFALLQHVAMAQQTHVVGDTLGWTVPNGGAASYSTWAAGKSFVVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            ILVFNF +G H+VA V +K  +DSCN ++  +I  N P +I L+S G HY+ CT   HC+
Sbjct  61   ILVFNFRSGSHSVAEV-SKGAFDSCNTSSPISISTNGPTNITLSSAGSHYYLCTFPSHCT  119

Query  506  QGQKLTVNV  532
             GQKL +NV
Sbjct  120  LGQKLAINV  128


 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 66/104 (63%), Gaps = 4/104 (4%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A +Y VGD+ GW+ P++G ++Y  WAN   F  GD LVFNF  G H VA V +K  YDSC
Sbjct  170  AQTYIVGDNLGWSVPTSGPNSYQRWANNKSFKVGDTLVFNFVNGTHNVAMV-SKASYDSC  228

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            N  +  N  +N PA I L ++G HY+ CT   HCS GQKL +NV
Sbjct  229  NTTSPINTISNGPARIRLTNSGEHYYMCTFPRHCSLGQKLAINV  272



>gb|KCW80159.1| hypothetical protein EUGRSUZ_C01507 [Eucalyptus grandis]
Length=173

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+  S Y+ WA+QH F  GDILVF+F++ 
Sbjct  10   LLGVVVAFLSCT---EATNYTVGGSEGWKIPSSAGS-YSDWASQHTFEVGDILVFDFDSS  65

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + V  V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  66   DNDVGDV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  124



>ref|XP_010541720.1| PREDICTED: umecyanin-like [Tarenaya hassleriana]
Length=180

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA++ E+ +       A++   A  Y VGD + W  PS  D  YT WA    F  GDIL 
Sbjct  1    MARIFEISIFCVAIFVAMAV--AEDYDVGDDTEWTRPSTAD-FYTRWAAGKTFRLGDILE  57

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            F F  G+H VA VN K  YD+CN AN   +    P  + LN+TG HYF CTV  HC+ GQ
Sbjct  58   FEFREGMHDVAIVN-KEGYDNCNKANPMTLFQKPPVKVTLNTTGTHYFICTVGDHCTVGQ  116

Query  515  KLTVNV  532
            KL V +
Sbjct  117  KLAVTI  122



>ref|XP_010050043.1| PREDICTED: early nodulin-like protein 2 [Eucalyptus grandis]
Length=322

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 76/127 (60%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            MA+ M +LV+M    +A+ +  A T++ VGDS GW  P  G   Y+ WA    FV GD L
Sbjct  1    MARGMNMLVLMVFLGAAIQSCSAQTTHVVGDSLGWVVPPGGAIAYSTWAANETFVVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VFNF TG+  VA V  K  YDSCN+ +  ++  N PA+I LN +G H+F  T    CS G
Sbjct  61   VFNFTTGMDDVAKV-TKAAYDSCNSTSPISLWTNGPATITLNQSGEHFFISTFDRRCSLG  119

Query  512  QKLTVNV  532
            +KL +NV
Sbjct  120  EKLAINV  126


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 54/102 (53%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD  GWN   N    Y  WA    F+ GD LVFNF  G   VA V  K+ YDSCN 
Sbjct  160  TYTVGDVVGWNVLVNTTQAYALWAANKTFMVGDTLVFNFVNGTQNVAEV-TKSAYDSCNT  218

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +  ++    P  I L + G H++  T    CS GQKL +NV
Sbjct  219  TSTISVYTVPPVKIILAAPGEHFYTSTYPDRCSLGQKLAINV  260



>ref|XP_003609366.1| Blue copper protein [Medicago truncatula]
 gb|AES91563.1| plastocyanin-like domain protein [Medicago truncatula]
Length=370

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNV-----DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVT  328
            MAK   +LV   V L+  +N+       T + VGD++GW  P+NG S YT WA+   F  
Sbjct  1    MAKNFNVLVF--VLLAVAANLFHGSFAQTRHVVGDTTGWTIPTNGASFYTNWASNKTFTV  58

Query  329  GDILVFNFNTGLHTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--H  499
            GD LVFN+ +G H VA V  K  YDSCN AN      NSPA++ LN TG   F C V  H
Sbjct  59   GDTLVFNYASGQHDVAKV-TKTAYDSCNGANTLFTLTNSPATVTLNETGQQNFICAVPGH  117

Query  500  CSQGQKLTVNV  532
            CS GQKL++NV
Sbjct  118  CSAGQKLSINV  128


 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD+ GW  PSNG + YT WA+   F  GDILVFNF    H V  V  K  YDSCN+
Sbjct  190  TYTVGDTIGWIIPSNGTAAYTTWASGKSFKVGDILVFNFQLNAHNVEEV-TKEKYDSCNS  248

Query  416  ANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +     +N P  + LN TG HY+ C V  HCS GQKL++NV
Sbjct  249  TSPIATFSNPPVRVTLNKTGTHYYICGVPGHCSAGQKLSINV  290



>ref|XP_007157642.1| hypothetical protein PHAVU_002G086900g [Phaseolus vulgaris]
 gb|ESW29636.1| hypothetical protein PHAVU_002G086900g [Phaseolus vulgaris]
Length=205

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 76/123 (62%), Gaps = 5/123 (4%)
 Frame = +2

Query  176  MELLVVMTVFLSAVSNVDATSYTVGDSSGW-NTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            M +LV + V  + +   +A  YTVG+++GW + P+ G S Y+ WA+   F  GDILVF F
Sbjct  7    MVILVAIAVSATILKATEAAEYTVGNTTGWISGPTGGASFYSDWASGITFKEGDILVFTF  66

Query  353  NTGLHTVATVNNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
            +   HTVA +N+K  +D C+   N  +   SPA I LN TG  YF CT+  HCS GQKL+
Sbjct  67   SAS-HTVAELNDKASFDGCSVNQNKEVITTSPARITLNRTGEFYFACTIQGHCSSGQKLS  125

Query  524  VNV  532
            V+V
Sbjct  126  VSV  128



>ref|XP_010042302.1| PREDICTED: stellacyanin-like [Eucalyptus grandis]
Length=194

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD+ GW  P+ G + Y AWAN   F  GDILVFNFN G H VA V  +  ++SC+ 
Sbjct  41   TYTVGDAMGWTIPAGGAAAYEAWANSQIFEVGDILVFNFNDGAHDVAEV-TETAFNSCDG  99

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             N  +I    PA I L + G H+F CTV  HCS GQK+ +NV
Sbjct  100  TNTLSISTVPPARITLATAGQHFFICTVPGHCSSGQKVAINV  141



>ref|XP_007155014.1| hypothetical protein PHAVU_003G165800g [Phaseolus vulgaris]
 gb|ESW27008.1| hypothetical protein PHAVU_003G165800g [Phaseolus vulgaris]
Length=333

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 74/126 (59%), Gaps = 5/126 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA+ +  LV+  V      +   T + VGDS+GW  PS G +TYT WA+   F  GD LV
Sbjct  1    MARSL-FLVLFAVATLLHGSAAQTRHVVGDSTGWTIPSGGAATYTTWASDKTFTVGDTLV  59

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNS-PASIPLNSTGVHYFFCT--VHCSQGQ  514
            FNF  G H VA V  K+ YD+CNAA       S PAS+ LN +G  Y+ C+   HCS GQ
Sbjct  60   FNFTNGRHDVAKV-TKSAYDACNAATTLFTLTSGPASVMLNQSGEQYYICSFGTHCSLGQ  118

Query  515  KLTVNV  532
            KLT++V
Sbjct  119  KLTIDV  124


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            ++TVGD+ GW  P+NG + Y +WA+   F  GDILVFN+ +  H V  V  +N +DSCN+
Sbjct  167  TFTVGDTLGWTVPANGAAAYASWASGKTFKVGDILVFNYQSNTHNVEEVTKEN-FDSCNS  225

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +        PA + L  +G HYF C    HC  GQKL +NV
Sbjct  226  TSPLATYTTPPARVTLTKSGAHYFICGFQGHCPAGQKLAINV  267



>ref|XP_010048016.1| PREDICTED: blue copper protein-like [Eucalyptus grandis]
Length=279

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD+ GW  P+ G + Y AWAN   F  GDILVFNFN G H VA V  +  + SC+ 
Sbjct  41   TYTVGDAMGWTIPAGGAAAYEAWANSQIFEVGDILVFNFNDGAHDVAEV-TETAFSSCDR  99

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             N  +I    PA I L + G H+F CTV  HCS GQK+ +NV
Sbjct  100  TNTLSISTVPPARITLATAGQHFFICTVPGHCSLGQKVAINV  141



>ref|XP_008362898.1| PREDICTED: mavicyanin-like [Malus domestica]
Length=195

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 73/126 (58%), Gaps = 5/126 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M   +   VV+T         +A ++TVGD++GW    + D TY++WA +H F  GD LV
Sbjct  5    MLGFVTAFVVITAAALITQRAEAETHTVGDATGWTNIVDSD-TYSSWAAKHTFKVGDTLV  63

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFC--TVHCSQGQ  514
            F F TG H VAT+  K  YD CN  +   + N  PAS  LN TG +YF C  T HCS+GQ
Sbjct  64   FQFTTGRHDVATL-TKTAYDECNNTDILGVLNQGPASYSLNKTGDYYFICSFTGHCSEGQ  122

Query  515  KLTVNV  532
            KL++ V
Sbjct  123  KLSIKV  128



>ref|XP_011017785.1| PREDICTED: cucumber peeling cupredoxin-like [Populus euphratica]
Length=246

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            S+   ++YTVGD++GW  PS G + YT WA    F  GDILVFNF    H VA V  K D
Sbjct  21   SSAAQSTYTVGDTTGWTIPSTGSAFYTTWAASKNFSVGDILVFNFAASAHDVAKV-TKAD  79

Query  398  YDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            YD+C  ++  ++    PA I +N++G HYF C    HCS GQKL +NV
Sbjct  80   YDACTTSSPISLTTTPPARITINASGDHYFLCNFPGHCSSGQKLMINV  127



>ref|XP_010047948.1| PREDICTED: blue copper protein-like [Eucalyptus grandis]
Length=279

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD+ GW  P+ G + Y AWAN   F  GDILVFNFN G H VA V  +  ++SC+ 
Sbjct  41   TYTVGDAMGWTIPAGGAAAYEAWANSQIFEVGDILVFNFNDGAHDVAEV-TETAFNSCDG  99

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             N  +I    PA I L + G H+F CTV  HCS GQK+ +NV
Sbjct  100  TNTLSISTVPPARITLATAGQHFFICTVPGHCSLGQKVVINV  141



>ref|XP_010048017.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
Length=180

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+  + Y+ WA+QH F  GD+LVF+F++ 
Sbjct  10   LLGVVVAFLSCA---EATNYTVGGSEGWKIPSSAGA-YSDWASQHTFEVGDVLVFDFDSS  65

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + VA V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  66   NNHVADV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  124



>ref|XP_006358288.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=332

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV---SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA+ +  LVV    L A+    ++   ++ VGD+  W  P+ G ++Y+ WA    F  GD
Sbjct  1    MARKLSTLVVFGAILFALLQHVSMAQQTHVVGDTLAWTVPNGGAASYSTWAAGKSFAVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            ILVFNF TG H+VA V +K  +DSCN ++  +I  N P +I L S G HY+ CT   HC+
Sbjct  61   ILVFNFRTGSHSVAEV-SKGAFDSCNTSSPISISTNGPTNITLTSVGSHYYLCTFPSHCT  119

Query  506  QGQKLTVNV  532
             GQKL +NV
Sbjct  120  LGQKLAINV  128


 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A +Y VGD+ GW+ P++G + Y  WAN   F  GD LVFNF  G H VA V +K  YDSC
Sbjct  170  AQTYIVGDNLGWSVPTSGPNAYQRWANGKSFKVGDTLVFNFVNGTHNVAMV-SKASYDSC  228

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            N  +  N  +N PA I L ++G HY+ CT   HCS GQKL +NV
Sbjct  229  NTTSPINTISNGPARIRLTNSGEHYYMCTFPRHCSLGQKLAINV  272



>ref|XP_008242795.1| PREDICTED: cucumber peeling cupredoxin-like [Prunus mume]
Length=242

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  176  MELLVVMTVFLSAVSNVDAT-SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            M   V M      +++V A  +Y VGD+ GW  P  G  TY  WA+   F  GD+LVF F
Sbjct  7    MAFFVAMAALALVMNSVGAANTYEVGDALGWTVPPAG--TYATWASNKTFTVGDVLVFKF  64

Query  353  NTGLHTVATVNNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
            +TG H VA V  K  YDSCNA +  +I  N PA++ LNS+G HY+ CT   HC  GQKL+
Sbjct  65   STGNHDVAEV-TKASYDSCNANSPISIATNGPANLTLNSSGEHYYICTFGGHCIGGQKLS  123

Query  524  VNV  532
            +NV
Sbjct  124  INV  126



>ref|XP_010048045.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
Length=179

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+    Y+ WA+QH F  GD+LVF+F++ 
Sbjct  10   LLGVVVAFLSCA---EATNYTVGGSEGWKIPSS-TGAYSDWASQHTFEVGDVLVFDFDSS  65

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + VA V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  66   NNDVADV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  124



>gb|KCW80120.1| hypothetical protein EUGRSUZ_C01450, partial [Eucalyptus grandis]
Length=172

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+  + Y+ WA+QH F  GD+LVF+F++ 
Sbjct  2    LLGVVVAFLSCA---EATNYTVGGSEGWKIPSSAGA-YSDWASQHTFEVGDVLVFDFDSS  57

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + VA V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  58   NNHVADV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  116



>ref|XP_008344079.1| PREDICTED: umecyanin-like [Malus domestica]
Length=208

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 73/126 (58%), Gaps = 5/126 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M   +   VV+T         +A ++TVGD++GW    + D TY++WA +H F  GD LV
Sbjct  5    MLGFVTAFVVITAAALITQRAEAETHTVGDATGWTNIVDSD-TYSSWAAKHTFKVGDTLV  63

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFC--TVHCSQGQ  514
            F F TG H VAT+  K  YD CN  +   + N  PAS  LN TG +YF C  T HCS+GQ
Sbjct  64   FQFTTGRHDVATL-TKTAYDECNNTDILGVLNQGPASYSLNKTGDYYFICSFTGHCSEGQ  122

Query  515  KLTVNV  532
            KL++ V
Sbjct  123  KLSIKV  128



>ref|XP_010254442.1| PREDICTED: blue copper protein [Nelumbo nucifera]
Length=317

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 8/130 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV---SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA  + L   + V ++ +   S    T++ VGD+ GW  P  G   Y+ WA+   F  GD
Sbjct  1    MATRVGLFACILVAVTGLLLQSAAAQTTHVVGDTLGWTIPPGGSIAYSTWASTRTFRVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HC  502
            IL FNF +G+H VA V  K  +DSCN+++   ++Q+ SP  I LNSTG H++ CT   HC
Sbjct  61   ILEFNFTSGVHDVAQV-TKEAFDSCNSSSPIGSVQSTSPVRIILNSTGEHFYICTFIQHC  119

Query  503  SQGQKLTVNV  532
            + GQKL +NV
Sbjct  120  ALGQKLAINV  129


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGDS GW  P  G   Y+ WA++  F+ GD L+FNF T  H VA V  K  +D+C+A
Sbjct  145  TYVVGDSLGWLVPPGGSIAYSTWASEKTFMVGDTLLFNFTTAQHDVAEV-TKTAFDNCDA  203

Query  416  AN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            ++    +Q+N PA + L S G H++ CT   HC+ GQKL +NV
Sbjct  204  SSTIGPVQSNGPARLSLTSVGQHFYICTFSQHCALGQKLAINV  246



>ref|XP_002308977.2| hypothetical protein POPTR_0006s06650g [Populus trichocarpa]
 gb|EEE92500.2| hypothetical protein POPTR_0006s06650g [Populus trichocarpa]
Length=163

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 77/126 (61%), Gaps = 10/126 (8%)
 Frame = +2

Query  176  MELLVVMTVFLSAVSNV----DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M  L+V  V L AVS +    +A  + VGD++GW +PS+  S Y+ WA+   F  GD L 
Sbjct  1    MRSLIVFVV-LGAVSLLLRGSEAVDHEVGDTTGWKSPSS-TSFYSDWASGKTFALGDTLK  58

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            F F TG H VATV +K+DYD+CN  +  N+    PA+I LN TG  YF CT+  HCS GQ
Sbjct  59   FTFTTGAHDVATV-SKSDYDNCNTGSQNNLLTTGPATITLNVTGDMYFLCTIAGHCSAGQ  117

Query  515  KLTVNV  532
            KL + V
Sbjct  118  KLAITV  123



>gb|KCW79988.1| hypothetical protein EUGRSUZ_C01322 [Eucalyptus grandis]
Length=173

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+  + Y+ WA+QH F  GD+LVF+F++ 
Sbjct  10   LLGVVVAFLSCA---EATNYTVGGSEGWKIPSSTGA-YSDWASQHTFEVGDVLVFDFDSS  65

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + VA V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  66   NNDVADV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  124



>ref|XP_010051537.1| PREDICTED: blue copper protein-like [Eucalyptus grandis]
Length=273

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD+ GW  P+ G + Y AWAN   F  GDILVFNFN G H VA V  +  + SC+ 
Sbjct  35   TYTVGDAMGWTIPAGGVAAYEAWANSQIFEVGDILVFNFNDGAHDVAEV-TETAFSSCDG  93

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             N  +I    PA I L + G H+F CTV  HCS GQK+ +NV
Sbjct  94   TNTLSISTVPPARITLATAGQHFFICTVPGHCSSGQKVAINV  135



>gb|KHG25750.1| Blue copper -like protein [Gossypium arboreum]
Length=167

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            KI++ M  LLVV+    S + +  A +YTVGD++GW  P+N    Y  W +   FV GDI
Sbjct  4    KIIS-MAALLVVLAS--SVLQSTYAATYTVGDTTGWTIPNNNPEFYDNWTDNKNFVVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQ  508
            LVFNF TG H VA V N+  YD+C   N  ++    PA++ LN TG ++F CT   HC  
Sbjct  61   LVFNFTTGQHDVAEV-NETAYDNCITTNPIVRYTTGPANVTLNRTGEYHFICTFAGHCGI  119

Query  509  GQKLTVNV  532
            GQKL+++V
Sbjct  120  GQKLSIDV  127



>ref|XP_007155024.1| hypothetical protein PHAVU_003G166800g [Phaseolus vulgaris]
 gb|ESW27018.1| hypothetical protein PHAVU_003G166800g [Phaseolus vulgaris]
Length=331

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 75/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  164  MAK--MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+   + L  V T+   + +    T + VGDS+GW  PS+G +TYT WA+   F  GD 
Sbjct  1    MARSFFLVLFAVATLLHGSAAQ---TRHMVGDSTGWTIPSDGAATYTTWASDKTFTLGDT  57

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANANIQNNS-PASIPLNSTGVHYFFCT--VHCSQ  508
            LVFNF  G H VA V  K+ YD+CN A       S PAS+ LN +G  Y+ C+   HCS 
Sbjct  58   LVFNFTNGRHDVAKV-TKSAYDACNGATTLFTLTSGPASVVLNQSGEQYYICSFGTHCSL  116

Query  509  GQKLTVNV  532
            GQKLT+NV
Sbjct  117  GQKLTINV  124


 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +2

Query  221  NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
            + +  ++TVGD+ GW  P+NG + Y +WA+   F  GDILVFN+ +  H V  V  +N +
Sbjct  162  SAEPVTFTVGDTLGWTVPANGATAYASWASGKTFKVGDILVFNYQSNTHNVEEVTKEN-F  220

Query  401  DSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            DSCN+ +        PA + L  +G HYF C    HC  GQKL +NV
Sbjct  221  DSCNSTSPLATYTTPPARVTLTKSGAHYFICGFQGHCPAGQKLVINV  267



>ref|XP_004303303.1| PREDICTED: cucumber peeling cupredoxin-like [Fragaria vesca subsp. 
vesca]
Length=179

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 70/126 (56%), Gaps = 8/126 (6%)
 Frame = +2

Query  170  KMMELL-VVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVF  346
            KMM +  +V  VFL   S    T + VGDS GWN P NG   Y  WA+   FV GDIL F
Sbjct  6    KMMVVFGLVTAVFLQ--SAAAQTVHVVGDSVGWNIPQNGAQDYVTWASSQTFVVGDILSF  63

Query  347  NFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            NF T  H V  V  K  +DSC++ NA  +     PA++ L S G HY+ CTV  HC  GQ
Sbjct  64   NFATNAHDVVEV-PKASFDSCSSTNAIGSTVTTGPANVTLASAGEHYYICTVGSHCQSGQ  122

Query  515  KLTVNV  532
            KL + V
Sbjct  123  KLAITV  128



>ref|XP_004235961.1| PREDICTED: cucumber peeling cupredoxin-like [Solanum lycopersicum]
Length=184

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 74/129 (57%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M KM+ ++V   + ++++ +  A  T + VGD+ GW  PSNG   Y  WA+   F  GD 
Sbjct  1    MDKMLYMIVFSALAITSMVHDTAAQTVHVVGDTMGWIVPSNGAVAYENWADDKTFRVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCT--VHCS  505
            LVFNF TG H V  V  +  +D CN+ NA        PASI LNSTG HYF CT   HC 
Sbjct  61   LVFNFTTGRHDVLQV-QETSFDGCNSQNAIGTAIMTGPASITLNSTGDHYFICTFGTHCQ  119

Query  506  QGQKLTVNV  532
             GQKL ++V
Sbjct  120  GGQKLEISV  128



>ref|XP_002527192.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
 gb|EEF35205.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
Length=242

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T++ VG + GW  P  G + Y+ WA    F  GD+LVFNF   +H VA V +K DYD+C 
Sbjct  27   TTHVVGGAVGWTIPPGGATVYSTWAANQTFAAGDVLVFNFANNIHDVAKV-SKADYDACA  85

Query  413  AANA-NIQNNSPASIPLNSTGVHYFFC--TVHCSQGQKLTVNV  532
            +AN  ++   SPA I +N++G HYF C  T HCS GQKL +NV
Sbjct  86   SANPISLAITSPARITINASGEHYFICNFTGHCSAGQKLMINV  128



>ref|XP_010050635.1| PREDICTED: blue copper protein-like [Eucalyptus grandis]
Length=279

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD+ GW  P+ G   Y AWAN   F  GDILVFNFN G H VA V  +  ++SC+ 
Sbjct  41   TYTVGDAMGWTIPAGGAVAYEAWANSQIFEVGDILVFNFNDGAHDVAEV-TETAFNSCDG  99

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             N  +I    PA I L + G H+F CTV  HCS GQK+ +NV
Sbjct  100  TNTLSISTVPPARITLATAGQHFFICTVPGHCSLGQKVAINV  141



>ref|XP_010040578.1| PREDICTED: mucin-5AC-like [Eucalyptus grandis]
Length=472

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 76/127 (60%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            MA+ M +LV+M +  +A+ +  A T++ VGDS GW  P  G   Y+ WA    FV GD L
Sbjct  1    MARGMNMLVLMVLLGAAIQSCSAQTTHVVGDSLGWVVPPGGAIAYSTWAANETFVVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VFNF TG+  VA V  K  YDSCN+ +   +  N PA+I LN +G H+F  T    CS G
Sbjct  61   VFNFTTGMDDVAKV-TKAAYDSCNSTSPISRWTNGPATITLNQSGEHFFISTFDRRCSLG  119

Query  512  QKLTVNV  532
            +KL +NV
Sbjct  120  EKLAINV  126


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 54/102 (53%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN-  412
            +YTVGD  GWN   N    Y  WA    F+ GDILVFNF  G   VA V  K+ +DSCN 
Sbjct  160  TYTVGDGVGWNVLVNTTQAYELWAANKTFMVGDILVFNFVNGTQNVAEV-TKSAFDSCNI  218

Query  413  AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +  ++    P  I L + G H++  T    CS GQKL + V
Sbjct  219  TSTISVYAVPPVRITLTTPGEHFYTSTYPNRCSLGQKLAITV  260


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 54/102 (53%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVG+  GWN   N    Y  WA    F+ GD LVFNF  G   VA V  K+ YDSCN 
Sbjct  298  TYTVGEGVGWNVLVNTTQAYALWAANKTFMVGDTLVFNFVNGTQNVAEV-TKSAYDSCNT  356

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +  ++    P  I L + G H++  T    CS GQKL +NV
Sbjct  357  TSTISVYTVPPVRIILATPGEHFYTSTYPDRCSLGQKLAINV  398



>ref|XP_007135755.1| hypothetical protein PHAVU_010G155900g [Phaseolus vulgaris]
 gb|ESW07749.1| hypothetical protein PHAVU_010G155900g [Phaseolus vulgaris]
Length=180

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = +2

Query  203  FLSAVSNVDATS-YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVAT  379
            FL +V N +A S + VGD++GW TP +  STY +WA+ + F  GDIL+FNF T  H V  
Sbjct  20   FLMSVQNTEAQSVFVVGDATGWTTPQD-SSTYQSWASDNTFAVGDILIFNFQTTQHNVVQ  78

Query  380  VNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            V+ ++ Y SC ++N    + N  P ++ LN TG HY+ C++  HC++GQKL +NV
Sbjct  79   VSEES-YTSCTSSNPIGTVYNTGPVNVTLNRTGQHYYICSIGQHCTRGQKLAINV  132



>ref|XP_003542629.1| PREDICTED: blue copper protein-like [Glycine max]
Length=336

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA+ + LLV+  V      +   T + VGD++GW  P+ G +TYTAWA+   F   D LV
Sbjct  1    MARNL-LLVLFAVATLLHGSAAQTRHMVGDATGWIIPAGGAATYTAWASNKTFTVNDTLV  59

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNS-PASIPLNSTGVHYFFCTV--HCSQGQ  514
            FNF TG H VA V  K+ +D+CN  +A     S PA++ LN TG  Y+ C+V  HCS GQ
Sbjct  60   FNFATGQHNVAKV-TKSAFDACNGGSAVFTLTSGPATVTLNETGEQYYICSVGSHCSAGQ  118

Query  515  KLTVNV  532
            KL +NV
Sbjct  119  KLAINV  124


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
            +  ++ VG+++GW  P N  S YTAWA+   F  GD+LVFN+ +  H V  V  K ++D+
Sbjct  177  EPATFIVGETAGWIVPGNA-SFYTAWASGKNFRVGDVLVFNYASNTHNVEEV-TKANFDA  234

Query  407  CNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            C++A+        PA + LN +G H+F C +  HC  GQKL +NV
Sbjct  235  CSSASPIATFTTPPARVTLNKSGQHFFICGIPGHCLGGQKLAINV  279



>ref|XP_010939704.1| PREDICTED: blue copper protein-like [Elaeis guineensis]
Length=176

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA    + +   + +S V+ V AT YTVGD+SGW +  +    Y+ W +   F  GD LV
Sbjct  1    MAGCTSITLGALILISCVTWVSATVYTVGDTSGWTSGVD----YSTWTSGKTFAAGDSLV  56

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            FN+ +G HTV  V++ +DYDSC+A+NA    +N P +I L + G HY+ C +  HCS G 
Sbjct  57   FNYASGAHTVTEVSS-SDYDSCSASNAITSDSNGPTTIQLKTPGTHYYICAIPGHCSGGM  115

Query  515  KLTVNV  532
            KL V V
Sbjct  116  KLAVAV  121



>gb|KCW45091.1| hypothetical protein EUGRSUZ_L01306 [Eucalyptus grandis]
Length=457

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 76/127 (60%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            MA+ M +LV+M +  +A+ +  A T++ VGDS GW  P  G   Y+ WA    FV GD L
Sbjct  1    MARGMNMLVLMVLLGAAIQSCSAQTTHVVGDSLGWVVPPGGAIAYSTWAANETFVVGDTL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VFNF TG+  VA V  K  YDSCN+ +  +   N PA+I LN +G H+F  T    CS G
Sbjct  61   VFNFTTGMDDVAKV-TKAAYDSCNSTSPISRWTNGPATITLNQSGEHFFISTFDRRCSLG  119

Query  512  QKLTVNV  532
            +KL +NV
Sbjct  120  EKLAINV  126


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 54/102 (53%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN-  412
            +YTVGD  GWN   N    Y  WA    F+ GDILVFNF  G   VA V  K+ +DSCN 
Sbjct  160  TYTVGDGVGWNVLVNTTQAYELWAANKTFMVGDILVFNFVNGTQNVAEV-TKSAFDSCNI  218

Query  413  AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +  ++    P  I L + G H++  T    CS GQKL + V
Sbjct  219  TSTISVYAVPPVRITLTTPGEHFYTSTYPNRCSLGQKLAITV  260


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN-  412
            +YTVG+  GWN   N    Y  WA    F+ GD LVFNF  G   VA V  K+ YDSCN 
Sbjct  298  TYTVGEGVGWNVLVNTTQAYALWAANKTFMVGDTLVFNFVNGTQNVAEV-TKSAYDSCNT  356

Query  413  AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVN  529
             +  ++    P  I L + G H++  T    CS GQKL +N
Sbjct  357  TSTISVYTVPPVRIILATPGEHFYTSTYPDRCSLGQKLAIN  397



>ref|XP_009364011.1| PREDICTED: mavicyanin-like [Pyrus x bretschneideri]
Length=197

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 74/130 (57%), Gaps = 8/130 (6%)
 Frame = +2

Query  161  IMAKMMEL---LVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTG  331
            ++ KM+      VV+T         +A ++TVGD++GW    + D TY++WA +H F  G
Sbjct  1    MVPKMLGFATAFVVITATALITQRAEAETHTVGDATGWTNIVDSD-TYSSWAAKHTFKVG  59

Query  332  DILVFNFNTGLHTVATVNNKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HC  502
            D LVF F TG H VAT+  K  YD C N     + N  PAS  LN TG +YF C    HC
Sbjct  60   DTLVFQFTTGRHDVATLTKKA-YDECSNTDILGVLNQGPASYSLNETGDYYFICAFPGHC  118

Query  503  SQGQKLTVNV  532
            S+GQKL++ V
Sbjct  119  SEGQKLSIKV  128



>ref|XP_006358287.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=332

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 76/129 (59%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV---SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA+    LVV    L A+    ++   ++ VGD+  W  P+ G ++Y+ WA    F  GD
Sbjct  1    MARKFSTLVVFGAILFALLQHVSMAQQTHVVGDTLAWTVPNGGAASYSTWAAGKTFAVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            +LVFNF TG H+VA V +K  +DSCN ++  +I  N P +I L S G HY+ CT   HC+
Sbjct  61   VLVFNFRTGSHSVAEV-SKGAFDSCNTSSPISISTNGPTNITLTSVGSHYYLCTFPSHCT  119

Query  506  QGQKLTVNV  532
             GQKL +NV
Sbjct  120  LGQKLAINV  128


 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A +Y VGD+ GW+ P++G + Y  WAN   F  GD LVFNF  G H VA V +K  YDSC
Sbjct  170  AQTYIVGDNLGWSVPTSGPNAYQRWANGKSFKVGDTLVFNFVNGTHNVAMV-SKASYDSC  228

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            N  +  N  +N PA I L ++G HY+ CT   HCS GQKL +NV
Sbjct  229  NTTSPINTISNGPARIRLTNSGEHYYMCTFPRHCSLGQKLAINV  272



>ref|XP_010250147.1| PREDICTED: cucumber peeling cupredoxin-like [Nelumbo nucifera]
Length=255

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 79/127 (62%), Gaps = 8/127 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M+K+  L+V++   L    +   T+Y VG+S+GW  PS+  +TY  WA+  +F+ GDIL 
Sbjct  5    MSKVGFLIVLVASLLR--YSAAQTTYVVGNSTGWTVPSD-TATYANWASSIKFMVGDILT  61

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            FNF TG H VA V  K +YD+C + +   +I    PA+I L+S G HYF CT+  HC+ G
Sbjct  62   FNFPTGEHDVAKV-TKTEYDACTSQSPIGSILTTGPANITLDSQGDHYFICTIGRHCANG  120

Query  512  QKLTVNV  532
            QKL + V
Sbjct  121  QKLAITV  127



>gb|ACL51760.1| putative phytocyanin [Pinus pinaster]
Length=202

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (59%), Gaps = 6/123 (5%)
 Frame = +2

Query  179  ELLVVM--TVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            ++LV +   + L+ + +V AT+YTVG S+GW  P++    YT W     F  GDILVF F
Sbjct  7    QVLVALGACLALAVLQSVAATTYTVGGSAGWTIPASNAKLYTDWVKATTFKLGDILVFKF  66

Query  353  NTGLHTVATVNNKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
             T +H V  V +K DYD C   +        PASI LNSTG HY+ C V  HC+ GQK++
Sbjct  67   ATNVHNVYRV-SKADYDKCVTTSPMEKYETGPASITLNSTGHHYYICAVSGHCAAGQKVS  125

Query  524  VNV  532
            + V
Sbjct  126  IKV  128



>ref|XP_002527195.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
 gb|EEF35208.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
Length=190

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 75/131 (57%), Gaps = 10/131 (8%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNV-----DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVT  328
            MAK M + V + +    +  V     +A  + VGD+ GW  P N  + Y  WA    F  
Sbjct  1    MAKTMSMKVAVALLAIVIGGVAFQSAEAVVHVVGDALGWQNPPN-STYYAEWAAARNFTI  59

Query  329  GDILVFNFNTGLHTVATVNNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--H  499
            GD LVFNF TG H VATV   +DY  C+  ++ N++N+ PA+I L + G+ Y+ CT   H
Sbjct  60   GDSLVFNFATGAHNVATV-TLDDYSDCDTDSSLNLRNSGPATINLTANGMQYYICTFSGH  118

Query  500  CSQGQKLTVNV  532
            CS+GQKL +NV
Sbjct  119  CSRGQKLAINV  129



>emb|CAN60010.1| hypothetical protein VITISV_018635 [Vitis vinifera]
Length=153

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = +2

Query  164  MAKMMEL---LVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA  +E+   L+V+ V L   +  D  ++ VG +  W+ P+ G+S YT WA+   F  GD
Sbjct  1    MAARVEIIGCLIVVAVLLQGAAAAD--THHVGGNISWSIPTEGESAYTTWASGEDFKLGD  58

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA---NIQNNSPASIPLNSTGVHYFFCTV--H  499
             +VFN+ TG HTVA V +K+ YD+C  AN    +IQ  SP +  LNST   YF CT+  H
Sbjct  59   TIVFNW-TGTHTVARV-SKDVYDNCTTANVLANDIQATSPVNYTLNSTEPQYFICTIGRH  116

Query  500  CSQGQKLTVNV  532
            CS GQK+T+++
Sbjct  117  CSLGQKVTISI  127



>gb|KCW80147.1| hypothetical protein EUGRSUZ_C01491 [Eucalyptus grandis]
Length=251

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL V+  FLS     +AT+YTVG S GW  PS+    Y+ WA+QH F  GD+LVF+F++ 
Sbjct  10   LLGVVVAFLSCA---EATNYTVGGSEGWKIPSST-GAYSDWASQHTFEVGDVLVFDFDSS  65

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + VA V  K DYD+CN  +   + + SPA+  L++ G +YF CT   HCSQGQKL + V
Sbjct  66   NNDVADV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYFLCTTAGHCSQGQKLAITV  124



>gb|KHN21265.1| Blue copper protein [Glycine soja]
Length=201

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 74/122 (61%), Gaps = 5/122 (4%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNT-PSNGDSTYTAWANQHQFVTGDILVFN  349
            +M +L+V+ V  + + +  A  YTVGD++GW + P  G S Y+ WA+   F  GDILVF 
Sbjct  7    IMVILIVIAVAATMLKSTKAAEYTVGDNTGWTSAPPGGASFYSDWASNITFREGDILVFT  66

Query  350  FNTGLHTVATVNNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            F T  HTVA + ++  +D C+   N  +   SPA I LN TG  YF CT+  HC+ GQKL
Sbjct  67   F-TASHTVAELTDRASFDGCSVNQNQGVITTSPARITLNRTGDFYFACTIQGHCNSGQKL  125

Query  521  TV  526
            ++
Sbjct  126  SI  127



>ref|XP_002285305.1| PREDICTED: umecyanin [Vitis vinifera]
 emb|CBI28218.3| unnamed protein product [Vitis vinifera]
Length=153

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = +2

Query  164  MAKMMEL---LVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA  +E+   L+V+ V L   +  D  ++ VG +  W+ P+ G+S YT WA+   F  GD
Sbjct  1    MAARVEIIGCLIVVAVLLQGAAAAD--THHVGGNISWSIPTEGESAYTTWASGEDFKLGD  58

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA---NIQNNSPASIPLNSTGVHYFFCTV--H  499
             +VFN+ TG HTVA V +K+ YD+C  AN    +IQ  SP +  LNST   YF CT+  H
Sbjct  59   TIVFNW-TGTHTVARV-SKDVYDNCTTANVLDNDIQATSPVNYTLNSTEPQYFICTIGRH  116

Query  500  CSQGQKLTVNV  532
            CS GQK+T+++
Sbjct  117  CSLGQKVTISI  127



>ref|XP_003527180.1| PREDICTED: blue copper protein-like [Glycine max]
Length=201

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 74/122 (61%), Gaps = 5/122 (4%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNT-PSNGDSTYTAWANQHQFVTGDILVFN  349
            +M +L+V+ V  + + +  A  YTVGD++GW + P  G S Y+ WA+   F  GDILVF 
Sbjct  7    IMVILIVIAVAATMLKSTKAAEYTVGDNTGWTSAPPGGASFYSDWASNITFREGDILVFT  66

Query  350  FNTGLHTVATVNNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            F T  HTVA + ++  +D C+   N  +   SPA I LN TG  YF CT+  HC+ GQKL
Sbjct  67   F-TASHTVAELTDRASFDGCSVNQNQGVITTSPARITLNRTGDFYFACTIQGHCNSGQKL  125

Query  521  TV  526
            ++
Sbjct  126  SI  127



>ref|XP_006364216.1| PREDICTED: cucumber peeling cupredoxin-like [Solanum tuberosum]
Length=201

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 11/129 (9%)
 Frame = +2

Query  176  MELLVVMTVF-LSAVSNV--DATSYTV---GDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M+ ++ M VF + AV+++  DAT+ TV   GD+ GW  PSNG + YT WA    F  GD 
Sbjct  1    MDKMLCMMVFGVLAVASMMQDATAQTVHVVGDTMGWIIPSNGTAAYTNWAAGKTFSVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCT--VHCS  505
            LVFNF T  H V  V  K  +D CN+ NA  N     PA++ LNSTG HY+ CT  +HC 
Sbjct  61   LVFNFTTDRHDVLQV-EKTSFDGCNSLNAIGNAIMTGPANMTLNSTGEHYYICTFGMHCL  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>ref|XP_006358285.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=237

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 77/127 (61%), Gaps = 5/127 (4%)
 Frame = +2

Query  161  IMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            ++ KM   LV+MT+      N+ A  + VGD+ GW  PS G +TY  WA+   F  GD L
Sbjct  1    MVTKMKIALVLMTILAVLPGNIVAVDHIVGDTMGWTIPS-GPTTYANWASGRTFRVGDTL  59

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VFNF TG H VA V  K+ YDSC++++   +    PA+I LNSTG  YF CT   HC+ G
Sbjct  60   VFNFATGAHDVAKV-TKSAYDSCSSSSPITLITVGPANITLNSTGSEYFICTFGQHCNAG  118

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  119  QKLAINV  125



>gb|ACL51761.1| putative phytocyanin [Pinus ponderosa]
Length=203

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (59%), Gaps = 6/123 (5%)
 Frame = +2

Query  179  ELLVVM--TVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            ++LV +   + L+ + +V ATSYTVG S+GW  P++    YT W     F  GDILVF F
Sbjct  7    QVLVALGACLALAVLQSVAATSYTVGGSTGWTIPASNAKLYTDWVKGTTFKLGDILVFKF  66

Query  353  NTGLHTVATVNNKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
             T +H V  V +K DYD C   +        PASI LN+TG HY+ C V  HC+ GQK++
Sbjct  67   ATNVHNVYRV-SKADYDKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVS  125

Query  524  VNV  532
            + V
Sbjct  126  IKV  128



>gb|ACL51762.1| putative phytocyanin [Pinus resinosa]
Length=203

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 66/112 (59%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  LSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVN  385
            L+ + +V AT+YTVG S+GW  P++    YT W     F  GDILVF F T +H V  V 
Sbjct  18   LAVLQSVAATTYTVGGSAGWTIPASNAKLYTDWVKATTFKLGDILVFKFATNVHNVYRV-  76

Query  386  NKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +K DYD C   +        PASI LN+TG HY+ C V  HC+ GQK+++ V
Sbjct  77   SKADYDKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVSIKV  128



>ref|XP_010050590.1| PREDICTED: blue copper protein-like [Eucalyptus grandis]
Length=267

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 71/129 (55%), Gaps = 8/129 (6%)
 Frame = +2

Query  164  MAKMMELLV---VMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            MA +M LL+   V T  L         +YTVGD  GW  P++G + Y AWA+ + F  GD
Sbjct  1    MAAIMALLLGSTVQTPALPPEHPKGTMTYTVGDVMGWTIPASGAAAYRAWASSNTFEVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            ILVFNFN G         +  + SC+ AN  +I    PA I L + G H+F CTV  HCS
Sbjct  61   ILVFNFNNGAQDAEV--TETAFSSCDGANPLSISTILPARIVLTTAGRHFFICTVPSHCS  118

Query  506  QGQKLTVNV  532
             GQK+ +NV
Sbjct  119  SGQKVAINV  127



>gb|ACL51759.1| putative phytocyanin [Pinus nigra]
Length=203

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  LSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVN  385
            L+ + +V AT+YTVG S+GW  P+     YT W     F  GDILVF F T +H V  V 
Sbjct  18   LAVLQSVAATTYTVGGSAGWTIPATNAKLYTDWVKATTFKLGDILVFKFATNVHNVYRV-  76

Query  386  NKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +K DYD C   +        PASI LN+TG HY+ C V  HC+ GQK+++ V
Sbjct  77   SKADYDKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVSIKV  128



>gb|ACJ70298.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70299.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70300.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70302.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70303.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70304.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70305.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70306.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70307.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70308.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70309.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70310.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70312.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70313.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70314.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70315.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70317.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70318.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70319.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70322.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70323.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70324.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70325.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70326.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70327.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70328.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70329.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70330.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70331.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70332.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70333.1| putative phytocyanin [Pinus sylvestris]
Length=203

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  LSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVN  385
            L+ + +V AT+YTVG S+GW  P+     YT W     F  GDILVF F T +H V  V 
Sbjct  18   LAVLQSVAATTYTVGGSAGWTIPATNAKLYTDWVKATTFKLGDILVFKFATNVHNVYRV-  76

Query  386  NKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +K DYD C   +        PASI LN+TG HY+ C V  HC+ GQK+++ V
Sbjct  77   SKADYDKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVSIKV  128



>gb|ACJ70301.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70320.1| putative phytocyanin [Pinus sylvestris]
 gb|ACJ70321.1| putative phytocyanin [Pinus sylvestris]
Length=203

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  LSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVN  385
            L+ + +V AT+YTVG S+GW  P+     YT W     F  GDILVF F T +H V  V 
Sbjct  18   LAVLQSVAATTYTVGGSAGWTIPATNAKLYTDWVKATTFKLGDILVFKFATNVHNVYRV-  76

Query  386  NKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +K DYD C   +        PASI LN+TG HY+ C V  HC+ GQK+++ V
Sbjct  77   SKADYDKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVSIKV  128



>gb|ACG40270.1| blue copper protein precursor [Zea mays]
Length=176

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 73/126 (58%), Gaps = 9/126 (7%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA     L+ + V +S+V+   AT++TVGDSSGW+   N    Y  WA+   F  GD LV
Sbjct  1    MAASRSALITLLVLVSSVAAASATTFTVGDSSGWSRSVN----YDNWASGKTFTDGDQLV  56

Query  344  FNFNTGLHTVATVNNKNDYDSCNAAN-ANIQNNSPASIPLNSTGVHYFFC--TVHCSQGQ  514
            FNF TG H V  V +K+ YD C+  N AN   N PA++ L S G HY+ C  T HCS G 
Sbjct  57   FNFATGNHDVVEV-DKSGYDGCSTTNAANTIQNGPATVNLTS-GTHYYICGFTGHCSAGM  114

Query  515  KLTVNV  532
            KL V V
Sbjct  115  KLAVTV  120



>ref|XP_008337273.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=374

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 68/104 (65%), Gaps = 4/104 (4%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            AT+Y VGD  GW+ PS G + YT WA+   F  GD LVF +++G H VA V  K  +D+C
Sbjct  26   ATTYQVGDGLGWSIPSGGAAAYTTWADNKTFTVGDTLVFTYSSGNHDVAEV-TKAAFDAC  84

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            NA N   ++  SP +I L+S+G HY+ CT   HCS GQKL+++V
Sbjct  85   NATNPITLETASPTNITLSSSGEHYYICTFSGHCSAGQKLSISV  128


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            ++TVG++SGW     G  +Y  WA    FV GD LVFN++ G H VA V  K +YDSCN 
Sbjct  198  TWTVGNNSGWTVLPPG--SYQTWAAXKTFVVGDTLVFNYSNGTHDVAVV-TKANYDSCNT  254

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            ++   +  N P  I LNSTG ++F CT   HC+ GQKL +NV
Sbjct  255  SSTLALFTNPPTRITLNSTGENFFICTFTGHCAGGQKLAINV  296



>ref|XP_011020150.1| PREDICTED: umecyanin-like [Populus euphratica]
Length=172

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 75/126 (60%), Gaps = 10/126 (8%)
 Frame = +2

Query  176  MELLVVMTVFLSAVSNV----DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M  L+V  V L AVS +    +A  + VGD++GW  P++  S Y+ W +   F  GD L 
Sbjct  1    MRSLIVFVV-LGAVSLLLRGSEAADHQVGDTTGWTRPTS-TSFYSDWVSGKTFALGDTLT  58

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANAN-IQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            F F TG+H VATV +K+DYD+CN  + N +    PA I LN TG  YF CT   HCS GQ
Sbjct  59   FTFTTGVHDVATV-SKSDYDNCNTGSPNSVVTTGPAKITLNVTGDSYFLCTFAGHCSAGQ  117

Query  515  KLTVNV  532
            KL +NV
Sbjct  118  KLAINV  123



>ref|XP_004235960.1| PREDICTED: cucumber peeling cupredoxin-like [Solanum lycopersicum]
Length=194

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNV--DATSYTV---GDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M +++ V+   + AV+N+  DAT+ TV   GD+  W  PSN  + YT WA    F  GDI
Sbjct  1    MYKMMCVIVFGVLAVANMMQDATAQTVHVVGDTMSWIVPSNSAAAYTNWAAGKTFSVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCT--VHCS  505
            LVFNF TG H V  V  K  +D CN+ NA  +     PA++ LNSTG HY+ CT  +HC 
Sbjct  61   LVFNFMTGRHDVLQV-EKTSFDGCNSQNAIGSAIMTGPANMTLNSTGEHYYICTFGMHCI  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>ref|NP_001130720.1| uncharacterized protein LOC100191824 precursor [Zea mays]
 gb|ACF79053.1| unknown [Zea mays]
 tpg|DAA47751.1| TPA: blue copper protein [Zea mays]
Length=178

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 73/126 (58%), Gaps = 9/126 (7%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA     L+ + V +S+V+   AT++TVGDSSGW+   N    Y  WA+   F  GD LV
Sbjct  1    MAASRSALITLLVLVSSVAAASATTFTVGDSSGWSRSVN----YDNWASGKTFTDGDQLV  56

Query  344  FNFNTGLHTVATVNNKNDYDSCNAAN-ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            FNF TG H V  V +K+ YD C+  N AN   N PA++ L S G HY+ C +  HCS G 
Sbjct  57   FNFATGNHDVVEV-DKSGYDGCSTTNAANTIQNGPATVNLTS-GTHYYICGISGHCSGGM  114

Query  515  KLTVNV  532
            KL V V
Sbjct  115  KLAVTV  120



>ref|XP_009368872.1| PREDICTED: blue copper protein-like [Pyrus x bretschneideri]
Length=219

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = +2

Query  170  KMMELLVVMTVFLSA---VSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            KM+  + V  V  +A   +   +A SYTVGD  GW    + + TY++WA  H F  GD L
Sbjct  4    KMLGYVTVFVVLAAAALVIERAEAESYTVGDDLGWTNIVDSN-TYSSWAANHTFKVGDTL  62

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VF F TG H VAT+  K  YD C+  +   + N  PAS  LN TG +YF CT+  HC+ G
Sbjct  63   VFQFLTGRHDVATLTKKA-YDECSTTDLLGVLNQGPASYNLNETGDYYFICTISGHCNDG  121

Query  512  QKLTVNV  532
            QKL++ V
Sbjct  122  QKLSIKV  128



>ref|XP_009368873.1| PREDICTED: umecyanin-like [Pyrus x bretschneideri]
Length=200

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T+Y VGD  GW+ PS G + YT WA+   F  GD LVFN+  G H VA V  K +YDSCN
Sbjct  27   TTYQVGDGLGWSVPSGGAAAYTTWADNKTFTVGDTLVFNYLNGSHDVAVVT-KANYDSCN  85

Query  413  -AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             ++   +  N P  I LNSTG ++F CT   HC+ GQKL +NV
Sbjct  86   TSSTLALFTNPPTRITLNSTGANFFICTFTGHCAGGQKLAINV  128



>ref|XP_006475877.1| PREDICTED: blue copper protein-like [Citrus sinensis]
Length=194

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 75/133 (56%), Gaps = 8/133 (6%)
 Frame = +2

Query  143  FEHH*KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQF  322
              H    MA+++  L      L   + VD     VG ++GW  P N ++ Y+ WA+ + F
Sbjct  1    MAHRNMNMAQLVMALAFAATLLHGTAAVD---LVVGGNTGWTIPPN-NTFYSNWASANTF  56

Query  323  VTGDILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV-  496
              GD LVFNF TG H + TV  +  YDSC+ ANA N   N PA + LN+TG HY+ C   
Sbjct  57   RIGDTLVFNFATGAHDL-TVVTRQAYDSCSTANAVNRITNGPARVRLNTTGQHYYICGFP  115

Query  497  -HCSQGQKLTVNV  532
             HC+ GQKLTVNV
Sbjct  116  GHCAAGQKLTVNV  128



>ref|XP_006450890.1| hypothetical protein CICLE_v10009575mg [Citrus clementina]
 gb|ESR64130.1| hypothetical protein CICLE_v10009575mg [Citrus clementina]
Length=194

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 74/126 (59%), Gaps = 8/126 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA+++  L      L   + VD     VG ++GW  P N ++ Y+ WA+ + F  GD LV
Sbjct  8    MAQLVMALAFAATLLHGTAAVD---LVVGGNTGWTIPPN-NTFYSNWASANTFRIGDTLV  63

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            FNF TG H + TV  +  YDSC+ ANA N   N PA + LN+TG HY+ C    HC+ GQ
Sbjct  64   FNFATGAHDL-TVVTRQAYDSCSTANAVNRITNGPARVRLNTTGQHYYICGFPGHCAAGQ  122

Query  515  KLTVNV  532
            KLTVNV
Sbjct  123  KLTVNV  128



>gb|ACJ70311.1| putative phytocyanin [Pinus sylvestris]
Length=203

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  LSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVN  385
            L+ + +V AT+YTVG S+GW  P+     YT W     F  GD+LVF F T +H V  V 
Sbjct  18   LAVLQSVAATTYTVGGSAGWTIPATNAKLYTDWVKATTFKLGDMLVFKFATNVHNVYRV-  76

Query  386  NKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +K DYD C   +        PASI LN+TG HY+ C V  HC+ GQK+++ V
Sbjct  77   SKADYDKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVSIKV  128



>gb|KDP30272.1| hypothetical protein JCGZ_17054 [Jatropha curcas]
Length=357

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 70/122 (57%), Gaps = 4/122 (3%)
 Frame = +2

Query  176  MELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFN  355
            M  L ++++     S+   T++ VG S GW  P  G S Y++WA    F  GDILVFNF 
Sbjct  1    MAFLALISIAALIHSSAAQTTHVVGGSLGWVIPPGGASAYSSWAANQTFAVGDILVFNFL  60

Query  356  TGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
               H V  V  K DYD+C+ +N  +  + SPA I +N TG HYFFC    HCS GQKL +
Sbjct  61   NNQHDVVKV-TKADYDACSTSNPISSVSTSPARITINETGGHYFFCNFNGHCSAGQKLMI  119

Query  527  NV  532
            NV
Sbjct  120  NV  121


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            ++TVGD+ GW   +N  + Y +WA+   F  GD+LVFN+  G H VA V  +N YDSCN 
Sbjct  205  TFTVGDTQGWAVVANAATFYQSWASNKTFNAGDVLVFNYPNGAHDVAEVTKEN-YDSCNT  263

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            AN  ++ +  P  I L + G H++ CTV  HC+ GQKL VNV
Sbjct  264  ANPISLSSTPPTRITLTA-GEHFYICTVPSHCTAGQKLAVNV  304



>ref|XP_007204490.1| hypothetical protein PRUPE_ppa019594mg, partial [Prunus persica]
 gb|EMJ05689.1| hypothetical protein PRUPE_ppa019594mg, partial [Prunus persica]
Length=151

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 62/117 (53%), Gaps = 3/117 (3%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            L++V+   +  +   +A  YTVGD  GW  P  G +TY +WA +H  V  DIL FNF  G
Sbjct  12   LVLVIAAAVFTLHGTEAAQYTVGDELGWTIPPGGAATYASWAAKHSLVVSDILTFNFAVG  71

Query  362  LHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
               +A V  K D+D+CN A        P      S G++Y  CT   HC++GQK+ +
Sbjct  72   EQDLALV-TKEDFDACNTAEPLFVFQEPGDFIFESEGMYYLTCTFAGHCAKGQKIAL  127



>ref|XP_002285304.1| PREDICTED: blue copper protein [Vitis vinifera]
Length=298

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T + VGDS GW  PS G  TY  WA    FV GD L FNF TG H VA V  K  + +CN
Sbjct  133  TEFIVGDSLGWTVPSGGAVTYQNWAANKTFVVGDSLKFNFTTGAHDVAEV-TKAAFTACN  191

Query  413  AANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              N  + +   PA I L++ G HYF CTV  HCS GQKL +NV
Sbjct  192  GTNPISHETEGPADIDLDTAGEHYFICTVGSHCSLGQKLAINV  234


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 62/104 (60%), Gaps = 4/104 (4%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A ++ VGD   W  PSNG   Y  WA    F+ GD+L F F TG H VA V  K  +D+C
Sbjct  24   AETHEVGDDLKWTVPSNGSVAYQNWAAGETFLVGDVLEFEFTTGAHDVAKV-TKTAFDAC  82

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            N+ N  + +   PA+  L+++G HYF CTV  HCS GQKL VNV
Sbjct  83   NSTNPISHKTTGPANFTLDTSGEHYFICTVGTHCSLGQKLAVNV  126



>ref|XP_008456879.1| PREDICTED: mucin-1-like [Cucumis melo]
Length=340

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 73/120 (61%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL+V   F  + S   A +YTVGD+ GW  P N  + Y+ WA+   FV GDILVFNF +G
Sbjct  12   LLLVAASFCRSSS---AATYTVGDALGWTVPPN-PTIYSDWASTKTFVVGDILVFNFASG  67

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             H V  V  K+  DSCN+ N  ++ NNSPA I L S G H+F C+   HCS GQ L++ V
Sbjct  68   RHDVTEV-TKSASDSCNSTNPISVANNSPARITLTSAGDHHFICSFPGHCSNGQTLSITV  126


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
            +  +Y VGDS GWN P++ +  Y +WA    FV GD+L FNF    H VA V  K++YDS
Sbjct  181  EPMTYVVGDSFGWNVPTSPN-FYDSWAQGKTFVVGDVLEFNFAIQRHDVAKV-TKDNYDS  238

Query  407  CNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            C+  +  +   + P  I L+  G H+F CT   HCS GQKL +NV
Sbjct  239  CSGQSPISFSTSPPVKITLSEPGEHFFICTFAGHCSVGQKLAINV  283



>ref|XP_004136088.1| PREDICTED: cucumber peeling cupredoxin-like [Cucumis sativus]
 ref|XP_004163556.1| PREDICTED: cucumber peeling cupredoxin-like [Cucumis sativus]
 gb|KGN45266.1| hypothetical protein Csa_7G432480 [Cucumis sativus]
Length=191

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 5/104 (5%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T + VGDS GW  P  G + Y+ WA+++ F  GD L FNF T +H V  V  K  +D+CN
Sbjct  24   TIHVVGDSDGWTVPQGGAAFYSDWASRNNFSVGDSLTFNFRTNMHDVLKV-TKESFDACN  82

Query  413  AANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            + NA  N+    PA++ L++ G+HYF CTV  HC  GQKL+V V
Sbjct  83   SNNAIGNVITTGPATVKLDAAGMHYFICTVGTHCLGGQKLSVTV  126



>ref|XP_010051715.1| PREDICTED: umecyanin-like [Eucalyptus grandis]
 gb|KCW82881.1| hypothetical protein EUGRSUZ_C04251 [Eucalyptus grandis]
Length=156

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 70/127 (55%), Gaps = 16/127 (13%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M   M +LV+M    +A+    A TS+ VGDS GW  P  G + Y+ WA           
Sbjct  1    MVSKMNMLVLMVFLGAAIRGCSAQTSHVVGDSLGWVVPPGGATAYSTWA-----------  49

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            +F F TG H VA V  K  YD C++ +  ++Q   PASI LN +G H++ CT+  HCS G
Sbjct  50   IFTFTTGAHDVAEVT-KAAYDGCSSTSPISLQTTGPASIRLNQSGEHFYICTIGSHCSLG  108

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  109  QKLAINV  115



>gb|KCW80158.1| hypothetical protein EUGRSUZ_C01506 [Eucalyptus grandis]
Length=262

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 6/103 (6%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNK--NDYDSC  409
            +YTVGD  GW  P++G + Y AWA+ + F  GDILVFNFN G   VA V     + YD  
Sbjct  24   TYTVGDVMGWTIPASGAAAYRAWASSNTFEVGDILVFNFNNGAQDVAEVTEAAFSSYD--  81

Query  410  NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             A   +I    PA I L + G H+F CT+  HCS GQK+ +NV
Sbjct  82   GAKPLSISTIPPARIALTTAGRHFFICTIPGHCSSGQKVAINV  124



>ref|XP_010535261.1| PREDICTED: cucumber peeling cupredoxin-like [Tarenaya hassleriana]
Length=185

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDST-YTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            T + VG++ GW  P  G ST YTAWA+  +F+ GDIL FNF T +H V  V  K  YD C
Sbjct  28   TVHVVGENMGWTVPRTGGSTAYTAWASSKRFMVGDILTFNFPTDIHDVLRV-TKESYDEC  86

Query  410  NAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             + N   ++  N PA++ L+S+G H+F CT+  HC  GQKL+++V
Sbjct  87   TSTNPIGDLIVNGPANVTLSSSGDHFFICTIGRHCLSGQKLSISV  131



>ref|XP_010050639.1| PREDICTED: cucumber peeling cupredoxin-like [Eucalyptus grandis]
Length=253

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 60/103 (58%), Gaps = 6/103 (6%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNK--NDYDSC  409
            +YTVGD  GW  P++G + Y AWA+   F  GDILVFNFN G   VA V     + YD  
Sbjct  24   AYTVGDVMGWTIPASGAAAYRAWASSITFEVGDILVFNFNNGAQDVAEVTEAAFSSYD--  81

Query  410  NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             A   +I    PA I L + G H+F CT+  HCS GQK+ +NV
Sbjct  82   GAKPLSISTIPPARIALTTAGRHFFICTIPGHCSSGQKVAINV  124



>gb|KHG25749.1| Blue copper [Gossypium arboreum]
Length=180

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 73/125 (58%), Gaps = 5/125 (4%)
 Frame = +2

Query  170  KMMELLVVMTVFLSAVSNVD-ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVF  346
            K++ +   + V  S +  +  A +YTVGD+ GW  P+     Y  W +   F+ GDILVF
Sbjct  4    KIVSMTATLVVLASNMLQITYAATYTVGDTIGWVIPTGYTELYHNWTDNKNFLVGDILVF  63

Query  347  NFNTGLHTVATVNNKNDYDSCNAANANI-QNNSPASIPLNSTGVHYFFCTV--HCSQGQK  517
             F TG H VA V  +  Y++C +AN  + ++  PA I LNS G H+F CT   HC++GQK
Sbjct  64   KFTTGEHDVAKV-TEAAYNACRSANTILTRSTGPARITLNSIGDHHFICTFADHCAEGQK  122

Query  518  LTVNV  532
            L+V V
Sbjct  123  LSVEV  127



>ref|XP_010103730.1| Blue copper protein [Morus notabilis]
 gb|EXB96872.1| Blue copper protein [Morus notabilis]
Length=284

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 80/132 (61%), Gaps = 15/132 (11%)
 Frame = +2

Query  164  MAKMMELL-----VVMTVF-LSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFV  325
            MA+ ++++     V +T+   SAV    AT+Y VGDSS W  PS+ ++ Y+ WA    FV
Sbjct  1    MARKLDMVLFAAFVALTILHTSAV----ATTYFVGDSSNWGIPSSSNA-YSNWAANKTFV  55

Query  326  TGDILVFNFNTGLHTVATVNNKNDYDSCNAANANI-QNNSPASIPLNSTGVHYFFCTV--  496
             GDILVFNF    H VA V N + YD+CN  N    Q +SPA+I L + G HY+ CT   
Sbjct  56   VGDILVFNFTENRHDVAEVTN-SAYDACNGTNPIFRQTSSPANITLQTVGEHYYICTFSG  114

Query  497  HCSQGQKLTVNV  532
            HC+ GQKL +NV
Sbjct  115  HCNAGQKLAINV  126


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 6/102 (6%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD+SGW     G S Y  WA+   F+ GDILVFNF  G H VA V  +N Y+SCN 
Sbjct  163  TYTVGDTSGWTVL--GASAYQTWASNKTFLVGDILVFNFANGSHDVAEVTKEN-YNSCNT  219

Query  416  -ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +  ++  N P  I L++ G H+F C    HC  GQKL++NV
Sbjct  220  NSTISLYTNPPVRITLDTAGEHFFTCPFPGHCDGGQKLSINV  261



>ref|XP_004287292.1| PREDICTED: uncharacterized protein LOC101313542 [Fragaria vesca 
subsp. vesca]
Length=353

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T+YTVGD++GWN   NG  TYT WA+   F  GD+LVFNF    H VA V  K +Y+SCN
Sbjct  174  TTYTVGDTAGWNVLGNG--TYTVWASNKTFFVGDVLVFNFLNQSHDVAEV-TKTNYESCN  230

Query  413  AANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +N  ++ +N P  I LN+TG  +F CT   HC+QGQKL +NV
Sbjct  231  TSNTLSLYSNPPVRITLNTTGEIFFICTFAGHCNQGQKLAINV  273


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 5/109 (5%)
 Frame = +2

Query  215  VSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKN  394
            +S   A ++ VGD  GWN P  G   Y+ W++ + F  GD LVF F +G H VA V  K 
Sbjct  19   ISTASAVTHQVGDGIGWNVPPGGAVAYSTWSSNNTFKAGDTLVFTFASGAHDVAKV-TKE  77

Query  395  DYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +D+CNA N  ++  NSPA++ L S G HY+ CT   HC  GQKL VNV
Sbjct  78   AFDACNATNPISLTTNSPATLTLTS-GEHYYICTFDSHCGSGQKLAVNV  125



>gb|AAF75824.1|AF101788_1 phytocyanin homolog [Pinus taeda]
Length=203

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = +2

Query  179  ELLVVM--TVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            ++LV +   + L+ + +V AT+Y VG ++GW  P++    YT W     F  GDILVF F
Sbjct  7    QVLVALGACLALAVLQSVAATTYAVGGNTGWTIPASNAKLYTDWVKARTFKLGDILVFKF  66

Query  353  NTGLHTVATVNNKNDYDSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
             T +H V  V+ K DYD C   +        PASI LN+TG HY+ C V  HC+ GQK++
Sbjct  67   ATNVHNVYRVS-KADYDKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVS  125

Query  524  VNV  532
            + V
Sbjct  126  IKV  128



>gb|ACJ70316.1| putative phytocyanin [Pinus sylvestris]
Length=203

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +2

Query  221  NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
            +V AT+YTVG S+GW  P+     YT W     F  GDILVF F T +H V  V +K DY
Sbjct  23   SVAATTYTVGGSAGWTIPATNAKLYTDWVKATTFKLGDILVFKFATNVHNVYRV-SKADY  81

Query  401  DSC-NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            D C   +        PASI LN+TG HY+ C V  HC+ GQK+++ V
Sbjct  82   DKCVTTSPLEKYETGPASITLNTTGHHYYICAVSGHCAAGQKVSIKV  128



>ref|XP_002517636.1| Blue copper protein precursor, putative [Ricinus communis]
 gb|EEF44800.1| Blue copper protein precursor, putative [Ricinus communis]
Length=216

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = +2

Query  164  MAKMMELLV--VMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MAK + + +  V+ V L   +    T + VGD  GW  PSNG + YT WA    F  GDI
Sbjct  1    MAKFIGVTIGFVLVVLLQCAAA--QTVHVVGDGIGWTVPSNGPAAYTNWATGKSFAVGDI  58

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            L FNF T  H V  V+  + YD+CN AN   ++    P +I L+STG HY+ CT   HC 
Sbjct  59   LSFNFATTAHDVLRVSEAS-YDACNNANPIGDLITTGPVNITLDSTGDHYYICTFSQHCQ  117

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  118  LGQKLAITV  126



>ref|XP_010247602.1| PREDICTED: umecyanin-like [Nelumbo nucifera]
Length=173

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 71/124 (57%), Gaps = 6/124 (5%)
 Frame = +2

Query  170  KMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            +MM LL  M V     S    T++TVG S+GW  PS+ +S YT WA+   F  GD L F+
Sbjct  4    RMMGLLGCMLVVALFQSAAAQTTHTVGGSTGWTLPSS-NSFYTTWASSQNFAVGDTLEFD  62

Query  350  FNTGLHTVATVNNKNDYDSCNAAN-ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            F+ G H VA V   N YDSC      +I + SPA I LN++G HYF CT+  HC  G KL
Sbjct  63   FS-GSHDVAQVTKAN-YDSCTKTPIGSIISTSPAEILLNASGDHYFICTISNHCQAGMKL  120

Query  521  TVNV  532
             + V
Sbjct  121  AITV  124



>emb|CAN60011.1| hypothetical protein VITISV_018636 [Vitis vinifera]
Length=299

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T + VGDS GW  PS G  TY  WA    FV GD L FNF TG H VA V  K  + +CN
Sbjct  133  TEFIVGDSLGWTVPSGGAVTYQNWAANKTFVVGDSLKFNFTTGAHDVAEV-TKAAFTACN  191

Query  413  AANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              N  + +   PA I L + G HYF CTV  HCS GQKL +NV
Sbjct  192  GXNPISHETEGPADIDLXTAGEHYFICTVGSHCSLGQKLAINV  234


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
             A ++ VGD   W  PSNG   Y  WA    F+ GD+L F F TG H VA V  K  +D+
Sbjct  23   KAETHEVGDDLKWTVPSNGSVAYQNWAAGETFLXGDVLEFEFTTGAHDVAKV-TKAAFDA  81

Query  407  CNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            CN+ N  + +   PA+  L+++G HYF CTV  HCS GQKL VNV
Sbjct  82   CNSTNPISHKTTGPANFTLDTSGEHYFICTVGTHCSLGQKLAVNV  126



>gb|AFK42629.1| unknown [Medicago truncatula]
Length=200

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = +2

Query  170  KMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            K M +L V+    + + + +A  +TVG ++GW+ PS G S Y+ WA  + F   D+LVFN
Sbjct  5    KNMSILFVVAFAAAILESTEAADHTVGGTTGWSVPS-GASFYSDWAASNTFKQNDVLVFN  63

Query  350  FNTGLHTVATVNNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            F  G HTVA V+ K D+D+CN   N  +    PA + LN TG  YF CT+  HCS GQKL
Sbjct  64   FAGG-HTVAEVS-KADFDNCNINQNGLVITTGPARVTLNRTGDFYFICTIQGHCSSGQKL  121

Query  521  TVNV  532
            +V V
Sbjct  122  SVKV  125



>ref|XP_004303302.1| PREDICTED: blue copper protein-like [Fragaria vesca subsp. vesca]
Length=220

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 72/126 (57%), Gaps = 8/126 (6%)
 Frame = +2

Query  170  KMMELL-VVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVF  346
            KMM +  +V  VFL +V+    T++ VG S GW  P NG   Y  WA+  +F+ GD L+F
Sbjct  6    KMMVVFGLVAAVFLHSVTA--QTAHVVGGSIGWMIPQNGAQEYVTWASGQEFIVGDTLIF  63

Query  347  NFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            NF T  H V  V  K  +DSC++AN   +     PA+I L +TG HY+ CT   HC  GQ
Sbjct  64   NFATDTHDVVQV-PKASFDSCSSANPIGSSITTGPANITLTTTGDHYYICTYGRHCQSGQ  122

Query  515  KLTVNV  532
            KL + V
Sbjct  123  KLAITV  128



>gb|KEH16093.1| plastocyanin-like domain protein [Medicago truncatula]
Length=200

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = +2

Query  170  KMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            K M +L V+    + + + +A  +TVG ++GW+ PS G S Y+ WA  + F   D+LVFN
Sbjct  5    KNMSILFVVAFAAAILESTEAADHTVGGTTGWSVPS-GASFYSDWAASNTFKQNDVLVFN  63

Query  350  FNTGLHTVATVNNKNDYDSCNA-ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            F  G HTVA V+ K D+D+CN   N  +    PA + LN TG  YF CT+  HCS GQKL
Sbjct  64   FAGG-HTVAEVS-KADFDNCNINQNGLVITTGPARVTLNRTGDFYFICTIQGHCSSGQKL  121

Query  521  TVNV  532
            +V V
Sbjct  122  SVKV  125



>ref|XP_009364056.1| PREDICTED: mavicyanin-like [Pyrus x bretschneideri]
Length=155

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 7/121 (6%)
 Frame = +2

Query  188  VVMTVFLSAVSNV----DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFN  355
            +V+ + + AVS +    +A  Y VGD  GW  P  G ++Y +WA +++FV  DIL FNF 
Sbjct  1    MVLAIAVVAVSTILHTTEAAEYVVGDDLGWTVPPGGAASYASWAAKYRFVVNDILYFNFT  60

Query  356  TGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVN  529
             G HTVA V  +N Y+ CN  +   + + P+ +   S+   YF CT   HC+ GQK+ V 
Sbjct  61   EGEHTVALVTKEN-YEICNTTDPLFKLDGPSGLQFLSSDTFYFTCTFTGHCAGGQKVEVY  119

Query  530  V  532
            +
Sbjct  120  I  120



>gb|ABK23833.1| unknown [Picea sitchensis]
Length=202

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 70/123 (57%), Gaps = 7/123 (6%)
 Frame = +2

Query  179  ELLVVMTVFL--SAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            E L+V+   L  S +  V ATSY VG SSGW  PS+    Y+ W     F  GD LVF F
Sbjct  7    EFLIVLGACLAVSVLQCVAATSYDVGGSSGWTIPSS-SKLYSDWVKSTTFKLGDKLVFKF  65

Query  353  NTGLHTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
             TG H    V+ K DYD C+ ++   +    PA++ LNSTG HY+ C V  HC+ GQK++
Sbjct  66   TTGQHNAYRVS-KADYDKCSGSSPMEKYETGPATVTLNSTGHHYYICAVSGHCTAGQKVS  124

Query  524  VNV  532
            V V
Sbjct  125  VKV  127



>ref|XP_008242791.1| PREDICTED: mavicyanin-like [Prunus mume]
Length=179

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 3/117 (3%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            L++V+   +  +   +A  YTVGD  GW  P  G +TY +WA +H  V  DIL FNF  G
Sbjct  12   LVLVIAAAVFTLHGTEAAQYTVGDELGWTIPPGGAATYASWAAKHSLVVSDILTFNFAVG  71

Query  362  LHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
               +A V  K D+D+CN ++       P      S G++Y  CT   HC++GQK+ +
Sbjct  72   EQDLALV-TKEDFDACNTSDPLFVFQDPGDFIFESEGMYYLTCTFAGHCAKGQKIAL  127



>ref|XP_004159419.1| PREDICTED: uncharacterized protein LOC101231385 [Cucumis sativus]
Length=336

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 71/120 (59%), Gaps = 8/120 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LL+V   F  + S   A +YTVGD+ GW  P N  + Y+ WA+   FV GDILVFNF +G
Sbjct  9    LLLVAAAFCRSSS---AATYTVGDALGWTVPPN-PTVYSDWASTKTFVVGDILVFNFASG  64

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             H V  V  K   DSCN+ N  ++ NNSPA I L S G  +F C+   HCS GQ L++ V
Sbjct  65   RHDVTEV-TKTASDSCNSTNPISVANNSPARITLTSAGDRHFICSFPGHCSNGQTLSITV  123


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
            +  +Y VGDS GWN P++  + Y +WA    FV GD+L FNF    H VA V  K++Y S
Sbjct  178  EPMTYIVGDSFGWNVPTS-PTFYDSWAQGKTFVVGDVLEFNFLIQRHDVAKV-TKDNYAS  235

Query  407  CNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            C+  +  ++  + P  I L+  G H+F CT   HCS GQKL +NV
Sbjct  236  CSGQSPISLTTSPPVKITLSEPGEHFFICTFAGHCSFGQKLAINV  280



>ref|XP_008361224.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=222

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 71/127 (56%), Gaps = 8/127 (6%)
 Frame = +2

Query  170  KMMELLVVMTVFLSA---VSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            KM+  + V     +A   +   +A SYTVGD  GW    + + TY++WA  H F  GD L
Sbjct  4    KMLGYVTVFVALAAAXLVIERAEAESYTVGDDLGWTNIVDSN-TYSSWAANHTFKVGDTL  62

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VF F TG H VAT+  K  YD C+  +   + +  PAS  LN TG +YF C +  HC+ G
Sbjct  63   VFEFLTGRHDVATLTKKA-YDECSTTDPLGVLDQGPASYILNETGNYYFICAISGHCNDG  121

Query  512  QKLTVNV  532
            QKL++ V
Sbjct  122  QKLSIKV  128



>gb|KHN15077.1| Stellacyanin [Glycine soja]
Length=169

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 5/106 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGD-STYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYD  403
            +A  + VG S+GW  PS GD S YT++A  + F   DILVFNF TG H V T++ K+ YD
Sbjct  24   EAAEHVVGGSAGWIIPSQGDTSLYTSFAANNTFRLNDILVFNFATGFHNVVTLSKKH-YD  82

Query  404  SCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            SCN +      + +PA I LN TG  YF C    HCS GQKL+++V
Sbjct  83   SCNVSEVMQSFDTAPARITLNRTGEFYFACAFSSHCSLGQKLSIHV  128



>ref|XP_003550819.1| PREDICTED: stellacyanin-like [Glycine max]
Length=169

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 5/106 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGD-STYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYD  403
            +A  + VG S+GW  PS GD S YT++A  + F   DILVFNF TG H V T++ K+ YD
Sbjct  24   EAAEHVVGGSAGWIIPSQGDTSLYTSFAANNTFRLNDILVFNFATGFHNVVTLSKKH-YD  82

Query  404  SCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            SCN +      + +PA I LN TG  YF C    HCS GQKL+++V
Sbjct  83   SCNVSEVMQSFDTAPARIILNRTGEFYFACAFSSHCSLGQKLSIHV  128



>ref|XP_009624895.1| PREDICTED: mucin-2-like [Nicotiana tomentosiformis]
Length=656

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 68/124 (55%), Gaps = 10/124 (8%)
 Frame = +2

Query  176  MELLVVMTVF--LSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            + +LVV T    +S   N    +Y VGD+ GW  P  G + Y+ WA    F  GD L FN
Sbjct  7    LAMLVVATALFNISMAQN----TYVVGDALGWTVPPGGAAAYSTWAAPKIFSVGDTLAFN  62

Query  350  FNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            F TG H VA V+ K D+DSCN A+  +   N P +I LNS G HY+ CT   HC  G KL
Sbjct  63   FATGAHNVAEVS-KADFDSCNTASPISTSTNGPTNIILNSVGTHYYLCTFAGHCDLGMKL  121

Query  521  TVNV  532
             + V
Sbjct  122  VITV  125



>gb|KEH30268.1| plastocyanin-like domain protein [Medicago truncatula]
 gb|KEH30324.1| plastocyanin-like domain protein [Medicago truncatula]
Length=172

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  170  KMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            K + +L ++    S + + +A  + VG  +GW  P +G S Y+ WA+   F   D+LVFN
Sbjct  5    KNISILFIVVFAASMLRSTEAIDHIVGSRNGWIIPVDGHSFYSDWASNITFKENDVLVFN  64

Query  350  FNTGLHTVATVNNKNDYDSCNAANANIQ----NNSPASIPLNSTGVHYFFCTV--HCSQG  511
            F TG HTV  + N+  +++CN  N NIQ    + SP    LN TGV YF C++  HC+ G
Sbjct  65   FVTGRHTVVEL-NQTYFENCN-VNQNIQFLDTSPSPVRFTLNRTGVFYFTCSIPGHCASG  122

Query  512  QKLTVNV  532
            QKL VNV
Sbjct  123  QKLIVNV  129



>ref|XP_002308109.2| hypothetical protein POPTR_0006s06640g [Populus trichocarpa]
 gb|EEE91632.2| hypothetical protein POPTR_0006s06640g [Populus trichocarpa]
Length=273

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            ++V  T++TVGD++GW  P+   + Y++WA    F  G+ILVFNF    H VA V  K D
Sbjct  21   TSVAQTTHTVGDTTGWAIPTGDPAFYSSWAANQTFNVGEILVFNFMANAHDVAKV-TKAD  79

Query  398  YDSCNAANA-NIQNNSPASIPLNSTGVHYFFC--TVHCSQGQKLTVNV  532
            YD+C  ++  ++   SPA I L+++G HYF C  T HCS GQK+ +NV
Sbjct  80   YDACTTSSPISLVETSPARINLDASGEHYFICNFTGHCSAGQKMMINV  127



>ref|XP_008461119.1| PREDICTED: uncharacterized protein LOC103499800 [Cucumis melo]
Length=434

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 71/127 (56%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA    +++   +FL    +   T YTVGDS+GW  P+NG + Y +WA    F  GD LV
Sbjct  1    MAGRFAIVLGFALFLFLEYSAAQTVYTVGDSAGWTVPANGVAFYESWAAGKTFHVGDSLV  60

Query  344  FNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCT--VHCSQG  511
            FNF TG+  V+ V  K  +D C+  N   +     PA+IPL S G +YF  +   HC QG
Sbjct  61   FNFRTGMDEVSRV-TKMGFDICSDDNEIGDSIETGPATIPLLSPGEYYFISSEDRHCQQG  119

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  120  QKLAINV  126


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 54/103 (52%), Gaps = 5/103 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN-  412
            ++ VGD+ GW  P  G   Y  W    +F+ GD LVFNF T    +  V  K  +D CN 
Sbjct  153  THVVGDTFGWGIPQGGAMFYANWTAGKRFIVGDSLVFNFRTREDDLVRV-TKQSFDLCND  211

Query  413  -AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
                 +  ++ PA+IPL + G +YF      HC QGQKL +NV
Sbjct  212  DGEIGDDIDHGPATIPLLTPGEYYFISNEDGHCQQGQKLAINV  254


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 52/103 (50%), Gaps = 5/103 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            ++ VG S GW  P  G + Y  W     F  GD LVFNF T +H V  V  K  +D C+ 
Sbjct  280  THIVGGSVGWTIPPGGAAFYVNWTAGKTFAVGDSLVFNFQTDVHDVERV-PKLSFDICSD  338

Query  416  AN--ANIQNNSPASIPLNSTGVHYFFCTVH--CSQGQKLTVNV  532
             N   +   + PA++ L + G HY+    +  C  GQKL +NV
Sbjct  339  DNEIGDTIESGPATVVLTTPGEHYYISGENQDCELGQKLAINV  381



>ref|XP_006842049.1| hypothetical protein AMTR_s00078p00022690 [Amborella trichopoda]
 gb|ERN03724.1| hypothetical protein AMTR_s00078p00022690 [Amborella trichopoda]
Length=178

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 76/134 (57%), Gaps = 7/134 (5%)
 Frame = +2

Query  146  EHH*KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDST-YTAWANQHQF  322
            E H  ++ ++    V+++V          T + VG S+ W+ P NG+++ Y  WAN   F
Sbjct  2    EFHCPLVVRLWWSFVLLSVVAMLCCASGTTVHVVGYSARWDVPQNGNTSFYQEWANSRSF  61

Query  323  VTGDILVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV  496
              GDIL FNF TG H VA V  K +YD+C A N  + +  N P  + L ++G HYF C++
Sbjct  62   CVGDILSFNFTTG-HDVAQV-RKAEYDACTAKNPISPVLGNGPVDVNLTASGEHYFLCSI  119

Query  497  --HCSQGQKLTVNV  532
              HCS GQ ++++V
Sbjct  120  GRHCSLGQHVSISV  133



>ref|XP_008389837.1| PREDICTED: mavicyanin-like [Malus domestica]
Length=168

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 72/131 (55%), Gaps = 9/131 (7%)
 Frame = +2

Query  164  MAKMMEL--LVVMTVFLSAVS----NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFV  325
            M K M    ++V+ + L+AV+      +A  Y VGD  GW  P  G ++Y +WA ++ FV
Sbjct  1    MVKTMNFGNVMVLAMTLAAVTMMLHTTEAAEYVVGDDLGWTVPPGGAASYASWAAKYSFV  60

Query  326  TGDILVFNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--H  499
              DIL FNF  G HTVA V  +N Y+ CN  +   + + P ++   ++   YF CT   H
Sbjct  61   VDDILYFNFTEGEHTVALVTKEN-YEICNTTDPXXKLDGPXALQFLASDTFYFTCTFAGH  119

Query  500  CSQGQKLTVNV  532
            C+ GQK+ V +
Sbjct  120  CAGGQKVAVYI  130



>ref|XP_004139303.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN60692.1| hypothetical protein Csa_2G006870 [Cucumis sativus]
Length=221

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A ++ VGDS GW  P    +TY+ WA+   F+ GD L FNF TG H V  V  K + DSC
Sbjct  25   AATHNVGDSLGWTIPPT-STTYSDWASTKTFLVGDNLFFNFTTGQHDVTEV-TKAELDSC  82

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +  N  ++  N PASIPL++ G  +F C++  HCS GQKLTV V
Sbjct  83   SGTNPISVMRNGPASIPLSTAGTRHFICSIPTHCSFGQKLTVTV  126



>ref|XP_009364055.1| PREDICTED: umecyanin-like [Pyrus x bretschneideri]
Length=163

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 7/120 (6%)
 Frame = +2

Query  185  LVVMTVFLSAVSNVD----ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            L+V+ + ++ V+ +     AT Y VGD  GW  P  G + Y +WA  H FV  D L F F
Sbjct  6    LMVLAIAVATVAMISHTTAATEYVVGDDLGWTVPPGGAAYYVSWAANHSFVLNDALYFKF  65

Query  353  NTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
              G HTVA V  +N ++ CN  N   +   P+ I   ++  +YF CT+  HC++GQK+ V
Sbjct  66   TEGEHTVAMVTKEN-FEICNTTNPIFELQKPSIIGFTASDTYYFTCTIAGHCAEGQKVAV  124



>ref|XP_008779708.1| PREDICTED: cucumber peeling cupredoxin-like [Phoenix dactylifera]
 gb|AEG74553.1| hypothetical protein [Phoenix dactylifera]
Length=188

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 63/105 (60%), Gaps = 6/105 (6%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A ++ VG S+GW  P N  S Y+ WA+   F  GD LVFNF TG HTV  V  K+ YD C
Sbjct  31   AATHVVGGSTGWIIPPN-SSFYSDWASTQTFAVGDTLVFNFQTGSHTVDKV-TKSGYDDC  88

Query  410  NAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            + +N   +    SPAS+PL + G HYF C +  HCS  QKL+V V
Sbjct  89   STSNLIGSAITTSPASVPLTTAGDHYFICGIPGHCSASQKLSVTV  133



>ref|XP_008777839.1| PREDICTED: cucumber peeling cupredoxin-like [Phoenix dactylifera]
Length=222

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 71/127 (56%), Gaps = 7/127 (6%)
 Frame = +2

Query  167  AKMMELLVVMTVFLSAVSNVDATSYTVGDS-SGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            A MM  +  +++ L       AT + VG S +GW  P N  S Y  W++   +V GD LV
Sbjct  15   AGMMIAVAAVSLVLEGSVVAAATRHVVGGSGTGWTIPPN-ASFYGEWSSSQTYVVGDTLV  73

Query  344  FNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            FNF TG+H V  V  K+ YD+C A N   +  +  PA++ L S+G HY+ C V  HCS G
Sbjct  74   FNFPTGIHNVIQV-PKSSYDACTAQNQIGSTLSTGPATVTLTSSGAHYYICGVSGHCSTG  132

Query  512  QKLTVNV  532
            QKL + V
Sbjct  133  QKLAITV  139



>ref|XP_002527191.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
 gb|EEF35204.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
Length=163

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 70/123 (57%), Gaps = 6/123 (5%)
 Frame = +2

Query  170  KMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            + +  L+V+   L   S   AT +TVGD  GW  PSN  S Y  WA+   F  GD +VFN
Sbjct  4    RWIGFLIVLLPLLD--STAAATKFTVGDGIGWAVPSNA-SFYDEWASDKTFQVGDSIVFN  60

Query  350  FNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
            ++  +H V  V +K++YD+C   N  ++  SP +I L +    YF CTV  HC+ GQK+T
Sbjct  61   WSE-VHNVLEVTSKSEYDNCTTTNGILRQTSPVTIDLTANSTLYFICTVGQHCALGQKVT  119

Query  524  VNV  532
            + V
Sbjct  120  IKV  122



>ref|XP_006659514.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=176

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 76/124 (61%), Gaps = 13/124 (10%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            +++LLV++   L+A +   AT++TVG S+GW+T      TY  WA+   F  GD LVFNF
Sbjct  8    LIKLLVLVGCALAASA---ATTHTVGGSAGWST----GQTYDTWASGQTFAVGDKLVFNF  60

Query  353  NTGLHTVATVNNKNDYDSCNAANANIQNNS--PASIPLNSTGVHYFFCTV--HCSQGQKL  520
              G HTV  V  K+DY++C+ +   I + +  PA+I L S G HY+ CTV  HC+ G KL
Sbjct  61   AGG-HTVTEVT-KSDYEACSVSGNPISDTTTGPATIDLTSAGAHYYICTVAGHCTGGMKL  118

Query  521  TVNV  532
             + V
Sbjct  119  AITV  122



>ref|XP_009411216.1| PREDICTED: cucumber peeling cupredoxin-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = +2

Query  170  KMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            + + LLVV    L  VS      + VG S GW  P N  + Y  WAN+  F  GD LVF 
Sbjct  6    RTLLLLVVAMSCLVTVSQAHQKIHIVGGSYGWKIPPN-KTFYEEWANKQNFFVGDKLVFL  64

Query  350  FNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            + TGL  V   + + ++  C   N  ++Q   P  + +   GVHYF+C+V  HC  GQKL
Sbjct  65   YTTGLQNVIEASEEEEFVYCKQTNVEDVQFVGPTILEVTKAGVHYFYCSVGLHCEGGQKL  124

Query  521  TVNV  532
             +NV
Sbjct  125  RINV  128



>ref|XP_011074212.1| PREDICTED: blue copper protein [Sesamum indicum]
Length=193

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 9/126 (7%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            ++  + ++VV+ V    +  V A  YTVGDSSGW     GD  Y +WA    F  GD LV
Sbjct  3    LSGRIAIMVVLAVICCGIPAVPAAVYTVGDSSGWAM--GGD--YGSWATDKTFAVGDTLV  58

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQ  514
            FN+  G HTV  V + NDY +C   N+   ++S A SI L S G HYF C V  HCS G 
Sbjct  59   FNYAPG-HTVDEV-SANDYKTCTTGNSLSSDSSGATSITLKSAGSHYFICGVPGHCSGGM  116

Query  515  KLTVNV  532
            KL + V
Sbjct  117  KLAITV  122



>ref|XP_008389848.1| PREDICTED: mavicyanin-like [Malus domestica]
 ref|XP_008389860.1| PREDICTED: mavicyanin-like [Malus domestica]
Length=167

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 71/131 (54%), Gaps = 9/131 (7%)
 Frame = +2

Query  164  MAKMMEL--LVVMTVFLSAVS----NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFV  325
            M K M    ++V+ + L+AVS      +A  Y VGD  GW  P  G ++Y +WA ++ FV
Sbjct  1    MVKTMNFGNVMVLAMALAAVSMMLHTTEAAEYVVGDDLGWTVPPGGAASYASWAAKYSFV  60

Query  326  TGDILVFNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--H  499
              DIL FNF  G HTVA V  K  Y+ CN  +   + + P ++    +  +YF CT   H
Sbjct  61   VDDILYFNFTEGEHTVALV-TKEKYEICNTTDPLSKLDGPIALRFLDSDTYYFTCTFAGH  119

Query  500  CSQGQKLTVNV  532
            C+ GQK+ V +
Sbjct  120  CTGGQKVAVYI  130



>ref|XP_004507625.1| PREDICTED: early nodulin-like protein 2-like [Cicer arietinum]
Length=240

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 7/129 (5%)
 Frame = +2

Query  161  IMAKM--MELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            +M+K+  M +L+V+    + + + +AT + VG S+GW + S   S Y+ WA+   F   D
Sbjct  1    MMSKLNNMSILLVIGFAAAILQSTEATDHIVGGSTGWIS-SPPASFYSNWASNITFREND  59

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            +LVFNF  G HTVA + NK +YDSCN +    +   SPA I LN TG  YF C+   HCS
Sbjct  60   VLVFNFVAGAHTVAEL-NKANYDSCNLSQPIQVIGTSPAKITLNKTGEFYFSCSFQGHCS  118

Query  506  QGQKLTVNV  532
             GQKL+V V
Sbjct  119  SGQKLSVKV  127



>ref|XP_008358046.1| PREDICTED: mavicyanin-like [Malus domestica]
Length=167

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 71/131 (54%), Gaps = 9/131 (7%)
 Frame = +2

Query  164  MAKMMEL--LVVMTVFLSAVS----NVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFV  325
            M K M    ++V+ + L+AVS      +A  Y VGD  GW  P  G ++Y +WA ++ FV
Sbjct  1    MVKTMNFGNVMVLAMALAAVSMMLHTTEAAEYVVGDDLGWTVPPGGAASYASWAAKYXFV  60

Query  326  TGDILVFNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--H  499
              DIL FNF  G HTVA V  K  Y+ CN  +   + + P ++    +  +YF CT   H
Sbjct  61   VDDILYFNFTEGEHTVALV-TKEKYEICNTTDPLSKLDGPIALRFLDSDTYYFTCTFAGH  119

Query  500  CSQGQKLTVNV  532
            C+ GQK+ V +
Sbjct  120  CTGGQKVAVYI  130



>ref|XP_009763449.1| PREDICTED: cucumber peeling cupredoxin-like [Nicotiana sylvestris]
Length=206

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 77/129 (60%), Gaps = 11/129 (9%)
 Frame = +2

Query  176  MELLVVMTVFLS-AVSNV--DATSYTV---GDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M++++ M VF++ AV+++  D+T+ TV   GD+ GW  P+NG + YT WA    F  GD 
Sbjct  1    MDIMLCMIVFVALAVTSLVQDSTAQTVHVVGDNIGWTIPNNGAAAYTNWAAGKTFRIGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T  H V  V  K  +D CN+ NA  N     PA++ L+S G HY+ CT   HC 
Sbjct  61   LVFNFMTDSHDVLQV-PKTSFDGCNSQNAIGNPIMGGPANVTLDSAGDHYYICTFGRHCQ  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>gb|EYU36477.1| hypothetical protein MIMGU_mgv1a014161mg [Erythranthe guttata]
Length=198

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 71/128 (55%), Gaps = 9/128 (7%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            KI   +  L+VV+ +    +  V A SYTVG++SGW+  ++    YT W +   F  GD 
Sbjct  3    KISDGIACLMVVLVIICCKIPGVPAASYTVGEASGWSIGAD----YTTWTSDKTFAVGDT  58

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQ  508
            LVFN+  G HTV  V + NDY SC   NA   ++S A ++ L + G HYF C V  HC  
Sbjct  59   LVFNYAPG-HTVDEV-SANDYKSCTTGNAIATDSSGATTVALKAAGPHYFICGVPGHCGG  116

Query  509  GQKLTVNV  532
            G KL V V
Sbjct  117  GMKLAVTV  124



>gb|KCW80132.1| hypothetical protein EUGRSUZ_C01472 [Eucalyptus grandis]
Length=160

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = +2

Query  203  FLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATV  382
             ++ +S  +AT+YTVG S GW  PS+  + Y+ WA+QH F  GD+LVF+F++  + VA V
Sbjct  1    MVALLSCAEATNYTVGGSEGWKIPSSAGA-YSDWASQHTFEVGDVLVFDFDSSNNDVADV  59

Query  383  NNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              K DYD+CN  +   + + SPA+  L++ G +Y   T   HCSQGQKL + V
Sbjct  60   -TKEDYDACNTDSPFTVLSTSPANYSLDTAGDYYILYTTAGHCSQGQKLAITV  111



>ref|XP_010026035.1| PREDICTED: blue copper protein [Eucalyptus grandis]
 gb|KCW83087.1| hypothetical protein EUGRSUZ_B00045 [Eucalyptus grandis]
Length=195

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 72/126 (57%), Gaps = 9/126 (7%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA    L++  TV L  V    AT YTVGD+ GW   ++    YT W +   F+ GD LV
Sbjct  1    MAGAGLLMLGATVLLQLVLPSLATVYTVGDTGGWVMGTD----YTTWTSGKTFLVGDSLV  56

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQ  514
            FN+  G HTV  V +K+DYD+C AAN    ++S A +IPL +   HYF C    HCS G 
Sbjct  57   FNYGGG-HTVDEV-SKSDYDACTAANVISTDSSGATTIPLKTAATHYFICGAAGHCSSGM  114

Query  515  KLTVNV  532
            KL V+V
Sbjct  115  KLAVSV  120



>ref|XP_004287293.1| PREDICTED: uncharacterized protein LOC101313831 [Fragaria vesca 
subsp. vesca]
Length=309

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M   ++   V+ + ++A+  S      + VGD  GW  P  G   Y  WA+ H+F  GDI
Sbjct  1    MGSELKYFAVLAITVAALLQSTAAVEKHVVGDKFGWIVPPGGHYAYEVWASGHKFSVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            L FNF TG   VA V  K  +DSCN+ N   ++   PA+  L++ G +YF  T+  HC  
Sbjct  61   LEFNFTTGEQDVAKV-TKEAFDSCNSTNPIELKTTGPANFTLDTIGEYYFIGTMDKHCEL  119

Query  509  GQKLTVNV  532
            GQKL +NV
Sbjct  120  GQKLAINV  127


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 6/102 (6%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VG+  GW  P  G+ +Y+AWA    F+ GD LVFNF      VA V  K  +D+C  
Sbjct  148  TYIVGEQLGWFVP--GEFSYSAWAYGKTFMVGDTLVFNFLNETQDVAIV-TKAVFDNCTT  204

Query  416  -ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +   +   SP  I LN+TG HYF  T   HC  GQKL +NV
Sbjct  205  NSTLAVYKYSPVHIILNTTGEHYFTSTYDSHCEYGQKLAINV  246



>ref|XP_008457411.1| PREDICTED: blue copper protein-like [Cucumis melo]
Length=334

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + LLV+  V   A+  +    T++ VGDS GW  P  G   Y  WA  H F+ GDI
Sbjct  1    MARTLALLVLAIVATCALVQTTTAGTTHVVGDSLGWVVPIGGPVVYATWAVSHTFLVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            L+FNF TG   VA V  +  + +CN+ N  +++   PA+  L+S G +YF  T+  HC  
Sbjct  61   LLFNFTTGEEDVARV-TREAFLTCNSTNPISLKTTGPANFTLDSLGEYYFIGTLDKHCIL  119

Query  509  GQKLTVNV  532
            GQ+L +NV
Sbjct  120  GQRLAINV  127


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +2

Query  239  YTVGDSSGWNTPSNGDST--YTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            YTVGD  GW  P        Y +WA    F+ GD L+FNF  G   VA V  K  +DSCN
Sbjct  151  YTVGDKLGWLIPPPDPLGLFYASWAYNKTFLVGDTLIFNFYNGSDDVAVV-TKEVFDSCN  209

Query  413  -AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              +   + +++PA I LNSTG HY+  T   HC   QKL +NV
Sbjct  210  ITSTLEVFSSTPAIIALNSTGEHYYTSTYEKHCILEQKLAINV  252



>ref|XP_010050631.1| PREDICTED: uncharacterized protein LOC104439242 [Eucalyptus grandis]
Length=497

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 79/141 (56%), Gaps = 15/141 (11%)
 Frame = +2

Query  140  PFEHH*KIMAKMME-------LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYT  298
            P EH      ++         LL VM   LS     +AT+YTVG S GW  PS+  + Y+
Sbjct  97   PLEHQLLQQPRLRASSGITACLLGVMVALLSCA---EATNYTVGGSEGWKIPSSAGA-YS  152

Query  299  AWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGV  475
             WA+QH F  GD+LVF+F++  + VA V  K DYD+CN  +   + + SPA+  L++ G 
Sbjct  153  DWASQHTFEVGDVLVFDFDSSNNDVADV-TKEDYDACNTDSPFTVLSTSPANYSLDTAGD  211

Query  476  HYFFCTV--HCSQGQKLTVNV  532
            +Y   T   HCSQGQKL + V
Sbjct  212  YYILYTTAGHCSQGQKLAITV  232


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 49/97 (51%), Gaps = 14/97 (14%)
 Frame = +2

Query  281  GDSTY----------TAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNAANA-N  427
            GDS Y          T  A Q     GDI +FNFN G   VA V  +  + SC+ AN  +
Sbjct  301  GDSDYDFAIGICRADTCAAAQTSERDGDIHLFNFNNGARDVAEV-TETAFGSCDGANPLS  359

Query  428  IQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            I     A I L + G H+F CTV  HCS GQK+ +NV
Sbjct  360  ISTVPLARITLTTAGQHFFICTVPGHCSSGQKVAINV  396



>ref|XP_002282262.2| PREDICTED: LOW QUALITY PROTEIN: blue copper protein [Vitis vinifera]
Length=338

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = +2

Query  224  VDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYD  403
            V  T++ VGDS GW  P  G   Y  WA+   FV GDILVFNF TG   VA V +K  +D
Sbjct  24   VAQTTHVVGDSLGWLVPPGGPIAYATWADTQTFVVGDILVFNFTTGEQDVARV-SKEGFD  82

Query  404  SCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            SCN+ N  +++   PA+  L++ G +YF  T+  HC  GQKL + V
Sbjct  83   SCNSTNPISLKTTGPANFTLDTVGDYYFIGTMDRHCPLGQKLAIKV  128


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN-  412
            +YTVGD  GW  P  G+  Y+ WA    F+ GD LVFNF  G   VA V  K  YDSCN 
Sbjct  146  TYTVGDILGWVVPPLGEVAYSTWAYNKIFIVGDSLVFNFINGTQDVAVV-TKEAYDSCNT  204

Query  413  AANANIQNNSPASIPLNSTGVHYFFCT--VHCSQGQKLTVNV  532
            ++   +   SP +I L +TG+HYF  T  +HC  GQKL +NV
Sbjct  205  SSTITVYATSPTTITLTTTGMHYFSSTYELHCGLGQKLAINV  246



>gb|EYU18255.1| hypothetical protein MIMGU_mgv1a009144mg [Erythranthe guttata]
Length=351

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGDS GW  P  G   Y  WA    F+ GDILVFNF+   H VA V  K ++DSCN 
Sbjct  172  TYVVGDSLGWTVPPGGPIAYRTWAMGKTFMVGDILVFNFSNRQHDVAEV-TKAEFDSCNI  230

Query  416  A--NANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +          PA I L+S G +Y+ CT+  HCS GQKL +NV
Sbjct  231  STTTTAPITTGPARITLSSAGENYYICTITQHCSWGQKLAINV  273


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 71/129 (55%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTV-FLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            M   + ++V M + F+ A+ N  +  T++  GDS GW  P  GD  Y  WA    FV GD
Sbjct  1    MEGRLNVVVFMALMFVGAMLNGSSAQTTHVAGDSIGWIVPPGGDIAYRTWAATRTFVVGD  60

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHY-FFCTV--HCS  505
            I+VFNF TG+H VA V  K  YDSCNA N    + +  +    ++   Y F CT   HC 
Sbjct  61   IIVFNFTTGMHDVAEV-TKESYDSCNANNPITMSTTGPTTITLTSAREYNFICTFGSHCI  119

Query  506  QGQKLTVNV  532
             GQKL++NV
Sbjct  120  LGQKLSINV  128



>gb|EYU18254.1| hypothetical protein MIMGU_mgv1a009144mg [Erythranthe guttata]
Length=282

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 60/103 (58%), Gaps = 5/103 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGDS GW  P  G   Y  WA    F+ GDILVFNF+   H VA V  K ++DSCN 
Sbjct  103  TYVVGDSLGWTVPPGGPIAYRTWAMGKTFMVGDILVFNFSNRQHDVAEV-TKAEFDSCNI  161

Query  416  ANANIQNNS--PASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +       +  PA I L+S G +Y+ CT+  HCS GQKL +NV
Sbjct  162  STTTTAPITTGPARITLSSAGENYYICTITQHCSWGQKLAINV  204



>emb|CBI28220.3| unnamed protein product [Vitis vinifera]
Length=301

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = +2

Query  224  VDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYD  403
            V  T++ VGDS GW  P  G   Y  WA+   FV GDILVFNF TG   VA V +K  +D
Sbjct  24   VAQTTHVVGDSLGWLVPPGGPIAYATWADTQTFVVGDILVFNFTTGEQDVARV-SKEGFD  82

Query  404  SCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            SCN+ N  +++   PA+  L++ G +YF  T+  HC  GQKL + V
Sbjct  83   SCNSTNPISLKTTGPANFTLDTVGDYYFIGTMDRHCPLGQKLAIKV  128


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN-  412
            +YTVGD  GW  P  G+  Y+ WA    F+ GD LVFNF  G   VA V  K  YDSCN 
Sbjct  146  TYTVGDILGWVVPPLGEVAYSTWAYNKIFIVGDSLVFNFINGTQDVAVV-TKEAYDSCNT  204

Query  413  AANANIQNNSPASIPLNSTGVHYFFCT--VHCSQGQKLTVNV  532
            ++   +   SP +I L +TG+HYF  T  +HC  GQKL +NV
Sbjct  205  SSTITVYATSPTTITLTTTGMHYFSSTYELHCGLGQKLAINV  246



>ref|XP_011020151.1| PREDICTED: uclacyanin-3-like [Populus euphratica]
Length=280

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            ++V  T++TVGD++GW  P+   + Y++WA    F  G+ILVFNF    H VA V  K D
Sbjct  21   TSVAQTTHTVGDTTGWAIPTGDPAFYSSWAANQTFNIGEILVFNFMANAHDVAKV-TKAD  79

Query  398  YDSCNAANA-NIQNNSPASIPLNSTGVHYFFC--TVHCSQGQKLTVNV  532
            YD+C  ++  +    SPA I L+++G HYF C  T HCS GQK+ +NV
Sbjct  80   YDACTTSSPISSVETSPARINLDASGEHYFICNFTGHCSAGQKMMINV  127



>ref|XP_008354500.1| PREDICTED: umecyanin-like [Malus domestica]
Length=157

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 3/101 (3%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            AT Y VGD  GW  P  G + Y +WA  H FV  D+L F F  G HTVA V  +N ++ C
Sbjct  19   ATEYVVGDDLGWTVPPGGAAYYVSWAANHSFVLNDVLHFKFIEGEHTVAMVTKEN-FEIC  77

Query  410  NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
            N  N   +   P+ I   ++  +YF CT+  HC++GQK+ V
Sbjct  78   NTTNPIFELQKPSIIGFTASDTYYFTCTIAGHCAEGQKVAV  118



>ref|XP_011016343.1| PREDICTED: blue copper protein-like [Populus euphratica]
Length=277

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            ++V  T++TVGD++GW  P+   + Y++WA    F  G+ILVFNF    H VA V  K D
Sbjct  21   TSVAQTTHTVGDTTGWAIPTGDPAFYSSWAANQTFNIGEILVFNFMANAHDVAKV-TKAD  79

Query  398  YDSCNAANA-NIQNNSPASIPLNSTGVHYFFC--TVHCSQGQKLTVNV  532
            YD+C  ++  +    SPA I L+++G HYF C  T HCS GQK+ +NV
Sbjct  80   YDACTTSSPISSVETSPARINLDASGEHYFICNFTGHCSAGQKMMINV  127



>ref|XP_006826439.1| hypothetical protein AMTR_s00004p00170860 [Amborella trichopoda]
 gb|ERM93676.1| hypothetical protein AMTR_s00004p00170860 [Amborella trichopoda]
Length=217

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A  +T+G S+GW  P +  S YT WAN  +F  GD L+FNF+TG H    V +K++YD+C
Sbjct  23   AVVHTLGGSTGWTVPPS-SSFYTTWANGQKFEMGDSLLFNFSTGAHNALEV-SKSEYDAC  80

Query  410  NAANANIQNNS--PASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              AN+ IQ  S  PA++ L+ TG HY+ C+   HC  GQK+ VNV
Sbjct  81   T-ANSPIQAYSTGPATVELSKTGTHYYLCSFGQHCISGQKVAVNV  124



>ref|XP_007204796.1| hypothetical protein PRUPE_ppa018102mg, partial [Prunus persica]
 gb|EMJ05995.1| hypothetical protein PRUPE_ppa018102mg, partial [Prunus persica]
Length=220

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
               +A ++TVG +SGW T +     YT+WA  H F  GDILVF F TG H VA +  K  
Sbjct  28   ERAEAETHTVGGASGW-TNTLAPEFYTSWAANHTFKVGDILVFEFTTGGHDVARL-GKEA  85

Query  398  YDSCNAAN--ANIQNNSPASIPLNSTGVHYFFC--TVHCSQGQKLTVNV  532
            +D+CN  +  +  +N  PA   LN TG +YF C    HCSQGQKL++ V
Sbjct  86   FDACNNTDLLSPPENQGPAKYSLNQTGDYYFICAFPAHCSQGQKLSIKV  134



>ref|XP_011087502.1| PREDICTED: umecyanin-like [Sesamum indicum]
Length=154

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 66/122 (54%), Gaps = 12/122 (10%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            L+ V T+F    +   A +YTVGD+ GW  P  GD  Y  WA +  F  GD ++F ++ G
Sbjct  11   LMAVATLF----AGCAADTYTVGDNLGWTIPPLGDVAYRTWAAKEDFDLGDNIIFRWS-G  65

Query  362  LHTVATVNNKNDYDSCNAANAN----IQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLT  523
             H V  V  K  YD+C A N      IQ  SP +  LNST  HYF CT+  HC  GQK+T
Sbjct  66   THDVVQV-TKEGYDNCTATNTTALTPIQTTSPYTFTLNSTAPHYFICTIENHCRLGQKVT  124

Query  524  VN  529
            + 
Sbjct  125  IQ  126



>ref|XP_003549750.2| PREDICTED: blue copper protein-like [Glycine max]
Length=242

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVG+++GW  P N  S Y AWA+   F  GDILVFN+ +  H V  V  K +YDSC++
Sbjct  88   TYTVGETAGWIVPGNA-SFYPAWASAKNFKVGDILVFNYPSNAHNVEEV-TKANYDSCSS  145

Query  416  ANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            A+        PA +PL+ +G HY+ C +  HC  GQKL++NV
Sbjct  146  ASPIATFTTPPARVPLSKSGEHYYICGIPGHCLGGQKLSINV  187



>ref|NP_001236879.1| uncharacterized protein LOC100305545 precursor [Glycine max]
 gb|ACU13277.1| unknown [Glycine max]
Length=171

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 73/130 (56%), Gaps = 9/130 (7%)
 Frame = +2

Query  164  MAKMMELLV--VMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            M KM  L +  V+   L  +   +A TSY VGD +GW  P +  STY  WA+   F  GD
Sbjct  1    MNKMTGLALGGVVAAILMVLQYAEAQTSYVVGDGTGWRVPQDA-STYQNWASDKNFTVGD  59

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HC  502
             L F F TGLH V  V+ ++ Y+SC++AN      N  PA++ LN  G HY+ C+   HC
Sbjct  60   TLSFIFQTGLHNVIEVSEES-YNSCSSANPIGTTYNTGPANVTLNRGGEHYYICSFGNHC  118

Query  503  SQGQKLTVNV  532
            + GQ+L + V
Sbjct  119  NNGQRLAITV  128



>gb|KHN37985.1| Blue copper protein [Glycine soja]
Length=172

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 73/130 (56%), Gaps = 9/130 (7%)
 Frame = +2

Query  164  MAKMMELLV--VMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGD  334
            M KM  L +  V+   L  +   +A TSY VGD +GW  P +  STY  WA+   F  GD
Sbjct  1    MNKMTGLALGGVVAAILMVLQYAEAQTSYVVGDGTGWRVPQDA-STYQNWASDKNFTVGD  59

Query  335  ILVFNFNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HC  502
             L F F TGLH V  V+ ++ Y+SC++AN      N  PA++ LN  G HY+ C+   HC
Sbjct  60   TLSFIFQTGLHNVIEVSEES-YNSCSSANPIGTTYNTGPANVTLNRGGEHYYICSFGNHC  118

Query  503  SQGQKLTVNV  532
            + GQ+L + V
Sbjct  119  NNGQRLAITV  128



>ref|XP_009595673.1| PREDICTED: cucumber peeling cupredoxin-like [Nicotiana tomentosiformis]
Length=220

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 75/129 (58%), Gaps = 11/129 (9%)
 Frame = +2

Query  176  MELLVVMTVFLS-AVSNV--DATSYTV---GDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M+ ++ M VF++ AV+++  D T+ TV   GD+ GW  P+NG + YT WA    F  GD 
Sbjct  1    MDKMLCMIVFVALAVASLVQDTTAQTVHVVGDNIGWTIPNNGAAAYTNWAAGKTFRVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T  H V  V  K  +D CN+ NA  N     PA++ L+S G HY+ CT   HC 
Sbjct  61   LVFNFMTDSHDVLQV-QKTSFDGCNSQNAIGNPIMAGPANVTLDSAGDHYYICTFGRHCQ  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>ref|XP_011101849.1| PREDICTED: mavicyanin-like [Sesamum indicum]
Length=186

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 76/126 (60%), Gaps = 12/126 (10%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MAK++  ++++ +  +A +   AT++TVG   GWNT       Y  WA++  F TGD L+
Sbjct  1    MAKLIAFVLLLLISPAAYA---ATTHTVGGLRGWNT----GVKYDDWASEQTFATGDSLL  53

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            F ++   HTV  V  + DY SC++AN  N   +SP ++PLN+TG  YF C    HCSQG 
Sbjct  54   FIYDIS-HTVDEVT-EADYQSCSSANPINSYPSSPTTVPLNATGTRYFICPRSNHCSQGM  111

Query  515  KLTVNV  532
            KLTV V
Sbjct  112  KLTVTV  117



>ref|XP_006364217.1| PREDICTED: cucumber peeling cupredoxin-like [Solanum tuberosum]
Length=185

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 69/129 (53%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLS-AVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M KM+ ++V   + +   V +  A T + VGDS GW  PSNG   YT W     F  GD 
Sbjct  1    MDKMLYMIVFSALVIGNMVQDTTAQTVHVVGDSMGWIVPSNGAVAYTNWTAGKTFRVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCT--VHCS  505
            LVFNF T  H V  V  +  +D CN+ NA        PA+I LNST  HYF CT   HC 
Sbjct  61   LVFNFATDRHDVLQV-EETSFDGCNSQNAIGTAIMTGPANITLNSTDDHYFICTFGTHCQ  119

Query  506  QGQKLTVNV  532
             GQKL ++V
Sbjct  120  GGQKLEISV  128



>ref|XP_007155021.1| hypothetical protein PHAVU_003G166500g [Phaseolus vulgaris]
 gb|ESW27015.1| hypothetical protein PHAVU_003G166500g [Phaseolus vulgaris]
Length=173

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 69/119 (58%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  LVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGL  364
            L+V  + +      +A  + VG +SGW  P +  S Y+++A    F   D LVF F TG+
Sbjct  9    LLVAAILMPLPYITEAAEHVVGGASGWIIPLDNPSLYSSFAATTTFRVNDTLVFKFKTGV  68

Query  365  HTVATVNNKNDYDSCNAANANIQ-NNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            H V T++ K+ ++SCN ++A    N SPA I LN TG  YF C    HCS GQKL++NV
Sbjct  69   HNVVTLSQKH-FESCNVSDAMESFNTSPAIITLNRTGEFYFACAFPSHCSLGQKLSINV  126



>ref|XP_009368875.1| PREDICTED: cucumber peeling cupredoxin-like [Pyrus x bretschneideri]
Length=177

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVD---ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVT  328
            K M  M+  LVVM V   ++ N+    A  Y VGDS GW  P N  S Y+ WA    F  
Sbjct  5    KDMNMMIACLVVMAVASPSLLNLKGATAAEYVVGDSLGWTVPPN-TSFYSDWAASKTFQI  63

Query  329  GDILVFNFNTGL-HTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--H  499
            GD +VFN+  G  H V  V +K +YD+C  ++  I         LNSTG  +F CTV  H
Sbjct  64   GDTVVFNWTEGWDHNVGEVASKEEYDNC--SDPGIVLGPGVRTELNSTGSRFFICTVGNH  121

Query  500  CSQGQKLTVNV  532
            C QGQK+T+ V
Sbjct  122  CQQGQKVTITV  132



>ref|XP_009599506.1| PREDICTED: cucumber peeling cupredoxin-like [Nicotiana tomentosiformis]
Length=203

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 76/129 (59%), Gaps = 7/129 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA--TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M +++ ++V+  + ++++  V    T + VGD+ GW+ P+NG + YT WA+   F  GD+
Sbjct  1    MDRVLCMVVIGALTIASLLQVTTAQTRHVVGDNIGWSIPNNGAAAYTNWASGKTFRVGDV  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T  H V  V  K  +D+C + NA  +     PA++ L+S G HY+ CT   HC 
Sbjct  61   LVFNFATNQHDVLQV-PKASFDACGSQNAIGDPIMTGPANVTLDSPGDHYYICTFGRHCQ  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  AGQKLAITV  128



>ref|XP_008242790.1| PREDICTED: cucumber peeling cupredoxin [Prunus mume]
Length=238

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 10/111 (9%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
               +A ++TVG +SGW T +     YT+WA  H F  GDILVF F TG H VA +  K  
Sbjct  28   ERAEAETHTVGGASGW-TNTLAPEFYTSWAANHTFKVGDILVFEFTTGGHDVARL-GKEA  85

Query  398  YDSCNAANANI----QNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +D+CN  N ++    +N  PA   LN TG +YF C    HCSQGQKL++ V
Sbjct  86   FDACN--NTDLLSLPENQGPAKYSLNQTGDYYFICAFPGHCSQGQKLSIKV  134



>ref|XP_004139413.1| PREDICTED: uncharacterized protein LOC101206368 [Cucumis sativus]
Length=348

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + LLV+  V   A+  +    T++ VGDS GW  P  G   Y  WA  H F+ GDI
Sbjct  1    MARTLALLVLAIVATCALVQTTTAGTTHVVGDSLGWVVPIGGPVVYATWAVSHTFLVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            L+FNF TG   VA V  +  + +CN+ N  +++   PA+  L++ G +YF  T+  HC  
Sbjct  61   LLFNFTTGEEDVARV-TREAFLTCNSTNPISLKTTGPANFTLDTLGEYYFIGTLDKHCIL  119

Query  509  GQKLTVNV  532
            GQ+L +NV
Sbjct  120  GQRLAINV  127


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDST--YTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
            +  +YTVGD  GW  P        Y +WA    F+ GD L+FNF  G   VA V  K  +
Sbjct  147  EPKNYTVGDKLGWLIPPPDPLGLFYASWAYNKTFLVGDTLIFNFYNGSDDVAVV-TKEVF  205

Query  401  DSCN-AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            DSCN  +   + N++PA+I LNSTG HY+  T   HC  GQKL +NV
Sbjct  206  DSCNITSTLEVFNSTPANIALNSTGEHYYTSTYEKHCMLGQKLAINV  252



>dbj|BAI52948.1| blue copper protein precursor [Citrullus lanatus subsp. vulgaris]
Length=171

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 68/117 (58%), Gaps = 8/117 (7%)
 Frame = +2

Query  203  FLSAVSNVDATSYTV---GDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTV  373
            FL+ V    AT+ TV   GD++GW  P +G + Y+ WA    F  GD L FNF TG H V
Sbjct  11   FLAVVFLQHATAQTVHVVGDNTGWTVPQDGPAFYSGWAANKNFRVGDSLTFNFQTGSHDV  70

Query  374  ATVNNKNDYDSCN--AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
              V +K  +D CN    + +I    P ++ L+ T +HYF+ T+  HCS GQKL++NV
Sbjct  71   LKV-SKESFDRCNFTGDDDDIIRTGPTTVRLHETDMHYFYWTIRTHCSLGQKLSINV  126



>ref|XP_002299749.2| hypothetical protein POPTR_0001s19280g [Populus trichocarpa]
 gb|EEE84554.2| hypothetical protein POPTR_0001s19280g [Populus trichocarpa]
Length=212

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 8/118 (7%)
 Frame = +2

Query  191  VMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHT  370
            +M +F  +V+    T Y VGD+ GW  P  G   Y  WA+   F+ GD L FNF T  H 
Sbjct  14   MMVLFQRSVAQ---TVYVVGDNDGWTVPQAGAQAYITWASGKNFMVGDTLTFNFTTNNHD  70

Query  371  VATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            V  V  K  +D+C ++N+  ++ +  P +I L+STG HY+ CT+  HC  GQKL + V
Sbjct  71   VLRV-QKESFDACTSSNSIGDVISTGPVNITLDSTGEHYYICTIGRHCQFGQKLAITV  127



>ref|XP_008228689.1| PREDICTED: cucumber peeling cupredoxin-like [Prunus mume]
Length=209

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (58%), Gaps = 8/120 (7%)
 Frame = +2

Query  188  VVMTVFLSAVSNVDATSYTVGDSSGWNTP-SNGDSTYTAWANQHQFVTGDILVFNFNTGL  364
            +V+++FL +V+      + VGDS GW  P S G   Y  WA+ ++FV GDIL FNF T  
Sbjct  7    LVVSMFLQSVAAQKV--HEVGDSIGWAIPPSGGAQAYVNWADNNKFVVGDILFFNFTTNA  64

Query  365  HTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            H V  V  K  +DSC + NA  +     PA++ L S G HYF CT+  HC  GQKL + V
Sbjct  65   HDVLQV-PKASFDSCRSDNAIGSTITTGPANVTLTSAGEHYFICTLGSHCQSGQKLAITV  123



>ref|XP_008358045.1| PREDICTED: umecyanin-like [Malus domestica]
Length=206

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 3/101 (3%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            AT Y VGD  GW  P  G + Y +WA  H FV  D+L F F  G HTVA V  +N ++ C
Sbjct  19   ATEYVVGDDLGWTVPPGGAAYYVSWAANHSFVLNDVLHFKFIEGEHTVAMVTKEN-FEIC  77

Query  410  NAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
            N  N   +   P+ I   ++  +YF CT+  HC++GQK+ V
Sbjct  78   NTTNPIFELQKPSIIGFTASDTYYFTCTIAGHCAEGQKIAV  118



>ref|XP_009365430.1| PREDICTED: cucumber peeling cupredoxin-like [Pyrus x bretschneideri]
Length=211

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 63/118 (53%), Gaps = 7/118 (6%)
 Frame = +2

Query  191  VMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHT  370
            V+ VFL   +    T + VGDS GW  P +G   Y  WA  ++FV GD LVFNF T  H 
Sbjct  12   VVAVFLQTAAA--QTGHVVGDSIGWTIPQSGAQEYVTWAASNKFVVGDTLVFNFATNAHD  69

Query  371  VATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            V  V  K  +DSC++ N         PA+I L S G HY+ CT   HC  GQKL + V
Sbjct  70   VLEV-PKASFDSCSSENPIGTAITTGPANITLTSAGDHYYICTYGRHCQSGQKLAITV  126



>ref|XP_004953983.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=220

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 8/108 (7%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            S   A+SYTVGD SGW T  +    YT+W     F  GD LVFN+  GLHTV  V +  +
Sbjct  22   STAAASSYTVGDGSGWTTGVD----YTSWTASKTFKVGDSLVFNYAKGLHTVVEV-SAAE  76

Query  398  YDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            Y +C AAN    ++S A ++PL + G HYF C++  HC  G KL V V
Sbjct  77   YMACTAANPLGSDSSGATTVPLKTPGTHYFVCSITGHCGAGMKLAVTV  124



>emb|CDY45100.1| BnaA02g04760D [Brassica napus]
Length=176

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA   + +  M +  +AV  V A  Y VGD + W  PS+ +  Y  WA++  F+ GD+L 
Sbjct  1    MAGFFKTVTFMVLVFAAV--VSAEDYEVGDDAKWARPSDLE-FYNTWASKKTFLVGDVLD  57

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            F F+   H VA V   ++Y++C      ++   SPA I LN TG  YF CT   HC  GQ
Sbjct  58   FEFDAERHDVAIV-TADEYENCEKETPLSLIKTSPAKIMLNDTGPIYFICTSADHCRFGQ  116

Query  515  KLTVNV  532
            KLTVNV
Sbjct  117  KLTVNV  122



>gb|KGN60691.1| hypothetical protein Csa_2G006860 [Cucumis sativus]
Length=361

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + LLV+  V   A+  +    T++ VGDS GW  P  G   Y  WA  H F+ GDI
Sbjct  1    MARTLALLVLAIVATCALVQTTTAGTTHVVGDSLGWVVPIGGPVVYATWAVSHTFLVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            L+FNF TG   VA V  +  + +CN+ N  +++   PA+  L++ G +YF  T+  HC  
Sbjct  61   LLFNFTTGEEDVARV-TREAFLTCNSTNPISLKTTGPANFTLDTLGEYYFIGTLDKHCIL  119

Query  509  GQKLTVNV  532
            GQ+L +NV
Sbjct  120  GQRLAINV  127


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDST--YTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
            +  +YTVGD  GW  P        Y +WA    F+ GD L+FNF  G   VA V  K  +
Sbjct  147  EPKNYTVGDKLGWLIPPPDPLGLFYASWAYNKTFLVGDTLIFNFYNGSDDVAVV-TKEVF  205

Query  401  DSCN-AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            DSCN  +   + N++PA+I LNSTG HY+  T   HC  GQKL +NV
Sbjct  206  DSCNITSTLEVFNSTPANIALNSTGEHYYTSTYEKHCMLGQKLAINV  252



>ref|XP_002527193.1| Early nodulin 16 precursor, putative [Ricinus communis]
 gb|EEF35206.1| Early nodulin 16 precursor, putative [Ricinus communis]
Length=312

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 69/126 (55%), Gaps = 4/126 (3%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M+K++ + ++   F S ++   A +  VGD  GW  P  GD  Y  WA  + F  GD+LV
Sbjct  1    MSKIVSVAILAIAFASLLNTTTAKTLVVGDGLGWLVPPGGDLAYATWAAINTFTVGDVLV  60

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            FNF TG   VA V  K  Y  CN+ N   ++   PA+  L++TG ++F  T+  HC  GQ
Sbjct  61   FNFTTGQQDVARV-TKEAYLFCNSTNPIALKTTGPANFTLDTTGAYFFISTMDKHCPLGQ  119

Query  515  KLTVNV  532
            +L + V
Sbjct  120  RLAIYV  125


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 63/112 (56%), Gaps = 6/112 (5%)
 Frame = +2

Query  209  SAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNN  388
            S V N    +YTVGD  GW  P  G   Y  WA    F+ GD+LVFNF  GL  VA V  
Sbjct  141  SPVPNRAPVTYTVGDGMGWIVPPGGALAYMTWAYNKTFIVGDVLVFNFVDGLQDVALV-T  199

Query  389  KNDYDSCNAANANIQ--NNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            K  Y++CN  N+ IQ  + SPA+I LN+TG ++F  T    C  GQ+L + V
Sbjct  200  KEAYETCN-TNSTIQVWSTSPANILLNATGDYFFTSTYPNRCILGQQLAIRV  250



>gb|KHG26691.1| Blue copper -like protein [Gossypium arboreum]
Length=236

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VG S+GW  P+N D  Y  WA+   FV GD LVFNF TG H VA V  +  Y++CN 
Sbjct  26   TYKVGGSTGWRVPTNID-FYEDWADDKVFVVGDALVFNFTTGKHNVAVV-TEAAYEACNT  83

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +   I  + PA I LN TG  YF C V  HCS GQKL V V
Sbjct  84   TDTITIICDGPARITLNRTGNFYFICAVPGHCSGGQKLRVEV  125



>ref|XP_006655916.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=195

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T YTVGD+SGW   ++    YT WA+  +   GDILVFN+  G HTV  V +  DY SC+
Sbjct  22   TKYTVGDTSGWAMGAD----YTTWASDKKLKVGDILVFNYAGGSHTVDEV-SAADYASCS  76

Query  413  AANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            A+NA   + S A ++ L + G HYF C V  HCS G KL V+V
Sbjct  77   ASNALASDGSGATTVTLKTAGKHYFICGVAGHCSNGMKLVVDV  119



>ref|XP_006346595.1| PREDICTED: cucumber peeling cupredoxin-like [Solanum tuberosum]
Length=166

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (53%), Gaps = 7/127 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            M K++   + M + L     +  T + VGDS GW+ P NG + YT WA+ +    GD LV
Sbjct  1    MEKIVCGALTMAILLQV--TIAQTDHIVGDSFGWSIPINGAAAYTMWADANTIKIGDTLV  58

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            F F  G H V  V +++ Y+ C+  N+        PA I + + G HY+ CTV  HC  G
Sbjct  59   FKFTEGNHDVQEV-SRSSYEECSTQNSIGEAIKKGPAKITMQTLGDHYYICTVGEHCLAG  117

Query  512  QKLTVNV  532
            QK+ + V
Sbjct  118  QKMAIKV  124



>ref|XP_009782681.1| PREDICTED: cucumber peeling cupredoxin-like [Nicotiana sylvestris]
 dbj|BAB16429.1| NtEIG-A1 [Nicotiana tabacum]
Length=184

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 11/129 (9%)
 Frame = +2

Query  176  MELLVVMTVF--LSAVSNVD----ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M++++ M +F  L+  S V      T++ VGD+ GW  PS+G S YT WA    F+ GD 
Sbjct  1    MDMIMRMVLFGALALASLVQLTTAQTAHVVGDNEGWTIPSSGASAYTNWAAGKTFMVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T  H V  V  K  +D C++ NA  +   + PA++ L+S G  Y+ CT   HC 
Sbjct  61   LVFNFMTNTHDVLQV-PKASFDGCSSQNAIGSAIVSGPANVTLDSAGERYYICTFGRHCQ  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>ref|XP_007202499.1| hypothetical protein PRUPE_ppa010678mg [Prunus persica]
 gb|EMJ03698.1| hypothetical protein PRUPE_ppa010678mg [Prunus persica]
Length=240

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 74/122 (61%), Gaps = 9/122 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDAT-SYTVGDSSGWNT-PSNGDSTYTAWANQHQFVTGDILVFNFN  355
              V M      +++V A  +Y VGD+ GW   PS    TY+ WA+   F  GD+LVF F+
Sbjct  9    FFVAMAALALVMNSVGAANTYEVGDAFGWVVAPS---VTYSTWASNKTFTVGDVLVFKFS  65

Query  356  TGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
            TG H VA V   N YDSC+A +  +++   PA++ L+++G HY+ CT   HC+ GQKL++
Sbjct  66   TGNHDVAKVTKAN-YDSCSATSPISLETKGPANLTLSTSGEHYYICTFGGHCAGGQKLSI  124

Query  527  NV  532
            NV
Sbjct  125  NV  126



>ref|NP_001267496.1| cucumber peeling cupredoxin-like precursor [Cucumis sativus]
 gb|AAC32421.1| stellacyanin [Cucumis sativus]
 gb|KGN45265.1| hypothetical protein Csa_7G432470 [Cucumis sativus]
Length=182

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            L ++  VFL   +   +T + VGD++GW+ PS+ +  Y+ WA    F  GD L FNF   
Sbjct  10   LGLIAVVFLHP-ATAQSTVHIVGDNTGWSVPSSPN-FYSQWAAGKTFRVGDSLQFNFPAN  67

Query  362  LHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVN  529
             H V  +  K  +D+CN  N+  +++  SP    L+  G+HYF CTV  HCS GQKL++N
Sbjct  68   AHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSIN  127

Query  530  V  532
            V
Sbjct  128  V  128



>ref|XP_008786863.1| PREDICTED: stellacyanin-like [Phoenix dactylifera]
 ref|XP_008779321.1| PREDICTED: stellacyanin-like [Phoenix dactylifera]
Length=188

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 6/103 (6%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            ++ VG S+GW  P N  S Y+ WA+   F  GD LVFNF TG HTV  V  K+ YD C+ 
Sbjct  33   THVVGGSTGWIVPPN-SSFYSDWASTQTFAVGDTLVFNFQTGSHTVDKV-TKSGYDDCST  90

Query  416  AN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +N   +     PAS+ L + G HYF C +  HCS GQKL+V V
Sbjct  91   SNLIGSAITTGPASVSLTTAGDHYFICGIPGHCSAGQKLSVTV  133



>ref|XP_009364010.1| PREDICTED: blue copper protein-like [Pyrus x bretschneideri]
Length=300

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M K + + ++    +  + +  A  ++ VGD  GW  P  G   Y +WA  H F  GD+L
Sbjct  1    MGKELSIAILAIAVVGLLHSTAAMETHVVGDKIGWVVPPGGQYAYASWAAVHHFAVGDLL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQG  511
            VFNF  G   VA V  K  +D+CN+ +   ++  SPA+  LN+TG +YF  T   HC  G
Sbjct  61   VFNFTNGDQDVARV-TKEAFDNCNSTDPITLETTSPANFTLNTTGEYYFIGTKDKHCELG  119

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  120  QKLAINV  126


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (54%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGD  GW  P + +  Y AWA    F+ GD LVF+F  G      +  K  Y++C  
Sbjct  144  TYVVGDQLGWLVPGD-EQAYAAWAYFKTFIVGDTLVFHFVNGTQDDVALVTKPAYENCTT  202

Query  416  -ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +   +  NSP +I LN++G H+F  T   HC  GQKL +NV
Sbjct  203  NSTIAVYTNSPVNILLNTSGEHFFISTYDRHCLLGQKLAINV  244



>ref|XP_008652820.1| PREDICTED: mavicyanin [Zea mays]
 tpg|DAA61875.1| TPA: blue copper protein isoform 1 [Zea mays]
 tpg|DAA61876.1| TPA: blue copper protein isoform 2 [Zea mays]
Length=158

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA  + L+V +       +   ATSYTVGDS GW T       Y++WA+++ FV GD LV
Sbjct  1    MANALPLIVALVAAAGCAALASATSYTVGDSQGWTTTG---VDYSSWASRNTFVVGDTLV  57

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQ  514
            FN+ +  HTV  V +K  YD+C+ ANA   +++ + +I L + G HYF C V  HC+ G 
Sbjct  58   FNYVSKAHTVTEV-SKAGYDACSGANALSDDDTGSTTITLQTPGTHYFICNVPGHCASGM  116

Query  515  KLTVNV  532
            KL V V
Sbjct  117  KLAVAV  122



>gb|ACG34757.1| blue copper protein precursor [Zea mays]
Length=158

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA  + L+V +       +   ATSYTVGDS GW T       Y++WA+++ FV GD LV
Sbjct  1    MANALPLIVALVAAAGCAALASATSYTVGDSQGWTTTG---VDYSSWASRNTFVVGDTLV  57

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQ  514
            FN+ +  HTV  V +K  YD+C+ ANA   +++ + +I L + G HYF C V  HC+ G 
Sbjct  58   FNYVSKAHTVTEV-SKAGYDACSGANALSDDDTGSTTITLQTPGTHYFICNVPGHCASGM  116

Query  515  KLTVNV  532
            KL V V
Sbjct  117  KLAVAV  122



>ref|XP_006450889.1| hypothetical protein CICLE_v10010527mg [Citrus clementina]
 gb|ESR64129.1| hypothetical protein CICLE_v10010527mg [Citrus clementina]
Length=310

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFL-SAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + L + +T  + S + N  A T++ VG   GW  P  G   Y  WA+   F  GDI
Sbjct  1    MARTIILAIAVTACMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQ  508
            L+FNF TG   VA+V  K  Y++CN A+  + +   PA   L + G +YF CT  +HC+ 
Sbjct  61   LLFNFTTGQQDVASV-TKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTL  119

Query  509  GQKLTVNV  532
            GQKL ++V
Sbjct  120  GQKLAIHV  127


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 53/101 (52%), Gaps = 8/101 (8%)
 Frame = +2

Query  239  YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA-  415
            YTVG + GW  P  G   Y +WA+ + F     ++FNF  G   VA V  K  Y++CN  
Sbjct  147  YTVGGNIGWAIPPGGALFYASWASFYSF----FVLFNFANGTQDVAIV-PKGVYETCNIN  201

Query  416  ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +   +  +SP  I L   G +YF  T   HCS GQ+L +NV
Sbjct  202  STIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINV  242



>ref|XP_009595672.1| PREDICTED: cucumber peeling cupredoxin-like [Nicotiana tomentosiformis]
Length=182

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 11/129 (9%)
 Frame = +2

Query  176  MELLVVMTVF--LSAVSNVDATS----YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M++++ M +F  L+  S V  T+    + VGD+ GW  P++G S YT WA    F+ GD 
Sbjct  1    MDMIMRMVLFGALALASLVQLTTAQTVHVVGDNIGWTIPNSGASVYTTWAAGKTFMVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF    H V  V  K  +D C++ NA  +   + PA+I L+S G HY+ CT   HC 
Sbjct  61   LVFNFEKDQHDVLQV-PKASFDGCSSQNAIDSAIMSVPANITLDSAGDHYYICTFGRHCQ  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>ref|XP_002285309.1| PREDICTED: umecyanin-like [Vitis vinifera]
Length=172

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 5/100 (5%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A +Y VG+   W  P N  + Y+ WA+ + F  GD LVFNF TG H VA V  K  +++C
Sbjct  23   AETYEVGNELSWRVPPN-TTAYSTWASAYTFRVGDTLVFNFTTGSHDVAKV-TKEAFNAC  80

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            N+++        PA+  LNSTG +YFFCTV  HCSQGQKL
Sbjct  81   NSSSPLTTLYTGPANYTLNSTGENYFFCTVGSHCSQGQKL  120



>ref|XP_004139412.1| PREDICTED: uncharacterized protein LOC101206131 [Cucumis sativus]
Length=295

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
             L+V   F  + S   A +YTVGD+ GW  P N  + Y+ WA+   FV GDILVFNF +G
Sbjct  9    FLLVAAAFCRSSS---AATYTVGDALGWTVPPN-PTVYSDWASTKTFVVGDILVFNFASG  64

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
             H V  V  K+  DSCN+ N  ++ NNSPA I L S G  +F C+   HCS GQ
Sbjct  65   RHDVTEV-TKSASDSCNSTNPISVANNSPARITLTSAGDRHFICSFPGHCSNGQ  117


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
            +  +Y VGDS GWN P++  + Y +WA    FV GD+L FNF    H VA V  K++Y S
Sbjct  178  EPMTYIVGDSFGWNVPTS-PTFYDSWAQGKTFVVGDVLEFNFLIQRHDVAKV-TKDNYAS  235

Query  407  CNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            C+  +  ++  + P  I L+  G H+F CT   HCS GQKL +NV
Sbjct  236  CSGQSPISLTTSPPVKITLSEPGEHFFICTFAGHCSFGQKLAINV  280



>ref|XP_006476115.1| PREDICTED: blue copper protein-like [Citrus sinensis]
 gb|KDO80197.1| hypothetical protein CISIN_1g020799mg [Citrus sinensis]
Length=321

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFL-SAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + L + +T  + S + N  A T++ VG   GW  P  G   Y  WA+   F  GDI
Sbjct  1    MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQ  508
            L+FNF TG   VA+V  K  Y++CN A+  + +   PA   L + G +YF CT  +HC+ 
Sbjct  61   LLFNFTTGQQDVASV-TKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTL  119

Query  509  GQKLTVNV  532
            GQKL ++V
Sbjct  120  GQKLAIHV  127


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 55/101 (54%), Gaps = 4/101 (4%)
 Frame = +2

Query  239  YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA-  415
            YTVG + GW  P  G   Y +WA+ + F   D LVFNF  G   VA V  K+ Y++CN  
Sbjct  147  YTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIV-PKDVYETCNIN  205

Query  416  ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +   +  +SP  I L   G +YF  T   HCS GQ+L +NV
Sbjct  206  STIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINV  246



>gb|KGN60693.1| hypothetical protein Csa_2G006880 [Cucumis sativus]
Length=336

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
             L+V   F  + S   A +YTVGD+ GW  P N  + Y+ WA+   FV GDILVFNF +G
Sbjct  9    FLLVAAAFCRSSS---AATYTVGDALGWTVPPN-PTVYSDWASTKTFVVGDILVFNFASG  64

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
             H V  V  K+  DSCN+ N  ++ NNSPA I L S G  +F C+   HCS GQ
Sbjct  65   RHDVTEV-TKSASDSCNSTNPISVANNSPARITLTSAGDRHFICSFPGHCSNGQ  117


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
            +  +Y VGDS GWN P++  + Y +WA    FV GD+L FNF    H VA V  K++Y S
Sbjct  178  EPMTYIVGDSFGWNVPTS-PTFYDSWAQGKTFVVGDVLEFNFLIQRHDVAKV-TKDNYAS  235

Query  407  CNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            C+  +  ++  + P  I L+  G H+F CT   HCS GQKL +NV
Sbjct  236  CSGQSPISLTTSPPVKITLSEPGEHFFICTFAGHCSFGQKLAINV  280



>ref|XP_008461121.1| PREDICTED: cucumber peeling cupredoxin-like [Cucumis melo]
Length=193

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 62/102 (61%), Gaps = 6/102 (6%)
 Frame = +2

Query  239  YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNAA  418
            + VGD++GW  PS  D+ Y+ WA ++ F  GD L F F TG H V  V  K  +++CN+ 
Sbjct  26   HVVGDTTGWTVPST-DTFYSEWAVKNAFAVGDSLSFEFLTGAHDVIQV-PKESFEACNSD  83

Query  419  NA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             A  ++    PA++ LN+ GVHYF C++  HC  GQKL V V
Sbjct  84   KAIGSVLTTGPATVKLNTAGVHYFICSIGKHCLGGQKLAVTV  125



>ref|XP_008242860.1| PREDICTED: mavicyanin-like [Prunus mume]
Length=171

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
            +A  Y VGD  GW  P NG +TY  WA+++ F+  DIL F F  G H V  V  +N ++ 
Sbjct  31   EAAEYVVGDDLGWTVPPNGAATYVEWASKYNFLVNDILDFKFAQGEHDVTLVTKEN-FEI  89

Query  407  CNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
            CN+ +   Q   PAS    S    Y  C+   HC+QGQK+ V
Sbjct  90   CNSTDPLFQLQKPASFQFLSADTFYIICSFAGHCAQGQKVAV  131



>ref|XP_007013487.1| Early nodulin 16, putative [Theobroma cacao]
 gb|EOY31106.1| Early nodulin 16, putative [Theobroma cacao]
Length=305

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            MA+   L +++   L+ +    A T++ VGD  GW  P  G   Y+ WA    F  GD+L
Sbjct  1    MARSSSLAILVIALLAILQATAAQTTHVVGDELGWLVPPGGPIAYSTWAAMQTFTVGDVL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VFNF TG   VA V  +  Y++CN+ N  +++   PA+  L+S   +YF  T+   CS G
Sbjct  61   VFNFTTGEQDVAMV-TREAYETCNSTNPISLKTTGPANFTLDSIREYYFIGTMDQRCSLG  119

Query  512  QKLTVNV  532
            QKL +NV
Sbjct  120  QKLAINV  126


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +YTVGD  GW  P  G   Y  WA    F+ GD LVFNF  G   VA V  K  Y++C+ 
Sbjct  145  TYTVGDDLGWLVPPAGPLAYETWAFNKTFLLGDTLVFNFINGTQDVAVV-TKEAYETCDT  203

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             N   +   SPA+I L +TG H+F  T   HC  GQKL +NV
Sbjct  204  NNTITVLTTSPANISLTTTGEHFFTSTYARHCDLGQKLAINV  245



>ref|XP_006421527.1| hypothetical protein CICLE_v10005962mg [Citrus clementina]
 gb|ESR34767.1| hypothetical protein CICLE_v10005962mg [Citrus clementina]
Length=195

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA     ++ +T+     ++V AT+YTVGD++GW T   G   Y +W +  +F  GD LV
Sbjct  1    MAAAKSAVISLTIMALFGASVAATTYTVGDNAGWTT--QGKVDYYSWVDGKEFKVGDTLV  58

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPAS--IPLNSTGVHYFFCTV--HCSQG  511
            F +N  +H V  V  + DY +CN A A+I+++   S  I LN+ G++YF C +  HC  G
Sbjct  59   FKYNNAMHDVHEV-TEADYVACN-AKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAG  116

Query  512  QKLTVNV  532
            Q+L + V
Sbjct  117  QRLRIEV  123



>gb|KDO80195.1| hypothetical protein CISIN_1g018026mg [Citrus sinensis]
Length=233

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            S+   T + VGD+ GW  P NG +TY+ WA    F  GD LVFNF  G H V  V  ++ 
Sbjct  18   SSTAQTRHVVGDALGWIVPPNGPATYSNWAANQTFTVGDTLVFNFAAGNHDVTRV-TQSS  76

Query  398  YDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +++CN  +  +   NSPAS+ L ++G HYF C+   HC  GQKL +NV
Sbjct  77   FNACNTTSPLSRTTNSPASVTLTASGPHYFICSFPGHCLGGQKLAINV  124



>ref|XP_004288796.1| PREDICTED: cucumber peeling cupredoxin-like [Fragaria vesca subsp. 
vesca]
Length=154

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 55/99 (56%), Gaps = 4/99 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
             YTVGD  GW  P   D  Y  W +++ FV  D LVFNF  G+H + TV  K D+DSCN 
Sbjct  21   QYTVGDDMGWMVPPTPDY-YATWVSKYYFVENDTLVFNFKQGMHDI-TVLTKEDFDSCNM  78

Query  416  ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTV  526
            AN   Q+  P  + + ++   YF C+   HC+ GQK  +
Sbjct  79   ANPLFQSPEPGEVMVMASDTFYFTCSFGQHCANGQKFAI  117



>ref|XP_008352254.1| PREDICTED: cucumber peeling cupredoxin-like [Malus domestica]
Length=177

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +2

Query  158  KIMAKMMELLVVMTVFLSAVSNVD---ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVT  328
            K M  M+  LVVM V   ++ N+    A  Y VGDS GW  P N  S Y+ WA    F  
Sbjct  5    KDMNMMIACLVVMAVACPSLLNLKGATAXEYVVGDSLGWTVPPN-TSFYSDWAASKTFQI  63

Query  329  GDILVFNFNTGL-HTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--H  499
            GD +VFN+     H V  V +K +YD+C+  +  I      S  L STG  +F CTV  H
Sbjct  64   GDTVVFNWTEXWEHNVGEVASKEEYDNCS--DPGIVLGPGVSTELKSTGSRFFICTVGNH  121

Query  500  CSQGQKLTVNV  532
            C QGQK+T+ V
Sbjct  122  CEQGQKVTITV  132



>ref|XP_011020152.1| PREDICTED: cucumber peeling cupredoxin-like [Populus euphratica]
Length=166

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 5/126 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            MA  ++ +V + + ++ +    + T Y VGD  GW  P N  S Y  W    +F  GD L
Sbjct  1    MAIRIDWIVFLIIAVALLEGATSETKYKVGDDGGWRVPDN-KSYYENWVGGKKFEVGDSL  59

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
             FN+ T  H V  V  K +YD+C   N  +++ SPA+  L   G +Y+ CT+  HC  GQ
Sbjct  60   EFNW-TDTHNVLEVTTKTEYDACAKTNGILKDTSPATFQLTKDGTYYYICTIGMHCDFGQ  118

Query  515  KLTVNV  532
            K+T+ V
Sbjct  119  KVTIVV  124



>ref|XP_010922520.1| PREDICTED: cucumber peeling cupredoxin-like [Elaeis guineensis]
Length=233

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 7/125 (6%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDS-SGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            MM  +V  ++ L       AT + VG S +GW  P N  S Y  W++   FV GD LVFN
Sbjct  15   MMVAVVAASLLLEGSVVTAATRHVVGGSGTGWTIPPN-ASFYDKWSSSQTFVVGDTLVFN  73

Query  350  FNTGLHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQK  517
            F TG+H V  +  K+ YD+C+  +   +  +  PA++ + S+G HY+ C V  HCS GQK
Sbjct  74   FPTGIHNVVQL-PKSSYDACSTKDQIGSTLSTGPATVTITSSGDHYYICGVSGHCSAGQK  132

Query  518  LTVNV  532
            L + V
Sbjct  133  LAITV  137



>gb|AAB24588.1| cupredoxin, CPC=type I copper protein [Cucumis sativus=cucumbers, 
peelings, Peptide, 137 aa]
Length=137

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 5/106 (5%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDS  406
            ++T + VGD++GW+ PS+ +  Y+ WA    F  GD L FNF    H V  +  K  +D+
Sbjct  1    ESTVHIVGDNTGWSVPSSPN-FYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDA  59

Query  407  CNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            CN  N+  +++  SP    L+  G+HYF CTV  HCS GQKL++NV
Sbjct  60   CNFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINV  105



>ref|XP_004159418.1| PREDICTED: uncharacterized protein LOC101231160 [Cucumis sativus]
Length=499

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAV--SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            MA+ + LLV+  V   A+  +    T++ VGDS GW  P  G   Y  WA  H F+ GDI
Sbjct  1    MARTLALLVLAIVATCALVQTTTAGTTHVVGDSLGWVVPIGGPVVYATWAVSHTFLVGDI  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQ  508
            L+FNF TG   VA V  +  + +CN+ N  +++   PA+  L++ G +YF  T+  HC  
Sbjct  61   LLFNFTTGEEDVARV-TREAFLTCNSTNPISLKTTGPANFTLDTLGEYYFIGTLDKHCIL  119

Query  509  GQKLTVNV  532
            GQ+L +NV
Sbjct  120  GQRLAINV  127


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = +2

Query  227  DATSYTVGDSSGWNTPSNGDST--YTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDY  400
            +  +YTVGD  GW  P        Y +WA    F+ GD L+FNF  G   VA V  K  +
Sbjct  147  EPKNYTVGDKLGWLIPPPDPLGLFYASWAYNKTFLVGDTLIFNFYNGSDDVAVV-TKEVF  205

Query  401  DSCN-AANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            DSCN  +   + N++PA+I LNSTG HY+  T   HC  GQKL +NV
Sbjct  206  DSCNITSTLEVFNSTPANIALNSTGEHYYTSTYEKHCMLGQKLAINV  252


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +2

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQG  511
            VFNF TG H V  V  K   DSC+  N  ++  N PASIPL++ G  +F C++  HCS G
Sbjct  339  VFNFTTGQHDVTEV-TKAGLDSCSGTNPISVMRNGPASIPLSTAGTRHFICSIPTHCSFG  397

Query  512  QKLTVNV  532
            QKLTV V
Sbjct  398  QKLTVTV  404



>ref|XP_009624033.1| PREDICTED: cucumber peeling cupredoxin-like [Nicotiana tomentosiformis]
Length=207

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 71/129 (55%), Gaps = 11/129 (9%)
 Frame = +2

Query  176  MELLVVMTVF--LSAVSNVDATS----YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M+ L+ M VF  L+  S V  T+    + VG++ GW  P+NG + YT WA    F  GD 
Sbjct  1    MDKLLCMIVFGALAVASLVQDTTAQTVHVVGNNIGWTIPNNGAAAYTNWAAGKTFRIGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T  H V  V  K  +D CN+ NA  N     PA++ L+S G HY+ CT   HC 
Sbjct  61   LVFNFMTDSHDVLQV-QKTSFDGCNSQNAIGNPIMAGPANVTLDSAGDHYYICTFGRHCQ  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>ref|XP_007202576.1| hypothetical protein PRUPE_ppa011524mg [Prunus persica]
 gb|EMJ03775.1| hypothetical protein PRUPE_ppa011524mg [Prunus persica]
Length=207

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 83/154 (54%), Gaps = 10/154 (6%)
 Frame = +2

Query  92   FPHHLLIHNTAQG*PEPFEHH*KIMAKMMELLV---VMTVFLSAVSNVDATSYTVGDSSG  262
             P+ L     +QG P+  EH    MA  M L +   ++ V ++ +    A +YTVGD  G
Sbjct  21   IPYVLGRKVESQGRPKA-EHSSTEMANQMGLHIGCLLLVVAVALLKGAAADNYTVGDDLG  79

Query  263  WNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNN  439
            W  P  G   Y  WAN+  F  GD +VFN+ TG HTVA V+  N Y +C  +N   + ++
Sbjct  80   WTIPPAGSIAYKTWANKKNFQIGDTIVFNW-TGSHTVAEVSEAN-YGNCTKSNPLALYDS  137

Query  440  SPASIPLNSTGVHYFFCTV--HCSQ-GQKLTVNV  532
            SP  IPL S    YF CTV  HCS  GQK+T+ +
Sbjct  138  SPVPIPLTSNLTRYFICTVDNHCSGLGQKVTIKI  171



>ref|XP_006490062.1| PREDICTED: blue copper protein-like [Citrus sinensis]
Length=195

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA     ++ +T+     ++V AT+YTVGD++GW T   G   Y +W +  +F  GD LV
Sbjct  1    MAMAKSAVISLTIMALFGASVAATTYTVGDNAGWTT--QGKVDYYSWVDGKEFKVGDTLV  58

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPAS--IPLNSTGVHYFFCTV--HCSQG  511
            F +N  +H V  V  + DY  CNA  A+I+++   S  I LN+ G++YF C +  HC  G
Sbjct  59   FKYNNAMHDVHEVT-EADYVECNA-KASIKHHISGSDAITLNAPGIYYFICGIPGHCQAG  116

Query  512  QKLTVNV  532
            Q+L + V
Sbjct  117  QRLRIEV  123



>ref|XP_009760367.1| PREDICTED: cucumber peeling cupredoxin-like [Nicotiana sylvestris]
Length=219

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 71/129 (55%), Gaps = 10/129 (8%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNV--DATSYTV---GDSSGWNTPSNGDSTYTAWANQHQFVTGDI  337
            M ++L V+     AV+N+  D T+ TV   GD+ GW  P+NG   YT WA    F  GD 
Sbjct  1    MDKILCVIVFGALAVANLVQDITAQTVHVVGDNIGWTIPNNGAVAYTNWAAGKTFSVGDT  60

Query  338  LVFNFNTGLHTVATVNNKNDYDSCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCS  505
            LVFNF T  H V  V  K  +D CN+ NA  +     PA++ L+S G HY+ CT   HC 
Sbjct  61   LVFNFGTNQHDVLQV-QKTSFDECNSQNAIGDPIMAGPANVTLDSAGDHYYICTFGRHCQ  119

Query  506  QGQKLTVNV  532
             GQKL + V
Sbjct  120  NGQKLAITV  128



>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0
Length=138

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +2

Query  224  VDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYD  403
            + +T + VGD++GW+ PS+ +  Y+ WA    F  GD L FNF    H V  +  K  +D
Sbjct  1    MQSTVHIVGDNTGWSVPSSPN-FYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFD  59

Query  404  SCNAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +CN  N+  +++  SP    L+  G+HYF CTV  HCS GQKL++NV
Sbjct  60   ACNFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINV  106



>ref|XP_004237949.1| PREDICTED: blue copper protein [Solanum lycopersicum]
Length=180

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 70/123 (57%), Gaps = 9/123 (7%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNF  352
            M +LL V  +F+  V    A  YTVGDSSGW    +    YT WA+      GD LVFN+
Sbjct  1    MGKLLAVTFLFMCCVVPSLAKVYTVGDSSGWGLGVD----YTTWASGITLNVGDSLVFNY  56

Query  353  NTGLHTVATVNNKNDYDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQKLT  523
             +G HTV  V++ +DY SC   N+   ++S A +IPL + G HYF C V  HCS G KL 
Sbjct  57   PSG-HTVDEVSS-SDYSSCTTGNSITSDSSGATTIPLKTAGTHYFICGVMGHCSGGMKLA  114

Query  524  VNV  532
            V V
Sbjct  115  VTV  117



>ref|XP_002460378.1| hypothetical protein SORBIDRAFT_02g027260 [Sorghum bicolor]
 gb|EER96899.1| hypothetical protein SORBIDRAFT_02g027260 [Sorghum bicolor]
Length=155

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 63/104 (61%), Gaps = 8/104 (8%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            ATSYTVGD  GW T    +  Y+ WA+   F  GD LVFN+ +  H+V  V+ K+ YD+C
Sbjct  22   ATSYTVGDGQGWTT----NVDYSTWASGKSFAVGDKLVFNYMSKAHSVTEVS-KSGYDTC  76

Query  410  NAANANIQNNSPASI-PLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            + AN    + S +++ PL + G HYF C V  HC++G KL V V
Sbjct  77   SGANPLSDDESGSTVVPLQTPGTHYFICNVPGHCAEGMKLAVAV  120



>ref|XP_008456869.1| PREDICTED: cucumber peeling cupredoxin-like [Cucumis melo]
Length=224

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 63/111 (57%), Gaps = 5/111 (5%)
 Frame = +2

Query  209  SAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNN  388
            S      A ++ VGDS GW  P +  +TY+ WA+   F+ GD L FNF TGLH V  V  
Sbjct  19   SPPQRAAAATHNVGDSLGWTIPPS-PTTYSDWASTKTFLVGDTLFFNFTTGLHDVTEV-T  76

Query  389  KNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            K   DSC+  N  +     PASI L++ G  +F C++  HCS GQ+LTV V
Sbjct  77   KAGLDSCSGTNPISAMRTGPASIKLSAAGTRHFICSIPTHCSFGQQLTVTV  127



>ref|XP_008385451.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=300

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M K + + ++    +  + +  A  ++ VGD  GW  P  G   Y +WA  H F  GD+L
Sbjct  1    MGKELSIALLAIAVVGLLHSTGAMETHVVGDKIGWVVPPGGQYAYESWAAMHHFAVGDLL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQG  511
            VFNF  G   VA V  K  +D+CN+ +   ++  SPA+  LN+TG +YF  T   HC  G
Sbjct  61   VFNFTNGDQDVARV-TKEAFDNCNSTDPITLKTTSPANFTLNTTGEYYFIGTKDKHCELG  119

Query  512  QKLTVNV  532
            QKL  NV
Sbjct  120  QKLAXNV  126


 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 54/102 (53%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGD  GW  P  G+  Y AWA    F+ GD LVFN   G      +  K  Y++C  
Sbjct  144  TYVVGDKLGWLVP-GGEQAYAAWAYGKTFIVGDTLVFNIVNGTQDDVALVTKPAYENCTT  202

Query  416  -ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +   +  NSP SI LN++G H+F  T   HC  GQKL +NV
Sbjct  203  NSTIAVYKNSPVSILLNTSGEHFFISTYDRHCLLGQKLAINV  244



>ref|XP_006450887.1| hypothetical protein CICLE_v10008731mg [Citrus clementina]
 ref|XP_006475878.1| PREDICTED: early nodulin-like protein 2-like [Citrus sinensis]
 gb|ESR64127.1| hypothetical protein CICLE_v10008731mg [Citrus clementina]
 gb|KDO80193.1| hypothetical protein CISIN_1g018026mg [Citrus sinensis]
Length=362

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            S+   T + VGD+ GW  P NG +TY+ WA    F  GD LVFNF  G H V  V  ++ 
Sbjct  18   SSTAQTRHVVGDALGWIVPPNGPATYSNWAANQTFTVGDTLVFNFAAGNHDVTRV-TQSS  76

Query  398  YDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            +++CN  +  +   NSPAS+ L ++G HYF C+   HC  GQKL +NV
Sbjct  77   FNACNTTSPLSRTTNSPASVTLTASGPHYFICSFPGHCLGGQKLAINV  124


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 58/102 (57%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            ++ VG + GW  P N    Y  WA  + F  GDILVF++   +H V  V  K  YDSCN+
Sbjct  197  THVVGGALGWTVPPNASVGYQNWARNNNFSVGDILVFDYPARVHDVVEVT-KAAYDSCNS  255

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            ++  +   N P  I L + G HYFFCT   HCS GQKL VNV
Sbjct  256  SSTISKSTNPPTRITLGTAGEHYFFCTFPGHCSAGQKLAVNV  297



>ref|XP_006421531.1| hypothetical protein CICLE_v10006656mg [Citrus clementina]
 gb|ESR34771.1| hypothetical protein CICLE_v10006656mg [Citrus clementina]
Length=212

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA     ++ +T+     ++V AT+YTVGD++GW T   G   Y +W +  +F  GD LV
Sbjct  1    MAMAKSAVISLTIMALLGASVAATTYTVGDNTGWTT--QGKVDYYSWVDGKEFKVGDTLV  58

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPAS--IPLNSTGVHYFFCTV--HCSQG  511
            F +N  +H V  V  + DY +CN A A+I+++   S  I LN+ G++YF C +  HC  G
Sbjct  59   FKYNNAMHDVHEV-TEADYVACN-AKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAG  116

Query  512  QKLTVNV  532
            Q+L + V
Sbjct  117  QRLRIEV  123



>ref|XP_009126430.1| PREDICTED: blue copper protein-like [Brassica rapa]
Length=234

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA   + +  M +  +AV  V A  Y VGD + W  PS+ +  Y  WA++  F+ GD+L 
Sbjct  1    MAGFFKTVTFMVLVFAAV--VSAEDYEVGDDAKWARPSDLE-FYNTWASKKTFLVGDVLD  57

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQ  514
            F F+   H VA V   ++Y++C      ++   SPA I LN TG  YF CT   HC  GQ
Sbjct  58   FEFDAERHDVAIV-TADEYENCEKETPLSLIKTSPAKIMLNDTGPIYFICTSADHCRFGQ  116

Query  515  KLTVNV  532
            KLTVNV
Sbjct  117  KLTVNV  122



>ref|NP_001168456.1| uncharacterized protein LOC100382230 precursor [Zea mays]
 gb|ACN28286.1| unknown [Zea mays]
 gb|AFW64389.1| hypothetical protein ZEAMMB73_344098 [Zea mays]
Length=205

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 63/108 (58%), Gaps = 8/108 (7%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            S   ATSYTVGD SGW T  +    YT+WA    F  GD LVFN+  GLHTV  V +  +
Sbjct  23   STAAATSYTVGDGSGWTTGVD----YTSWAASKNFKVGDNLVFNYAKGLHTVVEV-SAAE  77

Query  398  YDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            Y +C AAN    ++S A ++ L + G HYF C++  HC  G KL V V
Sbjct  78   YMACTAANPLGSDSSGATTVALRTPGTHYFVCSITGHCGAGMKLAVTV  125



>ref|XP_008354498.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=300

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDA-TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDIL  340
            M K + + ++    +  + +  A  ++ VGD  GW  P  G   Y +WA  H F  GD+L
Sbjct  1    MGKELSIALLAIAVVGLLHSTXAMETHVVGDKIGWVVPPGGQYAYESWAAMHHFAVGDLL  60

Query  341  VFNFNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQG  511
            VFNF  G   VA V  K  +D+CN+ +   ++  SPA+  LN+TG +YF  T   HC  G
Sbjct  61   VFNFTNGDQDVARV-TKEAFDNCNSTDPITLKTTSPANFTLNTTGEYYFIGTKDKHCELG  119

Query  512  QKLTVNV  532
            QKL  NV
Sbjct  120  QKLAXNV  126


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 54/102 (53%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGD  GW  P  G+  Y AWA    F+ GD LVFN   G      +  K  Y++C  
Sbjct  144  TYVVGDKLGWLVP-GGEQAYAAWAYGKTFIVGDTLVFNIVNGTQDDVALVTKPAYENCTT  202

Query  416  -ANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             +   +  NSP SI LN++G H+F  T   HC  GQKL +NV
Sbjct  203  NSTIAVYKNSPVSILLNTSGEHFFISTYDRHCLLGQKLAINV  244



>ref|XP_008242792.1| PREDICTED: mavicyanin-like [Prunus mume]
Length=173

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 63/122 (52%), Gaps = 3/122 (2%)
 Frame = +2

Query  167  AKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVF  346
            AK M +++ + V +  +   DA  YTVGD  GW  P  G +TY AWA +H  V  D L+F
Sbjct  3    AKTMNMILAIAVAVFMLHGTDAAEYTVGDGLGWTIPPGGAATYAAWAAEHSLVVNDFLIF  62

Query  347  NFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            NF  G   +A V  K D+D+CN A   I    P        G  Y  CT   HC++GQK+
Sbjct  63   NFAVGEQDLALV-TKEDFDACNTAEPLIVFKEPGEFQFLKEGTFYLTCTFAGHCAKGQKI  121

Query  521  TV  526
             +
Sbjct  122  AL  123



>dbj|BAJ97976.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 61/105 (58%), Gaps = 8/105 (8%)
 Frame = +2

Query  215  VSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKN  394
            ++   A  YTVGDSSGW T ++    YT WA+  +   GD LVFN+  G H VA V+   
Sbjct  19   ITTASAAKYTVGDSSGWTTGAD----YTTWASDKKIKVGDSLVFNYAGGAHNVAEVSAA-  73

Query  395  DYDSCNAANANIQNNS-PASIPLNSTGVHYFFCTV--HCSQGQKL  520
            DY SC+AANA   + S   ++ L + G HYF C V  HCS G KL
Sbjct  74   DYASCSAANALSSDGSGTTTVALKTAGKHYFICGVTGHCSSGMKL  118



>ref|XP_008389824.1| PREDICTED: mavicyanin-like [Malus domestica]
Length=166

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 71/131 (54%), Gaps = 10/131 (8%)
 Frame = +2

Query  164  MAKMMEL--LVVMTVFLSAVSNV----DATSYTVGDSSGWNTPSNGDSTYTAWANQHQFV  325
            MA+ M +  ++V+ + + A+S V    +A  YTVGD  GW  P      Y AWA++H F 
Sbjct  1    MARTMNMNNVMVLAIAIIAISVVLPTTEAALYTVGDELGWAIPPEA-GYYXAWASKHSFF  59

Query  326  TGDILVFNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--H  499
              DILVFNF  G   +A V  K D+D+CN +N     + P ++   ++   YF  T   H
Sbjct  60   VNDILVFNFTEGEEDLAMV-TKEDFDACNTSNPLFYFDEPPTLKFLASDTFYFTSTFDGH  118

Query  500  CSQGQKLTVNV  532
            C +GQK+ + +
Sbjct  119  CPRGQKVAIYI  129



>emb|CBI28221.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 5/100 (5%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            A +Y VG+   W  P N  + Y+ WA+ + F  GD LVFNF TG H VA V  K  +++C
Sbjct  23   AETYEVGNELSWRVPPN-TTAYSTWASAYTFRVGDTLVFNFTTGSHDVAKV-TKEAFNAC  80

Query  410  NAANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
            N+++        PA+  LNSTG +YFFCTV  HCSQGQKL
Sbjct  81   NSSSPLTTLYTGPANYTLNSTGENYFFCTVGSHCSQGQKL  120



>sp|P29602.3|CPC_CUCSA RecName: Full=Cucumber peeling cupredoxin; Short=CPC; AltName: 
Full=Stellacyanin [Cucumis sativus]
Length=137

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            +T + VGD++GW+ PS+ +  Y+ WA    F  GD L FNF    H V  +  K  +D+C
Sbjct  2    STVHIVGDNTGWSVPSSPN-FYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDAC  60

Query  410  NAANA--NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            N  N+  +++  SP    L+  G+HYF CTV  HCS GQKL++NV
Sbjct  61   NFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINV  105



>ref|XP_004287291.1| PREDICTED: stellacyanin-like [Fragaria vesca subsp. vesca]
Length=174

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 69/122 (57%), Gaps = 10/122 (8%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            LLVV    L  V+   A SYTVG+  GWN P  G   Y+ WA   QF  GD++VF + TG
Sbjct  13   LLVVAVALLKGVT---ADSYTVGEDLGWNIPPAGSVAYSTWAASKQFQLGDVVVFKW-TG  68

Query  362  LHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNST-GVHYFFCTV--HCS-QGQKLTV  526
             HTVA V    D+ SC  +N   + ++SPA I L+S  G  YF CT   HCS  GQK+ +
Sbjct  69   PHTVAEV-TAADFSSCTKSNPIALYDSSPARITLSSLNGTRYFICTEDNHCSVLGQKVAI  127

Query  527  NV  532
             +
Sbjct  128  TM  129



>ref|XP_007013491.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007013492.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31110.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31111.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=156

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 66/121 (55%), Gaps = 10/121 (8%)
 Frame = +2

Query  182  LLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTG  361
            ++VVM +F +      A +YTVGD   W  P  G   Y+ WA    F   D +VFN+ + 
Sbjct  12   IVVVMALFKTTA----ADTYTVGDELRWTIPPGGPIAYSTWARSKNFEINDTIVFNW-SD  66

Query  362  LHTVATVNNKNDYDSCNAAN--ANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVN  529
             H VA V ++ DYD+C   N    IQ  SPA+  L+S    YF CT+  HC  GQK+T+N
Sbjct  67   THDVAEV-SEADYDNCTKTNPIGTIQQTSPANFTLDSNRTRYFICTINTHCELGQKVTIN  125

Query  530  V  532
            +
Sbjct  126  I  126



>ref|XP_002452517.1| hypothetical protein SORBIDRAFT_04g027290 [Sorghum bicolor]
 gb|EES05493.1| hypothetical protein SORBIDRAFT_04g027290 [Sorghum bicolor]
Length=218

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 63/108 (58%), Gaps = 8/108 (7%)
 Frame = +2

Query  218  SNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKND  397
            S   ATSYTVGD SGW T  +    YT+WA    F  GD LVFN+  GLHTV  V +  +
Sbjct  22   STAAATSYTVGDGSGWTTGVD----YTSWAASKNFKVGDNLVFNYAKGLHTVVEV-SAAE  76

Query  398  YDSCNAANANIQNNSPA-SIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
            Y +C AAN    ++S A ++ L + G HYF C++  HC  G KL V V
Sbjct  77   YMACTAANPLGSDSSGATTVALKTPGTHYFVCSITGHCGAGMKLAVTV  124



>emb|CDP10431.1| unnamed protein product [Coffea canephora]
Length=330

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = +2

Query  173  MMELLVVMTVFLSAVSNVDATS-YTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFN  349
            +  L V M    S++  +DA   + VGD  GW  P  G   Y+ WA    F  GDIL+FN
Sbjct  8    LSALTVAMIALASSLHTIDAQRVHVVGDRLGWIVPPGGSIAYSTWAGLQVFSVGDILLFN  67

Query  350  FNTGLHTVATVNNKNDYDSCNAANA-NIQNNSPASIPLNSTGVHYFFCT--VHCSQGQKL  520
            F TG   VA V  K  +D CN+ N  +IQ   PA+  L+S G +YF  T   HC  GQKL
Sbjct  68   FTTGQQDVARV-TKEAFDVCNSTNPISIQTTGPANYTLSSAGEYYFISTQDEHCFFGQKL  126

Query  521  TVNV  532
             ++V
Sbjct  127  AISV  130


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  SYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCNA  415
            +Y VGD  GW  P  G   Y  WA    F  GD LVFNF TG   VA V  K  + +CN+
Sbjct  151  TYIVGDDLGWIVPPGGKIAYETWAYDKIFAVGDTLVFNFTTGEQDVARV-TKEAFGTCNS  209

Query  416  ANA-NIQNNSPASIPLNSTGVHYFFCTV--HCSQGQKLTVNV  532
             N  ++Q   PAS  LNSTG +YF  T+  HC  GQKL + V
Sbjct  210  TNPLSLQTTGPASYTLNSTGEYYFISTLDGHCFLGQKLAIIV  251



>ref|XP_002971821.1| hypothetical protein SELMODRAFT_19117, partial [Selaginella moellendorffii]
 gb|EFJ26738.1| hypothetical protein SELMODRAFT_19117, partial [Selaginella moellendorffii]
Length=103

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 62/104 (60%), Gaps = 4/104 (4%)
 Frame = +2

Query  230  ATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSC  409
            AT Y VGD  GW+ PS  + +Y  WA +H+F  GD LVF + +  HTV  V N+ D+++C
Sbjct  1    ATRYIVGDEVGWSDPSMSNVSYADWALKHRFHVGDSLVFKYPSDAHTVLKV-NRQDFEAC  59

Query  410  NAANANIQNNSPASI-PLNSTGVHYFFC--TVHCSQGQKLTVNV  532
            + +N+        SI  L+S G H+F C  T HC+QGQK  + V
Sbjct  60   HNSNSMASYKDGESIVHLSSAGPHWFICGETSHCNQGQKFGIMV  103



>ref|XP_004163555.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN45267.1| hypothetical protein Csa_7G432490 [Cucumis sativus]
Length=205

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +2

Query  233  TSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILVFNFNTGLHTVATVNNKNDYDSCN  412
            T   VGDS+GW  P NG + Y+ WA++  F  GD L FNF T +H+V  V  K  ++ C+
Sbjct  25   TVRVVGDSTGWTVPMNGAAFYSEWASKFNFAIGDYLTFNFGTNMHSVQKV-PKEAFEVCD  83

Query  413  AANAN--IQNNSPASIPLNSTGVHYFFCTV--HCSQGQKL  520
              N    +    P ++ L++ G+HYF CTV  HC +GQKL
Sbjct  84   GHNTTHYVITTGPTTLKLDTAGMHYFICTVGNHCFEGQKL  123



>ref|XP_010942621.1| PREDICTED: mavicyanin-like [Elaeis guineensis]
Length=178

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 67/125 (54%), Gaps = 6/125 (5%)
 Frame = +2

Query  164  MAKMMELLVVMTVFLSAVSNVDATSYTVGDSSGWNTPSNGDSTYTAWANQHQFVTGDILV  343
            MA    + +   + +S  +   AT YTVGDSSGW T  N    Y  W +   F+ GD L+
Sbjct  1    MAGCTSIALAALLLMSCATWGSATKYTVGDSSGWTTNVN----YNTWTSGKDFIVGDSLL  56

Query  344  FNFNTGLHTVATVNNKNDYDSCNAANANIQNNSPASIPLNSTGVHYFFCTV--HCSQGQK  517
            FNF TG HTV  V++ +     ++   +   N PA+I LN+TG  Y+ C +  HC+ G K
Sbjct  57   FNFATGAHTVTGVSSSDYNSCSSSNAISSVTNGPATIELNTTGTRYYICAIAGHCNLGMK  116

Query  518  LTVNV  532
            L V V
Sbjct  117  LEVTV  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628236657450