BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c119327_g1_i1 len=183 path=[1:0-182]

Length=183
                                                                      Score     E

ref|XP_007044112.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  62.4    6e-14   
ref|XP_004173716.1|  PREDICTED: uncharacterized protein LOC101232174  56.2    1e-13   
ref|XP_004137882.1|  PREDICTED: ABC transporter C family member 1...  57.4    2e-13   
gb|ABY49842.1|  hypothetical protein                                  54.3    4e-13   Vitis hybrid cultivar
emb|CAN83548.1|  hypothetical protein VITISV_035575                   54.3    4e-13   Vitis vinifera
emb|CAN63534.1|  hypothetical protein VITISV_001206                   54.3    4e-13   Vitis vinifera
emb|CAN61858.1|  hypothetical protein VITISV_016691                   54.3    4e-13   Vitis vinifera
emb|CAN65144.1|  hypothetical protein VITISV_026080                   53.9    5e-13   Vitis vinifera
gb|AAO26686.1|AF478373_1  gag-pol polyprotein                         53.1    8e-13   Vitis vinifera
ref|XP_010264152.1|  PREDICTED: uncharacterized protein LOC104602236  55.5    9e-13   
emb|CAN74241.1|  hypothetical protein VITISV_006638                   52.8    9e-13   Vitis vinifera
ref|XP_010068106.1|  PREDICTED: uncharacterized protein LOC104454933  55.8    1e-12   
gb|AAT38747.2|  Polyprotein, putative                                 52.8    1e-12   Solanum demissum
ref|XP_010644234.1|  PREDICTED: uncharacterized protein LOC104877519  52.0    2e-12   
emb|CAN71748.1|  hypothetical protein VITISV_019194                   52.0    2e-12   Vitis vinifera
ref|XP_007033977.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.1    1e-11   
emb|CAN60648.1|  hypothetical protein VITISV_033947                   50.1    2e-11   Vitis vinifera
gb|ABA95797.1|  retrotransposon protein, putative, unclassified       54.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71132.1|  hypothetical protein VITISV_007235                   49.3    3e-11   Vitis vinifera
gb|AAM91874.1|  putative copia-like polyprotein                       51.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008673671.1|  PREDICTED: uncharacterized protein LOC103649714  54.7    3e-11   
gb|AAP54332.2|  retrotransposon protein, putative, unclassified       51.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95230.1|  retrotransposon protein, putative, unclassified       51.6    4e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAE75905.1|  OSJNBa0088I22.18                                     51.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76133.1|  hypothetical protein VITISV_036298                   54.7    5e-11   Vitis vinifera
emb|CAN74964.1|  hypothetical protein VITISV_006810                   49.3    6e-11   Vitis vinifera
gb|AAO26685.1|AF478371_1  gag-pol polyprotein                         49.3    6e-11   Vitis vinifera
emb|CAN71658.1|  hypothetical protein VITISV_028062                   53.5    6e-11   Vitis vinifera
emb|CAN73763.1|  hypothetical protein VITISV_031179                   54.7    8e-11   Vitis vinifera
emb|CAN66416.1|  hypothetical protein VITISV_044133                   53.5    9e-11   Vitis vinifera
emb|CAN70756.1|  hypothetical protein VITISV_014702                   53.5    1e-10   Vitis vinifera
emb|CAN65647.1|  hypothetical protein VITISV_001300                   53.5    1e-10   Vitis vinifera
emb|CAN75922.1|  hypothetical protein VITISV_030752                   53.5    1e-10   Vitis vinifera
emb|CAN64673.1|  hypothetical protein VITISV_007430                   53.5    1e-10   Vitis vinifera
gb|AAL68641.1|AF458765_1  polyprotein                                 49.7    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010112166.1|  DNA polymerase theta                             50.1    1e-10   
emb|CAN77210.1|  hypothetical protein VITISV_000141                   53.1    1e-10   Vitis vinifera
emb|CAN63081.1|  hypothetical protein VITISV_016842                   52.8    1e-10   Vitis vinifera
ref|XP_006485859.1|  PREDICTED: uncharacterized protein LOC102626627  52.0    2e-10   
emb|CAN80088.1|  hypothetical protein VITISV_021656                   52.8    2e-10   Vitis vinifera
emb|CAN81139.1|  hypothetical protein VITISV_018760                   53.1    2e-10   Vitis vinifera
emb|CAN67925.1|  hypothetical protein VITISV_021168                   53.1    2e-10   Vitis vinifera
emb|CAN71246.1|  hypothetical protein VITISV_011986                   53.1    2e-10   Vitis vinifera
emb|CAN76019.1|  hypothetical protein VITISV_010645                   53.1    2e-10   Vitis vinifera
emb|CAN65410.1|  hypothetical protein VITISV_040416                   52.8    2e-10   Vitis vinifera
emb|CAN78616.1|  hypothetical protein VITISV_003658                   52.8    2e-10   Vitis vinifera
emb|CAN60609.1|  hypothetical protein VITISV_036599                   52.8    2e-10   Vitis vinifera
emb|CAN62535.1|  hypothetical protein VITISV_041880                   52.8    2e-10   Vitis vinifera
emb|CAN74286.1|  hypothetical protein VITISV_036410                   52.8    2e-10   Vitis vinifera
emb|CAN75744.1|  hypothetical protein VITISV_040125                   52.8    2e-10   Vitis vinifera
emb|CAN61179.1|  hypothetical protein VITISV_032292                   52.8    2e-10   Vitis vinifera
emb|CAN72018.1|  hypothetical protein VITISV_001841                   52.8    2e-10   Vitis vinifera
emb|CAN63730.1|  hypothetical protein VITISV_030286                   52.8    2e-10   Vitis vinifera
emb|CAN73074.1|  hypothetical protein VITISV_032386                   52.8    2e-10   Vitis vinifera
emb|CAN80771.1|  hypothetical protein VITISV_027574                   52.8    2e-10   Vitis vinifera
emb|CAN76679.1|  hypothetical protein VITISV_034325                   52.8    2e-10   Vitis vinifera
emb|CAN62614.1|  hypothetical protein VITISV_028123                   52.8    2e-10   Vitis vinifera
emb|CAN80469.1|  hypothetical protein VITISV_008623                   52.8    2e-10   Vitis vinifera
emb|CAN75900.1|  hypothetical protein VITISV_033582                   52.8    2e-10   Vitis vinifera
emb|CAN82075.1|  hypothetical protein VITISV_016661                   52.8    2e-10   Vitis vinifera
emb|CAN73101.1|  hypothetical protein VITISV_042890                   52.8    2e-10   Vitis vinifera
emb|CAD41085.2|  OSJNBb0011N17.2                                      49.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAN68682.1|  hypothetical protein VITISV_024814                   50.8    2e-10   Vitis vinifera
gb|AAO20078.1|  putative polyprotein                                  49.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72132.1|  hypothetical protein VITISV_040707                   52.8    2e-10   Vitis vinifera
emb|CAN70689.1|  hypothetical protein VITISV_012155                   52.8    2e-10   Vitis vinifera
emb|CAH66946.1|  B0809H07.1                                           48.9    2e-10   Oryza sativa [red rice]
emb|CAN61207.1|  hypothetical protein VITISV_015446                   52.8    2e-10   Vitis vinifera
emb|CAN63852.1|  hypothetical protein VITISV_004832                   52.8    2e-10   Vitis vinifera
emb|CAN60274.1|  hypothetical protein VITISV_024841                   52.4    2e-10   Vitis vinifera
emb|CAN66243.1|  hypothetical protein VITISV_015916                   52.4    2e-10   Vitis vinifera
emb|CAN80247.1|  hypothetical protein VITISV_027801                   54.7    3e-10   Vitis vinifera
ref|XP_009771264.1|  PREDICTED: uncharacterized protein LOC104221828  51.6    3e-10   
emb|CAN84135.1|  hypothetical protein VITISV_000113                   52.4    3e-10   Vitis vinifera
emb|CAN67317.1|  hypothetical protein VITISV_019719                   52.0    3e-10   Vitis vinifera
emb|CAN82359.1|  hypothetical protein VITISV_027367                   52.0    3e-10   Vitis vinifera
emb|CAN72188.1|  hypothetical protein VITISV_020673                   50.8    3e-10   Vitis vinifera
emb|CAN69102.1|  hypothetical protein VITISV_042048                   54.3    3e-10   Vitis vinifera
emb|CAN63637.1|  hypothetical protein VITISV_038689                   52.0    3e-10   Vitis vinifera
ref|XP_006584292.1|  PREDICTED: uncharacterized protein LOC102668041  53.1    3e-10   
emb|CAN64167.1|  hypothetical protein VITISV_015919                   52.8    3e-10   Vitis vinifera
emb|CAN81362.1|  hypothetical protein VITISV_013815                   51.6    4e-10   Vitis vinifera
emb|CAN74064.1|  hypothetical protein VITISV_028146                   51.6    4e-10   Vitis vinifera
emb|CAN69088.1|  hypothetical protein VITISV_031062                   52.8    5e-10   Vitis vinifera
emb|CAN64827.1|  hypothetical protein VITISV_030308                   51.2    5e-10   Vitis vinifera
emb|CAN60498.1|  hypothetical protein VITISV_027869                   54.3    5e-10   Vitis vinifera
gb|AAU10804.1|  unknown protein                                       49.7    5e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAN80547.1|  hypothetical protein VITISV_010898                   52.8    6e-10   Vitis vinifera
emb|CAN79281.1|  hypothetical protein VITISV_034553                   52.8    6e-10   Vitis vinifera
emb|CAN65230.1|  hypothetical protein VITISV_034221                   51.6    6e-10   Vitis vinifera
emb|CAN76032.1|  hypothetical protein VITISV_040150                   52.8    6e-10   Vitis vinifera
emb|CAN80753.1|  hypothetical protein VITISV_003323                   50.8    7e-10   Vitis vinifera
emb|CAN71812.1|  hypothetical protein VITISV_037409                   50.8    7e-10   Vitis vinifera
emb|CAN72710.1|  hypothetical protein VITISV_018096                   52.4    7e-10   Vitis vinifera
emb|CAN81715.1|  hypothetical protein VITISV_032902                   52.8    7e-10   Vitis vinifera
emb|CAN62266.1|  hypothetical protein VITISV_025647                   50.8    7e-10   Vitis vinifera
emb|CAN69691.1|  hypothetical protein VITISV_026777                   50.8    8e-10   Vitis vinifera
emb|CAN60930.1|  hypothetical protein VITISV_012765                   48.5    8e-10   Vitis vinifera
emb|CAN74104.1|  hypothetical protein VITISV_008952                   53.1    8e-10   Vitis vinifera
ref|XP_010042013.1|  PREDICTED: uncharacterized protein LOC104431013  53.5    8e-10   
emb|CAN67120.1|  hypothetical protein VITISV_017484                   53.9    8e-10   Vitis vinifera
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...  51.6    9e-10   
emb|CAN77046.1|  hypothetical protein VITISV_035257                   52.8    9e-10   Vitis vinifera
emb|CAN82064.1|  hypothetical protein VITISV_022772                   50.4    9e-10   Vitis vinifera
emb|CAN68059.1|  hypothetical protein VITISV_008424                   48.5    9e-10   Vitis vinifera
emb|CAN79977.1|  hypothetical protein VITISV_029183                   48.5    1e-09   Vitis vinifera
emb|CAN67506.1|  hypothetical protein VITISV_026948                   48.5    1e-09   Vitis vinifera
emb|CAN63276.1|  hypothetical protein VITISV_000400                   48.5    1e-09   Vitis vinifera
emb|CAN76181.1|  hypothetical protein VITISV_015418                   51.6    1e-09   Vitis vinifera
ref|XP_008460624.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  45.4    1e-09   
ref|XP_008342470.1|  PREDICTED: uncharacterized protein LOC103405274  50.4    1e-09   
emb|CAN77834.1|  hypothetical protein VITISV_024733                   53.1    1e-09   Vitis vinifera
emb|CAN79672.1|  hypothetical protein VITISV_012210                   52.8    1e-09   Vitis vinifera
emb|CAN78708.1|  hypothetical protein VITISV_019236                   49.7    1e-09   Vitis vinifera
emb|CAN64822.1|  hypothetical protein VITISV_025364                   48.5    1e-09   Vitis vinifera
emb|CAN62423.1|  hypothetical protein VITISV_020608                   52.4    1e-09   Vitis vinifera
gb|ABA93730.1|  retrotransposon protein, putative, unclassified       48.5    1e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83335.1|  hypothetical protein VITISV_043861                   53.5    1e-09   Vitis vinifera
emb|CAN66265.1|  hypothetical protein VITISV_042702                   52.0    1e-09   Vitis vinifera
emb|CAN74388.1|  hypothetical protein VITISV_041876                   53.5    1e-09   Vitis vinifera
ref|XP_010059409.1|  PREDICTED: uncharacterized protein LOC104447361  50.1    1e-09   
emb|CAN65502.1|  hypothetical protein VITISV_014793                   48.5    2e-09   Vitis vinifera
emb|CAN65249.1|  hypothetical protein VITISV_024219                   53.5    2e-09   Vitis vinifera
emb|CAN60445.1|  hypothetical protein VITISV_032468                   48.5    2e-09   Vitis vinifera
ref|XP_003597218.1|  Beta-galactosidase                               49.3    2e-09   
emb|CAN73860.1|  hypothetical protein VITISV_007289                   54.7    2e-09   Vitis vinifera
emb|CAH67874.1|  OSIGBa0153E02-OSIGBa0093I20.3                        48.5    2e-09   Oryza sativa [red rice]
emb|CAN76367.1|  hypothetical protein VITISV_024583                   49.3    2e-09   Vitis vinifera
ref|XP_010265857.1|  PREDICTED: uncharacterized protein LOC104603503  48.9    2e-09   
ref|XP_003621710.1|  Receptor-like protein kinase                     49.3    2e-09   
ref|XP_007028466.1|  Uncharacterized protein TCM_024268               57.8    2e-09   
emb|CAN62329.1|  hypothetical protein VITISV_029808                   52.4    2e-09   Vitis vinifera
emb|CAE05707.2|  OSJNBb0065J09.3                                      48.1    2e-09   Oryza sativa [red rice]
gb|AAP21414.1|  putative polyprotein                                  48.1    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN78392.1|  hypothetical protein VITISV_034679                   51.2    2e-09   Vitis vinifera
ref|XP_010268750.1|  PREDICTED: formin-like protein 13                44.3    2e-09   
emb|CAN69307.1|  hypothetical protein VITISV_001120                   48.1    2e-09   Vitis vinifera
emb|CAN62086.1|  hypothetical protein VITISV_035123                   48.5    2e-09   Vitis vinifera
emb|CAN76400.1|  hypothetical protein VITISV_001550                   48.9    3e-09   Vitis vinifera
emb|CAN78434.1|  hypothetical protein VITISV_003804                   47.0    3e-09   Vitis vinifera
emb|CAN80367.1|  hypothetical protein VITISV_014719                   50.8    3e-09   Vitis vinifera
emb|CAN74129.1|  hypothetical protein VITISV_041770                   49.7    3e-09   Vitis vinifera
emb|CAN75730.1|  hypothetical protein VITISV_031410                   47.0    3e-09   Vitis vinifera
emb|CAN61219.1|  hypothetical protein VITISV_021296                   52.8    3e-09   Vitis vinifera
emb|CAN69707.1|  hypothetical protein VITISV_017209                   51.6    3e-09   Vitis vinifera
ref|XP_010923376.1|  PREDICTED: uncharacterized protein LOC105046487  48.1    3e-09   
emb|CAN70024.1|  hypothetical protein VITISV_030172                   51.2    3e-09   Vitis vinifera
ref|XP_010908910.1|  PREDICTED: uncharacterized protein LOC105035160  49.7    3e-09   
emb|CAN82468.1|  hypothetical protein VITISV_039784                   47.4    3e-09   Vitis vinifera
emb|CAN63295.1|  hypothetical protein VITISV_032981                   48.1    4e-09   Vitis vinifera
ref|XP_009626483.1|  PREDICTED: uncharacterized protein LOC104117178  57.4    4e-09   
gb|ABA94321.1|  retrotransposon protein, putative, unclassified       47.0    4e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN73765.1|  hypothetical protein VITISV_035279                   50.1    4e-09   Vitis vinifera
emb|CAN80368.1|  hypothetical protein VITISV_014720                   45.8    4e-09   Vitis vinifera
ref|XP_010103877.1|  C2 domain-containing protein                     49.7    4e-09   
emb|CAN69913.1|  hypothetical protein VITISV_042568                   53.1    4e-09   Vitis vinifera
emb|CAN82537.1|  hypothetical protein VITISV_013040                   48.1    4e-09   Vitis vinifera
gb|ABG22578.1|  retrotransposon protein, putative, unclassified       50.8    4e-09   
emb|CAN79305.1|  hypothetical protein VITISV_036286                   53.1    5e-09   Vitis vinifera
emb|CAN76680.1|  hypothetical protein VITISV_034326                   46.6    5e-09   Vitis vinifera
emb|CAN79013.1|  hypothetical protein VITISV_031464                   51.6    5e-09   Vitis vinifera
gb|ABA94354.1|  retrotransposon protein, putative, unclassified       44.7    5e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74610.1|  hypothetical protein VITISV_029330                   48.5    5e-09   Vitis vinifera
emb|CAN59884.1|  hypothetical protein VITISV_026166                   55.1    5e-09   Vitis vinifera
emb|CAN67511.1|  hypothetical protein VITISV_026953                   49.7    5e-09   Vitis vinifera
emb|CAN80976.1|  hypothetical protein VITISV_039740                   45.1    6e-09   Vitis vinifera
emb|CAN74290.1|  hypothetical protein VITISV_036414                   46.6    6e-09   Vitis vinifera
emb|CAN73102.1|  hypothetical protein VITISV_042891                   47.4    6e-09   Vitis vinifera
emb|CAN73234.1|  hypothetical protein VITISV_033857                   47.8    6e-09   Vitis vinifera
emb|CAN64580.1|  hypothetical protein VITISV_002159                   47.8    6e-09   Vitis vinifera
emb|CAN76176.1|  hypothetical protein VITISV_022748                   51.2    7e-09   Vitis vinifera
emb|CAE03644.2|  OSJNBa0060N03.9                                      46.2    7e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ACB45081.1|  putative polyprotein                                  53.1    8e-09   Solanum habrochaites
emb|CAN80802.1|  hypothetical protein VITISV_018152                   46.6    8e-09   Vitis vinifera
emb|CAN83721.1|  hypothetical protein VITISV_003961                   49.7    8e-09   Vitis vinifera
emb|CAN61882.1|  hypothetical protein VITISV_001207                   48.5    9e-09   Vitis vinifera
emb|CAN67418.1|  hypothetical protein VITISV_005919                   45.4    9e-09   Vitis vinifera
emb|CAN71185.1|  hypothetical protein VITISV_014270                   49.7    1e-08   Vitis vinifera
emb|CAN78751.1|  hypothetical protein VITISV_028425                   49.7    1e-08   Vitis vinifera
emb|CAN73392.1|  hypothetical protein VITISV_022526                   45.1    1e-08   Vitis vinifera
emb|CBL94154.1|  putative polyprotein (retrotrasposon protein)        47.8    1e-08   
ref|XP_008375640.1|  PREDICTED: pre-mRNA polyadenylation factor f...  47.0    1e-08   
ref|XP_008385943.1|  PREDICTED: uncharacterized protein LOC103448457  48.9    1e-08   
emb|CAN64541.1|  hypothetical protein VITISV_006447                   48.5    1e-08   Vitis vinifera
gb|ABN08283.1|  hypothetical protein MtrDRAFT_AC155889g9v2            53.9    1e-08   Medicago truncatula
ref|XP_009335215.1|  PREDICTED: uncharacterized protein LOC103927954  47.8    1e-08   
emb|CAN82626.1|  hypothetical protein VITISV_044103                   45.1    1e-08   Vitis vinifera
ref|XP_007019891.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  52.0    1e-08   
emb|CAN80212.1|  hypothetical protein VITISV_005117                   44.7    2e-08   Vitis vinifera
emb|CAN79872.1|  hypothetical protein VITISV_017186                   48.9    2e-08   Vitis vinifera
emb|CAN76196.1|  hypothetical protein VITISV_041073                   48.9    2e-08   Vitis vinifera
emb|CAN69747.1|  hypothetical protein VITISV_016320                   49.3    2e-08   Vitis vinifera
emb|CAN62633.1|  hypothetical protein VITISV_031441                   55.1    2e-08   Vitis vinifera
gb|AFP55546.1|  gag-pol polyprotein                                   48.9    2e-08   
emb|CAN63874.1|  hypothetical protein VITISV_038274                   48.1    2e-08   Vitis vinifera
emb|CAN60732.1|  hypothetical protein VITISV_010209                   45.1    2e-08   Vitis vinifera
ref|XP_010689911.1|  PREDICTED: uncharacterized protein LOC104903561  46.2    2e-08   
ref|XP_010325686.1|  PREDICTED: uncharacterized protein LOC104649000  49.3    2e-08   
emb|CAN69715.1|  hypothetical protein VITISV_011263                   47.4    2e-08   Vitis vinifera
emb|CAN71273.1|  hypothetical protein VITISV_019661                   50.1    2e-08   Vitis vinifera
emb|CAN67064.1|  hypothetical protein VITISV_017541                   45.4    3e-08   Vitis vinifera
emb|CAN76494.1|  hypothetical protein VITISV_024984                   45.4    3e-08   Vitis vinifera
emb|CAN68175.1|  hypothetical protein VITISV_010332                   45.4    3e-08   Vitis vinifera
ref|XP_004308668.1|  PREDICTED: uncharacterized protein LOC101303284  46.2    3e-08   
emb|CAN60502.1|  hypothetical protein VITISV_031514                   48.5    3e-08   Vitis vinifera
ref|XP_010314100.1|  PREDICTED: uncharacterized protein LOC104644925  52.0    3e-08   
emb|CAN63210.1|  hypothetical protein VITISV_021170                   43.9    3e-08   Vitis vinifera
emb|CAN62921.1|  hypothetical protein VITISV_032126                   48.5    3e-08   Vitis vinifera
emb|CAN77110.1|  hypothetical protein VITISV_013963                   47.8    3e-08   Vitis vinifera
emb|CAN75466.1|  hypothetical protein VITISV_025054                   47.0    3e-08   Vitis vinifera
emb|CAN73624.1|  hypothetical protein VITISV_042460                   47.0    3e-08   Vitis vinifera
emb|CAN60019.1|  hypothetical protein VITISV_007668                   43.5    3e-08   Vitis vinifera
emb|CAN82483.1|  hypothetical protein VITISV_006799                   47.0    3e-08   Vitis vinifera
ref|XP_010917812.1|  PREDICTED: disease resistance protein RGA2-like  49.7    3e-08   
emb|CAN61004.1|  hypothetical protein VITISV_015023                   47.0    3e-08   Vitis vinifera
emb|CAN73399.1|  hypothetical protein VITISV_006541                   47.0    3e-08   Vitis vinifera
emb|CAN76465.1|  hypothetical protein VITISV_007267                   47.0    3e-08   Vitis vinifera
emb|CAN65160.1|  hypothetical protein VITISV_021747                   45.1    3e-08   Vitis vinifera
ref|XP_010270824.1|  PREDICTED: uncharacterized protein LOC104607033  48.9    3e-08   
emb|CAN69184.1|  hypothetical protein VITISV_004341                   45.1    3e-08   Vitis vinifera
ref|XP_010916812.1|  PREDICTED: uncharacterized protein LOC105041563  56.2    3e-08   
emb|CAN82518.1|  hypothetical protein VITISV_042699                   45.4    3e-08   Vitis vinifera
emb|CAN73661.1|  hypothetical protein VITISV_024361                   46.6    3e-08   Vitis vinifera
emb|CAN83808.1|  hypothetical protein VITISV_026963                   44.7    3e-08   Vitis vinifera
emb|CAN82103.1|  hypothetical protein VITISV_035488                   46.2    4e-08   Vitis vinifera
emb|CAN82851.1|  hypothetical protein VITISV_027998                   46.6    4e-08   Vitis vinifera
emb|CAN68502.1|  hypothetical protein VITISV_015736                   44.7    4e-08   Vitis vinifera
emb|CAN70109.1|  hypothetical protein VITISV_001696                   46.2    4e-08   Vitis vinifera
emb|CAN80566.1|  hypothetical protein VITISV_029672                   46.6    4e-08   Vitis vinifera
ref|XP_010245474.1|  PREDICTED: phospholipase D p1-like               44.3    4e-08   
emb|CAN75041.1|  hypothetical protein VITISV_027174                   47.8    4e-08   Vitis vinifera
emb|CAN61929.1|  hypothetical protein VITISV_014855                   47.8    4e-08   Vitis vinifera
emb|CAN80320.1|  hypothetical protein VITISV_034560                   47.8    4e-08   Vitis vinifera
ref|XP_008341769.1|  PREDICTED: uncharacterized protein LOC103404622  45.1    4e-08   
emb|CAN74499.1|  hypothetical protein VITISV_013001                   47.8    4e-08   Vitis vinifera
emb|CAN72951.1|  hypothetical protein VITISV_020157                   46.2    4e-08   Vitis vinifera
emb|CAN82711.1|  hypothetical protein VITISV_004468                   51.6    4e-08   Vitis vinifera
emb|CAN76366.1|  hypothetical protein VITISV_014139                   53.9    5e-08   Vitis vinifera
emb|CAN74430.1|  hypothetical protein VITISV_010987                   47.8    5e-08   Vitis vinifera
emb|CAN74984.1|  hypothetical protein VITISV_035210                   47.8    5e-08   Vitis vinifera
emb|CAN73389.1|  hypothetical protein VITISV_005955                   48.1    5e-08   Vitis vinifera
emb|CAN70361.1|  hypothetical protein VITISV_033646                   47.8    5e-08   Vitis vinifera
emb|CAN65108.1|  hypothetical protein VITISV_036622                   46.6    5e-08   Vitis vinifera
gb|AFN88207.1|  integrase core domain containing protein              44.7    5e-08   
gb|AEJ72555.1|  putative retroelement polyprotein                     45.1    5e-08   
emb|CAN68711.1|  hypothetical protein VITISV_015847                   47.8    5e-08   Vitis vinifera
emb|CAN61738.1|  hypothetical protein VITISV_000022                   45.1    6e-08   Vitis vinifera
ref|YP_173385.1|  hypothetical protein NitaMp039                      50.1    6e-08   Nicotiana tabacum [American tobacco]
ref|XP_004231364.1|  PREDICTED: uncharacterized protein LOC101245809  48.5    6e-08   
ref|XP_010677179.1|  PREDICTED: uncharacterized protein LOC104892859  48.1    6e-08   
ref|XP_009629549.1|  PREDICTED: uncharacterized protein LOC104119680  48.1    6e-08   
ref|XP_008369089.1|  PREDICTED: uncharacterized protein LOC103432662  45.8    6e-08   
emb|CAN60149.1|  hypothetical protein VITISV_016363                   48.9    7e-08   Vitis vinifera
emb|CAN79888.1|  hypothetical protein VITISV_019498                   48.5    7e-08   Vitis vinifera
emb|CAN59979.1|  hypothetical protein VITISV_015228                   48.5    7e-08   Vitis vinifera
emb|CAN79196.1|  hypothetical protein VITISV_000238                   44.7    7e-08   Vitis vinifera
emb|CAN80365.1|  hypothetical protein VITISV_014717                   49.7    7e-08   Vitis vinifera
emb|CAN66772.1|  hypothetical protein VITISV_006774                   44.7    7e-08   Vitis vinifera
emb|CAN77372.1|  hypothetical protein VITISV_026174                   44.7    7e-08   Vitis vinifera
emb|CAN78216.1|  hypothetical protein VITISV_021944                   51.2    7e-08   Vitis vinifera
gb|KFL89552.1|  hypothetical protein AmDm5_1575                       45.8    8e-08   
ref|XP_008357860.1|  PREDICTED: uncharacterized protein LOC103421593  45.8    8e-08   
emb|CAN70029.1|  hypothetical protein VITISV_010388                   49.3    8e-08   Vitis vinifera
emb|CAN75898.1|  hypothetical protein VITISV_033580                   49.3    8e-08   Vitis vinifera
emb|CAN62229.1|  hypothetical protein VITISV_010990                   41.6    9e-08   Vitis vinifera
emb|CAN77295.1|  hypothetical protein VITISV_005638                   42.7    9e-08   Vitis vinifera
emb|CAN59952.1|  hypothetical protein VITISV_006720                   44.7    9e-08   Vitis vinifera
emb|CAN80841.1|  hypothetical protein VITISV_002785                   48.9    9e-08   Vitis vinifera
emb|CAN73585.1|  hypothetical protein VITISV_033960                   45.1    9e-08   Vitis vinifera
emb|CAN77807.1|  hypothetical protein VITISV_036095                   43.1    1e-07   Vitis vinifera
emb|CAN72440.1|  hypothetical protein VITISV_039162                   45.8    1e-07   Vitis vinifera
emb|CAN82769.1|  hypothetical protein VITISV_037882                   42.4    1e-07   Vitis vinifera
emb|CAN79949.1|  hypothetical protein VITISV_044422                   41.6    1e-07   Vitis vinifera
ref|XP_004153049.1|  PREDICTED: uncharacterized mitochondrial pro...  48.9    1e-07   
emb|CAN61660.1|  hypothetical protein VITISV_000260                   41.6    1e-07   Vitis vinifera
ref|XP_007028212.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  46.6    1e-07   
emb|CAN65820.1|  hypothetical protein VITISV_042324                   48.5    1e-07   Vitis vinifera
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...  44.7    1e-07   
emb|CAN65716.1|  hypothetical protein VITISV_015039                   45.1    1e-07   Vitis vinifera
gb|ACB45089.1|  putative polyprotein                                  50.1    1e-07   
emb|CAN81099.1|  hypothetical protein VITISV_017741                   50.4    1e-07   
emb|CAN75626.1|  hypothetical protein VITISV_001221                   48.9    1e-07   
emb|CAC95126.1|  gag-pol polyprotein                                  46.6    1e-07   
emb|CAN74559.1|  hypothetical protein VITISV_042001                   43.5    1e-07   
emb|CAN78876.1|  hypothetical protein VITISV_033245                   47.8    1e-07   
emb|CAN60373.1|  hypothetical protein VITISV_034932                   45.1    1e-07   
emb|CAN78598.1|  hypothetical protein VITISV_001332                   44.7    1e-07   
emb|CAN63881.1|  hypothetical protein VITISV_039357                   44.7    1e-07   
emb|CAN70357.1|  hypothetical protein VITISV_013713                   44.7    1e-07   
emb|CAN79175.1|  hypothetical protein VITISV_001884                   44.7    1e-07   
emb|CAN59964.1|  hypothetical protein VITISV_022757                   44.7    1e-07   
emb|CAN83575.1|  hypothetical protein VITISV_025852                   44.7    1e-07   
emb|CAN60972.1|  hypothetical protein VITISV_032051                   44.7    1e-07   
emb|CAN64765.1|  hypothetical protein VITISV_009574                   44.7    1e-07   
emb|CAN68802.1|  hypothetical protein VITISV_008809                   44.7    1e-07   
emb|CAN81385.1|  hypothetical protein VITISV_012324                   44.7    1e-07   
emb|CAN82937.1|  hypothetical protein VITISV_039222                   44.7    1e-07   
emb|CAE04466.3|  OSJNBa0029L02.7                                      50.1    1e-07   
emb|CAN76326.1|  hypothetical protein VITISV_014220                   44.7    1e-07   
emb|CAN78330.1|  hypothetical protein VITISV_034973                   44.7    1e-07   
emb|CAN64770.1|  hypothetical protein VITISV_004450                   47.4    1e-07   
emb|CAN65356.1|  hypothetical protein VITISV_012647                   44.7    1e-07   
emb|CAN61540.1|  hypothetical protein VITISV_025242                   44.7    1e-07   
ref|XP_010265970.1|  PREDICTED: uncharacterized protein LOC104603606  47.0    1e-07   
ref|XP_007010638.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  48.9    1e-07   
ref|XP_010321174.1|  PREDICTED: uncharacterized protein LOC104647460  49.7    1e-07   
emb|CAN60829.1|  hypothetical protein VITISV_012059                   48.5    1e-07   
ref|XP_008441937.1|  PREDICTED: uncharacterized protein LOC103485932  44.7    1e-07   
dbj|BAK64102.1|  gag-pol polyprotein                                  43.1    1e-07   
ref|XP_010110245.1|  ABC transporter C family member 2                46.6    1e-07   
emb|CAN70229.1|  hypothetical protein VITISV_024789                   44.7    1e-07   
ref|XP_008350549.1|  PREDICTED: uncharacterized protein LOC103413885  45.4    1e-07   
ref|XP_007019411.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  49.7    1e-07   
emb|CAN64502.1|  hypothetical protein VITISV_020342                   48.1    1e-07   
emb|CAN72168.1|  hypothetical protein VITISV_004170                   44.7    1e-07   
emb|CAN65233.1|  hypothetical protein VITISV_022975                   47.8    1e-07   
emb|CAN62636.1|  hypothetical protein VITISV_006313                   48.9    1e-07   
gb|AGJ83729.1|  gag-pol polyprotein                                   46.2    1e-07   
emb|CAN61815.1|  hypothetical protein VITISV_009920                   42.7    2e-07   
emb|CAN72141.1|  hypothetical protein VITISV_017108                   42.7    2e-07   
emb|CAN81634.1|  hypothetical protein VITISV_034565                   52.0    2e-07   
emb|CAN77225.1|  hypothetical protein VITISV_002211                   44.3    2e-07   
emb|CAN69597.1|  hypothetical protein VITISV_038518                   44.3    2e-07   
ref|XP_010321266.1|  PREDICTED: uncharacterized protein LOC104647537  48.5    2e-07   
emb|CAN73014.1|  hypothetical protein VITISV_007603                   43.1    2e-07   
emb|CAN78733.1|  hypothetical protein VITISV_020436                   44.7    2e-07   
emb|CAD41731.1|  OSJNBb0034I13.10                                     50.4    2e-07   
ref|XP_011078646.1|  PREDICTED: uncharacterized protein LOC105162338  48.1    2e-07   
emb|CAN61034.1|  hypothetical protein VITISV_041749                   42.7    2e-07   
emb|CAN77772.1|  hypothetical protein VITISV_037439                   44.7    2e-07   
emb|CAN59866.1|  hypothetical protein VITISV_013438                   45.4    2e-07   
ref|XP_010322961.1|  PREDICTED: uncharacterized protein LOC104648099  50.1    2e-07   
ref|XP_010248475.1|  PREDICTED: uncharacterized protein LOC104591383  48.1    2e-07   
emb|CAN74101.1|  hypothetical protein VITISV_039542                   48.5    2e-07   
ref|XP_009785433.1|  PREDICTED: uncharacterized protein LOC104233697  48.9    2e-07   
emb|CAN77556.1|  hypothetical protein VITISV_039374                   45.1    2e-07   
emb|CAN67119.1|  hypothetical protein VITISV_017483                   49.3    2e-07   
emb|CAN81594.1|  hypothetical protein VITISV_042175                   56.2    2e-07   
ref|XP_010534024.1|  PREDICTED: uncharacterized protein LOC104809678  45.8    2e-07   
emb|CAN71207.1|  hypothetical protein VITISV_030632                   43.5    2e-07   
emb|CAN62538.1|  hypothetical protein VITISV_031159                   44.7    2e-07   
ref|XP_010650252.1|  PREDICTED: uncharacterized protein LOC104879339  42.0    2e-07   
ref|XP_010252449.1|  PREDICTED: uncharacterized protein LOC104594032  45.8    2e-07   
emb|CAN80084.1|  hypothetical protein VITISV_011294                   46.2    2e-07   
ref|XP_010662546.1|  PREDICTED: uncharacterized protein LOC104882159  45.4    2e-07   
emb|CAN66624.1|  hypothetical protein VITISV_037417                   46.2    2e-07   
emb|CAN66596.1|  hypothetical protein VITISV_019893                   42.7    2e-07   
ref|XP_009589835.1|  PREDICTED: uncharacterized protein LOC104087139  51.6    2e-07   
ref|NP_001061718.1|  Os08g0389500                                     50.4    2e-07   
ref|XP_008390461.1|  PREDICTED: uncharacterized protein LOC103452707  45.4    2e-07   
ref|XP_001990509.1|  GH19391                                          49.3    2e-07   
emb|CAN67362.1|  hypothetical protein VITISV_001157                   44.3    2e-07   
emb|CAN81440.1|  hypothetical protein VITISV_036850                   44.7    3e-07   
emb|CAN69870.1|  hypothetical protein VITISV_032283                   43.5    3e-07   
emb|CAN73405.1|  hypothetical protein VITISV_010053                   42.7    3e-07   
ref|XP_009793394.1|  PREDICTED: uncharacterized protein LOC104240273  48.1    3e-07   
emb|CAN65095.1|  hypothetical protein VITISV_011639                   43.9    3e-07   
ref|XP_008360651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  40.4    3e-07   
emb|CAN72222.1|  hypothetical protein VITISV_028929                   44.7    3e-07   
gb|KFD60227.1|  hypothetical protein M514_27597                       42.4    3e-07   
emb|CAN61322.1|  hypothetical protein VITISV_012106                   40.8    3e-07   
ref|XP_010323530.1|  PREDICTED: uncharacterized protein LOC104648296  52.8    3e-07   
emb|CAN80061.1|  hypothetical protein VITISV_007942                   44.7    3e-07   
emb|CAN69166.1|  hypothetical protein VITISV_015588                   44.3    3e-07   
emb|CAN82683.1|  hypothetical protein VITISV_000483                   50.4    3e-07   
emb|CAN63917.1|  hypothetical protein VITISV_019573                   50.8    3e-07   
emb|CAN63955.1|  hypothetical protein VITISV_034255                   50.1    3e-07   
gb|KFD66793.1|  LOW QUALITY PROTEIN: hypothetical protein M514_20937  42.4    3e-07   
emb|CAN63304.1|  hypothetical protein VITISV_002333                   44.7    3e-07   
emb|CAN67449.1|  hypothetical protein VITISV_031400                   44.7    3e-07   
emb|CAN64787.1|  hypothetical protein VITISV_014072                   47.4    3e-07   
ref|XP_011100172.1|  PREDICTED: uncharacterized protein LOC105178407  48.5    3e-07   
emb|CAN65942.1|  hypothetical protein VITISV_001716                   42.4    4e-07   
ref|XP_010555836.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  45.8    4e-07   
emb|CAN59829.1|  hypothetical protein VITISV_014235                   41.6    4e-07   
ref|XP_007014807.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  49.3    4e-07   
ref|XP_004243080.1|  PREDICTED: uncharacterized protein LOC101259058  50.4    4e-07   
gb|KFD60665.1|  hypothetical protein M514_27174                       42.4    4e-07   
ref|XP_009362153.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  44.7    4e-07   
emb|CAN67666.1|  hypothetical protein VITISV_041108                   45.8    4e-07   
ref|XP_009792974.1|  PREDICTED: uncharacterized protein LOC104239923  48.9    4e-07   
emb|CAN78557.1|  hypothetical protein VITISV_010019                   44.7    4e-07   
ref|XP_006365584.1|  PREDICTED: uncharacterized protein LOC102598606  46.2    4e-07   
emb|CAN77904.1|  hypothetical protein VITISV_024390                   45.4    4e-07   
emb|CAN60008.1|  hypothetical protein VITISV_024743                   42.7    4e-07   
emb|CAN67762.1|  hypothetical protein VITISV_040650                   50.1    4e-07   
ref|XP_010527127.1|  PREDICTED: uncharacterized protein LOC104804512  44.7    5e-07   
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like        47.0    5e-07   
emb|CAN67009.1|  hypothetical protein VITISV_004754                   42.7    5e-07   
ref|XP_008239585.1|  PREDICTED: uncharacterized protein LOC103338173  47.8    5e-07   
emb|CAN82206.1|  hypothetical protein VITISV_000176                   44.7    5e-07   
emb|CAN76639.1|  hypothetical protein VITISV_027481                   43.9    5e-07   
emb|CAN60152.1|  hypothetical protein VITISV_021503                   44.7    5e-07   
ref|XP_010097678.1|  hypothetical protein L484_023818                 44.3    5e-07   
emb|CAN60139.1|  hypothetical protein VITISV_024746                   42.7    5e-07   
ref|XP_008392761.1|  PREDICTED: uncharacterized protein LOC103454946  42.7    5e-07   
emb|CAN74819.1|  hypothetical protein VITISV_034590                   47.8    5e-07   
ref|XP_004514853.1|  PREDICTED: uncharacterized protein LOC101509170  46.2    5e-07   
ref|XP_010068635.1|  PREDICTED: uncharacterized protein LOC104455561  49.7    5e-07   
ref|XP_008346469.1|  PREDICTED: uncharacterized protein LOC103409432  43.9    6e-07   
ref|XP_010038876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  41.2    6e-07   
emb|CAN82268.1|  hypothetical protein VITISV_009286                   42.0    6e-07   
emb|CAN69647.1|  hypothetical protein VITISV_022133                   47.0    6e-07   
emb|CAN60058.1|  hypothetical protein VITISV_039054                   44.7    6e-07   
emb|CAN82452.1|  hypothetical protein VITISV_003326                   39.7    6e-07   
emb|CAN66267.1|  hypothetical protein VITISV_042704                   44.7    7e-07   
emb|CAN81503.1|  hypothetical protein VITISV_018161                   40.8    7e-07   
gb|ABF99351.1|  retrotransposon protein, putative, unclassified       48.1    7e-07   
gb|AAP44677.1|  putative gag-pol polyprotein                          48.1    7e-07   
ref|XP_009758686.1|  PREDICTED: uncharacterized protein LOC104211342  51.2    7e-07   
ref|XP_006493535.1|  PREDICTED: uncharacterized protein LOC102628714  44.3    7e-07   
emb|CAN80881.1|  hypothetical protein VITISV_018650                   48.5    7e-07   
emb|CAN79066.1|  hypothetical protein VITISV_019693                   48.5    7e-07   
ref|XP_008369660.1|  PREDICTED: uncharacterized protein LOC103433199  45.8    7e-07   
emb|CAN65808.1|  hypothetical protein VITISV_033389                   46.2    8e-07   
emb|CAN63908.1|  hypothetical protein VITISV_044218                   46.2    8e-07   
emb|CAN79930.1|  hypothetical protein VITISV_007488                   40.4    8e-07   
ref|XP_008460736.1|  PREDICTED: uncharacterized protein LOC103499498  47.0    8e-07   
emb|CAN71586.1|  hypothetical protein VITISV_009568                   40.4    8e-07   
gb|KFD61455.1|  hypothetical protein M514_26351                       45.1    8e-07   
ref|XP_009760577.1|  PREDICTED: uncharacterized protein LOC104212...  42.4    8e-07   
emb|CAN66588.1|  hypothetical protein VITISV_017097                   54.7    8e-07   
ref|XP_009761875.1|  PREDICTED: uncharacterized protein LOC104213986  45.4    8e-07   
emb|CAN74901.1|  hypothetical protein VITISV_010116                   42.7    8e-07   
ref|XP_010321197.1|  PREDICTED: uncharacterized protein LOC104647473  42.7    8e-07   
emb|CAN62588.1|  hypothetical protein VITISV_028559                   45.1    9e-07   
emb|CAN73437.1|  hypothetical protein VITISV_031733                   45.8    9e-07   
emb|CAN69851.1|  hypothetical protein VITISV_009554                   42.4    9e-07   
ref|XP_009623206.1|  PREDICTED: uncharacterized protein LOC104114450  47.0    9e-07   
gb|ACL97383.1|  Gag-Pol polyprotein                                   47.0    1e-06   
gb|ACL97384.1|  Gag-Pol polyprotein                                   47.0    1e-06   
emb|CAN75434.1|  hypothetical protein VITISV_027911                   44.7    1e-06   
ref|XP_011070841.1|  PREDICTED: uncharacterized protein LOC105156417  43.5    1e-06   
emb|CAN79194.1|  hypothetical protein VITISV_000236                   54.7    1e-06   
ref|XP_006359791.1|  PREDICTED: uncharacterized protein LOC102577647  46.2    1e-06   
emb|CAN64955.1|  hypothetical protein VITISV_029829                   45.8    1e-06   
ref|XP_008677438.1|  PREDICTED: uncharacterized protein LOC100304...  45.1    1e-06   
emb|CAN64698.1|  hypothetical protein VITISV_000807                   44.3    1e-06   
ref|XP_009630839.1|  PREDICTED: uncharacterized protein LOC104120720  49.3    1e-06   
emb|CAN59999.1|  hypothetical protein VITISV_001733                   46.6    1e-06   
gb|ACL97386.1|  Gag-Pol polyprotein                                   46.6    1e-06   
emb|CAN82201.1|  hypothetical protein VITISV_011128                   44.7    1e-06   
emb|CAN71595.1|  hypothetical protein VITISV_010143                   43.1    1e-06   
ref|XP_010662484.1|  PREDICTED: uncharacterized protein LOC104882143  43.1    1e-06   
ref|XP_009621229.1|  PREDICTED: uncharacterized protein LOC104112894  48.1    1e-06   
emb|CAN73331.1|  hypothetical protein VITISV_036068                   45.1    1e-06   
emb|CAN64963.1|  hypothetical protein VITISV_002891                   42.7    1e-06   
emb|CAN66675.1|  hypothetical protein VITISV_004941                   49.3    1e-06   
emb|CAN83990.1|  hypothetical protein VITISV_018454                   44.3    1e-06   
emb|CAN69753.1|  hypothetical protein VITISV_024937                   41.6    1e-06   
emb|CAD41367.2|  OSJNBa0088A01.6                                      47.0    1e-06   
ref|XP_010319674.1|  PREDICTED: uncharacterized protein LOC104646896  45.4    1e-06   
emb|CAN83392.1|  hypothetical protein VITISV_041406                   42.0    1e-06   
emb|CAN66999.1|  hypothetical protein VITISV_019171                   42.0    1e-06   
ref|XP_010027392.1|  PREDICTED: uncharacterized protein LOC104417889  47.4    1e-06   
emb|CAN69367.1|  hypothetical protein VITISV_035520                   40.4    1e-06   
emb|CAN82041.1|  hypothetical protein VITISV_033522                   39.7    1e-06   
emb|CAN81355.1|  hypothetical protein VITISV_039158                   44.3    1e-06   
emb|CAN73022.1|  hypothetical protein VITISV_004050                   44.7    1e-06   
gb|ACL97385.1|  Gag-Pol polyprotein                                   46.2    1e-06   
ref|XP_010501746.1|  PREDICTED: uncharacterized protein LOC104779049  47.8    1e-06   
emb|CAN73189.1|  hypothetical protein VITISV_042346                   54.3    1e-06   
gb|KHN36156.1|  Retrovirus-related Pol polyprotein from transposo...  44.3    1e-06   
gb|KHN22040.1|  Retrovirus-related Pol polyprotein from transposo...  44.3    1e-06   
emb|CAN76606.1|  hypothetical protein VITISV_012935                   39.3    1e-06   
emb|CAN74310.1|  hypothetical protein VITISV_037517                   45.1    2e-06   
ref|XP_009613186.1|  PREDICTED: cytosolic sulfotransferase 15-like    53.9    2e-06   
emb|CAN60366.1|  hypothetical protein VITISV_031870                   45.1    2e-06   
gb|AAG10817.1|AC011808_5  Putative retroelement polyprotein           44.7    2e-06   
emb|CAN70831.1|  hypothetical protein VITISV_005284                   44.7    2e-06   
ref|XP_010692457.1|  PREDICTED: uncharacterized protein LOC104905567  48.1    2e-06   
ref|XP_008778017.1|  PREDICTED: uncharacterized protein LOC103697854  49.7    2e-06   
ref|XP_008348733.1|  PREDICTED: uncharacterized protein LOC103411898  47.0    2e-06   
ref|XP_008351324.1|  PREDICTED: uncharacterized protein LOC103414737  41.2    2e-06   
emb|CAN62836.1|  hypothetical protein VITISV_020079                   40.0    2e-06   
ref|XP_010656794.1|  PREDICTED: uncharacterized protein LOC104880778  47.8    2e-06   
gb|AAU93584.2|  Polyprotein, putative                                 45.1    2e-06   
ref|XP_010555983.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  45.4    2e-06   
ref|XP_009338880.1|  PREDICTED: uncharacterized protein LOC103931184  46.6    2e-06   
ref|XP_010648064.1|  PREDICTED: uncharacterized protein LOC104878872  53.5    2e-06   
ref|XP_010651924.1|  PREDICTED: uncharacterized protein LOC104879740  42.7    2e-06   
ref|XP_010101443.1|  Retrovirus-related Pol polyprotein from tran...  42.4    2e-06   
emb|CAN78880.1|  hypothetical protein VITISV_024991                   52.8    2e-06   
emb|CAN68990.1|  hypothetical protein VITISV_015170                   44.7    2e-06   
dbj|BAB09923.1|  copia-like retrotransposable element                 45.1    2e-06   
emb|CAN71214.1|  hypothetical protein VITISV_039504                   40.4    2e-06   
emb|CAN67968.1|  hypothetical protein VITISV_025091                   45.4    2e-06   
gb|KFD68774.1|  hypothetical protein M514_19015                       41.6    2e-06   
emb|CAN72986.1|  hypothetical protein VITISV_005624                   38.9    2e-06   
ref|XP_010695444.1|  PREDICTED: uncharacterized protein LOC104908074  42.7    2e-06   
ref|XP_009605462.1|  PREDICTED: uncharacterized protein LOC104100012  47.0    2e-06   
emb|CAN80113.1|  hypothetical protein VITISV_037927                   43.1    2e-06   
emb|CAN80285.1|  hypothetical protein VITISV_026753                   43.5    2e-06   
ref|XP_006359484.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  50.1    2e-06   
gb|ABW74566.1|  integrase                                             43.5    2e-06   
emb|CAN64039.1|  hypothetical protein VITISV_021558                   42.4    2e-06   
ref|XP_010233157.1|  PREDICTED: protein CHROMATIN REMODELING 24-like  47.0    2e-06   
gb|KFD60884.1|  hypothetical protein M514_26945                       43.9    2e-06   
ref|XP_008392961.1|  PREDICTED: embryonic protein DC-8                43.5    2e-06   
emb|CAH66624.1|  OSIGBa0115A19.5                                      45.1    2e-06   



>ref|XP_007044112.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOX99943.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=597

 Score = 62.4 bits (150),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MVE MVAL+ N TWDLVDLPAGK AIGCKWV+ V
Sbjct  276  MVEEMVALDGNGTWDLVDLPAGKKAIGCKWVFAV  309


 Score = 40.8 bits (94),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  69   DVFVARLKARLVAKGYAQTYGID  1
            D  VARLK R VAKGYAQTYG+D
Sbjct  314  DGSVARLKGRFVAKGYAQTYGVD  336



>ref|XP_004173716.1| PREDICTED: uncharacterized protein LOC101232174 [Cucumis sativus]
Length=265

 Score = 56.2 bits (134),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E M AL++N TWDLV  PAGK AIGCKWV+ V
Sbjct  1    MIEEMTALDDNGTWDLVSRPAGKKAIGCKWVFAV  34


 Score = 45.8 bits (107),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  78  MKPDVFVARLKARLVAKGYAQTYGID  1
           M PD  VARLKARLVAKGYAQ YG D
Sbjct  36  MNPDRTVARLKARLVAKGYAQIYGTD  61



>ref|XP_004137882.1| PREDICTED: ABC transporter C family member 13-like [Cucumis sativus]
Length=2377

 Score = 57.4 bits (137),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             M+E M AL++N TWDLV  PAGK AIGCKWV+ V
Sbjct  1426  MIEEMTALDDNDTWDLVSRPAGKKAIGCKWVFAV  1459


 Score = 43.9 bits (102),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  78    MKPDVFVARLKARLVAKGYAQTYGID  1
             M PD  V RLKARLVAKGYAQ YG D
Sbjct  1461  MNPDGTVTRLKARLVAKGYAQIYGTD  1486


 Score = 38.1 bits (87),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MVE + A+E  +TW +V +P     +G KWVY V
Sbjct  1553  MVEEIEAMERTKTWTIVSIPKDHHTVGSKWVYKV  1586


 Score = 36.6 bits (83),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             KPD  + R KARLVAKGY Q  GID
Sbjct  1589  KPDGTIDRYKARLVAKGYNQQEGID  1613



>gb|ABY49842.1| hypothetical protein [Vitis hybrid cultivar]
Length=1382

 Score = 54.3 bits (129),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE+N TW LVDLP GK  +GCKWV+ V
Sbjct  888  MLEEICALEDNHTWKLVDLPQGKKVVGCKWVFAV  921


 Score = 46.2 bits (108),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA+GYAQTYG+D
Sbjct  923  VNPDGSVARLKARLVARGYAQTYGVD  948



>emb|CAN83548.1| hypothetical protein VITISV_035575 [Vitis vinifera]
Length=1225

 Score = 54.3 bits (129),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE+N TW LVDLP GK  +GCKWV+ V
Sbjct  794  MLEEICALEDNHTWKLVDLPQGKKVVGCKWVFAV  827


 Score = 46.2 bits (108),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA+GYAQTYG+D
Sbjct  829  VNPDGSVARLKARLVARGYAQTYGVD  854



>emb|CAN63534.1| hypothetical protein VITISV_001206 [Vitis vinifera]
Length=1189

 Score = 54.3 bits (129),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE+N TW LVDLP GK  +GCKWV+ V
Sbjct  743  MLEEICALEDNHTWKLVDLPQGKKVVGCKWVFAV  776


 Score = 46.2 bits (108),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA+GYAQTYG+D
Sbjct  778  VNPDGSVARLKARLVARGYAQTYGVD  803



>emb|CAN61858.1| hypothetical protein VITISV_016691 [Vitis vinifera]
Length=763

 Score = 54.3 bits (129),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE+N TW LVDLP GK  +GCKWV+ V
Sbjct  282  MLEEICALEDNHTWKLVDLPQGKKVVGCKWVFAV  315


 Score = 46.2 bits (108),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA+GYAQTYG+D
Sbjct  317  VNPDGSVARLKARLVARGYAQTYGVD  342



>emb|CAN65144.1| hypothetical protein VITISV_026080 [Vitis vinifera]
Length=1220

 Score = 53.9 bits (128),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE+N TW LVDLP GK  +GCKWV+ V
Sbjct  762  MLEEICALEDNHTWXLVDLPQGKKVVGCKWVFAV  795


 Score = 46.2 bits (108),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA+GYAQTYG+D
Sbjct  797  VXPDGSVARLKARLVARGYAQTYGVD  822



>gb|AAO26686.1|AF478373_1 gag-pol polyprotein [Vitis vinifera]
Length=225

 Score = 53.1 bits (126),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE+N TW LVDLP GK  +GCKWV+ V
Sbjct  100  MLEEICALEDNHTWKLVDLPQGKKVVGCKWVFAV  133


 Score = 46.2 bits (108),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA+GYAQTYG+D
Sbjct  135  VNPDDSVARLKARLVARGYAQTYGVD  160



>ref|XP_010264152.1| PREDICTED: uncharacterized protein LOC104602236 [Nelumbo nucifera]
Length=371

 Score = 55.5 bits (132),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E M AL EN TWDLVDLPA K A+GCKWV  V
Sbjct  226  MLEEMNALTENGTWDLVDLPASKKAVGCKWVLAV  259


 Score = 43.9 bits (102),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  69   DVFVARLKARLVAKGYAQTYGID  1
            D  VARLKARLVAKGYAQTYG+D
Sbjct  264  DGSVARLKARLVAKGYAQTYGVD  286



>emb|CAN74241.1| hypothetical protein VITISV_006638 [Vitis vinifera]
Length=1280

 Score = 52.8 bits (125),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVY  86
            M+E + ALE+N TW LVDLP GK  +GCKWV+
Sbjct  822  MLEEICALEDNHTWKLVDLPQGKKVVGCKWVF  853


 Score = 46.6 bits (109),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   + PD  VARLKARLVA+GYAQTYG+D
Sbjct  853  FAXKVNPDGSVARLKARLVARGYAQTYGVD  882



>ref|XP_010068106.1| PREDICTED: uncharacterized protein LOC104454933 [Eucalyptus grandis]
Length=729

 Score = 55.8 bits (133),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + ALE NQTWDLV LP GK AIGC+WVY V
Sbjct  405  MEEELQALEINQTWDLVPLPLGKTAIGCRWVYAV  438


 Score = 43.5 bits (101),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD   ARLKARLVAKGYAQ YG+D
Sbjct  440  VNPDGSFARLKARLVAKGYAQVYGVD  465



>gb|AAT38747.2| Polyprotein, putative [Solanum demissum]
Length=1402

 Score = 52.8 bits (125),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M++ + AL++N TW+LVDLP GK A+GCKWV+ +
Sbjct  930  MLDEIHALDDNHTWNLVDLPKGKKAVGCKWVFTI  963


 Score = 46.2 bits (108),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   + PD  +ARLKARLVAKGYAQTYG+D
Sbjct  961  FTIKVNPDGSMARLKARLVAKGYAQTYGVD  990



>ref|XP_010644234.1| PREDICTED: uncharacterized protein LOC104877519 [Vitis vinifera]
Length=528

 Score = 52.0 bits (123),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE N TW+LVDLP GK  +GCKWV+ +
Sbjct  443  MLEEIQALEVNHTWNLVDLPIGKNVVGCKWVFAI  476


 Score = 46.6 bits (109),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   + PD  VA+LKARLVAKGYAQTYG+D
Sbjct  474  FAIKVNPDGLVAQLKARLVAKGYAQTYGVD  503



>emb|CAN71748.1| hypothetical protein VITISV_019194 [Vitis vinifera]
Length=1306

 Score = 52.0 bits (123),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+  + ALE+N TW LVDLP GK  +GCKWV+ V
Sbjct  848  MLXEICALEDNHTWKLVDLPQGKKVVGCKWVFAV  881


 Score = 46.2 bits (108),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA+GYAQTYG+D
Sbjct  883  VNPDGSVARLKARLVARGYAQTYGVD  908



>ref|XP_007033977.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY04903.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=781

 Score = 50.1 bits (118),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            +VE M+AL+ N TWD VDL AGK  IGCKWV+ V
Sbjct  357  IVEEMMALDGNGTWDSVDLLAGKKVIGCKWVFAV  390


 Score = 45.8 bits (107),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  +ARLKARLVAKGYAQTYG+D
Sbjct  392  VNPDGSMARLKARLVAKGYAQTYGVD  417



>emb|CAN60648.1| hypothetical protein VITISV_033947 [Vitis vinifera]
Length=1257

 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE+N TW LV LP GK  +GCKWV+ V
Sbjct  800  MLEEICALEDNHTWKLVYLPQGKKIVGCKWVFAV  833


 Score = 44.7 bits (104),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKA+LVA+GYAQTYG+D
Sbjct  835  VNPDGSVARLKAKLVARGYAQTYGVD  860



>gb|ABA95797.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1588

 Score = 54.7 bits (130),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
             M E + ALE+N+TW+LV LP GK A+GCKWV+ V +T
Sbjct  1095  MKEELRALEKNKTWELVKLPMGKRAVGCKWVFTVKQT  1131


 Score = 40.0 bits (92),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             P+  V R KARLVAKGY+QTYGID
Sbjct  1132  PEGKVDRYKARLVAKGYSQTYGID  1155



>emb|CAN71132.1| hypothetical protein VITISV_007235 [Vitis vinifera]
Length=1259

 Score = 49.3 bits (116),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  178  VETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            +E + ALE+N TW LVD P GK  +GCKWV+ V
Sbjct  822  LEEIYALEDNHTWKLVDSPQGKKVVGCKWVFAV  854


 Score = 45.1 bits (105),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  VARLKARLVA GYAQTYG+D
Sbjct  856  VNPDGSVARLKARLVAXGYAQTYGVD  881



>gb|AAM91874.1| putative copia-like polyprotein [Oryza sativa Japonica Group]
Length=894

 Score = 51.6 bits (122),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M+E + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  401  MLEELEALEKNKTWDLVPFPKGKKVVNCKWVYTVKQ  436


 Score = 42.4 bits (98),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  438  PDENVERYKARLVAKGYSQTYGID  461



>ref|XP_008673671.1| PREDICTED: uncharacterized protein LOC103649714 [Zea mays]
Length=353

 Score = 54.7 bits (130),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M E ++AL++N+TW+LV LP GK A+GCKWV+ V +T
Sbjct  269  MKEELLALQKNKTWELVHLPEGKKAVGCKWVFTVKQT  305


 Score = 39.3 bits (90),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  + R KARLVAKGY+QTYGID
Sbjct  306  PEGKIDRYKARLVAKGYSQTYGID  329



>gb|AAP54332.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=822

 Score = 51.6 bits (122),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M+E + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  346  MLEELEALEKNKTWDLVPFPKGKKVVNCKWVYTVKQ  381


 Score = 42.4 bits (98),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  383  PDENVERYKARLVAKGYSQTYGID  406



>gb|ABA95230.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=936

 Score = 51.6 bits (122),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M+E + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  443  MLEELEALEKNKTWDLVPFPKGKKVVNCKWVYTVKQ  478


 Score = 42.0 bits (97),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  480  PDGNVERYKARLVAKGYSQTYGID  503



>emb|CAE75905.1| OSJNBa0088I22.18 [Oryza sativa Japonica Group]
Length=624

 Score = 51.6 bits (122),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M+E + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  396  MLEELEALEKNKTWDLVPFPKGKKVVNCKWVYTVKQ  431


 Score = 42.0 bits (97),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  433  PDGNVERYKARLVAKGYSQTYGID  456



>emb|CAN76133.1| hypothetical protein VITISV_036298 [Vitis vinifera]
Length=1161

 Score = 54.7 bits (130),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ MVAL  N TWDLV LP+GK  +GC+WVY V
Sbjct  696  MVDEMVALHSNGTWDLVVLPSGKSTVGCRWVYAV  729


 Score = 38.5 bits (88),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  733  PDGQVDRLKARLVAKGYTQVYGSD  756



>emb|CAN74964.1| hypothetical protein VITISV_006810 [Vitis vinifera]
Length=1248

 Score = 49.3 bits (116),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E + ALE N TW+ VDLP GK  +GCKWV+ +
Sbjct  798  MLEEIQALEVNHTWNRVDLPIGKNVVGCKWVFAI  831


 Score = 43.9 bits (102),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   + P+  VARLKARLVA+GYAQTYG+D
Sbjct  829  FAIKVNPNGSVARLKARLVAEGYAQTYGVD  858



>gb|AAO26685.1|AF478371_1 gag-pol polyprotein [Vitis vinifera]
Length=373

 Score = 49.3 bits (116),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+  + ALE+N TW LVDLP GK  +GCKWV  V
Sbjct  195  MLAEICALEDNHTWKLVDLPQGKKVVGCKWVSAV  228


 Score = 43.9 bits (102),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  V RLKARLVA+GYAQTYG+D
Sbjct  230  VNPDGSVVRLKARLVARGYAQTYGVD  255



>emb|CAN71658.1| hypothetical protein VITISV_028062 [Vitis vinifera]
Length=409

 Score = 53.5 bits (127),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  191  MVDEMAALHSNDTWDLVVLPSGKSTVGCRWVYTV  224


 Score = 39.7 bits (91),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  228  PDGQVDRLKARLVAKGYTQVYGFD  251



>emb|CAN73763.1| hypothetical protein VITISV_031179 [Vitis vinifera]
Length=564

 Score = 54.7 bits (130),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ MVAL  N TWDLV LP+GK  +GC+WVY V
Sbjct  368  MVDEMVALHSNGTWDLVVLPSGKSTVGCRWVYAV  401


 Score = 38.1 bits (87),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  405  PDGQVDRLKARLVAKGYTQVYGSD  428



>emb|CAN66416.1| hypothetical protein VITISV_044133 [Vitis vinifera]
Length=1549

 Score = 53.5 bits (127),  Expect(2) = 9e-11, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ MVAL  N TWDLV LP GK  +GC+WVY V
Sbjct  1269  MVDEMVALHFNGTWDLVSLPLGKSTVGCRWVYTV  1302


 Score = 38.9 bits (89),  Expect(2) = 9e-11, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLKARLVAKGY Q YG D
Sbjct  1306  PDGQVNRLKARLVAKGYTQIYGCD  1329



>emb|CAN70756.1| hypothetical protein VITISV_014702 [Vitis vinifera]
Length=1212

 Score = 53.5 bits (127),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  IGC+WVY V
Sbjct  750  MVDEMTALHSNGTWDLVVLPSGKSTIGCRWVYAV  783


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  787  PDGQVDRLKARLVAKGYTQVYGSD  810



>emb|CAN65647.1| hypothetical protein VITISV_001300 [Vitis vinifera]
Length=1094

 Score = 53.5 bits (127),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  IGC+WVY V
Sbjct  638  MVDEMAALHSNGTWDLVVLPSGKSTIGCRWVYTV  671


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  675  PDGQVDRLKARLVAKGYTQVYGSD  698



>emb|CAN75922.1| hypothetical protein VITISV_030752 [Vitis vinifera]
Length=1214

 Score = 53.5 bits (127),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  756  MVDEMAALHSNDTWDLVVLPSGKSTVGCRWVYAV  789


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  793  PDGQVDRLKARLVAKGYTQVYGSD  816



>emb|CAN64673.1| hypothetical protein VITISV_007430 [Vitis vinifera]
Length=1079

 Score = 53.5 bits (127),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC WVYVV
Sbjct  666  MVDEMAALHSNGTWDLVVLPSGKSTVGCHWVYVV  699


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  703  PDGQVDRLKARLVAKGYTQVYGSD  726



>gb|AAL68641.1|AF458765_1 polyprotein [Oryza sativa Japonica Group]
Length=1472

 Score = 49.7 bits (117),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
             M++ + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  979   MLDELEALEKNKTWDLVSYPNGKKVVNCKWVYAVKQ  1014


 Score = 42.0 bits (97),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V R KARLVAKGY+QTYGID
Sbjct  1016  PDGKVERYKARLVAKGYSQTYGID  1039



>ref|XP_010112166.1| DNA polymerase theta [Morus notabilis]
 gb|EXC32791.1| DNA polymerase theta [Morus notabilis]
Length=1941

 Score = 50.1 bits (118),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            ++E M ALE+N TW +V+LP GK  +GCKWV+ V
Sbjct  90   VLEEMQALEKNNTWSVVELPQGKSVVGCKWVFTV  123


 Score = 42.0 bits (97),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F    KPD  + R KARLVAKG+ QTYGID
Sbjct  121  FTVKFKPDGSIERYKARLVAKGFTQTYGID  150



>emb|CAN77210.1| hypothetical protein VITISV_000141 [Vitis vinifera]
Length=1236

 Score = 53.1 bits (126),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ MVAL  N TWDLV LP GK  +GC+WVY V
Sbjct  741  MVDEMVALHSNGTWDLVVLPFGKSTVGCRWVYAV  774


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  778  PDGQVDRLKARLVAKGYTQVYGSD  801



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score = 52.8 bits (125),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ MV L  N TWDLV LP+GK  +GC+WVY V
Sbjct  782  MVDEMVVLHSNGTWDLVVLPSGKSTVGCRWVYTV  815


 Score = 38.9 bits (89),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  V RLKARLVAKGY Q YG D
Sbjct  817  VSPDGQVDRLKARLVAKGYTQVYGSD  842



>ref|XP_006485859.1| PREDICTED: uncharacterized protein LOC102626627 [Citrus sinensis]
Length=1081

 Score = 52.0 bits (123),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M + M +L++NQTW+LVDLP GK  +GC+W+Y +
Sbjct  627  MNDEMRSLQKNQTWELVDLPPGKKPVGCRWIYTI  660


 Score = 40.0 bits (92),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  663  KADGSIERYKARLVAKGYTQTYGID  687



>emb|CAN80088.1| hypothetical protein VITISV_021656 [Vitis vinifera]
Length=1099

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  693  MVDEMXALHSNGTWDLVSLPXGKSTVGCRWVYXV  726


 Score = 38.9 bits (89),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  730  PDGQVDRLKARLVAKGYTQIYGCD  753



>emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera]
Length=1403

 Score = 53.1 bits (126),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  969   MVDEMTALHSNGTWDLVVLPSGKSTVGCRWVYAV  1002


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLKARLVAKGY Q YG D
Sbjct  1006  PDGQVDRLKARLVAKGYTQVYGSD  1029



>emb|CAN67925.1| hypothetical protein VITISV_021168 [Vitis vinifera]
Length=1354

 Score = 53.1 bits (126),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  839  MVDEMTALHSNGTWDLVVLPSGKSTVGCRWVYAV  872


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  876  PDGQVDRLKARLVAKGYTQVYGSD  899



>emb|CAN71246.1| hypothetical protein VITISV_011986 [Vitis vinifera]
Length=937

 Score = 53.1 bits (126),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  442  MVDEMTALHSNGTWDLVILPSGKSTVGCRWVYAV  475


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  479  PDGQVDRLKARLVAKGYTQVYGSD  502



>emb|CAN76019.1| hypothetical protein VITISV_010645 [Vitis vinifera]
Length=698

 Score = 53.1 bits (126),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  482  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYTV  515


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  519  PDGQVDRLKARLVAKGYTQVYGSD  542



>emb|CAN65410.1| hypothetical protein VITISV_040416 [Vitis vinifera]
Length=2253

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  1416  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  1449


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLKARLVAKGY Q YG D
Sbjct  1453  PDGQVDRLKARLVAKGYTQVYGSD  1476



>emb|CAN78616.1| hypothetical protein VITISV_003658 [Vitis vinifera]
Length=2172

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  1515  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  1548


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLKARLVAKGY Q YG D
Sbjct  1552  PDGQVDRLKARLVAKGYTQVYGSD  1575



>emb|CAN60609.1| hypothetical protein VITISV_036599 [Vitis vinifera]
Length=1455

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  996   MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  1029


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLKARLVAKGY Q YG D
Sbjct  1033  PDGQVDRLKARLVAKGYTQVYGSD  1056



>emb|CAN62535.1| hypothetical protein VITISV_041880 [Vitis vinifera]
Length=1314

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  851  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  884


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  888  PDGQVDRLKARLVAKGYTQVYGSD  911



>emb|CAN74286.1| hypothetical protein VITISV_036410 [Vitis vinifera]
Length=1262

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  812  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  845


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  849  PDGQVDRLKARLVAKGYTQVYGSD  872



>emb|CAN75744.1| hypothetical protein VITISV_040125 [Vitis vinifera]
Length=1257

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  772  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  805


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  809  PDGQVDRLKARLVAKGYTQVYGSD  832



>emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera]
Length=1237

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  776  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  809


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  813  PDGQVDRLKARLVAKGYTQVYGSD  836



>emb|CAN72018.1| hypothetical protein VITISV_001841 [Vitis vinifera]
Length=1225

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  730  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  763


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  767  PDGQVDRLKARLVAKGYTQVYGSD  790



>emb|CAN63730.1| hypothetical protein VITISV_030286 [Vitis vinifera]
Length=1205

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  710  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  743


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  747  PDGQVDRLKARLVAKGYTQVYGSD  770



>emb|CAN73074.1| hypothetical protein VITISV_032386 [Vitis vinifera]
Length=1195

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  734  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  767


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  771  PDGQVDRLKARLVAKGYTQVYGSD  794



>emb|CAN80771.1| hypothetical protein VITISV_027574 [Vitis vinifera]
Length=1193

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  723  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  756


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  760  PDGQVDRLKARLVAKGYTQVYGSD  783



>emb|CAN76679.1| hypothetical protein VITISV_034325 [Vitis vinifera]
Length=1117

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  706  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  739


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  743  PDGQVDRLKARLVAKGYTQVYGSD  766



>emb|CAN62614.1| hypothetical protein VITISV_028123 [Vitis vinifera]
Length=1102

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  617  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  650


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  654  PDGQVDRLKARLVAKGYTQVYGSD  677



>emb|CAN80469.1| hypothetical protein VITISV_008623 [Vitis vinifera]
Length=1041

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  580  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  613


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  617  PDGQVDRLKARLVAKGYTQVYGSD  640



>emb|CAN75900.1| hypothetical protein VITISV_033582 [Vitis vinifera]
Length=1041

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  562  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  595


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  599  PDGQVDRLKARLVAKGYTQVYGSD  622



>emb|CAN82075.1| hypothetical protein VITISV_016661 [Vitis vinifera]
Length=960

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  839  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  872


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  876  PDGQVDRLKARLVAKGYTQVYGSD  899



>emb|CAN73101.1| hypothetical protein VITISV_042890 [Vitis vinifera]
Length=772

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  277  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  310


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  314  PDGQVDRLKARLVAKGYTQVYGSD  337



>emb|CAD41085.2| OSJNBb0011N17.2 [Oryza sativa Japonica Group]
Length=1262

 Score = 49.3 bits (116),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M++ + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  769  MLDELEALEKNKTWDLVSYPNGKKVVNCKWVYAVKQ  804


 Score = 42.0 bits (97),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  806  PDGKVERYKARLVAKGYSQTYGID  829



>emb|CAN68682.1| hypothetical protein VITISV_024814 [Vitis vinifera]
Length=1248

 Score = 50.8 bits (120),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  169  MVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M ALE+N+TW+LV LP GK  +GCKWVY V
Sbjct  790  MEALEKNKTWELVKLPTGKKPVGCKWVYTV  819


 Score = 40.4 bits (93),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  + R KARLVAKGYAQTYGID
Sbjct  822  RADGSIERYKARLVAKGYAQTYGID  846



>gb|AAO20078.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1299

 Score = 49.3 bits (116),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M++ + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  806  MLDELEALEKNKTWDLVPFPKGKKIVNCKWVYTVKQ  841


 Score = 42.0 bits (97),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  843  PDGKVERYKARLVAKGYSQTYGID  866



>emb|CAN72132.1| hypothetical protein VITISV_040707 [Vitis vinifera]
Length=744

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  278  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  311


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  315  PDGQVDRLKARLVAKGYTQVYGSD  338



>emb|CAN70689.1| hypothetical protein VITISV_012155 [Vitis vinifera]
Length=1199

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  322  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  355


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  359  PDGQVDRLKARLVAKGYTQVYGSD  382



>emb|CAH66946.1| B0809H07.1 [Oryza sativa Indica Group]
Length=1120

 Score = 48.9 bits (115),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M++ + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  644  MLDELEALEKNKTWDLVPFPKGKKIVNCKWVYTVKQ  679


 Score = 42.0 bits (97),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  681  PDGKVERYKARLVAKGYSQTYGID  704



>emb|CAN61207.1| hypothetical protein VITISV_015446 [Vitis vinifera]
Length=900

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  421  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  454


 Score = 38.1 bits (87),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  458  PDGQVDRLKARLVAKGYTQVYGSD  481



>emb|CAN63852.1| hypothetical protein VITISV_004832 [Vitis vinifera]
Length=309

 Score = 52.8 bits (125),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  159  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  192


 Score = 38.1 bits (87),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  196  PDGQVDRLKARLVAKGYTQVYGSD  219



>emb|CAN60274.1| hypothetical protein VITISV_024841 [Vitis vinifera]
Length=1573

 Score = 52.4 bits (124),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY +
Sbjct  635  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAI  668


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  672  PDGQVDRLKARLVAKGYTQVYGSD  695



>emb|CAN66243.1| hypothetical protein VITISV_015916 [Vitis vinifera]
Length=1258

 Score = 52.4 bits (124),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  825  MVDEMAALHSNDTWDLVVLPYGKSTVGCRWVYTV  858


 Score = 38.5 bits (88),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  862  PDGQVDRLKARLVAKGYTQVYGSD  885



>emb|CAN80247.1| hypothetical protein VITISV_027801 [Vitis vinifera]
Length=1001

 Score = 54.7 bits (130),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY+V
Sbjct  641  MVDEMAALHSNDTWDLVVLPSGKSTVGCRWVYIV  674


 Score = 36.2 bits (82),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKA LVAKGY Q YG D
Sbjct  678  PDGQVDRLKAHLVAKGYTQVYGSD  701



>ref|XP_009771264.1| PREDICTED: uncharacterized protein LOC104221828 [Nicotiana sylvestris]
Length=390

 Score = 51.6 bits (122),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E M AL +N TW++V LP GK  +GC+WV++V
Sbjct  246  MIEEMTALHDNGTWEIVPLPKGKTTVGCRWVFIV  279


 Score = 39.7 bits (91),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F+  + P+  V RLKARLVAKGY Q YGID
Sbjct  277  FIVKVGPNGEVDRLKARLVAKGYTQVYGID  306


 Score = 50.8 bits (120),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E M AL +N TW++V LP GK  +GC+WV++V
Sbjct  10   MIEEMNALHDNDTWEIVPLPKGKTTVGCRWVFIV  43


 Score = 30.4 bits (67),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  90  FMWLMKPDVFVARLKARLVAKGYAQ  16
           F+  + P+  V RLKARLVAKGY Q
Sbjct  41  FIVKVGPNGEVDRLKARLVAKGYTQ  65



>emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera]
Length=1323

 Score = 52.4 bits (124),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  828  MVDEMAALHSNGTWDLVVLPXGKSTVGCRWVYAV  861


 Score = 38.5 bits (88),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  865  PDGQVDRLKARLVAKGYTQVYGSD  888



>emb|CAN67317.1| hypothetical protein VITISV_019719 [Vitis vinifera]
Length=1240

 Score = 52.0 bits (123),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  809  MVDEMTALHSNGTWDLVVLPPGKSTVGCRWVYAV  842


 Score = 38.5 bits (88),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  846  PDGQVDRLKARLVAKGYTQVYGSD  869



>emb|CAN82359.1| hypothetical protein VITISV_027367 [Vitis vinifera]
Length=984

 Score = 52.0 bits (123),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  649  MVDEMAALHSNDTWDLVVLPFGKSTVGCRWVYAV  682


 Score = 38.5 bits (88),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  686  PDGQVDRLKARLVAKGYTQVYGSD  709



>emb|CAN72188.1| hypothetical protein VITISV_020673 [Vitis vinifera]
Length=988

 Score = 50.8 bits (120),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M+E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  553  MIEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  586


 Score = 40.0 bits (92),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K +  + R KARLVAKGY QTYGID
Sbjct  589  KABGSIERFKARLVAKGYTQTYGID  613



>emb|CAN69102.1| hypothetical protein VITISV_042048 [Vitis vinifera]
Length=1135

 Score = 54.3 bits (129),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY++
Sbjct  710  MVDEMXALHSNXTWDLVSLPPGKSTVGCRWVYII  743


 Score = 36.6 bits (83),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V RLKARLV KGY Q YG D
Sbjct  747  PBGQVDRLKARLVVKGYTQIYGCD  770



>emb|CAN63637.1| hypothetical protein VITISV_038689 [Vitis vinifera]
Length=601

 Score = 52.0 bits (123),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N  WDLV LP GK  IGC+WVY V
Sbjct  187  MVDEMAALHSNGKWDLVSLPPGKSTIGCRWVYTV  220


 Score = 38.9 bits (89),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  224  PDGQVDRLKARLVAKGYTQIYGCD  247



>ref|XP_006584292.1| PREDICTED: uncharacterized protein LOC102668041 [Glycine max]
Length=1176

 Score = 53.1 bits (126),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M ALE N TW+LV LP GK  +GC+WVY V
Sbjct  681  MVDEMQALENNGTWELVPLPPGKTTVGCRWVYTV  714


 Score = 37.7 bits (86),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V RLKARLVAKGY Q YGI+
Sbjct  718  PNDKVDRLKARLVAKGYTQVYGIE  741



>emb|CAN64167.1| hypothetical protein VITISV_015919 [Vitis vinifera]
Length=383

 Score = 52.8 bits (125),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  121  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  154


 Score = 37.7 bits (86),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  158  PDGQVDRLKARLVAKGYTQVYGSD  181



>emb|CAN81362.1| hypothetical protein VITISV_013815 [Vitis vinifera]
Length=1535

 Score = 51.6 bits (122),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ MVAL  N TWDLV LP  K  +GC+WVY V
Sbjct  1281  MVDEMVALHSNGTWDLVSLPPCKPTVGCRWVYTV  1314


 Score = 38.9 bits (89),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLKARLVAKGY Q YG D
Sbjct  1318  PDGQVDRLKARLVAKGYTQIYGCD  1341



>emb|CAN74064.1| hypothetical protein VITISV_028146 [Vitis vinifera]
Length=1203

 Score = 51.6 bits (122),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  708  MVDEMDALHSNGTWDLVVLPSGKSTVGCRWVYAV  741


 Score = 38.5 bits (88),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  745  PDGQVDRLKARLVAKGYTQVYGSD  768



>emb|CAN69088.1| hypothetical protein VITISV_031062 [Vitis vinifera]
Length=940

 Score = 52.8 bits (125),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+W+Y V
Sbjct  460  MVDEMAALHSNGTWDLVSLPPGKSTVGCRWIYTV  493


 Score = 37.0 bits (84),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLV KGY Q YG D
Sbjct  497  PDGQVDRLKARLVVKGYTQIYGCD  520



>emb|CAN64827.1| hypothetical protein VITISV_030308 [Vitis vinifera]
Length=1096

 Score = 51.2 bits (121),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  I C+WVY V
Sbjct  744  MVDEMAALHSNDTWDLVVLPSGKSTIDCRWVYAV  777


 Score = 38.5 bits (88),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  781  PDGQVDRLKARLVAKGYTQVYGSD  804



>emb|CAN60498.1| hypothetical protein VITISV_027869 [Vitis vinifera]
Length=2077

 Score = 54.3 bits (129),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ MVAL  N TWDLV LP GK  IGC+WVY V
Sbjct  1052  MVDEMVALHFNGTWDLVSLPPGKSTIGCRWVYTV  1085


 Score = 35.4 bits (80),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLKARLVAKGY Q Y  D
Sbjct  1089  PDGQVDRLKARLVAKGYTQIYCCD  1112



>gb|AAU10804.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88702.1| unnamed protein product [Oryza sativa Japonica Group]
Length=444

 Score = 49.7 bits (117),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M++ + ALE+N+TWDLV  P GK  + CKWVY V +
Sbjct  305  MLDELEALEKNKTWDLVPFPEGKKVVNCKWVYTVKQ  340


 Score = 40.0 bits (92),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V R KARLVAKGY+QTYGID
Sbjct  342  PNGKVERYKARLVAKGYSQTYGID  365



>emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera]
Length=1181

 Score = 52.8 bits (125),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  711  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  744


 Score = 37.0 bits (84),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V RLKARLVAKGY Q YG D
Sbjct  748  PEGQVDRLKARLVAKGYTQVYGSD  771



>emb|CAN79281.1| hypothetical protein VITISV_034553 [Vitis vinifera]
Length=713

 Score = 52.8 bits (125),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  364  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  397


 Score = 37.0 bits (84),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLV KGY Q YG D
Sbjct  401  PDGQVDRLKARLVGKGYTQVYGSD  424



>emb|CAN65230.1| hypothetical protein VITISV_034221 [Vitis vinifera]
Length=482

 Score = 51.6 bits (122),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV  M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  1    MVXKMAALHSNVTWDLVVLPSGKSTVGCRWVYAV  34


 Score = 38.1 bits (87),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72  PDVFVARLKARLVAKGYAQTYGID  1
           PD  V RLKARLVAKGY Q YG D
Sbjct  38  PDGQVDRLKARLVAKGYTQVYGSD  61



>emb|CAN76032.1| hypothetical protein VITISV_040150 [Vitis vinifera]
Length=1152

 Score = 52.8 bits (125),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  731  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  764


 Score = 37.0 bits (84),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLV KGY Q YG D
Sbjct  768  PDGQVDRLKARLVXKGYTQVYGSD  791



>emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera]
Length=1304

 Score = 50.8 bits (120),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+W Y V
Sbjct  825  MVDEMAALHSNGTWDLVVLPSGKSTVGCRWXYAV  858


 Score = 38.5 bits (88),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  862  PDGQVDRLKARLVAKGYTQVYGSD  885



>emb|CAN71812.1| hypothetical protein VITISV_037409 [Vitis vinifera]
Length=621

 Score = 50.8 bits (120),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  169  MVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M ALE+N+TW+LV LP GK  +GCKWVY V
Sbjct  169  MEALEKNKTWELVKLPTGKKPVGCKWVYTV  198


 Score = 38.5 bits (88),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  + R KARLVAKGY QTYGID
Sbjct  201  RADGSIERYKARLVAKGYTQTYGID  225



>emb|CAN72710.1| hypothetical protein VITISV_018096 [Vitis vinifera]
Length=1110

 Score = 52.4 bits (124),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M  L  N TWDLV LP+GK  +GC+WVY V
Sbjct  686  MVDEMATLHSNGTWDLVSLPSGKSTVGCRWVYTV  719


 Score = 37.0 bits (84),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V RLKARLVAKGY Q YG D
Sbjct  723  PNGQVDRLKARLVAKGYTQIYGCD  746



>emb|CAN81715.1| hypothetical protein VITISV_032902 [Vitis vinifera]
Length=848

 Score = 52.8 bits (125),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  353  MVDEMAALHSNDTWDLVVLPPGKSTVGCRWVYAV  386


 Score = 36.6 bits (83),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLV KGY Q YG D
Sbjct  390  PDGQVDRLKARLVXKGYTQVYGSD  413



>emb|CAN62266.1| hypothetical protein VITISV_025647 [Vitis vinifera]
Length=1254

 Score = 50.8 bits (120),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  + TWDLV LP+GK  +GC+WVY V
Sbjct  796  MVDEMAALHSSGTWDLVVLPSGKSTVGCRWVYAV  829


 Score = 38.5 bits (88),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  833  PDGQVDRLKARLVAKGYTQVYGSD  856



>emb|CAN69691.1| hypothetical protein VITISV_026777 [Vitis vinifera]
Length=1223

 Score = 50.8 bits (120),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M  L  N TWDLV LP+GK  +GC+WVY V
Sbjct  744  MVDEMAILHSNGTWDLVVLPSGKSTVGCRWVYAV  777


 Score = 38.5 bits (88),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  781  PDGQVDRLKARLVAKGYTQVYGSD  804



>emb|CAN60930.1| hypothetical protein VITISV_012765 [Vitis vinifera]
Length=1201

 Score = 48.5 bits (114),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  705  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  738


 Score = 40.8 bits (94),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  741  KADGXIERFKARLVAKGYTQTYGID  765



>emb|CAN74104.1| hypothetical protein VITISV_008952 [Vitis vinifera]
Length=1211

 Score = 53.1 bits (126),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  800  MVDEMTALHSNGTWDLVVLPSGKSTVGCRWVYTV  833


 Score = 36.2 bits (82),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKA LVAKGY Q YG D
Sbjct  837  PDGQVDRLKAHLVAKGYTQVYGSD  860



>ref|XP_010042013.1| PREDICTED: uncharacterized protein LOC104431013, partial [Eucalyptus 
grandis]
Length=175

 Score = 53.5 bits (127),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + ALE NQTWDLV LP GK AIGC+WVY V
Sbjct  120  MEEELQALEINQTWDLVPLPLGKTAIGCRWVYAV  153


 Score = 35.8 bits (81),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQ  16
            + PD  +ARLKARLVAKGYAQ
Sbjct  155  VNPDGSLARLKARLVAKGYAQ  175



>emb|CAN67120.1| hypothetical protein VITISV_017484 [Vitis vinifera]
Length=1179

 Score = 53.9 bits (128),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  718  MVDEMAALHSNGTWDLVSLPLGKFTVGCRWVYTV  751


 Score = 35.0 bits (79),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAK Y Q YG D
Sbjct  755  PDGQVDRLKARLVAKVYTQIYGCD  778



>gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1353

 Score = 51.6 bits (122),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M++ M ALE N TW+LV LP GK  +GC+WVY V
Sbjct  863  MIDEMQALENNGTWELVPLPPGKKTVGCRWVYAV  896


 Score = 37.7 bits (86),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  + RLKARLVAKGY Q YG+D
Sbjct  900  PNGEIDRLKARLVAKGYTQIYGLD  923



>emb|CAN77046.1| hypothetical protein VITISV_035257 [Vitis vinifera]
Length=1478

 Score = 52.8 bits (125),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  983   MVDEMAALHXNGTWDLVVLPSGKXXVGCRWVYAV  1016


 Score = 36.2 bits (82),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72    PDVFVARLKARLVAKGYAQTYGID  1
             PD  V RLK RLVAKGY Q YG +
Sbjct  1020  PDGQVBRLKXRLVAKGYTQVYGSB  1043



>emb|CAN82064.1| hypothetical protein VITISV_022772 [Vitis vinifera]
Length=1224

 Score = 50.4 bits (119),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M  L  N TWDLV LP GK  +GC+WVY V
Sbjct  771  MVDEMATLHSNGTWDLVVLPPGKSTVGCRWVYAV  804


 Score = 38.5 bits (88),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  808  PDGQVDRLKARLVAKGYTQVYGSD  831



>emb|CAN68059.1| hypothetical protein VITISV_008424 [Vitis vinifera]
Length=507

 Score = 48.5 bits (114),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  115  MNEKMKSLQKNETWELVECPPGKKPVGCRWIYTV  148


 Score = 40.4 bits (93),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  151  KADGSIERFKARLVAKGYTQTYGID  175



>emb|CAN79977.1| hypothetical protein VITISV_029183 [Vitis vinifera]
Length=1572

 Score = 48.5 bits (114),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  544  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  577


 Score = 40.4 bits (93),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  580  KADGSIERFKARLVAKGYTQTYGID  604



>emb|CAN67506.1| hypothetical protein VITISV_026948 [Vitis vinifera]
Length=1063

 Score = 48.5 bits (114),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  590  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  623


 Score = 40.4 bits (93),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  626  KADGSIERFKARLVAKGYTQTYGID  650



>emb|CAN63276.1| hypothetical protein VITISV_000400 [Vitis vinifera]
Length=1030

 Score = 48.5 bits (114),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  633  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  666


 Score = 40.4 bits (93),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  669  KADGSIERFKARLVAKGYTQTYGID  693



>emb|CAN76181.1| hypothetical protein VITISV_015418 [Vitis vinifera]
Length=323

 Score = 51.6 bits (122),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  1    MVDEMAALHSNDTWDLVVLPFGKSTVGCRWVYAV  34


 Score = 37.4 bits (85),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72  PDVFVARLKARLVAKGYAQTYGID  1
           PD  V RLKARLVAKGY Q YG D
Sbjct  38  PDGQVDRLKARLVAKGYTQVYGSD  61



>ref|XP_008460624.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103499401 
[Cucumis melo]
Length=789

 Score = 45.4 bits (106),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   + PD  VARLKARLVAK YAQTYGID
Sbjct  467  FSLKVNPDGTVARLKARLVAKDYAQTYGID  496


 Score = 43.5 bits (101),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVY  86
            M+E M A ++N T DLV  PAGK AIGCK V+
Sbjct  436  MIEEMTAFDDNGTGDLVSXPAGKKAIGCKLVF  467



>ref|XP_008342470.1| PREDICTED: uncharacterized protein LOC103405274 [Malus domestica]
Length=239

 Score = 50.4 bits (119),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + +L++N TW++ DLPAGK  +GCKWVY V
Sbjct  154  MNEELKSLKKNATWEITDLPAGKKPVGCKWVYTV  187


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKGY Q YGID
Sbjct  190  KADGTVDRFKARLVAKGYTQKYGID  214



>emb|CAN77834.1| hypothetical protein VITISV_024733 [Vitis vinifera]
Length=1300

 Score = 53.1 bits (126),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY +
Sbjct  848  MVDEMAALHSNDTWDLVVLPSGKSTVGCRWVYTI  881


 Score = 35.8 bits (81),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V RLKARLVAKGY Q YG D
Sbjct  889  VDRLKARLVAKGYTQVYGSD  908



>emb|CAN79672.1| hypothetical protein VITISV_012210 [Vitis vinifera]
Length=1211

 Score = 52.8 bits (125),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  734  MVDEMDALHSNGTWDLVVLPSGKFTVGCRWVYAV  767


 Score = 36.2 bits (82),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKA LVAKGY Q YG D
Sbjct  771  PDGQVDRLKAHLVAKGYTQVYGSD  794



>emb|CAN78708.1| hypothetical protein VITISV_019236 [Vitis vinifera]
Length=542

 Score = 49.7 bits (117),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP  K  +GC WVY V
Sbjct  196  MVDEMTALHSNGTWDLVSLPPSKSTVGCHWVYTV  229


 Score = 38.9 bits (89),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            + PD  V RLKARLVAKGY Q YG D
Sbjct  231  VSPDGQVDRLKARLVAKGYTQIYGCD  256



>emb|CAN64822.1| hypothetical protein VITISV_025364 [Vitis vinifera]
Length=756

 Score = 48.5 bits (114),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  328  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  361


 Score = 40.0 bits (92),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  364  KXDGSIERFKARLVAKGYTQTYGID  388



>emb|CAN62423.1| hypothetical protein VITISV_020608 [Vitis vinifera]
Length=1177

 Score = 52.4 bits (124),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDL+ LP+GK  +GC+WVY V
Sbjct  789  MVDEMAALHSNGTWDLIVLPSGKSTVGCRWVYAV  822


 Score = 36.2 bits (82),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V  LKARLVAKGY Q YG D
Sbjct  826  PDGQVDHLKARLVAKGYTQVYGSD  849



>gb|ABA93730.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=656

 Score = 48.5 bits (114),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M E + AL +N+TW+LV LP  K A+GCKWV+ V +T
Sbjct  163  MKEELNALVKNKTWELVKLPPEKRAVGCKWVFTVKQT  199


 Score = 40.0 bits (92),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V R KARLVAKGY+QTYGID
Sbjct  200  PEGKVDRYKARLVAKGYSQTYGID  223



>emb|CAN83335.1| hypothetical protein VITISV_043861 [Vitis vinifera]
Length=603

 Score = 53.5 bits (127),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVN  77
            MV+ M  L  N TWDLV LP+GK  +GC+WVY VN
Sbjct  207  MVDEMATLHSNGTWDLVVLPSGKSTVGCRWVYTVN  241


 Score = 35.0 bits (79),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V  LKARLVAKGY Q YG D
Sbjct  244  PDGQVDCLKARLVAKGYTQVYGSD  267



>emb|CAN66265.1| hypothetical protein VITISV_042702 [Vitis vinifera]
Length=588

 Score = 52.0 bits (123),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC WVY+V
Sbjct  232  MVDEMAALHSNDTWDLVVLPFGKSTVGCHWVYIV  265


 Score = 36.6 bits (83),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V RLKARLVAKGY Q YG D
Sbjct  269  PNGQVDRLKARLVAKGYTQVYGSD  292



>emb|CAN74388.1| hypothetical protein VITISV_041876 [Vitis vinifera]
Length=874

 Score = 53.5 bits (127),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  600  MVDEMAALHSNDTWDLVVLPSGKSTVGCRWVYTV  633


 Score = 35.0 bits (79),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V  LKARLVAKGY Q YG D
Sbjct  637  PDGQVDCLKARLVAKGYTQVYGSD  660



>ref|XP_010059409.1| PREDICTED: uncharacterized protein LOC104447361 [Eucalyptus grandis]
Length=673

 Score = 50.1 bits (118),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M ALE+N+TW++VD P GK  +GCKWV+ V
Sbjct  566  MKEEMEALEKNKTWEIVDRPRGKNLVGCKWVFTV  599


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYG+D
Sbjct  602  KADGSLERYKARLVAKGYTQTYGVD  626



>emb|CAN65502.1| hypothetical protein VITISV_014793 [Vitis vinifera]
Length=962

 Score = 48.5 bits (114),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  565  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  598


 Score = 39.7 bits (91),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  601  KVDGSIERFKARLVAKGYTQTYGID  625



>emb|CAN65249.1| hypothetical protein VITISV_024219 [Vitis vinifera]
Length=578

 Score = 53.5 bits (127),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  126  MVDEMAALHSNGTWDLVSLPSGKSIVGCRWVYTV  159


 Score = 34.7 bits (78),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  69   DVFVARLKARLVAKGYAQTYGID  1
            D  V RLKARLVAKGY Q YG +
Sbjct  164  DSQVDRLKARLVAKGYTQIYGCE  186



>emb|CAN60445.1| hypothetical protein VITISV_032468 [Vitis vinifera]
Length=1121

 Score = 48.5 bits (114),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  677  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  710


 Score = 39.7 bits (91),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KAR+VAKGY QTYGID
Sbjct  713  KADGSIERFKARMVAKGYTQTYGID  737



>ref|XP_003597218.1| Beta-galactosidase [Medicago truncatula]
Length=2260

 Score = 49.3 bits (116),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             M   M ALE+N TW+LV LP GK  +GC+WV+ +
Sbjct  1447  MTAEMEALEKNATWELVSLPVGKSTVGCRWVFTI  1480


 Score = 38.9 bits (89),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             K D  V R KARLVAKGY Q+YG+D
Sbjct  1483  KADGSVERFKARLVAKGYTQSYGVD  1507



>emb|CAN73860.1| hypothetical protein VITISV_007289 [Vitis vinifera]
Length=564

 Score = 54.7 bits (130),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  154  MVDEMTALHSNDTWDLVVLPSGKFTVGCRWVYTV  187


 Score = 33.5 bits (75),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  69   DVFVARLKARLVAKGYAQTYGID  1
            +  V RLKA LVAKGY Q YG D
Sbjct  192  BXQVDRLKAXLVAKGYTQVYGXD  214



>emb|CAH67874.1| OSIGBa0153E02-OSIGBa0093I20.3 [Oryza sativa Indica Group]
Length=806

 Score = 48.5 bits (114),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M+E M ALE+N+TW+LV  P GK  + CKWV  V +
Sbjct  313  MMEEMSALEKNKTWELVPFPTGKKVVSCKWVNAVKQ  348


 Score = 39.7 bits (91),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 2/28 (7%)
 Frame = -1

Query  78   MKPDVF--VARLKARLVAKGYAQTYGID  1
            +K D F  V R KARLVAKGY+QTYGID
Sbjct  346  VKQDPFGKVERYKARLVAKGYSQTYGID  373



>emb|CAN76367.1| hypothetical protein VITISV_024583 [Vitis vinifera]
Length=1121

 Score = 49.3 bits (116),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y+V
Sbjct  638  MNEEMKSLQKNETWELVECPPGKKLVGCRWIYIV  671


 Score = 38.9 bits (89),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            + R KARLVAKGY QTYGID
Sbjct  679  IERFKARLVAKGYTQTYGID  698



>ref|XP_010265857.1| PREDICTED: uncharacterized protein LOC104603503 [Nelumbo nucifera]
Length=518

 Score = 48.9 bits (115),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVY  86
            M + + ALE NQTWDL+ LPAGK  IG KWVY
Sbjct  271  MNKELEALESNQTWDLMPLPAGKKPIGSKWVY  302


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            +KPD  V R KARLVAKGY Q  GID
Sbjct  306  LKPDGIVDRCKARLVAKGYNQVVGID  331



>ref|XP_003621710.1| Receptor-like protein kinase [Medicago truncatula]
Length=1085

 Score = 49.3 bits (116),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M++ MVALE N TW+LV  P GK  +GC+WV+ V
Sbjct  475  MIDEMVALESNHTWELVPPPPGKSIVGCRWVFNV  508


 Score = 38.9 bits (89),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  512  PDEQVDRLKARLVAKGYTQVYGQD  535



>ref|XP_007028466.1| Uncharacterized protein TCM_024268 [Theobroma cacao]
 gb|EOY08968.1| Uncharacterized protein TCM_024268 [Theobroma cacao]
Length=786

 Score = 57.8 bits (138),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MVE MVAL+ N TWD VDLPAGK AIGCKWV  V
Sbjct  368  MVEEMVALDGNCTWDSVDLPAGKKAIGCKWVLAV  401


 Score = 30.4 bits (67),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 13/15 (87%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -1

Query  45   ARLVAKGYAQTYGID  1
            A LVAKGYAQTY ID
Sbjct  410  ASLVAKGYAQTYSID  424



>emb|CAN62329.1| hypothetical protein VITISV_029808 [Vitis vinifera]
Length=374

 Score = 52.4 bits (124),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  1    MVDEMTALHSNGTWDLVVLPSGKSTVGCRWVYTV  34


 Score = 35.4 bits (80),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72  PDVFVARLKARLVAKGYAQTYGID  1
           PD  V RLKARLVAKGY   YG D
Sbjct  38  PDGQVDRLKARLVAKGYTXVYGSD  61



>emb|CAE05707.2| OSJNBb0065J09.3 [Oryza sativa Japonica Group]
Length=1015

 Score = 48.1 bits (113),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M+E M ALE+N+TW+LV  P GK  + CKWV  V +
Sbjct  504  MMEEMSALEKNKTWELVPFPTGKKVVSCKWVNAVKQ  539


 Score = 39.7 bits (91),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 2/28 (7%)
 Frame = -1

Query  78   MKPDVF--VARLKARLVAKGYAQTYGID  1
            +K D F  V R KARLVAKGY+QTYGID
Sbjct  537  VKQDPFGKVERYKARLVAKGYSQTYGID  564



>gb|AAP21414.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF99446.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1393

 Score = 48.1 bits (113),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M E + AL +N+TW+LV LP  K A+GCKWV+ V +T
Sbjct  900  MKEELNALVKNKTWELVKLPPEKRAVGCKWVFTVKQT  936


 Score = 40.0 bits (92),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V R KARLVAKGY+QTYGID
Sbjct  937  PEGKVDRYKARLVAKGYSQTYGID  960



>emb|CAN78392.1| hypothetical protein VITISV_034679 [Vitis vinifera]
Length=534

 Score = 51.2 bits (121),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  201  MVDEMAALHFNGTWDLVVLPSGKSIVGCRWVYTV  234


 Score = 36.6 bits (83),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V RLKARLVAKGY Q YG D
Sbjct  242  VDRLKARLVAKGYTQVYGFD  261



>ref|XP_010268750.1| PREDICTED: formin-like protein 13 [Nelumbo nucifera]
Length=304

 Score = 44.3 bits (103),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY+QTYGID
Sbjct  252  PDGRVERLKARLVAKGYSQTYGID  275


 Score = 43.5 bits (101),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL  N TWDL  LP GK  +GCK VY V
Sbjct  215  MEEELSALHHNHTWDLTALPPGKQVVGCKRVYSV  248



>emb|CAN69307.1| hypothetical protein VITISV_001120 [Vitis vinifera]
Length=1215

 Score = 48.1 bits (113),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+ K  +GC WVY V
Sbjct  769  MVDEMDALHSNGTWDLVVLPSSKSTVGCHWVYTV  802


 Score = 39.7 bits (91),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  806  PDGQVDRLKARLVAKGYTQVYGFD  829



>emb|CAN62086.1| hypothetical protein VITISV_035123 [Vitis vinifera]
Length=1151

 Score = 48.5 bits (114),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  655  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  688


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  + R KARLVAKGY QTYGID
Sbjct  691  QADGSIERFKARLVAKGYTQTYGID  715



>emb|CAN76400.1| hypothetical protein VITISV_001550 [Vitis vinifera]
Length=626

 Score = 48.9 bits (115),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  169  MVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M ALE+N+ W+LV LP GK  +GCKWVY V
Sbjct  169  MEALEKNKIWELVKLPTGKKPVGCKWVYTV  198


 Score = 38.9 bits (89),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  + R KARLVAKGY QTYGID
Sbjct  201  RADGSIERYKARLVAKGYTQTYGID  225



>emb|CAN78434.1| hypothetical protein VITISV_003804 [Vitis vinifera]
Length=973

 Score = 47.0 bits (110),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y +
Sbjct  522  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTM  555


 Score = 40.4 bits (93),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  558  KADGSIERFKARLVAKGYTQTYGID  582



>emb|CAN80367.1| hypothetical protein VITISV_014719 [Vitis vinifera]
Length=1573

 Score = 50.8 bits (120),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            + M AL  N TWDLV LP+GK  +GC+WVY+V
Sbjct  902  DEMAALHSNDTWDLVVLPSGKSTVGCRWVYIV  933


 Score = 36.6 bits (83),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            ++PD  V  LKARLVAKGY Q YG D
Sbjct  935  VRPDGQVDPLKARLVAKGYTQVYGSD  960



>emb|CAN74129.1| hypothetical protein VITISV_041770 [Vitis vinifera]
Length=537

 Score = 49.7 bits (117),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  + C+WVY V
Sbjct  151  MVDEMAALHYNGTWDLVVLPSGKSTVSCRWVYAV  184


 Score = 37.7 bits (86),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARL+AKGY Q YG D
Sbjct  188  PDGQVDRLKARLIAKGYTQVYGSD  211



>emb|CAN75730.1| hypothetical protein VITISV_031410 [Vitis vinifera]
Length=1043

 Score = 47.0 bits (110),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M + ++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  614  MNEEMKSFQKNETWELVECPPGKKLVGCRWIYTV  647


 Score = 40.4 bits (93),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  650  KADGSIKRFKARLVAKGYTQTYGID  674



>emb|CAN61219.1| hypothetical protein VITISV_021296 [Vitis vinifera]
Length=729

 Score = 52.8 bits (125),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M+AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  469  MVDEMIALHFNVTWDLVVLPSGKSTVGCRWVYTV  502


 Score = 34.7 bits (78),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLK  LVAKGY Q YG D
Sbjct  506  PDGQVDRLKGHLVAKGYTQVYGSD  529



>emb|CAN69707.1| hypothetical protein VITISV_017209 [Vitis vinifera]
Length=185

 Score = 51.6 bits (122),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  1    MVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  34


 Score = 35.8 bits (81),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72  PDVFVARLKARLVAKGYAQTYGID  1
           PD  V RLKAR+VAKGY Q YG D
Sbjct  38  PDGQVDRLKARVVAKGYTQIYGSD  61



>ref|XP_010923376.1| PREDICTED: uncharacterized protein LOC105046487 [Elaeis guineensis]
Length=436

 Score = 48.1 bits (113),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M+E M AL +NQ WDLV LP GK  +  KWVY V +T
Sbjct  297  MLEEMTALFKNQMWDLVTLPVGKHPVRYKWVYTVKQT  333


 Score = 39.3 bits (90),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V R KARLVAKGY QTYG+D
Sbjct  334  PEGKVERYKARLVAKGYTQTYGVD  357



>emb|CAN70024.1| hypothetical protein VITISV_030172 [Vitis vinifera]
Length=1091

 Score = 51.2 bits (121),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC WVY V
Sbjct  690  MVDEMAALHSNGTWDLVSLPPGKSTVGCCWVYTV  723


 Score = 35.8 bits (81),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V RLKARLVAKGY Q YG D
Sbjct  731  VDRLKARLVAKGYTQIYGCD  750



>ref|XP_010908910.1| PREDICTED: uncharacterized protein LOC105035160 [Elaeis guineensis]
Length=3799

 Score = 49.7 bits (117),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            ++E M AL++N+TW++VDLP GK  +GCKW++ V
Sbjct  806  VLEEMRALKKNRTWEVVDLPRGKETVGCKWMFTV  839


 Score = 37.7 bits (86),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKG+ QTYGID
Sbjct  842  KSDGSLERYKARLVAKGFTQTYGID  866



>emb|CAN82468.1| hypothetical protein VITISV_039784 [Vitis vinifera]
Length=906

 Score = 47.4 bits (111),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK   GC+W+Y V
Sbjct  451  MNEEMKSLQKNETWELVECPPGKKPFGCRWIYTV  484


 Score = 39.7 bits (91),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  487  KADGSLERFKARLVAKGYTQTYGID  511



>emb|CAN63295.1| hypothetical protein VITISV_032981 [Vitis vinifera]
Length=540

 Score = 48.1 bits (113),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK ++GC W+Y V
Sbjct  60   MNEEMKSLQKNETWELVECPPGKRSVGCHWIYTV  93


 Score = 39.3 bits (90),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  96   KADDSIERYKARLVAKGYTQTYGID  120



>ref|XP_009626483.1| PREDICTED: uncharacterized protein LOC104117178, partial [Nicotiana 
tomentosiformis]
Length=357

 Score = 57.4 bits (137),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M + + ALEEN TWD+VDLPAGK+ IGCKWVY V
Sbjct  153  MQQEVTALEENNTWDVVDLPAGKVPIGCKWVYKV  186


 Score = 29.3 bits (64),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V R K RLVAKG++Q  G+D
Sbjct  194  VERYKGRLVAKGFSQNEGLD  213



>gb|ABA94321.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1133

 Score = 47.0 bits (110),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M E + AL +N+TW+LV LP  K  +GCKWV+ V +T
Sbjct  759  MKEELNALVKNKTWELVKLPPEKRTVGCKWVFTVKQT  795


 Score = 40.0 bits (92),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V R KARLVAKGY+QTYGID
Sbjct  796  PEGKVDRYKARLVAKGYSQTYGID  819



>emb|CAN73765.1| hypothetical protein VITISV_035279 [Vitis vinifera]
Length=2260

 Score = 50.1 bits (118),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  175   ETMVALEENQTWDLVDLPAGKIAIGCKWVYVVN  77
             E + ALE N TW++ DLP GK  +GCKW+++VN
Sbjct  1767  EEVRALENNGTWEITDLPRGKKPVGCKWIFIVN  1799


 Score = 37.0 bits (84),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             K D  V R KARLVAKG+ Q+YGID
Sbjct  1801  KADGNVDRYKARLVAKGFTQSYGID  1825


 Score = 45.4 bits (106),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M AL +N+TW LV+LP G+  +GCKWV+ +
Sbjct  790  MKEEMEALLKNKTWILVNLPKGQKTVGCKWVFSI  823


 Score = 37.4 bits (85),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKG+ QTYG+D
Sbjct  826  KVDGTIERYKARLVAKGFTQTYGVD  850



>emb|CAN80368.1| hypothetical protein VITISV_014720 [Vitis vinifera]
Length=869

 Score = 45.8 bits (107),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E M AL++N TW++VDLP  K  +GCKWV+++
Sbjct  416  EEMNALKKNGTWEVVDLPKEKKVVGCKWVFMI  447


 Score = 40.8 bits (94),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            FM   K D  V R KARLVAKG+ QTYGID
Sbjct  445  FMIKSKADGSVERYKARLVAKGFTQTYGID  474



>ref|XP_010103877.1| C2 domain-containing protein [Morus notabilis]
 gb|EXB97318.1| C2 domain-containing protein [Morus notabilis]
Length=550

 Score = 49.7 bits (117),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  169  MVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M ALE+N+TWDLV++P GK  +GCKWV+ V
Sbjct  5    MDALEKNKTWDLVEMPQGKKLVGCKWVFPV  34


 Score = 37.4 bits (85),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  75  KPDVFVARLKARLVAKGYAQTYGI  4
           K D  + R KARLVAKGYAQTYGI
Sbjct  37  KADGSLERDKARLVAKGYAQTYGI  60



>emb|CAN69913.1| hypothetical protein VITISV_042568 [Vitis vinifera]
Length=863

 Score = 53.1 bits (126),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -3

Query  169  MVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M +LE+N+TW+L+DLPAGK  IGCKWVY V  T
Sbjct  1    MESLEKNKTWELIDLPAGKKPIGCKWVYTVKYT  33


 Score = 33.5 bits (75),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  54  RLKARLVAKGYAQTYGID  1
           R KARLV KGY QTYG+D
Sbjct  40  RYKARLVGKGYTQTYGVD  57



>emb|CAN82537.1| hypothetical protein VITISV_013040 [Vitis vinifera]
Length=680

 Score = 48.1 bits (113),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  259  MNEEMKSLQKNETWELVECPPGKNLVGCRWIYTV  292


 Score = 38.9 bits (89),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLV KGY QTYGID
Sbjct  295  KADGSIERFKARLVVKGYTQTYGID  319



>gb|ABG22578.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=836

 Score = 50.8 bits (120),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M E + AL +N TW+LV LP GK A+GCKWV+ V +T
Sbjct  354  MKEELNALMKNNTWELVKLPPGKRAVGCKWVFTVKQT  390


 Score = 35.8 bits (81),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V R KARL AKGY+QTYGID
Sbjct  395  VDRYKARLHAKGYSQTYGID  414



>emb|CAN79305.1| hypothetical protein VITISV_036286 [Vitis vinifera]
Length=546

 Score = 53.1 bits (126),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  196  MVDEMTALHSNGTWDLVVLPSGKSTVGCRWVYTV  229


 Score = 33.9 bits (76),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKA LVAK Y Q YG D
Sbjct  233  PDGQVDRLKAHLVAKCYTQVYGFD  256



>emb|CAN76680.1| hypothetical protein VITISV_034326 [Vitis vinifera]
Length=716

 Score = 46.6 bits (109),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+ VY V
Sbjct  258  MVDEMAALHSNGTWDLVVLPFGKSTVGCRLVYAV  291


 Score = 40.4 bits (93),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGYAQ YG D
Sbjct  295  PDGQVDRLKARLVAKGYAQVYGSD  318



>emb|CAN79013.1| hypothetical protein VITISV_031464 [Vitis vinifera]
Length=987

 Score = 51.6 bits (122),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M  L  N TWDLV LP GK  +GC+WVY V
Sbjct  617  MVDEMTTLHSNGTWDLVSLPPGKSTVGCRWVYTV  650


 Score = 35.0 bits (79),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V  LKARLVAKGYAQ YG D
Sbjct  658  VDXLKARLVAKGYAQIYGCD  677



>gb|ABA94354.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=882

 Score = 44.7 bits (104),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNE  74
            M++ + ALE+N+TWDLV  P GK  +  KWVY V +
Sbjct  558  MLDELEALEKNKTWDLVPFPKGKKIVNYKWVYTVKQ  593


 Score = 42.0 bits (97),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V R KARLVAKGY+QTYGID
Sbjct  595  PDGKVERYKARLVAKGYSQTYGID  618



>emb|CAN74610.1| hypothetical protein VITISV_029330 [Vitis vinifera]
Length=364

 Score = 48.5 bits (114),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC WVY V
Sbjct  1    MVDEMDALHFNGTWDLVVLPSGKSTVGCHWVYAV  34


 Score = 37.7 bits (86),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72  PDVFVARLKARLVAKGYAQTYGID  1
           PD  V RLKARLVAKGY Q YG D
Sbjct  38  PDGQVDRLKARLVAKGYTQVYGSD  61



>emb|CAN59884.1| hypothetical protein VITISV_026166 [Vitis vinifera]
Length=6311

 Score = 55.1 bits (131),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ M AL  N TWDLV LP+GK  +GC+WVYVV
Sbjct  1518  MVDEMAALHSNDTWDLVVLPSGKSTVGCRWVYVV  1551


 Score = 31.6 bits (70),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  63    FVARLKARLVAKGYAQTYGID  1
             +V  +KARLVAKGY Q YG D
Sbjct  1547  WVYVVKARLVAKGYTQVYGSD  1567



>emb|CAN67511.1| hypothetical protein VITISV_026953 [Vitis vinifera]
Length=335

 Score = 49.7 bits (117),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            +++ M ALE+N TW LV+LP GK  IGCKWV+ +
Sbjct  144  VLKEMQALEKNDTWSLVELPQGKSVIGCKWVFTI  177


 Score = 36.6 bits (83),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   ++PD  + R KA+LVAKG+ QTYGI+
Sbjct  175  FTIKVRPDGSIERHKAQLVAKGFTQTYGIN  204



>emb|CAN80976.1| hypothetical protein VITISV_039740 [Vitis vinifera]
Length=563

 Score = 45.1 bits (105),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  178  VETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            +E M AL++N TW LV LP GK  I CKW++ V
Sbjct  192  LEEMRALKKNDTWSLVKLPQGKSVIRCKWIFTV  224


 Score = 41.2 bits (95),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   +KPD  + R KARL AKG+ QTYG+D
Sbjct  222  FTVKLKPDGLIERYKARLFAKGFTQTYGVD  251



>emb|CAN74290.1| hypothetical protein VITISV_036414 [Vitis vinifera]
Length=584

 Score = 46.6 bits (109),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+L++ P GK   GC+W+Y V
Sbjct  109  MNEEMKSLQKNETWELIECPPGKKPAGCRWIYTV  142


 Score = 40.0 bits (92),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  145  KADGSIERFKARLVAKGYTQTYGID  169



>emb|CAN73102.1| hypothetical protein VITISV_042891 [Vitis vinifera]
Length=1493

 Score = 47.4 bits (111),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             ++E + ALE+N+TW++++LP GK  +GCKW++ V
Sbjct  1000  VMEEIRALEKNETWEVMNLPRGKKPVGCKWIFTV  1033


 Score = 38.9 bits (89),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             K D  V R KARLVAKG+ QTYGID
Sbjct  1036  KADGTVERYKARLVAKGFTQTYGID  1060



>emb|CAN73234.1| hypothetical protein VITISV_033857 [Vitis vinifera]
Length=1402

 Score = 47.8 bits (112),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+ VY V
Sbjct  907  MVDEMAALHSNGTWDLVVLPSGKSTVGCRXVYAV  940


 Score = 38.5 bits (88),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKARLVAKGY Q YG D
Sbjct  944  PDGQVDRLKARLVAKGYTQVYGSD  967



>emb|CAN64580.1| hypothetical protein VITISV_002159 [Vitis vinifera]
Length=1453

 Score = 47.8 bits (112),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  169   MVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             M ALE+N+TW+LV LP  K  +GCKWVY V
Sbjct  1045  MEALEKNKTWELVKLPTRKKPVGCKWVYTV  1074


 Score = 38.5 bits (88),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             + D  + R KARLVAKGY QTYGID
Sbjct  1077  RXDGSIERYKARLVAKGYTQTYGID  1101



>emb|CAN76176.1| hypothetical protein VITISV_022748 [Vitis vinifera]
Length=1025

 Score = 51.2 bits (121),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+ K  +GC+WVY V
Sbjct  582  MVDEMTALHSNDTWDLVVLPSSKSTVGCRWVYTV  615


 Score = 35.0 bits (79),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKA LVAKGY Q YG D
Sbjct  619  PDGQVDRLKACLVAKGYTQVYGSD  642



>emb|CAE03644.2| OSJNBa0060N03.9 [Oryza sativa Japonica Group]
Length=1045

 Score = 46.2 bits (108),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M E +  L +N+TW+LV LP  K A+GCKWV+ V +T
Sbjct  928  MKEELNDLVKNKTWELVKLPPEKRAVGCKWVFTVKQT  964


 Score = 40.0 bits (92),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V R KARLVAKGY+QTYGID
Sbjct  965  PEGKVDRYKARLVAKGYSQTYGID  988



>gb|ACB45081.1| putative polyprotein [Solanum habrochaites]
Length=559

 Score = 53.1 bits (126),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + ALEEN+TW++V LP GK AIGCKWVY +
Sbjct  349  MKEEIQALEENKTWEVVTLPIGKKAIGCKWVYKI  382


 Score = 32.7 bits (73),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V R KARLVAKGY+Q  G+D
Sbjct  390  VERFKARLVAKGYSQQEGLD  409



>emb|CAN80802.1| hypothetical protein VITISV_018152 [Vitis vinifera]
Length=588

 Score = 46.6 bits (109),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            ++E M  L++N TW LV LP GK  +GCKW++ V
Sbjct  224  VLEEMRTLKKNDTWSLVKLPQGKSVVGCKWIFTV  257


 Score = 39.3 bits (90),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F    KP   + R KARLVAKG+ QTYG+D
Sbjct  255  FTVKFKPGGLIERYKARLVAKGFTQTYGVD  284



>emb|CAN83721.1| hypothetical protein VITISV_003961 [Vitis vinifera]
Length=1101

 Score = 49.7 bits (117),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y+V
Sbjct  605  MDEEMKSLQKNETWELVECPPGKKPVGCRWIYIV  638


 Score = 36.2 bits (82),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGI  4
            K D  + R KARLV KGY QTYGI
Sbjct  641  KADGSIERFKARLVVKGYTQTYGI  664



>emb|CAN61882.1| hypothetical protein VITISV_001207 [Vitis vinifera]
Length=375

 Score = 48.5 bits (114),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  178  VETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            +E M +L++N TW +VDLP GK  +GCKWV+ V
Sbjct  19   MEEMKSLQKNNTWKIVDLPGGKHPVGCKWVFTV  51


 Score = 37.4 bits (85),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72  PDVFVARLKARLVAKGYAQTYGID  1
           PD  V R KARLVAKG+ QT+GID
Sbjct  55  PDGKVERYKARLVAKGFTQTFGID  78



>emb|CAN67418.1| hypothetical protein VITISV_005919 [Vitis vinifera]
Length=960

 Score = 45.4 bits (106),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P  K  +GC+W+Y V
Sbjct  551  MNEEMKSLQKNETWELVECPPRKKPVGCRWIYTV  584


 Score = 40.4 bits (93),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  587  KADGSIERFKARLVAKGYTQTYGID  611



>emb|CAN71185.1| hypothetical protein VITISV_014270 [Vitis vinifera]
Length=1024

 Score = 49.7 bits (117),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M++ M AL    TWDLV LP+GK  +GC+WVY V
Sbjct  571  MMDEMAALHSTXTWDLVVLPSGKSTVGCRWVYAV  604


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V RLKARLVAKGY Q YG D
Sbjct  612  VDRLKARLVAKGYTQVYGSD  631



>emb|CAN78751.1| hypothetical protein VITISV_028425 [Vitis vinifera]
Length=926

 Score = 49.7 bits (117),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M++ M AL    TWDLV LP+GK  +GC+WVY V
Sbjct  431  MMDEMAALHSTXTWDLVVLPSGKSTVGCRWVYAV  464


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V RLKARLVAKGY Q YG D
Sbjct  472  VDRLKARLVAKGYTQVYGSD  491



>emb|CAN73392.1| hypothetical protein VITISV_022526 [Vitis vinifera]
Length=1020

 Score = 45.1 bits (105),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E   +L++N+TW+L++ P GK  +GC+W+Y V
Sbjct  536  MNEEKKSLQKNETWELIECPPGKNPVGCRWIYTV  569


 Score = 40.4 bits (93),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  572  KADGSIERFKARLVAKGYTQTYGID  596



>emb|CBL94154.1| putative polyprotein (retrotrasposon protein) [Malus domestica]
Length=1390

 Score = 47.8 bits (112),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M+AL++N TW++  LP GK  +GC+WV+ V
Sbjct  897  MDEEMLALQKNNTWEVTSLPEGKKTVGCRWVFTV  930


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  + R KARLVAKGY QTYG+D
Sbjct  933  QADGSIDRYKARLVAKGYTQTYGVD  957



>ref|XP_008375640.1| PREDICTED: pre-mRNA polyadenylation factor fip-1-like [Malus 
domestica]
Length=491

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + +L++N TW++ DLPA K  +GCKWVY V
Sbjct  1    MNEELRSLKKNATWEITDLPARKKPVGCKWVYTV  34


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75  KPDVFVARLKARLVAKGYAQTYGID  1
           K D  V R KARLVAKGY Q YGID
Sbjct  37  KADGTVDRFKARLVAKGYTQKYGID  61



>ref|XP_008385943.1| PREDICTED: uncharacterized protein LOC103448457 [Malus domestica]
Length=623

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M+AL++N TW+++ LPAGK  +GC+WV+ V
Sbjct  210  MDEEMLALQKNNTWEVMMLPAGKKTVGCRWVFTV  243


 Score = 36.2 bits (82),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KA LVAKGY QTYG+D
Sbjct  246  KVDGTVNRYKAXLVAKGYTQTYGVD  270



>emb|CAN64541.1| hypothetical protein VITISV_006447 [Vitis vinifera]
Length=551

 Score = 48.5 bits (114),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  71   MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  104


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R K RLV KGY QTYGID
Sbjct  107  KADGSIERFKVRLVGKGYTQTYGID  131



>gb|ABN08283.1| hypothetical protein MtrDRAFT_AC155889g9v2 [Medicago truncatula]
Length=531

 Score = 53.9 bits (128),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP GK  +GC+WVY V
Sbjct  96   MVDEMAALHSNDTWDLVPLPDGKTTVGCRWVYTV  129


 Score = 31.6 bits (70),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            + RLKARLVAKGY Q + +D
Sbjct  137  IDRLKARLVAKGYTQIFVLD  156



>ref|XP_009335215.1| PREDICTED: uncharacterized protein LOC103927954 [Pyrus x bretschneideri]
Length=1700

 Score = 47.8 bits (112),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M+AL++N TW++  LP GK  +GC+WV+ V
Sbjct  795  MDEEMLALQKNNTWEVTSLPEGKKTVGCRWVFTV  828


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/20 (75%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            + R KARLVAKGY QTYG+D
Sbjct  836  IDRYKARLVAKGYTQTYGVD  855



>emb|CAN82626.1| hypothetical protein VITISV_044103 [Vitis vinifera]
Length=2075

 Score = 45.1 bits (105),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+   GK  +GC+W+Y V
Sbjct  104  MNEEMKSLQKNETWELVEYAPGKKPVGCRWIYTV  137


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  140  KVDGSIERFKARLVAKGYTQTYGID  164



>ref|XP_007019891.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY17116.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1164

 Score = 52.0 bits (123),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            ++E M AL++N+TWD+V+LP GK ++GCKWV+ +
Sbjct  696  VLEEMRALKKNETWDVVELPEGKSSVGCKWVFTI  729


 Score = 33.1 bits (74),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKG+ Q +G+D
Sbjct  732  KSDGEIERHKARLVAKGFTQVFGVD  756



>emb|CAN80212.1| hypothetical protein VITISV_005117 [Vitis vinifera]
Length=672

 Score = 44.7 bits (104),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +  +N+TW+LV+ P GK  +GC+W+Y V
Sbjct  288  MNEEMKSSXKNETWELVECPLGKKPVGCRWIYTV  321


 Score = 40.4 bits (93),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  324  KTDGSIERFKARLVAKGYTQTYGID  348



>emb|CAN79872.1| hypothetical protein VITISV_017186 [Vitis vinifera]
Length=908

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            + E M ALE+N TW+++ LP GK  +GCKWV++V
Sbjct  449  IFEEMRALEKNHTWEVMGLPKGKNTVGCKWVFIV  482


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/18 (83%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  54   RLKARLVAKGYAQTYGID  1
            R KARLVAKG+ QTYGID
Sbjct  492  RYKARLVAKGFTQTYGID  509



>emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera]
Length=1505

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             + E M ALE+N TW+++ LP GK  +GCKWV+ V
Sbjct  1011  IFEEMRALEKNHTWEVMGLPKGKTTVGCKWVFTV  1044


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/18 (83%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  54    RLKARLVAKGYAQTYGID  1
             R KARLVAKG+ QTYGID
Sbjct  1054  RYKARLVAKGFTQTYGID  1071



>emb|CAN69747.1| hypothetical protein VITISV_016320 [Vitis vinifera]
Length=634

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWD V LP+ K  +GC+WVY V
Sbjct  444  MVDEMTALHSNDTWDFVVLPSSKSXVGCRWVYXV  477


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V RLKARLVAKGY Q YG D
Sbjct  485  VDRLKARLVAKGYTQVYGSD  504



>emb|CAN62633.1| hypothetical protein VITISV_031441 [Vitis vinifera]
Length=1213

 Score = 55.1 bits (131),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ MVAL  N TWDLV LP+GK  +GC+WVY V
Sbjct  927  MVDEMVALHSNDTWDLVVLPSGKSTVGCRWVYAV  960


 Score = 29.6 bits (65),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -1

Query  63   FVARLKARLVAKGYAQTYGID  1
            +V  +KARLVAKGY   YG D
Sbjct  956  WVYAVKARLVAKGYTXVYGSD  976



>gb|AFP55546.1| gag-pol polyprotein [Rosa rugosa]
Length=1180

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M   M ALE+N TW+LV LP GK  +GC+WVY V
Sbjct  686  MTVEMDALEKNCTWELVSLPQGKKTVGCRWVYTV  719


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  69   DVFVARLKARLVAKGYAQTYGID  1
            D  V R KARLVAKGY Q YG+D
Sbjct  724  DGSVDRYKARLVAKGYTQKYGVD  746



>emb|CAN63874.1| hypothetical protein VITISV_038274 [Vitis vinifera]
Length=583

 Score = 48.1 bits (113),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +G +WVY V
Sbjct  105  MVDEMAALHSNGTWDLVVLPSGKSTVGYRWVYAV  138


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLK RLVAKGY Q YG D
Sbjct  142  PDGQVDRLKXRLVAKGYTQVYGSD  165



>emb|CAN60732.1| hypothetical protein VITISV_010209 [Vitis vinifera]
Length=1409

 Score = 45.1 bits (105),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVY  86
            E M AL++N TW LV LP GK  +GC+WV+
Sbjct  917  EEMKALQKNDTWALVPLPXGKKTVGCRWVF  946


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKGY QTYG+D
Sbjct  951  KXDGSVERYKARLVAKGYTQTYGVD  975



>ref|XP_010689911.1| PREDICTED: uncharacterized protein LOC104903561 [Beta vulgaris 
subsp. vulgaris]
Length=715

 Score = 46.2 bits (108),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M + + A   NQTW++V LP GK AIGCKWVY V
Sbjct  615  MQKELDAFIANQTWEMVFLPKGKKAIGCKWVYKV  648


 Score = 38.1 bits (87),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            +K D  + RLKARLVAKG+ Q YGID
Sbjct  650  LKADGSLERLKARLVAKGFTQKYGID  675



>ref|XP_010325686.1| PREDICTED: uncharacterized protein LOC104649000 [Solanum lycopersicum]
Length=1041

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M + + AL +N TW+L+ LPAGK  +GC+WVY +
Sbjct  956  MTQELTALHDNDTWELMSLPAGKKVVGCRWVYKI  989


 Score = 35.0 bits (79),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             K D  + R KARLV KGY Q YG+D
Sbjct  992   KADESIERYKARLVVKGYTQHYGVD  1016



>emb|CAN69715.1| hypothetical protein VITISV_011263 [Vitis vinifera]
Length=1040

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKWV+ V
Sbjct  547  EEVRALEKNGTWEITDLPRGKKPVGCKWVFTV  578


 Score = 37.0 bits (84),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  581  KADGNVDRYKARLVAKGFTQSYGID  605



>emb|CAN71273.1| hypothetical protein VITISV_019661 [Vitis vinifera]
Length=1276

 Score = 50.1 bits (118),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV  M AL  N TWDLV LP+GK  +G +WVY+V
Sbjct  345  MVAKMAALHSNDTWDLVVLPSGKFTVGYRWVYIV  378


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V RLKA LV KGY Q YG D
Sbjct  382  PDGQVDRLKAHLVVKGYTQVYGSD  405



>emb|CAN67064.1| hypothetical protein VITISV_017541 [Vitis vinifera]
Length=1127

 Score = 45.4 bits (106),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E M AL++N TW++VDLP  K  +GCKWV+ +
Sbjct  566  EEMNALKKNGTWEVVDLPREKKVVGCKWVFTI  597


 Score = 38.9 bits (89),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ QTYGID
Sbjct  600  KADGSVERYKARLVAKGFTQTYGID  624



>emb|CAN76494.1| hypothetical protein VITISV_024984 [Vitis vinifera]
Length=988

 Score = 45.4 bits (106),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E M AL++N TW++VDLP  K  +GCKWV+ +
Sbjct  507  EEMNALKKNGTWEVVDLPREKKVVGCKWVFTI  538


 Score = 38.9 bits (89),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ QTYGID
Sbjct  541  KADGSVERYKARLVAKGFTQTYGID  565



>emb|CAN68175.1| hypothetical protein VITISV_010332 [Vitis vinifera]
Length=660

 Score = 45.4 bits (106),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  + C+W+Y V
Sbjct  213  MNEEMKSLQKNETWELVECPPGKKPVECRWIYTV  246


 Score = 38.9 bits (89),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R K RLVAKGY QTYGID
Sbjct  249  KADGSIERFKTRLVAKGYTQTYGID  273



>ref|XP_004308668.1| PREDICTED: uncharacterized protein LOC101303284 [Fragaria vesca 
subsp. vesca]
Length=1678

 Score = 46.2 bits (108),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL+ N TWD+V  PAGK  +GC+WV+ V
Sbjct  423  MNEELEALQINSTWDIVPKPAGKKTVGCRWVFTV  456


 Score = 38.1 bits (87),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   FMWLMKPDVFVARLKARLVAKGYAQTYGID  1
            F   +K D  + R KARLVAKGY Q YGID
Sbjct  454  FTVKLKADGSIDRYKARLVAKGYTQRYGID  483



>emb|CAN60502.1| hypothetical protein VITISV_031514 [Vitis vinifera]
Length=714

 Score = 48.5 bits (114),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  275  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  308


 Score = 35.4 bits (80),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  +   KARLV KGY QTYGID
Sbjct  311  KADGSIELFKARLVVKGYTQTYGID  335



>ref|XP_010314100.1| PREDICTED: uncharacterized protein LOC104644925 [Solanum lycopersicum]
Length=1024

 Score = 52.0 bits (123),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M++   AL  N TWDLV LPAGK AIGCKWVY V
Sbjct  617  MMQEFDALYANNTWDLVRLPAGKQAIGCKWVYKV  650


 Score = 32.0 bits (71),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R K+RLV KGY Q  GID
Sbjct  653  KSDGSIERFKSRLVVKGYTQQVGID  677



>emb|CAN63210.1| hypothetical protein VITISV_021170 [Vitis vinifera]
Length=512

 Score = 43.9 bits (102),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  + C+W+Y +
Sbjct  71   MNEEMKSLQKNETWELVECPPGKKPVRCRWIYTM  104


 Score = 40.0 bits (92),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 2/32 (6%)
 Frame = -1

Query  90   FMWLMKPDVF--VARLKARLVAKGYAQTYGID  1
            +++ MK  V+  + R KARLVAKGY QTYGID
Sbjct  100  WIYTMKYKVYASIERFKARLVAKGYTQTYGID  131



>emb|CAN62921.1| hypothetical protein VITISV_032126 [Vitis vinifera]
Length=1085

 Score = 48.5 bits (114),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P GK  +GC+W+Y V
Sbjct  632  MNEEMKSLQKNETWELVECPPGKKPVGCRWIYTV  665


 Score = 35.4 bits (80),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + + KARLVAKGY QT GID
Sbjct  668  KADGSIEQFKARLVAKGYTQTXGID  692



>emb|CAN77110.1| hypothetical protein VITISV_013963 [Vitis vinifera]
Length=481

 Score = 47.8 bits (112),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            + M AL  N TW+LV LP+GK  +GC+WVY V
Sbjct  186  DEMTALHSNGTWNLVALPSGKSTVGCRWVYTV  217


 Score = 35.8 bits (81),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  V  LKARLVAKGY Q YG D
Sbjct  221  PDGQVDHLKARLVAKGYTQIYGSD  244



>emb|CAN75466.1| hypothetical protein VITISV_025054 [Vitis vinifera]
Length=1576

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175   ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  1083  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  1114


 Score = 37.0 bits (84),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             K D  V R KARLVAKG+ Q+YGID
Sbjct  1117  KADGNVDRYKARLVAKGFTQSYGID  1141



>emb|CAN73624.1| hypothetical protein VITISV_042460 [Vitis vinifera]
Length=1287

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  818  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  849


 Score = 37.0 bits (84),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  852  KADGNVDRYKARLVAKGFTQSYGID  876



>emb|CAN60019.1| hypothetical protein VITISV_007668 [Vitis vinifera]
Length=917

 Score = 43.5 bits (101),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+ V+   GK ++GC+W+Y V
Sbjct  497  MNEEMKSLQKNETWEFVECLLGKKSVGCRWIYTV  530


 Score = 40.4 bits (93),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKGY QTYGID
Sbjct  533  KADGSIERFKARLVAKGYTQTYGID  557



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  687  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  718


 Score = 37.0 bits (84),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  721  KADGNVDRYKARLVAKGFTQSYGID  745



>ref|XP_010917812.1| PREDICTED: disease resistance protein RGA2-like [Elaeis guineensis]
Length=1112

 Score = 49.7 bits (117),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M+E M AL +  TW+LV LPAGK  +GCKW++ V  T
Sbjct  930  MLEEMRALTKYNTWELVSLPAGKQILGCKWIFTVKRT  966


 Score = 33.9 bits (76),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            P+  V   KARLVAK Y QTYGID
Sbjct  967  PEGIVEGYKARLVAKRYIQTYGID  990



>emb|CAN61004.1| hypothetical protein VITISV_015023 [Vitis vinifera]
Length=1010

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  517  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  548


 Score = 37.0 bits (84),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  551  KADGNVDRYKARLVAKGFTQSYGID  575



>emb|CAN73399.1| hypothetical protein VITISV_006541 [Vitis vinifera]
Length=834

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  341  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  372


 Score = 37.0 bits (84),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  375  KADGNVDRYKARLVAKGFTQSYGID  399



>emb|CAN76465.1| hypothetical protein VITISV_007267 [Vitis vinifera]
Length=701

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  252  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  283


 Score = 37.0 bits (84),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  286  KADGNVDRYKARLVAKGFTQSYGID  310



>emb|CAN65160.1| hypothetical protein VITISV_021747 [Vitis vinifera]
Length=2411

 Score = 45.1 bits (105),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             MV+ M AL  N T DLV LP+GK  + C+WVY V
Sbjct  2065  MVDEMTALHSNDTLDLVVLPSGKSIVDCRWVYTV  2098


 Score = 38.5 bits (88),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  78    MKPDVFVARLKARLVAKGYAQTYGID  1
             + P+  V RLKARLVAKGYAQ YG D
Sbjct  2100  VSPNGQVDRLKARLVAKGYAQVYGSD  2125



>ref|XP_010270824.1| PREDICTED: uncharacterized protein LOC104607033 [Nelumbo nucifera]
Length=482

 Score = 48.9 bits (115),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ + AL    TWDLVDLP  K  IGCKWVY +
Sbjct  396  MVDEIQALTSTHTWDLVDLPPDKSVIGCKWVYKI  429


 Score = 35.0 bits (79),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  + R KARLVAKG+ Q YGID
Sbjct  432  RADGSIERYKARLVAKGFTQEYGID  456



>emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera]
Length=1360

 Score = 45.1 bits (105),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ +LP GK  +GCKW++ V
Sbjct  925  EEIQALEKNGTWEISELPEGKRPVGCKWIFTV  956


 Score = 38.9 bits (89),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  + R KARLVAKG+ Q+YGID
Sbjct  960  PDGSINRFKARLVAKGFTQSYGID  983



>ref|XP_010916812.1| PREDICTED: uncharacterized protein LOC105041563 [Elaeis guineensis]
Length=215

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVNET  71
            M+E M AL +NQTWDL+ LPA K  +GCKWVY + +T
Sbjct  161  MLEKMTALSKNQTWDLITLPASKHPVGCKWVYTIKQT  197



>emb|CAN82518.1| hypothetical protein VITISV_042699 [Vitis vinifera]
Length=797

 Score = 45.4 bits (106),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E M AL++N TW++VDLP  K  +GCKWV+ +
Sbjct  358  EEMNALKKNGTWEVVDLPKEKKVVGCKWVFTI  389


 Score = 38.1 bits (87),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKG+ QTYGID
Sbjct  392  KADENIERYKARLVAKGFTQTYGID  416



>emb|CAN73661.1| hypothetical protein VITISV_024361 [Vitis vinifera]
Length=577

 Score = 46.6 bits (109),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            +++ MVALE+N TWD+V+   GK  +GCKWV+ +
Sbjct  331  VLKEMVALEKNHTWDIVNKLEGKTPVGCKWVFAI  364


 Score = 37.4 bits (85),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKG+ QTYGID
Sbjct  367  KSDGSIDRYKARLVAKGFTQTYGID  391



>emb|CAN83808.1| hypothetical protein VITISV_026963 [Vitis vinifera]
Length=971

 Score = 44.7 bits (104),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ +LP GK  +GCKW++ V
Sbjct  610  EEIQALEKNGTWEISELPEGKRPVGCKWIFTV  641


 Score = 38.9 bits (89),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  + R KARLVAKG+ Q+YGID
Sbjct  645  PDGSINRFKARLVAKGFTQSYGID  668



>emb|CAN82103.1| hypothetical protein VITISV_035488 [Vitis vinifera]
Length=1152

 Score = 46.2 bits (108),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            ++E + ALE+N TW++++LP GK  +GCKWV+ V
Sbjct  696  VMEEIRALEKNGTWEVMNLPRGKKLVGCKWVFTV  729


 Score = 37.7 bits (86),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KAR+VAKG+ QTYGID
Sbjct  732  KADGTIERYKARMVAKGFTQTYGID  756



>emb|CAN82851.1| hypothetical protein VITISV_027998 [Vitis vinifera]
Length=1239

 Score = 46.6 bits (109),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  762  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  793


 Score = 37.0 bits (84),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  796  KADGNVDRYKARLVAKGFTQSYGID  820



>emb|CAN68502.1| hypothetical protein VITISV_015736 [Vitis vinifera]
Length=539

 Score = 44.7 bits (104),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M + ++N+TW+LV+  +GK  +GC+W+Y+V
Sbjct  43   MNEEMKSFQKNETWELVECLSGKKPVGCRWIYIV  76


 Score = 38.9 bits (89),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R K+RLVAKGY QTYGID
Sbjct  79   KADDSIERFKSRLVAKGYTQTYGID  103



>emb|CAN70109.1| hypothetical protein VITISV_001696 [Vitis vinifera]
Length=920

 Score = 46.2 bits (108),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+LV+ P  K  +GC+W+Y+V
Sbjct  471  MNEEMKSLQKNETWELVECPPRKKPVGCRWIYIV  504


 Score = 37.4 bits (85),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAK Y QTYGID
Sbjct  507  KADDSIERFKARLVAKEYTQTYGID  531



>emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera]
Length=1636

 Score = 46.6 bits (109),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  925  EEVRALEKNGTWEITDLPRGKKLVGCKWIFTV  956


 Score = 37.0 bits (84),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  959  KADGNVDRYKARLVAKGFTQSYGID  983



>ref|XP_010245474.1| PREDICTED: phospholipase D p1-like [Nelumbo nucifera]
Length=918

 Score = 44.3 bits (103),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL+ N TW+L  LP  K  +GCKW Y V
Sbjct  162  MEEELSALQHNHTWELTTLPPDKHTVGCKWAYTV  195


 Score = 39.3 bits (90),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            +PD  V +LKARLV+KGY+Q YG+D
Sbjct  198  RPDGSVEQLKARLVSKGYSQLYGVD  222



>emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera]
Length=1381

 Score = 47.8 bits (112),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  891  MKEELDALTKNHTWDLVTLPPGQSVVGCKWIYKI  924


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  V R KARLVAKG+ Q YGID
Sbjct  927  RSDGSVERYKARLVAKGFTQEYGID  951



>emb|CAN61929.1| hypothetical protein VITISV_014855 [Vitis vinifera]
Length=1271

 Score = 47.8 bits (112),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  825  MKEELDALTKNHTWDLVTLPPGQSVVGCKWIYKI  858


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  V R KARLVAKG+ Q YGID
Sbjct  861  RSDGSVERYKARLVAKGFTQEYGID  885



>emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera]
Length=1261

 Score = 47.8 bits (112),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  801  MKEELDALTKNHTWDLVTLPPGQSVVGCKWIYKI  834


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  V R KARLVAKG+ Q YGID
Sbjct  837  RSDGSVERYKARLVAKGFTQEYGID  861



>ref|XP_008341769.1| PREDICTED: uncharacterized protein LOC103404622 [Malus domestica]
Length=265

 Score = 45.1 bits (105),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M + +VAL +N+TW LV LP  K  IGCKW+Y V
Sbjct  174  MQKEIVALHDNRTWTLVPLPPHKHPIGCKWIYKV  207


 Score = 38.5 bits (88),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  78   MKPDVFVARLKARLVAKGYAQTYGID  1
            +KPD  V R KARLVAKGY+Q  G+D
Sbjct  209  LKPDGSVERYKARLVAKGYSQIKGLD  234



>emb|CAN74499.1| hypothetical protein VITISV_013001 [Vitis vinifera]
Length=993

 Score = 47.8 bits (112),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  503  MKEELDALTKNHTWDLVTLPPGQSVVGCKWIYKI  536


 Score = 35.4 bits (80),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  V R KARLVAKG+ Q YGID
Sbjct  539  RSDGSVERYKARLVAKGFTQEYGID  563



>emb|CAN72951.1| hypothetical protein VITISV_020157 [Vitis vinifera]
Length=644

 Score = 46.2 bits (108),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M +L++N+TW+ V+ P GK  +GC+W+Y V
Sbjct  576  MNEKMKSLQKNETWERVECPPGKKPVGCRWIYTV  609


 Score = 37.4 bits (85),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KA+LV KGY QTYGID
Sbjct  612  KADGSIERFKAKLVVKGYTQTYGID  636



>emb|CAN82711.1| hypothetical protein VITISV_004468 [Vitis vinifera]
Length=1157

 Score = 51.6 bits (122),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            MV+ M AL  N TWDLV LP+GK  +GC+WVY V
Sbjct  707  MVDEMAALHFNGTWDLVVLPSGKSTVGCRWVYTV  740


 Score = 31.6 bits (70),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = -1

Query  60   VARLKARLVAKGYAQTYGID  1
            V RLKARLV KGY Q Y  D
Sbjct  748  VDRLKARLVTKGYTQVYSSD  767



>emb|CAN76366.1| hypothetical protein VITISV_014139 [Vitis vinifera]
Length=365

 Score = 53.9 bits (128),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E M ALE+NQTWD+V+LP GK  +GCKW++ V
Sbjct  273  MDEEMRALEKNQTWDIVELPKGKKTVGCKWIFNV  306


 Score = 29.6 bits (65),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 13/18 (72%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -1

Query  54   RLKARLVAKGYAQTYGID  1
            R KARLVAK Y +TY ID
Sbjct  316  RYKARLVAKEYTRTYDID  333



>emb|CAN74430.1| hypothetical protein VITISV_010987 [Vitis vinifera]
Length=2471

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  1138  MKEELDALTKNHTWDLVPLPPGQSVVGCKWIYKI  1171


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             + D  V R KARLVAKG+ Q YGID
Sbjct  1174  RSDGSVERYKARLVAKGFTQEYGID  1198



>emb|CAN74984.1| hypothetical protein VITISV_035210 [Vitis vinifera]
Length=2408

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  1985  MKEELDALTKNHTWDLVPLPPGQSVVGCKWIYKI  2018


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             + D  V R KARLVAKG+ Q YGID
Sbjct  2021  RSDGSVERYKARLVAKGFTQEYGID  2045



>emb|CAN73389.1| hypothetical protein VITISV_005955 [Vitis vinifera]
Length=177

 Score = 48.1 bits (113),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVVN  77
            MV+ M AL  N TWDLV LP+GK  + C+WVY V 
Sbjct  1    MVDEMAALHSNGTWDLVVLPSGKSTVSCRWVYAVK  35


 Score = 35.0 bits (79),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = -1

Query  72  PDVFVARLKARLVAKGYAQTYGID  1
           PD  V  LKARLVAKGY Q YG D
Sbjct  38  PDGQVDHLKARLVAKGYTQVYGSD  61



>emb|CAN70361.1| hypothetical protein VITISV_033646 [Vitis vinifera]
Length=1013

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  523  MKEELDALTKNHTWDLVPLPPGQSVVGCKWIYKI  556


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  V R KARLVAKG+ Q YGID
Sbjct  559  RSDGSVERYKARLVAKGFTQEYGID  583



>emb|CAN65108.1| hypothetical protein VITISV_036622 [Vitis vinifera]
Length=607

 Score = 46.6 bits (109),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  175  ETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            E + ALE+N TW++ DLP GK  +GCKW++ V
Sbjct  114  EEVRALEKNGTWEITDLPRGKKPVGCKWIFTV  145


 Score = 37.0 bits (84),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVAKG+ Q+YGID
Sbjct  148  KADGNVDRYKARLVAKGFTQSYGID  172



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score = 44.7 bits (104),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M++ M AL+ N TW+LV LP+ K  +GC+WV+ +
Sbjct  892  MLDEMNALQNNGTWELVPLPSRKSVVGCRWVFAI  925


 Score = 38.5 bits (88),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -1

Query  72   PDVFVARLKARLVAKGYAQTYGID  1
            PD  + RLKARLVAKGY Q +G+D
Sbjct  929  PDGTIDRLKARLVAKGYTQIFGLD  952



>gb|AEJ72555.1| putative retroelement polyprotein [Malus domestica]
Length=1249

 Score = 45.1 bits (105),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVY  86
            M E + AL EN+TW +  LP G  A+GC+WVY
Sbjct  821  MDEELRALNENKTWSITKLPKGMRAVGCRWVY  852


 Score = 38.1 bits (87),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  V R KARLVA+G+ QTYGID
Sbjct  857  KSDGLVERHKARLVARGFTQTYGID  881



>emb|CAN68711.1| hypothetical protein VITISV_015847 [Vitis vinifera]
Length=1168

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            M E + AL +N TWDLV LP G+  +GCKW+Y +
Sbjct  678  MKEELDALTKNHTWDLVPLPPGQSVVGCKWIYKI  711


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            + D  V R KARLVAKG+ Q YGID
Sbjct  714  RSDGSVERYKARLVAKGFTQEYGID  738



>emb|CAN61738.1| hypothetical protein VITISV_000022 [Vitis vinifera]
Length=479

 Score = 45.1 bits (105),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
            ++E M  L++N TWD+V+   GK  IGCKWV+ +
Sbjct  295  IIEEMATLKKNHTWDIVNKLEGKTPIGCKWVFAI  328


 Score = 38.1 bits (87),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -1

Query  75   KPDVFVARLKARLVAKGYAQTYGID  1
            K D  + R KARLVAKG+ QTYGID
Sbjct  331  KSDGSIDRYKARLVAKGFTQTYGID  355



>ref|YP_173385.1| hypothetical protein NitaMp039 [Nicotiana tabacum]
 ref|YP_009049804.1| hypothetical protein (mitochondrion) [Capsicum annuum]
 dbj|BAD83449.1| hypothetical protein (mitochondrion) [Nicotiana tabacum]
 gb|AIG89815.1| hypothetical protein (mitochondrion) [Capsicum annuum]
 gb|AIG90162.1| hypothetical protein (mitochondrion) [Capsicum annuum]
Length=152

 Score = 50.1 bits (118),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 2/37 (5%)
 Frame = -3

Query  181  MVETMVALEENQTWDLVDLPAGKIAIG--CKWVYVVN  77
            M+E M ALE+N+TW++VDLP GK  +G  CKWVY V 
Sbjct  1    MMEEMSALEKNETWEIVDLPPGKKTVGSKCKWVYTVK  37


 Score = 32.7 bits (73),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -1

Query  75  KPDVFVARLKARLVAKGYAQTYGID  1
           +P   + R KARLVA+G+ QT GID
Sbjct  39  QPSGEIERYKARLVARGFTQTKGID  63



>ref|XP_004231364.1| PREDICTED: uncharacterized protein LOC101245809 [Solanum lycopersicum]
Length=1094

 Score = 48.5 bits (114),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             M +   AL  N TWDLV LP GK AIGC+WVY V
Sbjct  970   MTQEFDALHLNHTWDLVPLPFGKKAIGCRWVYKV  1003


 Score = 34.7 bits (78),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -1

Query  75    KPDVFVARLKARLVAKGYAQTYGID  1
             K D  + RLKARLV KGY Q  GID
Sbjct  1006  KADGTIERLKARLVVKGYTQQAGID  1030



>ref|XP_010677179.1| PREDICTED: uncharacterized protein LOC104892859 [Beta vulgaris 
subsp. vulgaris]
Length=2018

 Score = 48.1 bits (113),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  181   MVETMVALEENQTWDLVDLPAGKIAIGCKWVYVV  80
             M + + ALE N TW+L +LP GK AIGCKWV+ V
Sbjct  1017  MHKEIAALEANGTWELTNLPKGKKAIGCKWVFKV  1050


 Score = 34.7 bits (78),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  78    MKPDVFVARLKARLVAKGYAQTYGID  1
             +K D  +  LKARLVAKG+ Q YGID
Sbjct  1052  LKEDGSLEWLKARLVAKGFTQQYGID  1077



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506872938168