BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c119455_g1_i1 len=134 path=[112:0-133]

Length=134
                                                                      Score     E

ref|XP_001451036.1|  hypothetical protein                             89.0    9e-21   Paramecium tetraurelia strain d4-2
ref|XP_001439193.1|  hypothetical protein                             89.0    9e-21   Paramecium tetraurelia strain d4-2
ref|XP_001454235.1|  hypothetical protein                             89.0    9e-21   Paramecium tetraurelia strain d4-2
ref|XP_001437755.1|  hypothetical protein                             89.0    9e-21   Paramecium tetraurelia strain d4-2
ref|XP_001462400.1|  hypothetical protein                             89.0    9e-21   Paramecium tetraurelia strain d4-2
ref|XP_001441009.1|  hypothetical protein                             89.0    9e-21   Paramecium tetraurelia strain d4-2
ref|XP_001445791.1|  hypothetical protein                             89.0    1e-20   Paramecium tetraurelia strain d4-2
ref|XP_001460412.1|  hypothetical protein                             88.6    1e-20   Paramecium tetraurelia strain d4-2
ref|XP_004030185.1|  hypothetical protein IMG5_166160                 87.0    6e-20   
ref|XP_001007104.2|  hypothetical protein TTHERM_00205170             84.7    5e-19   Tetrahymena thermophila
ref|XP_004030697.1|  hypothetical protein IMG5_155380                 83.6    1e-18   
emb|CDW83246.1|  phosphoesterase family                               77.8    2e-16   
ref|XP_004035073.1|  phosphoesterase family protein, putative         79.3    1e-15   
ref|XP_004030266.1|  hypothetical protein IMG5_164990                 74.7    1e-15   
gb|EJY82839.1|  hypothetical protein OXYTRI_19544                     72.0    3e-14   
gb|EJY70755.1|  hypothetical protein OXYTRI_08383                     72.0    4e-14   
emb|CDW77505.1|  UNKNOWN                                              68.9    5e-13   
gb|EJY70482.1|  hypothetical protein OXYTRI_08769                     68.6    7e-13   
ref|XP_001032016.1|  hypothetical protein TTHERM_00703450             66.2    4e-12   Tetrahymena thermophila
emb|CDW75565.1|  UNKNOWN                                              68.2    8e-12   
ref|XP_001031054.1|  hypothetical protein TTHERM_00938790             65.1    1e-11   Tetrahymena thermophila
gb|EJY73309.1|  Putative transport system kinase                      67.4    1e-11   
ref|XP_004034556.1|  hypothetical protein IMG5_117950                 58.2    3e-09   
ref|XP_004030806.1|  hypothetical protein IMG5_153420                 58.2    3e-09   
gb|EJY66085.1|  hypothetical protein OXYTRI_13749                     57.4    7e-09   
emb|CDW89746.1|  phosphoesterase family                               57.0    9e-09   
emb|CDW80464.1|  phosphoesterase family                               51.6    6e-07   
gb|EJY81303.1|  hypothetical protein OXYTRI_21187                     50.4    2e-06   
ref|XP_004039707.1|  protein kinase domain protein                    51.6    4e-06   
emb|CDW77025.1|  UNKNOWN                                              45.4    2e-04   
gb|EJY65446.1|  hypothetical protein OXYTRI_14400                     45.1    3e-04   
gb|EJY83537.1|  hypothetical protein OXYTRI_18734                     44.7    3e-04   
ref|XP_001456655.1|  hypothetical protein                             42.7    0.001   Paramecium tetraurelia strain d4-2



>ref|XP_001451036.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK83639.1| unnamed protein product [Paramecium tetraurelia]
Length=146

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  58   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  101



>ref|XP_001439193.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 ref|XP_001445052.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK71796.1| unnamed protein product [Paramecium tetraurelia]
 emb|CAK77655.1| unnamed protein product [Paramecium tetraurelia]
Length=145

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  57   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  100



>ref|XP_001454235.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK86838.1| unnamed protein product [Paramecium tetraurelia]
Length=146

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  58   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  101



>ref|XP_001437755.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK70358.1| unnamed protein product [Paramecium tetraurelia]
Length=146

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  58   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  101



>ref|XP_001462400.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK95027.1| unnamed protein product [Paramecium tetraurelia]
Length=146

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  58   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  101



>ref|XP_001441009.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK73612.1| unnamed protein product [Paramecium tetraurelia]
Length=146

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  58   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  101



>ref|XP_001445791.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK78394.1| unnamed protein product [Paramecium tetraurelia]
Length=146

 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  58   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  101



>ref|XP_001460412.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK93015.1| unnamed protein product [Paramecium tetraurelia]
Length=146

 Score = 88.6 bits (218),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTLESVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  58   EVQILKSEKDTLESVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  101



>ref|XP_004030185.1| hypothetical protein IMG5_166160, partial [Ichthyophthirius multifiliis]
 gb|EGR28949.1| hypothetical protein IMG5_166160 [Ichthyophthirius multifiliis]
Length=157

 Score = 87.0 bits (214),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTL+SVL+MKTQDVKKTLTNELMRIEEEMKRHFAH
Sbjct  68   EVQILKSEKDTLQSVLSMKTQDVKKTLTNELMRIEEEMKRHFAH  111



>ref|XP_001007104.2| hypothetical protein TTHERM_00205170 [Tetrahymena thermophila]
 gb|EAR86859.2| transport system kinase [Tetrahymena thermophila SB210]
Length=154

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTL+SVL+MKTQDVKKTLT+ELMRIEEEMKRHFAH
Sbjct  65   EVQILKSEKDTLQSVLSMKTQDVKKTLTSELMRIEEEMKRHFAH  108



>ref|XP_004030697.1| hypothetical protein IMG5_155380, partial [Ichthyophthirius multifiliis]
 gb|EGR29461.1| hypothetical protein IMG5_155380 [Ichthyophthirius multifiliis]
Length=150

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTL+SVL+MKTQDVKKTLTNEL RI+EEMKRHFAH
Sbjct  61   EVQILKSEKDTLQSVLSMKTQDVKKTLTNELQRIDEEMKRHFAH  104



>emb|CDW83246.1| phosphoesterase family [Stylonychia lemnae]
Length=165

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQ+L+SEK++LESVLTMKTQDV+KTLTNEL ++EEEMKRH+AH
Sbjct  76   EVQVLRSEKESLESVLTMKTQDVRKTLTNELFKVEEEMKRHYAH  119



>ref|XP_004035073.1| phosphoesterase family protein, putative [Ichthyophthirius multifiliis]
 gb|EGR31587.1| phosphoesterase family protein, putative [Ichthyophthirius multifiliis]
Length=655

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQILKSEKDTL+SVL+MKTQDVKKTLTNEL RIEEEMKRHFAH
Sbjct  566  EVQILKSEKDTLQSVLSMKTQDVKKTLTNELTRIEEEMKRHFAH  609



>ref|XP_004030266.1| hypothetical protein IMG5_164990 [Ichthyophthirius multifiliis]
 gb|EGR29030.1| hypothetical protein IMG5_164990 [Ichthyophthirius multifiliis]
Length=103

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            E QILKSEKDTL SVL MKTQDVKKTLTNEL R+EEEM RHF+H
Sbjct  14   EAQILKSEKDTLLSVLQMKTQDVKKTLTNELARMEEEMNRHFSH  57



>gb|EJY82839.1| hypothetical protein OXYTRI_19544 [Oxytricha trifallax]
Length=173

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            +VQ+L+ +K++LE+VLTMKTQDV+KTLTNEL ++EEEMKRH+AH
Sbjct  84   DVQVLRQDKESLENVLTMKTQDVRKTLTNELFKVEEEMKRHYAH  127



>gb|EJY70755.1| hypothetical protein OXYTRI_08383 [Oxytricha trifallax]
Length=173

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            +VQ+L+ +K++LE+VLTMKTQDV+KTLTNEL ++EEEMKRH+AH
Sbjct  84   DVQVLRQDKESLENVLTMKTQDVRKTLTNELFKVEEEMKRHYAH  127



>emb|CDW77505.1| UNKNOWN [Stylonychia lemnae]
Length=169

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQIL+SEK+TLESVLTMK QD +K LTNEL R+EEE+KRH+++
Sbjct  78   EVQILRSEKETLESVLTMKCQDTRKALTNELHRVEEEIKRHYSN  121



>gb|EJY70482.1| hypothetical protein OXYTRI_08769 [Oxytricha trifallax]
Length=174

 Score = 68.6 bits (166),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHF  7
            EVQIL+SEK+TLESVLTMK QD +K LTNEL R+EEE+KRH+
Sbjct  84   EVQILRSEKETLESVLTMKCQDTRKALTNELHRVEEEIKRHY  125



>ref|XP_001032016.1| hypothetical protein TTHERM_00703450 [Tetrahymena thermophila]
 gb|EAR84353.1| transport system kinase [Tetrahymena thermophila SB210]
Length=166

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            E+QILKSEKDTL+ VL +KT DV+ TLTNEL R+E+EM+RHF H
Sbjct  77   ELQILKSEKDTLQQVLKVKTDDVQNTLTNELKRLEDEMRRHFNH  120



>emb|CDW75565.1| UNKNOWN [Stylonychia lemnae]
Length=560

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHF  7
            EVQIL+SEK+TLESVLTMK QD +K LTNEL R+EEE+KRH+
Sbjct  470  EVQILRSEKETLESVLTMKCQDTRKALTNELHRVEEEIKRHY  511



>ref|XP_001031054.1| hypothetical protein TTHERM_00938790 [Tetrahymena thermophila]
 gb|EAR83391.1| transport system kinase [Tetrahymena thermophila SB210]
Length=160

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            E+ IL SEKD+L SVL MK QDVKKTL NEL+R+E+EM RHF +
Sbjct  71   ELAILNSEKDSLSSVLNMKAQDVKKTLMNELIRLEDEMNRHFNN  114



>gb|EJY73309.1| Putative transport system kinase [Oxytricha trifallax]
Length=446

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHF  7
            EVQI++SEK+TLESVLTMK QD +K LTNEL R+EEE+KRH+
Sbjct  356  EVQIMRSEKETLESVLTMKCQDTRKALTNELHRVEEEIKRHY  397



>ref|XP_004034556.1| hypothetical protein IMG5_117950 [Ichthyophthirius multifiliis]
 gb|EGR31070.1| hypothetical protein IMG5_117950 [Ichthyophthirius multifiliis]
Length=141

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            E Q+LK+EK+T+E VL  K Q ++  L NE++R+EEEMKRH+AH
Sbjct  51   EFQVLKNEKETVEQVLRAKNQGIQNILQNEIIRLEEEMKRHYAH  94



>ref|XP_004030806.1| hypothetical protein IMG5_153420 [Ichthyophthirius multifiliis]
 gb|EGR29570.1| hypothetical protein IMG5_153420 [Ichthyophthirius multifiliis]
Length=140

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            + ++LK+EK+TLE VL +K  D+K TL+NEL R+E+EMKRHF H
Sbjct  51   DFKMLKTEKNTLEQVLKVKNSDIKNTLSNELKRLEDEMKRHFIH  94



>gb|EJY66085.1| hypothetical protein OXYTRI_13749 [Oxytricha trifallax]
Length=144

 Score = 57.4 bits (137),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQ L++EK++LE+VL +K Q+V+KTLTNE  RIEEE+KR+ A 
Sbjct  53   EVQHLRAEKESLENVLALKAQEVRKTLTNEANRIEEELKRNLAQ  96



>emb|CDW89746.1| phosphoesterase family [Stylonychia lemnae]
Length=137

 Score = 57.0 bits (136),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            EVQ +++EK++LE+VL +K Q+V+KTLTNE  RIEEE+KR+ A 
Sbjct  47   EVQNMRAEKESLENVLALKAQEVRKTLTNEANRIEEELKRNLAQ  90



>emb|CDW80464.1| phosphoesterase family [Stylonychia lemnae]
Length=127

 Score = 51.6 bits (122),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHF  7
            E+Q L+SEK+TLE VL  K  D++K L NE++R EEEMK+ +
Sbjct  39   EIQTLRSEKETLEDVLNRKASDIRKNLANEVLRAEEEMKKSY  80



>gb|EJY81303.1| hypothetical protein OXYTRI_21187 [Oxytricha trifallax]
Length=131

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHF  7
            E+Q L+SEK+TLE VL  K  D++K L NE++R EEEMK+ +
Sbjct  43   EIQTLRSEKETLEDVLNRKAGDIRKNLANEVLRAEEEMKKSY  84



>ref|XP_004039707.1| protein kinase domain protein [Ichthyophthirius multifiliis]
 gb|EGR34403.1| protein kinase domain protein [Ichthyophthirius multifiliis]
Length=403

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            E+  L +EKD L  VL MK QDV+KTL NEL+R+E+EM RH  +
Sbjct  314  ELASLNNEKDQLGQVLNMKAQDVEKTLMNELIRLEDEMNRHITN  357



>emb|CDW77025.1| UNKNOWN [Stylonychia lemnae]
Length=188

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRH  10
            +V ++KSEK+TLESVL+MK  D KKT+ NE  R+  +M R+
Sbjct  99   QVGMIKSEKETLESVLSMKIDDAKKTVQNEEKRVRNDMMRN  139



>gb|EJY65446.1| hypothetical protein OXYTRI_14400 [Oxytricha trifallax]
Length=194

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRH  10
            +V ++KSEK+TLESVL+MK  D KKT+ NE  R+  +M R+
Sbjct  105  QVGMIKSEKETLESVLSMKIDDAKKTVQNEEKRVRNDMIRN  145



>gb|EJY83537.1| hypothetical protein OXYTRI_18734 [Oxytricha trifallax]
 gb|EJY86714.1| hypothetical protein OXYTRI_11085 [Oxytricha trifallax]
Length=194

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRH  10
            +V ++KSEK+TLESVL+MK  D KKT+ NE  R+  +M R+
Sbjct  105  QVGMIKSEKETLESVLSMKIDDAKKTVQNEEKRVRNDMIRN  145



>ref|XP_001456655.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK89258.1| unnamed protein product [Paramecium tetraurelia]
Length=138

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  EVQILKSEKDTLESVLTMKTQDVKKTLTNELMRIEEEMKRHFAH  1
            E Q LK  KD  E++L+ KT+D+ KTL NEL+ +++EMKR   +
Sbjct  49   EYQSLKQLKDEFEAILSNKTEDMLKTLQNELIHLDDEMKREVGY  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512165903184