BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11923_g1_i1 len=2007 path=[53:0-2006]

Length=2007
                                                                      Score     E

ref|XP_009800189.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       797   0.0      
ref|XP_009613830.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       796   0.0      
ref|XP_010317511.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       787   0.0      
ref|XP_006356126.1|  PREDICTED: probable peptide/nitrate transpor...    778   0.0      
ref|XP_011101929.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       756   0.0      
ref|XP_002522283.1|  nitrate transporter, putative                      751   0.0      Ricinus communis
ref|XP_003632975.2|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       749   0.0      
ref|XP_011102252.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       748   0.0      
ref|XP_004295409.1|  PREDICTED: nitrate transporter 1.2-like            741   0.0      
ref|XP_006468198.1|  PREDICTED: nitrate transporter 1.2-like            739   0.0      
ref|XP_011009674.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       734   0.0      
ref|XP_010054300.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       725   0.0      
ref|XP_002305708.2|  hypothetical protein POPTR_0004s06290g             724   0.0      Populus trichocarpa [western balsam poplar]
emb|CBI30755.3|  unnamed protein product                                748   0.0      
ref|XP_007025262.1|  Major facilitator superfamily protein              724   0.0      
ref|XP_006449569.1|  hypothetical protein CICLE_v10017858mg             741   0.0      
ref|XP_007213595.1|  hypothetical protein PRUPE_ppa002462mg             722   0.0      
ref|XP_008225414.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       721   0.0      
ref|XP_009353476.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       719   0.0      
ref|XP_008371731.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       714   0.0      
ref|XP_004163358.1|  PREDICTED: nitrate transporter 1.2-like            714   0.0      
ref|XP_008439704.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       713   0.0      
gb|KDO77964.1|  hypothetical protein CISIN_1g043156mg                   711   0.0      
ref|XP_010059065.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       710   0.0      
gb|EYU28131.1|  hypothetical protein MIMGU_mgv1a025040mg                707   0.0      
gb|KHN48035.1|  Putative peptide/nitrate transporter                    706   0.0      
ref|XP_003532772.2|  PREDICTED: probable peptide/nitrate transpor...    707   0.0      
ref|XP_008358638.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       711   0.0      
ref|XP_008383580.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       704   0.0      
gb|KCW74201.1|  hypothetical protein EUGRSUZ_E02847                     702   0.0      
ref|XP_007159501.1|  hypothetical protein PHAVU_002G243000g             699   0.0      
ref|XP_003629872.1|  Nitrate/chlorate transporter                       697   0.0      
ref|XP_004504417.1|  PREDICTED: probable peptide/nitrate transpor...    695   0.0      
ref|XP_010088624.1|  putative peptide/nitrate transporter               694   0.0      
ref|XP_003541681.1|  PREDICTED: nitrate transporter 1.2-like            692   0.0      
gb|AET04345.2|  peptide/nitrate transporter                             688   0.0      
ref|XP_003547187.2|  PREDICTED: nitrate transporter 1.2-like            688   0.0      
gb|KHN06924.1|  Nitrate transporter 1.2                                 687   0.0      
ref|XP_007147975.1|  hypothetical protein PHAVU_006G170100g             684   0.0      
ref|XP_003593801.1|  Peptide transporter PTR1                           684   0.0      
ref|XP_004486281.1|  PREDICTED: nitrate transporter 1.2-like            683   0.0      
ref|XP_007159500.1|  hypothetical protein PHAVU_002G242900g             682   0.0      
ref|XP_003629869.1|  Nitrate/chlorate transporter                       678   0.0      
ref|XP_006580182.1|  PREDICTED: nitrate transporter 1.2-like            674   0.0      
gb|KHN06438.1|  Nitrate transporter 1.2                                 673   0.0      
gb|KHN47373.1|  Nitrate transporter 1.2                                 665   0.0      
emb|CDO96897.1|  unnamed protein product                                657   0.0      
gb|KGN49340.1|  hypothetical protein Csa_6G520380                       657   0.0      
ref|XP_010925175.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       661   0.0      
ref|XP_008792400.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       648   0.0      
ref|XP_003567115.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       613   0.0      
dbj|BAD86972.1|  putative nitrate transporter                           603   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567116.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       605   0.0      
ref|XP_006646322.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    593   0.0      
ref|XP_004972177.1|  PREDICTED: probable peptide/nitrate transpor...    585   0.0      
gb|EEC71475.1|  hypothetical protein OsI_03732                          600   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMT19989.1|  Peptide transporter PTR2                                579   0.0      
gb|EEE55380.1|  hypothetical protein OsJ_03453                          600   0.0      Oryza sativa Japonica Group [Japonica rice]
tpg|DAA57644.1|  TPA: hypothetical protein ZEAMMB73_431416              576   0.0      
ref|XP_002456356.1|  hypothetical protein SORBIDRAFT_03g034595          561   0.0      Sorghum bicolor [broomcorn]
emb|CDM83976.1|  unnamed protein product                                530   3e-178   
ref|XP_010908386.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       487   6e-160   
ref|XP_007017375.1|  Major facilitator superfamily protein              479   1e-157   
ref|XP_008220717.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       478   3e-157   
ref|XP_004238589.2|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       477   4e-157   
ref|XP_006434871.1|  hypothetical protein CICLE_v10003139mg             476   2e-156   
ref|XP_008792636.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       474   2e-155   
ref|XP_002282221.2|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       473   3e-155   Vitis vinifera
emb|CBI19585.3|  unnamed protein product                                473   3e-154   
ref|XP_004501602.1|  PREDICTED: probable peptide/nitrate transpor...    469   9e-154   
ref|XP_011017254.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    468   2e-153   
ref|XP_011017253.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    468   2e-153   
gb|KHN04528.1|  Putative peptide/nitrate transporter                    466   1e-152   
ref|XP_007136650.1|  hypothetical protein PHAVU_009G062200g             466   2e-152   
gb|KDO84362.1|  hypothetical protein CISIN_1g008651mg                   464   2e-152   
ref|XP_006473393.1|  PREDICTED: nitrate transporter 1.2-like            464   4e-152   
ref|XP_003523589.2|  PREDICTED: nitrate transporter 1.2-like            466   6e-152   
gb|KDP38407.1|  hypothetical protein JCGZ_04332                         481   6e-152   
ref|XP_011083919.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       466   1e-151   
ref|XP_006375010.1|  hypothetical protein POPTR_0014s03550g             463   4e-151   
ref|XP_006848555.1|  hypothetical protein AMTR_s00169p00048300          461   5e-151   
ref|XP_009761039.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       461   8e-151   
ref|XP_006354962.1|  PREDICTED: probable peptide/nitrate transpor...    460   1e-150   
emb|CDP07606.1|  unnamed protein product                                461   1e-150   
gb|KCW85044.1|  hypothetical protein EUGRSUZ_B01888                     453   4e-150   
ref|XP_009605561.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       456   1e-148   
ref|XP_007017376.1|  Nitrate transporter 1:2, putative                  454   1e-148   
ref|XP_009766629.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       455   3e-148   
ref|XP_010059778.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       455   3e-148   
ref|XP_009605560.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       454   5e-148   
ref|XP_011030670.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    455   6e-148   
gb|ABR16528.1|  unknown                                                 455   1e-147   Picea sitchensis
ref|XP_004152790.1|  PREDICTED: probable peptide/nitrate transpor...    452   2e-147   
ref|XP_008676281.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       451   7e-147   
ref|XP_003602970.1|  Peptide transporter PTR3-A                         449   4e-146   
ref|XP_002301204.2|  hypothetical protein POPTR_0002s13090g             447   7e-146   Populus trichocarpa [western balsam poplar]
ref|XP_010089930.1|  Nitrate transporter 1.2                            445   2e-144   
ref|XP_004238192.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       442   2e-143   
ref|XP_009365671.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       443   8e-143   
ref|XP_002510282.1|  nitrate transporter, putative                      439   8e-143   Ricinus communis
ref|XP_011030677.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    439   1e-142   
ref|XP_003527710.2|  PREDICTED: nitrate transporter 1.2-like            439   5e-142   
gb|KEH35736.1|  peptide/nitrate transporter                             436   2e-140   
ref|XP_006354936.1|  PREDICTED: probable peptide/nitrate transpor...    433   4e-140   
ref|XP_004238191.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5            433   1e-139   
ref|XP_004293234.1|  PREDICTED: probable peptide/nitrate transpor...    431   7e-139   
gb|KHN22290.1|  Nitrate transporter 1.2                                 429   2e-138   
ref|XP_008790065.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       429   1e-137   
ref|XP_004134923.1|  PREDICTED: probable peptide/nitrate transpor...    419   2e-137   
ref|XP_009341381.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       427   4e-137   
ref|XP_010042512.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       426   5e-137   
ref|XP_007201615.1|  hypothetical protein PRUPE_ppa019863mg             427   5e-137   
emb|CBI39681.3|  unnamed protein product                                427   7e-137   
gb|AEK82130.1|  dicarboxylate transporter                               424   2e-136   
ref|XP_006577196.1|  PREDICTED: nitrate transporter 1.2-like isof...    424   2e-136   
ref|XP_008795325.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       424   4e-136   
ref|XP_006604775.1|  PREDICTED: nitrate transporter 1.2-like            423   4e-136   
ref|XP_003591266.1|  Peptide transporter PTR1                           424   4e-136   
ref|XP_007163280.1|  hypothetical protein PHAVU_001G221300g             422   7e-136   
ref|XP_002276071.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       428   8e-136   Vitis vinifera
ref|XP_007019707.1|  Major facilitator superfamily protein              423   1e-135   
ref|XP_003529696.1|  PREDICTED: probable peptide/nitrate transpor...    422   1e-135   
emb|CDX93764.1|  BnaA09g23640D                                          422   3e-135   
ref|XP_009114795.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            421   5e-135   
ref|XP_011087574.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       421   6e-135   
ref|XP_004230414.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            421   9e-135   
ref|XP_008339431.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       421   9e-135   
ref|XP_010912660.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       419   3e-134   
ref|XP_003626123.1|  Peptide transporter PTR1                           419   3e-134   
ref|XP_010548417.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    419   6e-134   
emb|CDY50182.1|  BnaCnng18870D                                          418   7e-134   
gb|KDP42512.1|  hypothetical protein JCGZ_00309                         419   9e-134   
ref|XP_002265350.3|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       417   2e-133   Vitis vinifera
ref|XP_004495820.1|  PREDICTED: nitrate transporter 1.2-like            417   3e-133   
ref|XP_004144799.1|  PREDICTED: probable peptide/nitrate transpor...    419   4e-133   
ref|XP_006349278.1|  PREDICTED: probable peptide/nitrate transpor...    417   4e-133   
ref|XP_009803729.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       417   4e-133   
ref|XP_010470202.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       416   4e-133   
ref|XP_011087621.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       416   8e-133   
ref|XP_010414658.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    416   8e-133   
ref|XP_008237812.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       416   8e-133   
ref|XP_006392243.1|  hypothetical protein EUTSA_v10023363mg             415   1e-132   
ref|XP_004979163.1|  PREDICTED: probable peptide/nitrate transpor...    414   1e-132   
ref|XP_004494500.1|  PREDICTED: nitrate transporter 1.2-like            414   1e-132   
ref|XP_010511033.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       414   2e-132   
ref|XP_009776306.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       414   3e-132   
gb|KFK40857.1|  hypothetical protein AALP_AA2G050600                    414   3e-132   
ref|XP_010930551.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    414   3e-132   
gb|KFK45078.1|  hypothetical protein AALP_AA1G340600                    414   4e-132   
ref|XP_008218643.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       414   4e-132   
ref|XP_009757573.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    414   4e-132   
ref|XP_010252354.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    414   5e-132   
gb|EYU36281.1|  hypothetical protein MIMGU_mgv1a004263mg                411   5e-132   
ref|XP_007145059.1|  hypothetical protein PHAVU_007G206400g             414   5e-132   
ref|XP_007221822.1|  hypothetical protein PRUPE_ppa002962mg             414   6e-132   
ref|XP_009757572.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    414   6e-132   
gb|KCW85010.1|  hypothetical protein EUGRSUZ_B01831                     411   6e-132   
emb|CDO97656.1|  unnamed protein product                                414   7e-132   
ref|XP_008459507.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            412   7e-132   
ref|XP_010930186.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    412   1e-131   
gb|KHN43381.1|  Nitrate transporter 1.2                                 410   1e-131   
ref|XP_006470829.1|  PREDICTED: probable peptide/nitrate transpor...    412   2e-131   
ref|XP_006415085.1|  hypothetical protein EUTSA_v10007132mg             412   2e-131   
ref|XP_003592869.1|  Peptide transporter PTR1                           412   2e-131   
ref|XP_006431440.1|  hypothetical protein CICLE_v10000639mg             412   2e-131   
ref|XP_004290270.1|  PREDICTED: probable peptide/nitrate transpor...    412   2e-131   
ref|NP_176183.1|  probable peptide/nitrate transporter                  412   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930188.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    411   3e-131   
ref|XP_009617493.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       412   3e-131   
gb|KHN11039.1|  Putative peptide/nitrate transporter                    411   4e-131   
ref|XP_010930189.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    410   6e-131   
ref|XP_011003705.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       411   8e-131   
ref|XP_010930190.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       410   9e-131   
ref|XP_003540130.1|  PREDICTED: probable peptide/nitrate transpor...    411   9e-131   
ref|XP_006302056.1|  hypothetical protein CARUB_v10020041mg             410   1e-130   
ref|XP_006385186.1|  proton-dependent oligopeptide transport fami...    410   2e-130   
ref|XP_009624590.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       409   3e-130   
ref|XP_007153917.1|  hypothetical protein PHAVU_003G076000g             409   3e-130   
ref|NP_174610.2|  probable peptide/nitrate transporter                  409   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009421158.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       409   4e-130   
ref|XP_006836895.1|  hypothetical protein AMTR_s00099p00121400          409   4e-130   
ref|XP_002888185.1|  proton-dependent oligopeptide transport fami...    408   5e-130   
ref|XP_008670698.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       409   5e-130   
ref|XP_009610133.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    408   8e-130   
dbj|BAJ85519.1|  predicted protein                                      407   1e-129   
ref|XP_004250721.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    407   1e-129   
ref|XP_004231309.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       408   1e-129   
ref|XP_009610132.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    407   1e-129   
ref|XP_009113280.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    407   1e-129   
ref|XP_004141613.1|  PREDICTED: probable peptide/nitrate transpor...    406   2e-129   
ref|XP_010099787.1|  putative peptide/nitrate transporter               407   3e-129   
ref|XP_010478766.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4 isof...    406   4e-129   
gb|EYU35371.1|  hypothetical protein MIMGU_mgv1a003103mg                406   5e-129   
ref|XP_008378949.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       406   5e-129   
ref|XP_010499893.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       405   5e-129   
ref|XP_009401109.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       405   7e-129   
ref|XP_010248018.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    405   7e-129   
ref|XP_011095121.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            405   1e-128   
ref|XP_009795124.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       405   2e-128   
ref|XP_006307047.1|  hypothetical protein CARUB_v10008635mg             404   2e-128   
ref|XP_006840235.1|  hypothetical protein AMTR_s00089p00178270          403   2e-128   
ref|XP_006385089.1|  proton-dependent oligopeptide transport fami...    404   2e-128   
ref|XP_009103101.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       404   3e-128   
ref|XP_010065237.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            403   8e-128   
ref|XP_011028408.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            405   9e-128   
ref|XP_006358567.1|  PREDICTED: probable peptide/nitrate transpor...    403   1e-127   
ref|XP_009355381.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       403   1e-127   
ref|XP_009600843.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       404   1e-127   
ref|XP_010542589.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4 isof...    401   2e-127   
ref|XP_010094918.1|  Nitrate transporter 1.2                            402   4e-127   
ref|XP_009113281.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    400   6e-127   
ref|XP_010063728.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       401   6e-127   
ref|XP_011092258.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            400   7e-127   
ref|XP_002512591.1|  nitrate transporter, putative                      401   9e-127   Ricinus communis
ref|XP_009366884.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            400   1e-126   
ref|XP_004169231.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    400   1e-126   
ref|XP_010910278.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       399   2e-126   
ref|XP_009403716.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    399   2e-126   
ref|XP_009403715.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    399   2e-126   
ref|XP_010066966.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       399   2e-126   
ref|XP_011092687.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       398   3e-126   
ref|XP_009416965.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       398   4e-126   
gb|AAG51210.1|AC051630_7  nitrate transporter NTL1, putative; 540...    398   5e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007023125.1|  Major facilitator superfamily protein              400   5e-126   
ref|XP_008373309.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       398   6e-126   
ref|XP_009602084.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       398   8e-126   
ref|XP_002893770.1|  proton-dependent oligopeptide transport fami...    397   9e-126   
ref|XP_010248019.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    397   1e-125   
ref|XP_004133734.1|  PREDICTED: probable peptide/nitrate transpor...    397   2e-125   
ref|XP_002268504.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       397   2e-125   Vitis vinifera
ref|XP_009757633.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       397   2e-125   
ref|XP_009415000.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       396   2e-125   
gb|KGN61036.1|  hypothetical protein Csa_2G035360                       397   2e-125   
ref|XP_004979024.1|  PREDICTED: probable peptide/nitrate transpor...    396   3e-125   
gb|KHN26211.1|  Putative peptide/nitrate transporter                    396   3e-125   
ref|XP_006359595.1|  PREDICTED: probable peptide/nitrate transpor...    395   4e-125   
ref|XP_003577653.2|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       397   4e-125   
ref|XP_008453012.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       396   4e-125   
ref|XP_006605772.1|  PREDICTED: probable peptide/nitrate transpor...    396   4e-125   
emb|CDP15160.1|  unnamed protein product                                396   4e-125   
ref|XP_006371371.1|  proton-dependent oligopeptide transport fami...    395   4e-125   
ref|XP_006423955.1|  hypothetical protein CICLE_v10028084mg             395   5e-125   
ref|XP_006362722.1|  PREDICTED: probable peptide/nitrate transpor...    395   6e-125   
ref|XP_006480388.1|  PREDICTED: probable peptide/nitrate transpor...    396   8e-125   
ref|XP_004300018.1|  PREDICTED: probable peptide/nitrate transpor...    396   1e-124   
ref|XP_004304920.1|  PREDICTED: probable peptide/nitrate transpor...    395   1e-124   
ref|XP_011007486.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like...    394   2e-124   
ref|XP_010461172.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    395   3e-124   
ref|XP_006441808.1|  hypothetical protein CICLE_v10019334mg             394   5e-124   
ref|XP_006423956.1|  hypothetical protein CICLE_v10030352mg             391   1e-123   
ref|XP_004248524.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5            391   1e-123   
gb|EYU35036.1|  hypothetical protein MIMGU_mgv1a020801mg                391   1e-123   
ref|XP_006478312.1|  PREDICTED: probable peptide/nitrate transpor...    392   1e-123   
gb|KDO56389.1|  hypothetical protein CISIN_1g044175mg                   390   1e-123   
ref|XP_003536010.1|  PREDICTED: probable peptide/nitrate transpor...    391   2e-123   
ref|XP_008802942.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            392   2e-123   
ref|XP_006480335.1|  PREDICTED: probable peptide/nitrate transpor...    391   3e-123   
ref|XP_006353083.1|  PREDICTED: probable peptide/nitrate transpor...    390   4e-123   
gb|KHG30344.1|  hypothetical protein F383_15360                         390   4e-123   
ref|XP_010682129.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            391   5e-123   
ref|XP_008345984.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       382   5e-123   
gb|KDO56387.1|  hypothetical protein CISIN_1g007582mg                   390   5e-123   
ref|XP_004485415.1|  PREDICTED: probable peptide/nitrate transpor...    389   8e-123   
gb|KHN13971.1|  Putative peptide/nitrate transporter                    390   9e-123   
gb|EYU19371.1|  hypothetical protein MIMGU_mgv1a020538mg                387   2e-122   
gb|KDP23323.1|  hypothetical protein JCGZ_23156                         390   3e-122   
ref|XP_007031286.1|  Major facilitator superfamily protein isoform 1    389   3e-122   
ref|XP_006423957.1|  hypothetical protein CICLE_v10029865mg             385   6e-122   
ref|XP_009366004.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       387   7e-122   
gb|KGN62553.1|  hypothetical protein Csa_2G360700                       383   1e-121   
ref|XP_007046240.1|  Nitrate transporter 1:2                            386   1e-121   
ref|XP_008363954.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       386   2e-121   
ref|XP_010096334.1|  Nitrate transporter 1.2                            385   2e-121   
ref|XP_009353536.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       386   2e-121   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176             385   2e-121   
ref|XP_002448096.1|  hypothetical protein SORBIDRAFT_06g021020          384   3e-121   Sorghum bicolor [broomcorn]
ref|XP_002975508.1|  hypothetical protein SELMODRAFT_103849             385   3e-121   
ref|XP_009139262.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            384   9e-121   
gb|KHG02514.1|  Nitrate transporter 1.2 -like protein                   384   1e-120   
gb|KDO42071.1|  hypothetical protein CISIN_1g008953mg                   382   1e-120   
ref|XP_002877959.1|  proton-dependent oligopeptide transport fami...    383   1e-120   
ref|XP_008246336.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       384   1e-120   
ref|XP_004976049.1|  PREDICTED: nitrate transporter 1.2-like isof...    382   2e-120   
ref|XP_002271787.2|  PREDICTED: protein NRT1/ PTR FAMILY 4.6            384   3e-120   
ref|XP_010242343.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       382   4e-120   
ref|XP_011071033.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       382   6e-120   
gb|EEC68011.1|  hypothetical protein OsI_35810                          382   6e-120   
emb|CAN63859.1|  hypothetical protein VITISV_037742                     383   8e-120   
ref|NP_001067697.1|  Os11g0283500                                       381   8e-120   
gb|KHG03238.1|  Nitrate transporter 1.2 -like protein                   381   9e-120   
dbj|BAK00345.1|  predicted protein                                      380   1e-119   
gb|KDO56388.1|  hypothetical protein CISIN_1g007582mg                   381   1e-119   
ref|XP_010548409.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    379   1e-119   
ref|XP_008360213.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       382   1e-119   
ref|XP_011025003.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       380   2e-119   
ref|NP_973919.1|  probable peptide/nitrate transporter                  380   2e-119   
ref|XP_004960746.1|  PREDICTED: probable peptide/nitrate transpor...    380   2e-119   
ref|XP_007015371.1|  Major facilitator superfamily protein              381   2e-119   
ref|XP_008388909.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       380   2e-119   
ref|NP_174024.2|  probable peptide/nitrate transporter                  380   3e-119   
emb|CBI16981.3|  unnamed protein product                                389   3e-119   
ref|XP_006292488.1|  hypothetical protein CARUB_v10018717mg             379   3e-119   
ref|XP_007224501.1|  hypothetical protein PRUPE_ppa023308mg             380   5e-119   
dbj|BAJ97770.1|  predicted protein                                      380   7e-119   
ref|XP_010528782.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            379   7e-119   
ref|XP_010256286.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6 isof...    379   8e-119   
ref|XP_006382249.1|  putative nitrate transporter family protein        380   8e-119   
ref|XP_008364013.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       379   9e-119   
ref|XP_010504206.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       378   1e-118   
ref|XP_007208183.1|  hypothetical protein PRUPE_ppa018162mg             377   1e-118   
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             377   2e-118   
ref|XP_010427083.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            377   2e-118   
ref|XP_008222341.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       377   2e-118   
ref|XP_011039060.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       379   3e-118   
ref|XP_008808913.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       377   3e-118   
ref|XP_010515930.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       377   3e-118   
ref|XP_009782128.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       377   3e-118   
ref|XP_004298454.1|  PREDICTED: nitrate transporter 1.2-like            377   4e-118   
ref|XP_010683268.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       377   4e-118   
ref|XP_009406476.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       378   4e-118   
emb|CDP11530.1|  unnamed protein product                                378   5e-118   
ref|XP_006438574.1|  hypothetical protein CICLE_v10031067mg             376   6e-118   
gb|KDP21234.1|  hypothetical protein JCGZ_21705                         376   8e-118   
emb|CDP09676.1|  unnamed protein product                                376   8e-118   
ref|XP_002448098.1|  hypothetical protein SORBIDRAFT_06g021040          375   8e-118   
ref|XP_009359906.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       377   9e-118   
gb|AAL32531.1|  nitrate transporter (NTL1)                              376   1e-117   
gb|AAG52554.1|AC010675_2  nitrate transporter (NTL1); 53025-56402       376   1e-117   
emb|CDY13185.1|  BnaC04g26500D                                          375   1e-117   
ref|XP_010915166.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    375   1e-117   
gb|KFK44618.1|  hypothetical protein AALP_AA1G282200                    375   2e-117   
ref|XP_007037215.1|  Nitrate transporter 1:2 isoform 2                  375   2e-117   
ref|XP_006302053.1|  hypothetical protein CARUB_v10020037mg             375   2e-117   
ref|XP_002447891.1|  hypothetical protein SORBIDRAFT_06g017470          375   2e-117   
ref|NP_564978.1|  nitrate transporter 1:2                               375   2e-117   
ref|XP_007037214.1|  Nitrate transporter 1:2 isoform 1                  375   2e-117   
ref|XP_009366005.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       375   2e-117   
ref|XP_010930552.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    374   2e-117   
gb|AAC28086.1|  nitrate transporter NTL1                                375   2e-117   
ref|NP_190982.1|  peptide transporter PTR1                              375   2e-117   
ref|XP_006378161.1|  nitrate transporter family protein                 375   3e-117   
ref|XP_008369656.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       376   3e-117   
ref|XP_009105655.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6 isof...    374   3e-117   
ref|XP_008221686.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6            375   4e-117   
ref|XP_008339944.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       374   4e-117   
ref|XP_011086399.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    374   1e-116   
ref|XP_011006591.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6 isof...    373   1e-116   
gb|KHN01167.1|  Nitrate transporter 1.2                                 373   1e-116   
ref|XP_011086398.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    373   2e-116   
emb|CDY38765.1|  BnaA07g28370D                                          375   2e-116   
ref|XP_009594286.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       373   2e-116   
ref|XP_009411885.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       373   2e-116   
ref|XP_009103119.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5            372   2e-116   
ref|XP_002449305.1|  hypothetical protein SORBIDRAFT_05g007450          373   3e-116   
ref|XP_008669378.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    372   3e-116   
ref|XP_007221995.1|  hypothetical protein PRUPE_ppa003278mg             372   3e-116   
ref|XP_004976039.1|  PREDICTED: nitrate transporter 1.2-like isof...    371   3e-116   
emb|CDY11649.1|  BnaC06g30900D                                          372   5e-116   
ref|XP_010313060.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    370   5e-116   
ref|XP_010252355.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4 isof...    371   6e-116   
ref|XP_006577197.1|  PREDICTED: nitrate transporter 1.2-like isof...    369   6e-116   
ref|XP_009360402.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       371   6e-116   
ref|XP_003519098.1|  PREDICTED: nitrate transporter 1.2-like            371   6e-116   
ref|XP_004508775.1|  PREDICTED: nitrate transporter 1.2-like            371   7e-116   
ref|XP_010512046.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       370   1e-115   
ref|XP_006573086.1|  PREDICTED: nitrate transporter 1.2-like            370   2e-115   
gb|KFK41404.1|  hypothetical protein AALP_AA2G126500                    370   2e-115   
ref|XP_004292959.1|  PREDICTED: peptide transporter PTR1-like           371   2e-115   
ref|XP_006586002.1|  PREDICTED: nitrate transporter 1.2-like            370   2e-115   
ref|XP_003532047.1|  PREDICTED: nitrate transporter 1.2-like            370   2e-115   
ref|XP_006662843.1|  PREDICTED: probable peptide/nitrate transpor...    370   3e-115   
ref|XP_010470989.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       370   3e-115   
ref|XP_009116102.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            369   4e-115   
dbj|BAJ88685.1|  predicted protein                                      369   4e-115   
ref|XP_006344286.1|  PREDICTED: nitrate transporter 1.2-like            369   5e-115   
gb|KHN13482.1|  Nitrate transporter 1.2                                 369   5e-115   
gb|ADQ74764.1|  nitrate transporter 1.2a                                369   6e-115   
ref|XP_011087215.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       369   7e-115   
ref|XP_010112066.1|  putative peptide/nitrate transporter               370   7e-115   
gb|EMS61008.1|  Nitrate transporter 1.2                                 368   8e-115   
ref|XP_006600419.1|  PREDICTED: probable peptide/nitrate transpor...    369   1e-114   
gb|EPS62192.1|  hypothetical protein M569_12600                         369   1e-114   
ref|XP_004975689.1|  PREDICTED: probable peptide/nitrate transpor...    369   1e-114   
ref|XP_008659709.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       368   1e-114   
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373             368   1e-114   
ref|XP_006842099.1|  hypothetical protein AMTR_s00078p00081800          368   1e-114   
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       368   1e-114   
gb|KHN13483.1|  Nitrate transporter 1.2                                 368   1e-114   
gb|KDO51375.1|  hypothetical protein CISIN_1g008177mg                   367   2e-114   
ref|XP_006652449.1|  PREDICTED: nitrate transporter 1.2-like            367   2e-114   
ref|XP_002298456.2|  hypothetical protein POPTR_0001s27970g             367   2e-114   
ref|XP_004236970.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       367   2e-114   
gb|ACN31606.1|  unknown                                                 367   2e-114   
ref|XP_010415652.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6            367   3e-114   
gb|KHG08248.1|  Peptide transporter PTR1 -like protein                  367   3e-114   
ref|XP_006600669.1|  PREDICTED: nitrate transporter 1.2-like            367   3e-114   
ref|NP_001150745.1|  peptide transporter PTR2                           367   4e-114   
gb|KEH23143.1|  proton-dependent oligopeptide transport family pr...    366   5e-114   
ref|XP_004236524.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6            367   6e-114   
ref|XP_006367069.1|  PREDICTED: nitrate transporter 1.2-like            366   6e-114   
ref|XP_010678584.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6            365   1e-113   
ref|XP_001785012.1|  predicted protein                                  366   1e-113   
ref|XP_011042610.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       365   1e-113   
ref|XP_002888743.1|  ATNRT1:2                                           365   1e-113   
gb|EPS73609.1|  proton-dependent oligopeptide transport family pr...    363   2e-113   
emb|CAH67350.1|  OSIGBa0130B08.10                                       364   2e-113   
ref|XP_004298249.1|  PREDICTED: probable peptide/nitrate transpor...    364   2e-113   
gb|EYU41841.1|  hypothetical protein MIMGU_mgv1a017650mg                364   2e-113   
ref|XP_003604615.1|  Peptide transporter PTR1                           365   2e-113   
ref|XP_006840406.1|  hypothetical protein AMTR_s00045p00149350          362   2e-113   
gb|KDP24486.1|  hypothetical protein JCGZ_25050                         364   3e-113   
ref|XP_009611762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       365   3e-113   
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106             364   4e-113   
ref|XP_006398647.1|  hypothetical protein EUTSA_v10013125mg             363   5e-113   
gb|KHG24890.1|  Nitrate transporter 1.2 -like protein                   362   6e-113   
ref|XP_011042609.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       363   7e-113   
ref|XP_003551989.1|  PREDICTED: nitrate transporter 1.2-like            363   9e-113   
ref|XP_002970311.1|  hypothetical protein SELMODRAFT_411211             363   1e-112   
ref|XP_011007487.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    362   1e-112   
ref|XP_009766846.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       363   1e-112   
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       362   1e-112   
gb|KCW61417.1|  hypothetical protein EUGRSUZ_H04144                     362   2e-112   
gb|KHN19631.1|  Nitrate transporter 1.2                                 362   2e-112   
gb|KHN48660.1|  Nitrate transporter 1.2                                 362   3e-112   
ref|XP_002442038.1|  hypothetical protein SORBIDRAFT_08g007710          361   3e-112   
ref|XP_006579545.1|  PREDICTED: nitrate transporter 1.2-like isof...    362   3e-112   
ref|XP_010227181.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       373   3e-112   
ref|XP_010024892.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    362   3e-112   
ref|XP_010024893.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like...    362   3e-112   
ref|XP_002448097.1|  hypothetical protein SORBIDRAFT_06g021030          360   4e-112   
ref|XP_011080797.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       360   4e-112   
gb|KEH19843.1|  peptide/nitrate transporter plant                       361   5e-112   
ref|XP_006390956.1|  hypothetical protein EUTSA_v10018324mg             361   6e-112   
ref|XP_010112601.1|  Nitrate transporter 1.2                            361   7e-112   
emb|CDM81622.1|  unnamed protein product                                360   7e-112   
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                    360   8e-112   
ref|XP_009804530.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       362   8e-112   
ref|XP_009614193.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       360   9e-112   
ref|NP_001267691.1|  nitrate transporter 1.2-like                       361   1e-111   
ref|XP_009402913.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    360   1e-111   
gb|KGN63650.1|  hypothetical protein Csa_1G008560                       361   1e-111   
ref|XP_004301168.1|  PREDICTED: nitrate transporter 1.2-like            361   1e-111   
emb|CDP09643.1|  unnamed protein product                                358   1e-111   
ref|XP_008453176.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       361   1e-111   
ref|XP_009627419.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       360   1e-111   
ref|NP_001053171.1|  Os04g0491500                                       359   1e-111   
ref|XP_009403717.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    358   2e-111   
ref|XP_007155340.1|  hypothetical protein PHAVU_003G192800g             360   2e-111   
ref|XP_004960747.1|  PREDICTED: probable peptide/nitrate transpor...    359   2e-111   
ref|XP_002445162.1|  hypothetical protein SORBIDRAFT_07g005100          359   2e-111   
emb|CAD41354.1|  OSJNBa0076N16.17                                       359   2e-111   
ref|XP_002318610.2|  hypothetical protein POPTR_0012s07250g             359   2e-111   
ref|NP_001052876.1|  Os04g0441800                                       360   3e-111   
ref|XP_007154512.1|  hypothetical protein PHAVU_003G124800g             359   3e-111   
emb|CAH67347.1|  OSIGBa0130B08.7                                        358   4e-111   
ref|XP_004506789.1|  PREDICTED: peptide transporter PTR1-like iso...    358   5e-111   
ref|XP_011019153.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            358   5e-111   
ref|XP_010044085.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            358   5e-111   
ref|XP_010028891.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6            358   5e-111   
ref|XP_003542395.1|  PREDICTED: probable peptide/nitrate transpor...    358   7e-111   
ref|XP_011007488.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    357   8e-111   
ref|XP_003579814.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       358   9e-111   
ref|XP_004492413.1|  PREDICTED: peptide transporter PTR1-like iso...    357   1e-110   
tpg|DAA37185.1|  TPA: hypothetical protein ZEAMMB73_657087              355   1e-110   
ref|XP_004509943.1|  PREDICTED: nitrate transporter 1.2-like            357   2e-110   
dbj|BAJ91276.1|  predicted protein                                      357   3e-110   
ref|XP_002978475.1|  hypothetical protein SELMODRAFT_418377             356   3e-110   
ref|XP_001771110.1|  predicted protein                                  357   3e-110   
ref|XP_003613584.1|  Nitrate transporter NTL1                           356   4e-110   
gb|KDO76042.1|  hypothetical protein CISIN_1g008106mg                   356   4e-110   
ref|XP_002978476.1|  hypothetical protein SELMODRAFT_443914             356   4e-110   
ref|XP_010558361.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       356   4e-110   
emb|CDP14862.1|  unnamed protein product                                357   5e-110   
ref|XP_004137914.1|  PREDICTED: peptide transporter PTR5-like           355   5e-110   
ref|XP_008239599.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       355   5e-110   
ref|XP_004238766.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like...    355   5e-110   
gb|KEH32395.1|  peptide/nitrate transporter                             357   6e-110   
ref|XP_009773749.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6 isof...    356   8e-110   
ref|XP_007226671.1|  hypothetical protein PRUPE_ppa021364mg             355   8e-110   
ref|XP_002323559.2|  proton-dependent oligopeptide transport fami...    355   8e-110   
ref|XP_009773748.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6 isof...    356   9e-110   
ref|XP_004966021.1|  PREDICTED: nitrate transporter 1.2-like            355   9e-110   
ref|XP_002280835.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       356   1e-109   
gb|KDO53228.1|  hypothetical protein CISIN_1g0083672mg                  354   1e-109   
ref|XP_004238765.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       355   1e-109   
ref|XP_001781231.1|  predicted protein                                  355   1e-109   
ref|XP_011003661.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    354   2e-109   
ref|XP_007211275.1|  hypothetical protein PRUPE_ppa003360mg             355   2e-109   
ref|XP_009613364.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       355   2e-109   
ref|XP_011003660.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    354   2e-109   
ref|XP_009795638.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       354   2e-109   
ref|XP_002309120.2|  proton-dependent oligopeptide transport fami...    353   2e-109   
ref|XP_006429306.1|  hypothetical protein CICLE_v10011381mg             353   2e-109   
gb|AES91185.2|  peptide/nitrate transporter                             354   3e-109   
ref|XP_002280138.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       354   3e-109   
ref|XP_008456458.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       353   3e-109   
gb|EMT31661.1|  Peptide transporter PTR5                                353   3e-109   
ref|XP_007140383.1|  hypothetical protein PHAVU_008G107200g             353   3e-109   
gb|AES81567.2|  peptide transporter                                     354   4e-109   
ref|XP_003625349.1|  Peptide transporter PTR3-A                         354   4e-109   



>ref|XP_009800189.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like, partial [Nicotiana 
sylvestris]
Length=597

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/574 (72%), Positives = 485/574 (84%), Gaps = 4/574 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             +K +L++GKVDWRGR A KDKHGG   S  ILG F  ENMA++VLGVTLVTY NGVM+ +
Sbjct  1     DKTQLLEGKVDWRGRIATKDKHGGQGPSSLILGTFACENMASLVLGVTLVTYFNGVMHYD  60

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             +ADAA  VTN++G +YILT++ A+LADTYIGRF+AVLIS WIEFLGLGLLA QAHY K K
Sbjct  61    IADAATQVTNYSGTSYILTVLVAILADTYIGRFKAVLISCWIEFLGLGLLAFQAHYPKYK  120

Query  438   PPP-CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             PP  CN LD    CE+V G+NAA+LF+ALY VA+GSAG+K+A+PSHGADQFDE D+KE  
Sbjct  121   PPQNCNILDPTSTCEKVGGKNAALLFIALYLVALGSAGIKSALPSHGADQFDENDKKETL  180

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFNWLLL VC+GG++S T  VW+ ++KGWDWGF  ST+AMF GGI F LGLP+YR+
Sbjct  181   QMSSFFNWLLLAVCIGGSISTTFIVWIQENKGWDWGFFVSTMAMFLGGIIFCLGLPWYRI  240

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +VI+GSSAIT+I QV+VAA+ NR LQLPEDS +LYEI +DKEA  I AEFLPHTD Y+FL
Sbjct  241   FVIKGSSAITEIFQVYVAAVRNRNLQLPEDSADLYEIDEDKEA-AIPAEFLPHTDTYKFL  299

Query  975   DKAAIQTSWD--EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             DKAAIQTS    E PNPW++CRVTQVENAKILL+++PVF CT+IMTLCLAQLQTFSIQQG
Sbjct  300   DKAAIQTSQQQSETPNPWKLCRVTQVENAKILLSMIPVFCCTIIMTLCLAQLQTFSIQQG  359

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  IT  F I P+SLP +PI+FLI +IP+YD++ VP +R+ TGIPTGIT L RV VG
Sbjct  360   FTMDTRITNKFHIPPASLPIIPIIFLIIIIPIYDQIIVPILRKFTGIPTGITYLQRVGVG  419

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS+LSM AA+ILE+KRKQVAR+ NMLDAIPILQPLPISVFWLSIQ+FIFGIADMFTYV
Sbjct  420   LVLSALSMTAASILEVKRKQVARDNNMLDAIPILQPLPISVFWLSIQFFIFGIADMFTYV  479

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYSQAPKELKSVSSCFLW+SMSLGYF SS++VKVVN ATK +T SGGWL GNN N
Sbjct  480   GLLEFFYSQAPKELKSVSSCFLWTSMSLGYFLSSIVVKVVNKATKKITNSGGWLVGNNFN  539

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             RNHL LFY +L+ LS VNF +YL V+ RYKYR Q
Sbjct  540   RNHLNLFYLMLAVLSMVNFGIYLIVASRYKYRVQ  573



>ref|XP_009613830.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like, partial [Nicotiana 
tomentosiformis]
Length=597

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/574 (71%), Positives = 483/574 (84%), Gaps = 4/574 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             +K +L++GKVDWRGR A KDKHGG   S  ILG F  ENMA+ VLGVTLVTY NGVM+ +
Sbjct  1     DKTQLLEGKVDWRGRIATKDKHGGQGPSSLILGTFACENMASFVLGVTLVTYFNGVMHYD  60

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             +ADAA  VTN++G +YILT++ A+LADTYIGRF+AVLIS WIEFLGLGLLA QAHY K K
Sbjct  61    VADAATQVTNYSGTSYILTVLVAILADTYIGRFKAVLISCWIEFLGLGLLAFQAHYPKYK  120

Query  438   PPP-CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             PP  CN LD    CE+VAG+NAA LF+ALY VA+GSAGVK+A+PSHGADQFDE D+KE  
Sbjct  121   PPQNCNILDPTSTCEKVAGKNAAFLFIALYLVALGSAGVKSALPSHGADQFDENDKKEAL  180

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFNWLLL VC+GG++S T  VW+ ++KGWDWGF  ST+AMF G I F LGLP+YR+
Sbjct  181   QMSSFFNWLLLAVCIGGSISTTFIVWIQENKGWDWGFFVSTLAMFLGAIIFCLGLPWYRI  240

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +VI+GSSAIT+I QV+VAA+ NR LQLPEDS +LYEI++D EA  I AEFLPHT+ Y+FL
Sbjct  241   FVIKGSSAITEIFQVYVAAVRNRNLQLPEDSADLYEINEDNEA-AIPAEFLPHTNTYKFL  299

Query  975   DKAAIQTSWD--EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             DKAAIQ S    E+PNPW++CRVTQVENAKILL+++PVF CT+IMTLCLAQLQTFSIQQG
Sbjct  300   DKAAIQISQQQSEKPNPWKLCRVTQVENAKILLSMIPVFCCTIIMTLCLAQLQTFSIQQG  359

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  IT  F I P+SLP +PI+FLI +IP+YD++ VP +R+ TGIPTGIT L RV VG
Sbjct  360   FTMDTRITNKFHIPPASLPIIPIIFLIIIIPVYDQIIVPILRKFTGIPTGITYLQRVGVG  419

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS+LSM AA+ILE+KRKQVAR+ NMLDAIP+LQPLPISVFWLSIQ+FIFGIADMFTYV
Sbjct  420   LVLSALSMTAASILEVKRKQVARDNNMLDAIPVLQPLPISVFWLSIQFFIFGIADMFTYV  479

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYSQAPKELKSVSSCFLW+SMS+GYF SS++VK+VN AT+ +T SGGWL GNN N
Sbjct  480   GLLEFFYSQAPKELKSVSSCFLWTSMSIGYFLSSIVVKIVNKATQKITNSGGWLVGNNFN  539

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             RNHL LFY +L+ LS VNF +YL V+ RYKYR Q
Sbjct  540   RNHLNLFYLMLAVLSMVNFGIYLIVASRYKYRVQ  573



>ref|XP_010317511.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Solanum lycopersicum]
Length=605

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/579 (70%), Positives = 482/579 (83%), Gaps = 5/579 (1%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             + +++K EL++GKVDWRGR A KDKHGG   S+ ILG F  EN+A+ VLGVTLVTY NGV
Sbjct  3     MGARDKSELLEGKVDWRGRIATKDKHGGQGPSLLILGTFACENIASFVLGVTLVTYFNGV  62

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+ ++ADAA  VTN++G +YILT++ A+LADTYIGRF AV +S WIEFLGL LLA QAHY
Sbjct  63    MHYDVADAATQVTNYSGTSYILTVLVAILADTYIGRFTAVFVSCWIEFLGLALLAFQAHY  122

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              K KPP CN LD    CE+V G+NAA+LFVALY VA+GSAG+K+A+PSHGADQFDEKD+K
Sbjct  123   PKYKPPLCNILDPTSNCEKVDGKNAALLFVALYLVALGSAGIKSALPSHGADQFDEKDKK  182

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             E  +MSSFFNWLLL VC+GG+ S T  VW+ QHKGWDWGF  ST+AM  G I F +GLP+
Sbjct  183   EAIQMSSFFNWLLLAVCLGGSFSTTFIVWIQQHKGWDWGFFVSTLAMLCGAIIFCVGLPW  242

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             YR++VI+G+SAIT+I QV+VAAI NR LQLP+DS +LYEI +D+E V I  EFLPHTD Y
Sbjct  243   YRIFVIKGTSAITEIFQVYVAAIRNRNLQLPQDSSDLYEIDEDEE-VAIPTEFLPHTDTY  301

Query  966   RFLDKAA-IQTSWDEEP---NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTF  1133
             +FLDKAA IQTS  +     NPWR+CRVTQVENAKILL++VPVF CT+IMTLCLAQLQTF
Sbjct  302   KFLDKAAIIQTSQQQSKKAINPWRLCRVTQVENAKILLSMVPVFCCTIIMTLCLAQLQTF  361

Query  1134  SIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLH  1313
             SIQQG TMD  IT SF I P+SLP +PI+FLI +IP+YD++ VP +R+ TGIPTGIT L 
Sbjct  362   SIQQGFTMDTRITNSFHIPPASLPIIPIVFLIIIIPVYDQIIVPILRKFTGIPTGITYLQ  421

Query  1314  RVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIAD  1493
             RV VGL+LS+LSM AA+ILE+KRKQVA+E NMLDAIP+LQPLPISVFWLSIQ+FIFGIAD
Sbjct  422   RVGVGLVLSALSMTAASILEVKRKQVAQEHNMLDAIPVLQPLPISVFWLSIQFFIFGIAD  481

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             MFTYVGLLEFFYSQAPKELKSVSSCFLW+SMS+GYF SS++VK+VN ATK +T SGGWL 
Sbjct  482   MFTYVGLLEFFYSQAPKELKSVSSCFLWTSMSIGYFLSSIIVKIVNKATKKVTNSGGWLV  541

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             GNN NRNHL LFY +L+ LS +NF VYL V+ +YKYR Q
Sbjct  542   GNNFNRNHLNLFYLMLAVLSCLNFCVYLVVASKYKYRVQ  580



>ref|XP_006356126.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Solanum tuberosum]
Length=614

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/586 (69%), Positives = 481/586 (82%), Gaps = 9/586 (2%)
 Frame = +3

Query  57    NFLINSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYL  236
             N ++ + +K E+++GKVDWRGR A KDKHGG   S+ ILG F  EN+A+ VLGVTLVTY 
Sbjct  3     NEVLVAVDKSEVLEGKVDWRGRIATKDKHGGQGPSLLILGTFACENIASFVLGVTLVTYF  62

Query  237   NGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQ  416
             NGVM+ ++ADAA  VTN++G +YILT++ A+LADTYIGRF AV +S WIEFLGLGLLA Q
Sbjct  63    NGVMHYDVADAATQVTNYSGTSYILTVLVAILADTYIGRFTAVFVSCWIEFLGLGLLAFQ  122

Query  417   AHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEK  596
             AHY K KP  CN LD    CE+V G+NAA+LFVALY VA+GSAG+K+A+PSHGADQFDEK
Sbjct  123   AHYPKYKPTLCNILDPTSNCEKVDGKNAALLFVALYLVALGSAGIKSALPSHGADQFDEK  182

Query  597   DRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLG  776
             D+KE  +MSSFFNWLLL VC+GG+ S T  VW+ +HKGWDWGF  ST+AM  G I F +G
Sbjct  183   DKKEAIQMSSFFNWLLLAVCLGGSFSTTFIVWIQEHKGWDWGFFVSTLAMLCGAIIFCVG  242

Query  777   LPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHT  956
             LP+YR++VI+G SAIT+I QV+VAAI NR LQLP+DS  LYEI +D+EA  I AEFLPHT
Sbjct  243   LPWYRIFVIKGRSAITEIFQVYVAAIRNRNLQLPQDSSNLYEIDEDEEA-AIQAEFLPHT  301

Query  957   DKYRFLDKAA-IQTSWD-------EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLC  1112
             D Y+FLDKAA IQTS         +  NPWR+CRVTQVENAKILL++VPVF CT+IMTLC
Sbjct  302   DTYKFLDKAAIIQTSQQQQQQQSAKTINPWRLCRVTQVENAKILLSMVPVFCCTIIMTLC  361

Query  1113  LAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIP  1292
             LAQLQTFSIQQG TMD  IT SF I P+SLP +PI+FLI +IP+YD++ VP +R+ TGIP
Sbjct  362   LAQLQTFSIQQGFTMDTRITNSFHIPPASLPIIPIVFLIIIIPVYDQIIVPILRKFTGIP  421

Query  1293  TGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQY  1472
             TGIT L RV VGL+LS+LSM AA+ILE+KRKQVARE NMLDAIP+LQPLPISVFWLSIQ+
Sbjct  422   TGITYLQRVGVGLVLSALSMTAASILEVKRKQVAREHNMLDAIPVLQPLPISVFWLSIQF  481

Query  1473  FIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMT  1652
             FIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLW+SMS+GYF SS++VK+VN ATK +T
Sbjct  482   FIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWTSMSIGYFLSSIIVKIVNKATKKVT  541

Query  1653  ESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              SGGWL GNN NRNHL LFY +L+ L  +NF VYL V+ +YKYR Q
Sbjct  542   NSGGWLVGNNFNRNHLNLFYLMLAVLCCLNFCVYLVVASKYKYRVQ  587



>ref|XP_011101929.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Sesamum indicum]
Length=603

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/576 (69%), Positives = 473/576 (82%), Gaps = 5/576 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
              +K ELI+GKVDWRG+TA+KDKHGG RAS+ ILG F FENMAT+ L V LVTY   VM+ 
Sbjct  11    HDKAELIEGKVDWRGKTAQKDKHGGSRASLLILGAFTFENMATMALAVNLVTYFTEVMHF  70

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             N+ADAAN +TN+ G +YILTI+ A LADTYIGRF+ VL++  IE LGLGLLA+QAHY  L
Sbjct  71    NIADAANQLTNYMGTSYILTILMAFLADTYIGRFKTVLVATCIEALGLGLLALQAHYRHL  130

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPP CN  D   KC ++ G NAA+LFVALY VA+GS GVK+A+PSHGADQFD+KD +E  
Sbjct  131   KPPLCNIYDPNSKCIQLGGANAALLFVALYLVALGSGGVKSALPSHGADQFDDKDPEETK  190

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             + SSFFNWLLL VC+GGA+SLT FVW+  HKGWDWGFA STVAMFFG + F +GL  YR 
Sbjct  191   QKSSFFNWLLLAVCIGGAISLTFFVWIQDHKGWDWGFAVSTVAMFFGIVIFAVGLQQYRY  250

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +VI GSSA+T+I+QV+VAAI NRKL+LP+DS ELYEI++D EA    AEFL H+  +RFL
Sbjct  251   HVINGSSALTEILQVYVAAIRNRKLRLPQDSNELYEINRDSEAAN-QAEFLSHSSAFRFL  309

Query  975   DKAAIQTSWDEE---PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             DKAAIQTS   +   P+PW++CRVTQVENAKILLN+VP+F CT+IMTLCLAQLQTFSIQQ
Sbjct  310   DKAAIQTSLTPDTPRPSPWKLCRVTQVENAKILLNMVPIFCCTIIMTLCLAQLQTFSIQQ  369

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             G TMD +ITK F+I P+SLP +P+ FL+ ++P+YDR+FVP  R+ TGI TGIT L RV V
Sbjct  370   GVTMDTSITKHFKIPPASLPIIPVAFLVIIVPVYDRVFVPLARKFTGISTGITHLQRVGV  429

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQ-PLPISVFWLSIQYFIFGIADMFT  1502
             GL+LS LSMA AAI+E KRKQVA++ NMLDAIP+LQ P+PISVFWLS QYFIFGIADMFT
Sbjct  430   GLILSCLSMAVAAIVEHKRKQVAKDHNMLDAIPLLQPPIPISVFWLSFQYFIFGIADMFT  489

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
             YVGLLEFFYSQ P +LKS+SSCFLW+SM+LGYF S+++VK+VN ATK +T SGGWL GN 
Sbjct  490   YVGLLEFFYSQVPNDLKSISSCFLWTSMALGYFLSTIIVKIVNSATKDITRSGGWLAGNK  549

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             +NR HL LFY LLS LS +NF +YLFVS RYKYRQ+
Sbjct  550   INRGHLNLFYWLLSMLSLLNFCIYLFVSTRYKYRQE  585



>ref|XP_002522283.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF40141.1| nitrate transporter, putative [Ricinus communis]
Length=587

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/575 (67%), Positives = 467/575 (81%), Gaps = 4/575 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             EK E I+GKVDW+GR A K KHGG   S  +LG FGFE +A++ L V LVTY NG+M+  
Sbjct  3     EKLEFIEGKVDWKGRQAVKYKHGGTGTSFLVLGTFGFEELASVALAVNLVTYFNGIMHFE  62

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             +ADAAN +TNF GA YILTI+ A +ADTYIGR++AV++S ++E LGL +LA+QAH+ KLK
Sbjct  63    IADAANQLTNFMGAGYILTILVAFVADTYIGRWKAVILSGFLELLGLVVLAVQAHFPKLK  122

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PP CN  D    CE++ G +A +LFV LY VA GS G+KAA+PSHGADQFD++D KE  +
Sbjct  123   PPLCNVFDPTSHCEKIGGAHALLLFVGLYLVAFGSGGIKAALPSHGADQFDDRDAKESRQ  182

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFN LLL +CVGGA+SLTL VW+   KGWDWGF  S +AM  G I F+ GLP YR+ 
Sbjct  183   MSSFFNHLLLVICVGGAISLTLLVWVQDKKGWDWGFTFSALAMVLGLIMFSAGLPMYRIQ  242

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             ++Q SSAIT+IIQV+VAAI NRKLQ+PED  ELYEI+KDKEA  + AEF  HTD +RFLD
Sbjct  243   LVQKSSAITEIIQVYVAAIRNRKLQIPEDPSELYEINKDKEA-AMEAEFQFHTDTFRFLD  301

Query  978   KAAIQTSWDEEPN---PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             KAA+QT  +++P    PW++CRVTQVE AKI+L ++PVF CT+IMTLCLAQLQTFS+QQG
Sbjct  302   KAAVQTGQNKKPEAPIPWKLCRVTQVEKAKIILGMLPVFCCTIIMTLCLAQLQTFSVQQG  361

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              +MD  ITKSF I P+SLP +P LFLI +IP+YDRLFVP  R++TG P GIT L R+ VG
Sbjct  362   LSMDTRITKSFNIPPASLPIIPFLFLIVIIPIYDRLFVPFARKITGHPAGITHLQRIGVG  421

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LSS+SMA+AA++E KRKQVAR+ NMLDAIP+LQPLPISVFWLSIQYFIFGIADMFTYV
Sbjct  422   LILSSISMASAALMEGKRKQVARDHNMLDAIPVLQPLPISVFWLSIQYFIFGIADMFTYV  481

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYSQAPK +KS+S+CFLWSSM+LGYF S++LVK+VN ATK +T SGGWL GNN+N
Sbjct  482   GLLEFFYSQAPKGIKSISTCFLWSSMALGYFFSTILVKMVNSATKDITRSGGWLAGNNIN  541

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             RNHL LFY LLS LSF+NF  YLFV+KRYKYR QI
Sbjct  542   RNHLNLFYWLLSALSFINFCTYLFVAKRYKYRPQI  576



>ref|XP_003632975.2| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Vitis vinifera]
Length=596

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/578 (67%), Positives = 466/578 (81%), Gaps = 7/578 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             ++  EL++GKVDW+GRTA K+KHGG R S  IL  F  ENMAT+ L V LVTY NGVM+ 
Sbjct  2     EKGEELVEGKVDWKGRTAIKNKHGGQRFSSLILASFALENMATVALAVNLVTYFNGVMHF  61

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             ++ADAAN +TN+ G  YIL+IV A LAD YIGRF AVL+SA+IE +GLGLLA+QAHY KL
Sbjct  62    SIADAANELTNYMGTAYILSIVVAFLADAYIGRFYAVLVSAFIELVGLGLLAVQAHYPKL  121

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPP C   D    C++V G NAA+LFVALY VA G+AG+KAA+P+HGADQFDEKD +E  
Sbjct  122   KPPTCVIFDPTADCQQVHGGNAALLFVALYLVAAGTAGIKAALPTHGADQFDEKDPQEAM  181

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFN LLL +CVGGAVSLTL VW+  +KGWD GF   T+A+F   I F +GLP YR+
Sbjct  182   QMSSFFNGLLLALCVGGAVSLTLVVWIQDNKGWDKGFGVPTLAIFLAMIVFAVGLPRYRI  241

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +VIQG+SAIT+IIQV VA+  NRKL LP+D  ELYEI KDKEA T  AEFLPH D YRFL
Sbjct  242   HVIQGTSAITEIIQVLVASFRNRKLPLPDDPAELYEIDKDKEAAT-EAEFLPHRDIYRFL  300

Query  975   DKAAIQTSW------DEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
             DKAAIQT+        E PNPW++CRVTQVENAKI+  +VP+F CT+IMTLCLAQLQTFS
Sbjct  301   DKAAIQTTLLGNSDKPETPNPWKLCRVTQVENAKIIAGMVPIFCCTIIMTLCLAQLQTFS  360

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             I+QG TMD  +  SF I P+SLP LP++F+I LIP+YDR+FVP  R +TG+ TGIT L R
Sbjct  361   IEQGLTMDTRVANSFNIPPASLPILPVIFMIILIPVYDRIFVPYARGITGLRTGITHLQR  420

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADM  1496
             + VGL+LS++SMA +A++E  RK+VAR+ NMLDAIP+LQPLPISVFWLS QYFIFGIAD+
Sbjct  421   IGVGLVLSAISMATSAVMEALRKRVARDNNMLDAIPVLQPLPISVFWLSFQYFIFGIADL  480

Query  1497  FTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGG  1676
             FTYVGLLEFFYS+APK +KS+S+CFLWSSM+LGY+ S+V+V +VN ATKG+T SGGWL G
Sbjct  481   FTYVGLLEFFYSEAPKAIKSISTCFLWSSMALGYYFSTVVVNIVNRATKGITRSGGWLAG  540

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NN+NRNHL LFY LLS LS +NFFVYLFV+KRYKYR Q
Sbjct  541   NNINRNHLNLFYWLLSILSVINFFVYLFVAKRYKYRPQ  578



>ref|XP_011102252.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Sesamum indicum]
Length=604

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/576 (68%), Positives = 470/576 (82%), Gaps = 5/576 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
              +K ELI+GKVDWRG+TA+KDKHGG RAS+ ILG F FENMAT+ L V LVTY   VM+ 
Sbjct  12    HDKAELIEGKVDWRGKTAQKDKHGGSRASLLILGAFTFENMATMALAVNLVTYFTEVMHF  71

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             N+ADAAN +TN+ G +YILTI+ A LADTYIGRF+ VL++  IE LGLGLLA+QAHY  L
Sbjct  72    NIADAANQLTNYMGTSYILTILMAFLADTYIGRFKTVLVATCIEALGLGLLALQAHYRHL  131

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPP CN  D   KC ++ G NAA+LFVALY VA+GS GVK+A+PSHGADQFD+KD +E  
Sbjct  132   KPPLCNIYDPNSKCIQLGGANAALLFVALYLVALGSGGVKSALPSHGADQFDDKDPEETK  191

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             + SSFFNWLLL VC+GGA+SLT FVW+  HKGWDWGFA STVAMFFG + F +GL  YR 
Sbjct  192   QKSSFFNWLLLAVCIGGAISLTFFVWIQDHKGWDWGFAVSTVAMFFGIVIFAVGLQQYRY  251

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +VI GSSA+T+I+QV+VAAI NRKL+LP+DS ELYEI++D EA    AEFL H+  +RFL
Sbjct  252   HVINGSSALTEILQVYVAAIRNRKLRLPQDSNELYEINRDSEAAN-QAEFLSHSSAFRFL  310

Query  975   DKAAIQTSWDEE---PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             DKAAIQTS   +   P+PW++CR+TQVENAKILLN+VP+F CT+IMTLCLAQLQTFSIQQ
Sbjct  311   DKAAIQTSLAPDTPRPSPWKLCRITQVENAKILLNMVPIFCCTIIMTLCLAQLQTFSIQQ  370

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             G TMD +ITK F+I P+SLP +P+ FL+ ++P+YDR+FVP  R    I TGIT L RV V
Sbjct  371   GVTMDTSITKHFKIPPASLPIIPVAFLVIIVPVYDRVFVPLARNSQAISTGITHLQRVGV  430

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQ-PLPISVFWLSIQYFIFGIADMFT  1502
             GL+LS LSMA AAI+E KRKQVA++ NMLDAIP+LQ P+PISVFWLS QYFIFGIADMFT
Sbjct  431   GLILSCLSMAVAAIVEHKRKQVAKDHNMLDAIPLLQPPIPISVFWLSFQYFIFGIADMFT  490

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
             YVGLLEFFYSQ P +LKS+SSCFLW+SM+LGYF S+++VK+VN ATK +T SGGWL GN 
Sbjct  491   YVGLLEFFYSQVPNDLKSISSCFLWTSMALGYFLSTIIVKIVNSATKDITRSGGWLAGNK  550

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             +NR HL LFY LLS LS +NF +YLFVS RYKYRQ+
Sbjct  551   INRGHLNLFYWLLSILSLLNFCIYLFVSTRYKYRQE  586



>ref|XP_004295409.1| PREDICTED: nitrate transporter 1.2-like [Fragaria vesca subsp. 
vesca]
Length=589

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/573 (66%), Positives = 458/573 (80%), Gaps = 6/573 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             ++K E ++GKVDW+GR A K KHGG+R +  IL  FGFENMAT+ L V LVTY NGVM+ 
Sbjct  4     EKKIEFVEGKVDWKGRAAVKQKHGGMRTAFLILATFGFENMATLALAVNLVTYFNGVMHF  63

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              ++DAAN +TNFAG  YIL+I  A++AD+++GRF+ +LISA  EFLGL LL +QAHY KL
Sbjct  64    EISDAANQLTNFAGTGYILSIAMAIVADSFLGRFKTLLISASFEFLGLALLTVQAHYPKL  123

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             +PP CN  D    CE+V+G NAA+LF+ALY +A G+AGVKA +PSHGADQF+EKD KE  
Sbjct  124   QPPICNVFDPTASCEKVSGGNAALLFIALYMLAAGAAGVKATLPSHGADQFEEKDPKEAQ  183

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFN LLL VC+GG VSLTL VW+  ++GWDWGF  ST+AMF G + F  GLP YR+
Sbjct  184   QMSSFFNMLLLAVCLGGVVSLTLIVWIQDNRGWDWGFGISTIAMFLGVVVFFSGLPMYRI  243

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
               +QG+SA+ + IQV+VAAI NR L LP D  +LYEI  DKEA +I  EFLPH   + FL
Sbjct  244   QAVQGTSALIETIQVYVAAIRNRNLTLPSDPSDLYEIDTDKEA-SIEEEFLPHRPVFGFL  302

Query  975   DKAAI---QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             DKAA+   Q    E  NPW++CRVTQVENAKILL +VP+FLCT+IMTLCLAQLQTFSIQQ
Sbjct  303   DKAAVKRGQNDNRESVNPWKLCRVTQVENAKILLGMVPIFLCTIIMTLCLAQLQTFSIQQ  362

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             G TMD ++TK F+I P+SLP +PI+FL+ +IP+YDR+FVP   + TGIP+GIT L R+ V
Sbjct  363   GVTMDTSVTKHFKIPPASLPIIPIMFLVIIIPVYDRIFVPLASKFTGIPSGITHLQRIGV  422

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTY  1505
             GL+LS +SM  A I+E+KRK VAR+ NMLDAIP+LQPLPIS FWLS QYFIFGIADMFTY
Sbjct  423   GLVLSCVSMGVAGIMEVKRKDVARDHNMLDAIPVLQPLPISTFWLSFQYFIFGIADMFTY  482

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             VGLLEFFYS+APK LKS+S+CFLWSSM+LGYF S+VLVK+VN AT G   +GGWL GNN+
Sbjct  483   VGLLEFFYSEAPKGLKSISTCFLWSSMALGYFFSTVLVKIVNAATHG--SNGGWLAGNNI  540

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             NRNHL LFY LLSG+SF+NFFVYLFVS+RYKYR
Sbjct  541   NRNHLNLFYWLLSGMSFLNFFVYLFVSRRYKYR  573



>ref|XP_006468198.1| PREDICTED: nitrate transporter 1.2-like [Citrus sinensis]
Length=624

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/577 (65%), Positives = 462/577 (80%), Gaps = 7/577 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             E  EL++GKVDW+GR A K KHGGI+ S+ IL  FGFEN+ATI LGV LVTY NGV++++
Sbjct  32    ENLELVEGKVDWKGRPAVKYKHGGIKTSLLILAAFGFENLATIALGVNLVTYFNGVLHLD  91

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LA+AAN VTN+ G +YIL+IV A+LAD +IGRF+AVLIS  +EFLGL L+ +QAHY  LK
Sbjct  92    LAEAANQVTNYMGTSYILSIVVALLADAFIGRFKAVLISGSVEFLGLALITIQAHYPDLK  151

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PPPCN  D    C+++ G +AA+LFVALY +A G+AG+KAA+P +GADQFDEKD  E  +
Sbjct  152   PPPCNVFDPTAGCKKIEGSDAALLFVALYLIATGTAGIKAALPPYGADQFDEKDPIEARQ  211

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFN L L VC+GGA+S+TL VW+  +KGWD GF  S+VA+F   I F  GLP YR  
Sbjct  212   MSSFFNLLFLAVCIGGAISVTLIVWIQDNKGWDRGFGLSSVAVFLATIIFAAGLPLYRFQ  271

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             V+QGSS + +IIQV+VAAI NRKL+LPED  ELYEI+ DKEA  I  EFLPH D +RFLD
Sbjct  272   VVQGSSVLIEIIQVYVAAIRNRKLELPEDPMELYEINMDKEA-AIETEFLPHRDIFRFLD  330

Query  978   KAAIQTSWDEE------PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSI  1139
             KAAIQ +  E       PNPW++CRVTQVENAKI+L ++P+F CT++MTLCLAQLQTFSI
Sbjct  331   KAAIQKTSTENLEITEAPNPWKLCRVTQVENAKIILGMIPIFCCTIVMTLCLAQLQTFSI  390

Query  1140  QQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRV  1319
             QQG TMD ++T SF I P+SLP LPILF+I  +P+YDR+FVP   ++TG PTGIT L RV
Sbjct  391   QQGLTMDTSVTTSFHIPPASLPILPILFMILAVPVYDRIFVPFAGKITGNPTGITHLQRV  450

Query  1320  AVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMF  1499
              VGL+LS +SMA AAI E+ RK VAR+ NMLDAIP++QPLPIS FWLSIQ+FIFGIADMF
Sbjct  451   GVGLVLSCISMAIAAIFEVIRKDVARDHNMLDAIPVVQPLPISTFWLSIQFFIFGIADMF  510

Query  1500  TYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGN  1679
             TYVGLLEFFYS+APK +KS+S+CFLW SM+LGYF S++LV +VN AT+G+T+SGGWL GN
Sbjct  511   TYVGLLEFFYSEAPKGIKSLSTCFLWCSMALGYFFSTILVNIVNSATRGITQSGGWLAGN  570

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             N+NRNHL LF+ LLS LSF+NF VYLF+S RY YR Q
Sbjct  571   NINRNHLNLFFWLLSALSFINFSVYLFMSSRYNYRPQ  607



>ref|XP_011009674.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Populus euphratica]
Length=597

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/575 (67%), Positives = 470/575 (82%), Gaps = 4/575 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QEK E ++GKVDW+GR A K+KHGG+  S+ IL +F  E++ATI L V  VTY NGVM+ 
Sbjct  2     QEKLEFVEGKVDWKGRQALKNKHGGLWTSLLILVMFALESLATISLAVNFVTYFNGVMHF  61

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              +ADAAN VTN+ G +YIL+IVAAVLADT  GR R  +IS  +E +GL LLA QAHYA+L
Sbjct  62    QIADAANMVTNYMGVSYILSIVAAVLADTLFGRHRTAVISGCLELMGLSLLAFQAHYARL  121

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPPPCN LD    CE+V G NA +LFVAL+ +A GS+G+KA+VPSHGADQFDEKD KE  
Sbjct  122   KPPPCNILDPTAHCEKVGGGNAVLLFVALFVLAAGSSGIKASVPSHGADQFDEKDPKELI  181

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSS+FN++LL VC+G AVSLT+FVW+  +KGWDWGF    ++M    I F  GLP +R+
Sbjct  182   QMSSYFNFVLLAVCLGAAVSLTVFVWIQDNKGWDWGFGVGAISMLLAVIIFIAGLPMHRI  241

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +V+QGSS + +I+QV+VAA  NRKLQLPED  +LYEI+KDKEA  I AEFLPH D  RFL
Sbjct  242   HVVQGSSTVVEILQVYVAAFRNRKLQLPEDPLDLYEINKDKEA-AIEAEFLPHRDTLRFL  300

Query  975   DKAAIQTS---WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             DKAAIQTS   + E PNPW++CRVTQVENAKILL+++PVF CT+IMTLCLAQLQTFSIQQ
Sbjct  301   DKAAIQTSTEKFSEAPNPWKLCRVTQVENAKILLSVLPVFSCTIIMTLCLAQLQTFSIQQ  360

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             G TMD +ITKSF + P+SLP +P++FLI L+P+YDRL VP  R+ TG+PTGIT L R+ V
Sbjct  361   GLTMDTSITKSFNVPPASLPIIPVIFLIILVPIYDRLVVPFARKFTGLPTGITHLQRIGV  420

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTY  1505
             GL+LSS+SMA+AA++E+KRK VAR+ NMLDAIP+LQPLPIS FW+SIQ+FIFGIADMFTY
Sbjct  421   GLILSSISMASAALMEVKRKDVARDHNMLDAIPVLQPLPISTFWISIQFFIFGIADMFTY  480

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             VGLLEFFYS+APK LKS+SSCFLWSSM+LGYF S++LV +VNG TKG T+SGGWL GNN+
Sbjct  481   VGLLEFFYSEAPKGLKSISSCFLWSSMALGYFLSTILVNIVNGVTKGSTKSGGWLAGNNI  540

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NRN+L LFY LLS LSF+NF  YLFV++RYKY+ Q
Sbjct  541   NRNNLNLFYWLLSILSFINFCAYLFVARRYKYKPQ  575



>ref|XP_010054300.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Eucalyptus grandis]
Length=604

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/582 (64%), Positives = 459/582 (79%), Gaps = 8/582 (1%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             ++  +K EL+ GKVDW+GRTA K KHGG+R  + IL  FGFE MATI L V LVTY NGV
Sbjct  19    LHDWDKPELVQGKVDWKGRTALKHKHGGMRIGLLILATFGFEQMATIALAVNLVTYFNGV  78

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             ++ ++AD+AN +TNF G++ IL+IV A LAD YIGRF A L+S  +EFL L LL +QAHY
Sbjct  79    LHFDIADSANELTNFLGSSNILSIVVAALADIYIGRFNATLLSGCVEFLALALLTVQAHY  138

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
               L+PP CN  D   +CE+V G NAA+ F+ALY +A GSAG+KAA+P+HGADQFDEKD +
Sbjct  139   PGLRPPTCNIFDPTSQCEKVGGGNAALFFIALYLLAAGSAGIKAALPTHGADQFDEKDPR  198

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             E  +MSSFFN+LLL VC+GGA SLTL VW+  +KGWDWGF  ST+AMF G + FTLGLP+
Sbjct  199   EVGDMSSFFNFLLLIVCLGGAASLTLIVWIQDNKGWDWGFGISTIAMFLGVVLFTLGLPW  258

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             +R+  IQG+SAI +I QVFVAAI NRK  LPED  ELYEI +D EA     EFLPH D +
Sbjct  259   HRIQPIQGTSAIVEIFQVFVAAIRNRKFPLPEDPVELYEIDRDAEAAG-DKEFLPHRDTF  317

Query  966   RFLDKAAIQTS------WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             RFLDKAA++ +        E PNPW++CR+TQVENAKI+L +VP+F CT+IMTLCLAQLQ
Sbjct  318   RFLDKAAVKETPTLPHRQSESPNPWKLCRMTQVENAKIVLGMVPIFCCTIIMTLCLAQLQ  377

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFSIQQG TM+ +I    +I P+SLP +P+ FLI ++P+YDRL VP  R++TG PTGIT 
Sbjct  378   TFSIQQGLTMETSIGS-SKIPPASLPIVPVSFLIIIVPVYDRLIVPFARKITGHPTGITH  436

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+ VGL+LSSLSMA AAI+E+KRK+VAR+  MLDA+P+ QPLPISVFWLS QYFIFGI
Sbjct  437   LQRIGVGLVLSSLSMAMAAIMEVKRKKVARDHGMLDAMPVAQPLPISVFWLSFQYFIFGI  496

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ADMFTY+GLLEFFYS+AP+ LKS+S+CFLW SM+LGYF SS+LVK+VN ATKG+T SGGW
Sbjct  497   ADMFTYIGLLEFFYSEAPEGLKSLSTCFLWCSMALGYFFSSILVKIVNKATKGVTRSGGW  556

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             L GNN+NRNHL LFY LLS LS  NF VYL  ++RYKYR +I
Sbjct  557   LAGNNINRNHLNLFYLLLSILSISNFLVYLVAARRYKYRPRI  598



>ref|XP_002305708.2| hypothetical protein POPTR_0004s06290g [Populus trichocarpa]
 gb|EEE86219.2| hypothetical protein POPTR_0004s06290g [Populus trichocarpa]
Length=597

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/575 (67%), Positives = 465/575 (81%), Gaps = 4/575 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QEK E ++GKVDW+GR A K+KHGG+ AS+ IL +F  E+MATI L V  VTY NGVM+ 
Sbjct  2     QEKLEFVEGKVDWKGRQALKNKHGGLWASLLILVMFALESMATISLAVNFVTYFNGVMHF  61

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              +ADAAN VTN+ G +YIL+IVAAVLADT  GR R  +IS  +E +GL LLA QAHYAKL
Sbjct  62    QIADAANMVTNYMGVSYILSIVAAVLADTLFGRHRTAVISGCLELMGLSLLAFQAHYAKL  121

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPPPCN LD    CE+V G N  +LFV+L+ +A GS+G KA+VPSHGADQFDEKD KE  
Sbjct  122   KPPPCNILDPTAHCEKVGGGNIVLLFVSLFVLAAGSSGTKASVPSHGADQFDEKDPKELI  181

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSS+FN++LL VC+G AVSLT FVW+  +KGWDWGF    ++M    I F  GLP +R+
Sbjct  182   QMSSYFNFVLLAVCLGAAVSLTFFVWIQDNKGWDWGFGVGAISMLLAVIVFIAGLPMHRI  241

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +V+QGSS + +I+QV+VAA  NRKLQLPED  +LYEI+KDKEA  I AE LPH D  RFL
Sbjct  242   HVVQGSSTVVEILQVYVAAFRNRKLQLPEDPLDLYEINKDKEA-AIEAESLPHRDTLRFL  300

Query  975   DKAAIQTS---WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             DKAAIQTS   + E PNPW++CRVTQVENAKILL+++PVF CT+IMTLCLAQLQTFSIQQ
Sbjct  301   DKAAIQTSTEKFSEAPNPWKLCRVTQVENAKILLSILPVFSCTIIMTLCLAQLQTFSIQQ  360

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             G TMD +ITKSF I P+SLP +P++FLI L+PLYDRL VP  R+ TG+PTGIT L R+ V
Sbjct  361   GLTMDTSITKSFNIPPASLPIIPVIFLIILVPLYDRLVVPFARKFTGLPTGITHLQRIGV  420

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTY  1505
             GL+LSS+SMA+AA++E+KRK VAR+ NMLDAIP+LQPLPIS  W+SIQ+FIFGIADMFTY
Sbjct  421   GLILSSISMASAALMEVKRKDVARDHNMLDAIPVLQPLPISTLWISIQFFIFGIADMFTY  480

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             VGLLEFFYS+APK LKS+S+CFLW SM+LGYF S++LV +VNG TKG T+SGGWL GNN+
Sbjct  481   VGLLEFFYSEAPKGLKSISTCFLWCSMALGYFLSTILVNIVNGVTKGSTKSGGWLAGNNI  540

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NRN+L LFY LLS LSF+NF VYLFV++RY YR Q
Sbjct  541   NRNNLNLFYWLLSILSFLNFCVYLFVARRYTYRPQ  575



>emb|CBI30755.3| unnamed protein product [Vitis vinifera]
Length=1252

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/574 (67%), Positives = 464/574 (81%), Gaps = 7/574 (1%)
 Frame = +3

Query  87    ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLAD  266
             EL++GKVDW+GRTA K+KHGG R S  IL  F  ENMAT+ L V LVTY NGVM+ ++AD
Sbjct  662   ELVEGKVDWKGRTAIKNKHGGQRFSSLILASFALENMATVALAVNLVTYFNGVMHFSIAD  721

Query  267   AANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPP  446
             AAN +TN+ G  YIL+IV A LAD YIGRF AVL+SA+IE +GLGLLA+QAHY KLKPP 
Sbjct  722   AANELTNYMGTAYILSIVVAFLADAYIGRFYAVLVSAFIELVGLGLLAVQAHYPKLKPPT  781

Query  447   CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             C   D    C++V G NAA+LFVALY VA G+AG+KAA+P+HGADQFDEKD +E  +MSS
Sbjct  782   CVIFDPTADCQQVHGGNAALLFVALYLVAAGTAGIKAALPTHGADQFDEKDPQEAMQMSS  841

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFN LLL +CVGGAVSLTL VW+  +KGWD GF   T+A+F   I F +GLP YR++VIQ
Sbjct  842   FFNGLLLALCVGGAVSLTLVVWIQDNKGWDKGFGVPTLAIFLAMIVFAVGLPRYRIHVIQ  901

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA  986
             G+SAIT+IIQV VA+  NRKL LP+D  ELYEI KDKEA T  AEFLPH D YRFLDKAA
Sbjct  902   GTSAITEIIQVLVASFRNRKLPLPDDPAELYEIDKDKEAAT-EAEFLPHRDIYRFLDKAA  960

Query  987   IQTSW------DEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             IQT+        E PNPW++CRVTQVENAKI+  +VP+F CT+IMTLCLAQLQTFSI+QG
Sbjct  961   IQTTLLGNSDKPETPNPWKLCRVTQVENAKIIAGMVPIFCCTIIMTLCLAQLQTFSIEQG  1020

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  +  SF I P+SLP LP++F+I LIP+YDR+FVP  R +TG+ TGIT L R+ VG
Sbjct  1021  LTMDTRVANSFNIPPASLPILPVIFMIILIPVYDRIFVPYARGITGLRTGITHLQRIGVG  1080

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS++SMA +A++E  RK+VAR+ NMLDAIP+LQPLPISVFWLS QYFIFGIAD+FTYV
Sbjct  1081  LVLSAISMATSAVMEALRKRVARDNNMLDAIPVLQPLPISVFWLSFQYFIFGIADLFTYV  1140

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYS+APK +KS+S+CFLWSSM+LGY+ S+V+V +VN ATKG+T SGGWL GNN+N
Sbjct  1141  GLLEFFYSEAPKAIKSISTCFLWSSMALGYYFSTVVVNIVNRATKGITRSGGWLAGNNIN  1200

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             RNHL LFY LLS LS +NFFVYLFV+KRYKYR Q
Sbjct  1201  RNHLNLFYWLLSILSVINFFVYLFVAKRYKYRPQ  1234



>ref|XP_007025262.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY27884.1| Major facilitator superfamily protein [Theobroma cacao]
Length=692

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/581 (65%), Positives = 454/581 (78%), Gaps = 5/581 (1%)
 Frame = +3

Query  51    LFNFLINSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVT  230
             LFN L+   EK E+++GKVDW+G+ A K KHGG+RA++FIL  F FENMA + L V LVT
Sbjct  98    LFNLLL---EKLEVVEGKVDWKGKAAVKYKHGGMRAALFILVTFAFENMANLHLAVNLVT  154

Query  231   YLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLA  410
             + NG+++  +ADAAN +TNF G  YIL+I+  VLAD+YIGRF+ VLIS  IEFLGL LL+
Sbjct  155   FFNGILHFEIADAANALTNFMGTGYILSILFGVLADSYIGRFKTVLISGSIEFLGLALLS  214

Query  411   MQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFD  590
             +QAH+  LKP  CN  D    CE++   +AA L++ALY VA G+ G+KAAVPSHGADQFD
Sbjct  215   VQAHFPSLKPSACNVFDPTSHCEKIKRGDAAFLYIALYLVAAGTGGIKAAVPSHGADQFD  274

Query  591   EKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFT  770
             EKD +E   MSSFFN LLL VC+GGAVSLTL VW+  HKGWD GF  S +AM  G I   
Sbjct  275   EKDSREAKHMSSFFNLLLLAVCLGGAVSLTLIVWVDDHKGWDLGFMVSAIAMVLGVIIAV  334

Query  771   LGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLP  950
              G P YR++++QG+S I +IIQV+VAAI NR LQLPE+  ELYEI KDKEA  + A+ LP
Sbjct  335   AGWPLYRIHIVQGTSVIVEIIQVYVAAIRNRNLQLPENPLELYEIDKDKEA-AVEADLLP  393

Query  951   HTDKYRFLDKAAIQT-SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             H + YRFLDKAAIQT S  + PNPW++CRVTQVENAKI+  ++PVF CT+IMTLCLAQLQ
Sbjct  394   HRNVYRFLDKAAIQTASTAQSPNPWKLCRVTQVENAKIIFGMIPVFACTIIMTLCLAQLQ  453

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFS+QQG TMD  I  SF I P+SLP +P+ FLI ++P YD++ VP +RR TG PTGIT 
Sbjct  454   TFSVQQGLTMDTTIVGSFHIPPASLPIIPVGFLIIIVPFYDQIVVPLLRRFTGHPTGITH  513

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+ VGL+LSS+SMA AAI+E+KRK VAR+ NMLDAIP+LQPLPI  FWLS QYFIFGI
Sbjct  514   LQRIGVGLILSSISMAVAAIMEVKRKAVARDHNMLDAIPVLQPLPIRTFWLSFQYFIFGI  573

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ADMFTYVGLLEFFYS+APK LK+VS+CFLWSSM+LGY+ SS+LVK+VN ATK  T S GW
Sbjct  574   ADMFTYVGLLEFFYSEAPKGLKTVSTCFLWSSMALGYYLSSILVKIVNRATKDNTNSRGW  633

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L GNN+NRNHL LFY LLS LS  NF VYLFV+ RYKYR +
Sbjct  634   LAGNNINRNHLNLFYLLLSVLSLANFIVYLFVASRYKYRSE  674



>ref|XP_006449569.1| hypothetical protein CICLE_v10017858mg [Citrus clementina]
 gb|ESR62809.1| hypothetical protein CICLE_v10017858mg [Citrus clementina]
Length=1143

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/578 (65%), Positives = 464/578 (80%), Gaps = 7/578 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             +E  EL++GKVDW+GR A K KHGGI+ S+ IL  FGFEN+ATI LGV LVTY NGV+++
Sbjct  550   RENLELVEGKVDWKGRPAVKYKHGGIKTSLLILAAFGFENLATIALGVNLVTYFNGVLHL  609

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             +LA+AAN VTN+ G +YIL+IV A+LAD +IGRF+AVLIS  +EFLGL L+ +QAHY  L
Sbjct  610   DLAEAANQVTNYMGTSYILSIVVALLADAFIGRFKAVLISGSVEFLGLALITIQAHYPDL  669

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPPPCN  D    C+++ G +AA+LFVALY +A G+AG+KAA+P +GADQFDEKD  E  
Sbjct  670   KPPPCNVFDPTAGCKKIEGSDAALLFVALYLIATGTAGIKAALPPYGADQFDEKDPIEAR  729

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFN L L VC+GGA+S+TL VW+  +KGWD GF  S+VA+F   I F  GLP YR 
Sbjct  730   QMSSFFNLLFLAVCIGGAISVTLIVWIQDNKGWDRGFGLSSVAVFLATIIFAAGLPLYRF  789

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
              V+QGSS + +IIQV+VAAI NRKL+LPED  ELYEI+ DKEA  I  EFLPH D +RFL
Sbjct  790   QVVQGSSVLIEIIQVYVAAIRNRKLELPEDPMELYEINMDKEA-AIETEFLPHRDIFRFL  848

Query  975   DKAAIQTSWDEE------PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
             DKAAIQ +  E       PNPW++CRVTQVENAKI+L ++P+F CT++MTLCLAQLQTFS
Sbjct  849   DKAAIQKTSTENLEITEAPNPWKLCRVTQVENAKIILGMIPIFCCTIVMTLCLAQLQTFS  908

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             IQQG TMD ++T SF I P+SLP LPILF+I  +P+YDR+FVP  R++TG PTGIT L R
Sbjct  909   IQQGLTMDTSVTTSFHIPPASLPILPILFMILAVPVYDRIFVPFARKITGNPTGITHLQR  968

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADM  1496
             V VGL+LS +SMA AA+ E+ RK VAR+ NMLDAIP++QPLPIS FWLSIQ+FIFGIADM
Sbjct  969   VGVGLVLSCISMAIAAVFEVIRKDVARDHNMLDAIPVVQPLPISTFWLSIQFFIFGIADM  1028

Query  1497  FTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGG  1676
             FTYVGLLEFFYS+APK +KS+S+CFLW SM+LGYF S++LV +VN AT+G+T+SGGWL G
Sbjct  1029  FTYVGLLEFFYSEAPKGIKSLSTCFLWCSMALGYFFSTILVNIVNSATRGITQSGGWLAG  1088

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NN+NRNHL LF+ LLS LSF+NF VYLF+S RY YR Q
Sbjct  1089  NNINRNHLNLFFWLLSALSFINFSVYLFMSSRYNYRPQ  1126



>ref|XP_007213595.1| hypothetical protein PRUPE_ppa002462mg [Prunus persica]
 gb|EMJ14794.1| hypothetical protein PRUPE_ppa002462mg [Prunus persica]
Length=670

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/578 (66%), Positives = 464/578 (80%), Gaps = 7/578 (1%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
              S +K EL++GKVDW+GR+A K KHGG+R ++ IL  FGFENMAT  L V LVTY NGVM
Sbjct  78    RSMDKLELVEGKVDWKGRSAVKYKHGGMRTAVLILATFGFENMATFALAVNLVTYFNGVM  137

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             +  LADAAN +TN+ G  YIL+I+ A+LADT+ GRF+A+L S   EF+GL LL +QAHY 
Sbjct  138   HFELADAANQLTNYMGTGYILSIIVAILADTFFGRFKALLTSGCFEFVGLALLTVQAHYP  197

Query  429   KLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKE  608
             KL+PP CN  D    CE+V G NAA+LF+ALY +A G+AG+KA +PSHGADQFDEKD +E
Sbjct  198   KLRPPLCNVFDPTAMCEKVGGGNAALLFIALYMLAAGAAGIKATLPSHGADQFDEKDPRE  257

Query  609   GSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFY  788
               +MSSFFN LLL VC+GGAVSLTL VW+  ++GWDWGF +ST+AMF G + F  GLP Y
Sbjct  258   ARQMSSFFNLLLLAVCLGGAVSLTLIVWIQDNRGWDWGFGSSTIAMFLGVVIFFAGLPLY  317

Query  789   RVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYR  968
             R+  I+G+SAI +IIQV+VAAI NR L LPED  +LYEI+KDKEA  +  EFLPH   +R
Sbjct  318   RIQPIRGTSAIVEIIQVYVAAIRNRNLSLPEDPADLYEINKDKEA-ALEEEFLPHRSIFR  376

Query  969   FLDKAAIQTSW----DEE--PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
             FLDKAAIQ S     DE+  PNPW++CRVTQVENAKI+L +VP+F CT+IMTLCLAQLQT
Sbjct  377   FLDKAAIQPSTTGQVDEQQPPNPWKLCRVTQVENAKIILGMVPIFGCTIIMTLCLAQLQT  436

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FSIQQG TMD +ITKSF+I P+SLP +P+LFLI +IP+YDR+FVP   + TGIP+GIT L
Sbjct  437   FSIQQGLTMDTSITKSFKIPPASLPIIPVLFLIIIIPVYDRIFVPIASKFTGIPSGITHL  496

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIA  1490
              R+ VGL+LS +SMA A I+E+KRK VAR+ NML A P+LQPLPIS FWLS QYFIFGIA
Sbjct  497   QRIGVGLILSCVSMAVAGIMEVKRKDVARDHNMLLARPVLQPLPISTFWLSFQYFIFGIA  556

Query  1491  DMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWL  1670
             D+FTYVGLLEFFYS+AP  LKS+S+CFLWSSM+LGYF S++LVK+VNGATK +T SGGWL
Sbjct  557   DLFTYVGLLEFFYSEAPMGLKSISTCFLWSSMALGYFFSTILVKIVNGATKDVTRSGGWL  616

Query  1671  GGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
              GNN+N NHL LFY LLS +S +NF VY+FV+KRYKYR
Sbjct  617   AGNNINLNHLNLFYWLLSFMSLINFIVYVFVAKRYKYR  654



>ref|XP_008225414.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Prunus mume]
 ref|XP_008231692.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Prunus mume]
Length=670

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/578 (66%), Positives = 462/578 (80%), Gaps = 7/578 (1%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
              S +K EL++GKVDW+GR+A K KHGG+R ++ IL  FGFENMAT  L V LVTY NGVM
Sbjct  78    RSMDKLELVEGKVDWKGRSAVKYKHGGMRTAVLILATFGFENMATFALAVNLVTYFNGVM  137

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             +  LADAAN +TN+ G  YIL+I+ A+LADT+ GRF+ +L S   EF+GL LL +QAHY 
Sbjct  138   HFELADAANQLTNYMGTGYILSIIVAILADTFFGRFKTLLTSGCFEFVGLALLTVQAHYP  197

Query  429   KLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKE  608
             KL+PP CN  D    CE+V G NAA+LF+ALY +A G+AG+KA +PSHGADQFDEKD +E
Sbjct  198   KLRPPLCNVFDPTAMCEKVGGGNAALLFIALYILAAGAAGIKATLPSHGADQFDEKDPRE  257

Query  609   GSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFY  788
               +MSSFFN LLL VC+GGAVSLTL VW+  ++GWDWGF  ST+AMF G + F  GLP Y
Sbjct  258   ARQMSSFFNLLLLAVCLGGAVSLTLIVWIQDNRGWDWGFGFSTIAMFLGVVIFFAGLPLY  317

Query  789   RVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYR  968
             R+  I+G+SAI +IIQV+VAAI NR L LPED  +LYEI+KDKEA  +  EFLPH   +R
Sbjct  318   RIQPIKGTSAIVEIIQVYVAAIRNRNLSLPEDPADLYEINKDKEA-ALEEEFLPHRSIFR  376

Query  969   FLDKAAIQTSW----DEE--PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
             FLDKAAIQ S     DE+  PNPW++CRVTQVENAKI+L +VP+F CT+IMTLCLAQLQT
Sbjct  377   FLDKAAIQPSTTGQVDEQQPPNPWKLCRVTQVENAKIILGMVPIFGCTIIMTLCLAQLQT  436

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FSIQQG TMD +ITKSF+I P+SL  +P+LFLI +IP+YDR+FVP   ++TGIP+GIT L
Sbjct  437   FSIQQGLTMDTSITKSFKIPPASLSIIPVLFLIIIIPVYDRIFVPIASKITGIPSGITHL  496

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIA  1490
              RV VGL+LS +SMA A I+E+KRK VAR+ NML A P+LQPLPIS FWLS QYFIFGIA
Sbjct  497   QRVGVGLILSCVSMAVAGIMEVKRKDVARDHNMLLARPVLQPLPISTFWLSFQYFIFGIA  556

Query  1491  DMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWL  1670
             D+FTYVGLLEFFYS+AP  LKS+S+CFLWSSM+LGYF S++LVK+VNGATK +T SGGWL
Sbjct  557   DLFTYVGLLEFFYSEAPMGLKSISTCFLWSSMALGYFFSTILVKIVNGATKDVTRSGGWL  616

Query  1671  GGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
              GNN+N NHL LFY LLS +S +NF VY+FV+KRYKYR
Sbjct  617   AGNNINLNHLNLFYWLLSFMSLINFIVYVFVAKRYKYR  654



>ref|XP_009353476.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Pyrus x bretschneideri]
Length=650

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/572 (65%), Positives = 461/572 (81%), Gaps = 4/572 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             EK EL++GKVDW+GR+A K KHGG++ S+ ILG F FENMAT+ L V LVTY NGVM+  
Sbjct  60    EKLELVEGKVDWKGRSAVKYKHGGMKTSVLILGTFAFENMATLALAVNLVTYFNGVMHFE  119

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LADAAN +TN+ G  YIL+I+ A+LADT+ GRF+ +LIS  +EF+GL L+ +QAHY KL 
Sbjct  120   LADAANQLTNYMGTGYILSILMAILADTFFGRFKTLLISGCLEFVGLALMTVQAHYPKLT  179

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PP C+  D   KCE+V G NAA+LF+ALY +A G++G+KA +PSHGADQFDE D +E  +
Sbjct  180   PPVCSVFDPTAKCEKVEGGNAALLFIALYILAAGASGLKATLPSHGADQFDELDPREARQ  239

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFN+LLL VC+GG VSLTL VW+  ++GWDWGF  ST+AMF G + F  GLP YR+ 
Sbjct  240   MSSFFNFLLLAVCLGGVVSLTLIVWVQDNEGWDWGFGISTIAMFLGVVIFFAGLPLYRIQ  299

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             VI+G+SA+ ++IQV+VAAI N+ L LPED  ELYEISKDKEA  +  EFLPH   +RFLD
Sbjct  300   VIRGTSALVELIQVYVAAIRNKNLSLPEDPSELYEISKDKEA-ALEQEFLPHRPIFRFLD  358

Query  978   KAAI---QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             KA+I   Q    + PNPW++CRVTQVENAKI+L +VP+F CT+IMTLCLAQLQTFSIQQG
Sbjct  359   KASIRRGQVDEQQPPNPWKLCRVTQVENAKIILGMVPIFCCTIIMTLCLAQLQTFSIQQG  418

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD +ITK F+I P+SLP +PI+FL  +IP+YDR+FVP   + TGIP+GIT L R+ VG
Sbjct  419   LTMDTSITKHFKIPPASLPIIPIVFLAIIIPVYDRVFVPIASKFTGIPSGITHLQRIGVG  478

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS +SM  A I+E+KRK VARE NML A P++QPLPIS FWLS QYFIFGIADMFTYV
Sbjct  479   LVLSCVSMGVAGIMEVKRKDVAREHNMLLARPVVQPLPISTFWLSFQYFIFGIADMFTYV  538

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYS++PK LKS+S+CFLWSSM+LGYF S++LVK+VN ATKG+T+SGGWL GNN+N
Sbjct  539   GLLEFFYSESPKGLKSISTCFLWSSMALGYFFSTILVKIVNNATKGVTKSGGWLAGNNIN  598

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
              NHL LFY LLS +S +NFF+Y+FV+KRYKYR
Sbjct  599   LNHLNLFYWLLSLMSLINFFIYVFVAKRYKYR  630



>ref|XP_008371731.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like [Malus domestica]
Length=602

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/573 (65%), Positives = 457/573 (80%), Gaps = 4/573 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QEK EL++GKVDW+GR+A K KHGG++ ++ ILG F FENMAT+ L V LVTY N VM+ 
Sbjct  11    QEKLELVEGKVDWKGRSAVKYKHGGMKTAVLILGTFAFENMATLALAVNLVTYFNRVMHF  70

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              LADAAN +TN+ G  YIL+I+ A+LADT+ GRF+ +LIS   EF+GL L+ +QAHY KL
Sbjct  71    ELADAANQLTNYMGTGYILSILMAILADTFFGRFKTLLISGCFEFVGLALMTVQAHYPKL  130

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
              PP CN  D   KCE+V G NAA+LF+ALY +A G++G+KA +PSHGADQFDE D +E  
Sbjct  131   TPPVCNVFDPTAKCEKVEGGNAALLFIALYIMAAGASGLKATLPSHGADQFDESDPREAR  190

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFN+LLL VC+GG VSLTL VW+  +KGWDWGF  ST+AMF G + F  GLP YR+
Sbjct  191   QMSSFFNFLLLAVCLGGVVSLTLIVWVQDNKGWDWGFGISTIAMFLGVVIFFAGLPLYRI  250

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
              VI G+SAI ++IQV+VAAI N+ L LPED  ELYEISKDKEA  +  EFLPH   +RFL
Sbjct  251   QVIGGTSAIVELIQVYVAAIRNKNLSLPEDPAELYEISKDKEA-ALEQEFLPHRPIFRFL  309

Query  975   DKAAI---QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             DKA+I   Q    + PNPW++CRVTQVENAKI+L +VP+F CT+IMTLCLAQLQTFSIQQ
Sbjct  310   DKASIRRGQVDEQQPPNPWKLCRVTQVENAKIILGMVPIFCCTIIMTLCLAQLQTFSIQQ  369

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             G TMD +ITK F+I P+SLP +PI+FL  +IP+YD +FVP   + TGIP+GIT L R+ V
Sbjct  370   GLTMDTSITKHFKIPPASLPIIPIVFLAIIIPVYDSVFVPIASKFTGIPSGITHLQRIGV  429

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTY  1505
             GL+LS +SM  A I+E+KRK VARE NML A P++QPLPIS FWLS QYFIFGIADMFTY
Sbjct  430   GLVLSCVSMGVAGIMEVKRKDVAREHNMLLARPVVQPLPISTFWLSFQYFIFGIADMFTY  489

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             VGLLEFFYS++PK LKS+S+CFLWSSM+LGYF S++LVK+VN ATKG+T+SGGWL GNN+
Sbjct  490   VGLLEFFYSESPKGLKSISTCFLWSSMALGYFFSTILVKIVNNATKGVTKSGGWLAGNNI  549

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             N NHL LFY LLS +S +N F+Y+FV+KRYKYR
Sbjct  550   NLNHLNLFYWLLSLMSLINXFIYVFVAKRYKYR  582



>ref|XP_004163358.1| PREDICTED: nitrate transporter 1.2-like [Cucumis sativus]
Length=592

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/578 (64%), Positives = 458/578 (79%), Gaps = 7/578 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QEK E+++GKVDW+GR A K KHGG ++S+ IL  FGFE+MA   L V L+TY N VM+ 
Sbjct  2     QEKLEIVEGKVDWKGRLAYKHKHGGTKSSLLILATFGFESMAIFALAVNLITYFNSVMHF  61

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              LADAAN +TN+ G  YIL+I+ A+LADTY GR + V+IS  +EFL L LL +QAHY KL
Sbjct  62    ELADAANQLTNYMGTGYILSILMAILADTYFGRVKTVIISGCLEFLALILLMIQAHYPKL  121

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPPPCN  DK   CE V G++A +L++ALY +A G+AG+KAA+PSHGADQFDEKD KE  
Sbjct  122   KPPPCNMFDKQSHCETVEGKSAVVLYIALYILATGTAGIKAALPSHGADQFDEKDPKEAM  181

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFN LLLG+C+GGAVSLTL VW+  +KGWDWG   S  AMFF  + F  G+P YR+
Sbjct  182   QMSSFFNKLLLGLCLGGAVSLTLIVWIQDYKGWDWGLGVSAAAMFFSVVIFVAGMPLYRI  241

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +++ GSS I QI+QV+VAAI NRKL LPEDS  LYEI +DKE   +  +FLPH + YRFL
Sbjct  242   HIVSGSSTILQILQVYVAAIRNRKLILPEDSTHLYEIERDKEN-AMEDDFLPHRNIYRFL  300

Query  975   DKAAIQTSWD------EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
             DKAAIQ +        E  + W++C VTQVENAKI+L++VP+F CT+IMTLCLAQLQTFS
Sbjct  301   DKAAIQQTPSRQVGNPEASSAWKLCTVTQVENAKIVLSMVPIFCCTIIMTLCLAQLQTFS  360

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             IQQG TMD  +T SF I P+SLP +P+ F+I ++P+YD++FVP  R+ TGIPTGIT L R
Sbjct  361   IQQGLTMDTKLTNSFSIPPASLPIIPVSFIILIVPIYDKIFVPFARKFTGIPTGITHLQR  420

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADM  1496
             V VGL+LSS+SMA AA++E+KRK VAR+ NMLDA P+ QPLPIS FWLS Q+FIFGIAD+
Sbjct  421   VGVGLVLSSISMAVAALVEVKRKGVARDHNMLDATPVSQPLPISTFWLSFQFFIFGIADL  480

Query  1497  FTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGG  1676
             FTYVGLLEFFYS+APK LKSVS+CFLWSSM+LGYF S+++VK+VN AT+G+T SGGWL G
Sbjct  481   FTYVGLLEFFYSEAPKALKSVSTCFLWSSMALGYFLSTIIVKIVNRATEGITRSGGWLVG  540

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NN+NRNHL LFY +LS LS +NFF+Y+FV+K+YKYR Q
Sbjct  541   NNINRNHLNLFYWMLSILSLINFFIYVFVAKKYKYRNQ  578



>ref|XP_008439704.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like [Cucumis melo]
Length=592

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/578 (65%), Positives = 461/578 (80%), Gaps = 7/578 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QEK E+++GKVDW+GR A K KHGG R+S+ IL  FGFE+MA   L V L+TY N VM+ 
Sbjct  2     QEKLEVVEGKVDWKGRLAYKHKHGGTRSSLLILVAFGFESMANFALAVNLITYFNSVMHF  61

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              LADAAN +TN+ G  YIL+I+ A+LADTY GR + V+IS+  EFL L LL +QAHY  L
Sbjct  62    ELADAANQLTNYMGTGYILSILMAILADTYFGRVKTVIISSCFEFLALILLMIQAHYPNL  121

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPPPCN  DK   CE V G++AA+L+VALY +A+G+AG+KAA+PSHGADQFDEKD KE  
Sbjct  122   KPPPCNMFDKQSHCETVEGKSAAMLYVALYILAIGNAGIKAALPSHGADQFDEKDPKEAM  181

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFN LLLG+C+GGAVSLTL VW+  +KGWDWG   S+ AMFF  + F  GLP YR+
Sbjct  182   QMSSFFNKLLLGLCLGGAVSLTLIVWIQDYKGWDWGLGVSSAAMFFSVVIFVAGLPLYRM  241

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +++ GSS I QI+QV+VAAI NRKL LPEDS +LYEI +DKE V    +FLPH + YRFL
Sbjct  242   HIVSGSSTILQILQVYVAAIRNRKLILPEDSTQLYEIERDKE-VAAEDDFLPHRNIYRFL  300

Query  975   DKAAIQ-TSWDEEPNP-----WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
             DKAAIQ T   +  NP     W++C VTQVENAKI+L++VP+F CT+IMTLCLAQLQTFS
Sbjct  301   DKAAIQETPSRQVENPEASSAWKLCTVTQVENAKIVLSMVPIFCCTIIMTLCLAQLQTFS  360

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             IQQG TMD  +T SF I P+SLP +P+ F+I ++P+YD++ VP  R+LTGIPTGIT L R
Sbjct  361   IQQGLTMDTKLTNSFSIPPASLPIIPVSFIILIVPIYDKILVPFARKLTGIPTGITHLQR  420

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADM  1496
             V VGL+LSS+SMA AA++E+KRK VAR+ NMLDA P+ QPLPIS FWLS Q+FIFGIAD+
Sbjct  421   VGVGLVLSSISMAVAALVEVKRKGVARDHNMLDATPVSQPLPISTFWLSFQFFIFGIADL  480

Query  1497  FTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGG  1676
             FTYVGLLEFFYS+APK LKSVS+CFLWSSM+LGYF S+++VK+VN AT+G+T SGGWL G
Sbjct  481   FTYVGLLEFFYSEAPKALKSVSTCFLWSSMALGYFLSTIVVKIVNRATEGITRSGGWLIG  540

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NN+NRNHL LFY +LS LS +NFF+Y+FV+K+YKYR  
Sbjct  541   NNINRNHLNLFYWMLSILSLINFFIYIFVAKKYKYRNH  578



>gb|KDO77964.1| hypothetical protein CISIN_1g043156mg, partial [Citrus sinensis]
Length=578

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/577 (64%), Positives = 451/577 (78%), Gaps = 22/577 (4%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             E  EL++GKVDW+GR A K KHGGI+ S+ IL  FGFEN+ATI LGV LVTY NGV++++
Sbjct  1     ENLELVEGKVDWKGRPAVKYKHGGIKTSLLILAAFGFENLATIALGVNLVTYFNGVLHLD  60

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LA+AAN VTN+ G +YIL+IV A+LAD +IGRF+AVLIS  +EFL               
Sbjct  61    LAEAANQVTNYMGTSYILSIVVALLADAFIGRFKAVLISGSVEFL---------------  105

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PPPCN  D    C+++ G +AA+LFVALY +A G+AG+KAA+P +GADQFDEKD  E  +
Sbjct  106   PPPCNVFDPTAGCKKIEGSDAALLFVALYLIATGTAGIKAALPPYGADQFDEKDPIEARQ  165

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFN L L VC+GGA+S+TL VW+  +KGWD GF  S+VA+F   I F  GLP YR  
Sbjct  166   MSSFFNLLFLAVCIGGAISVTLIVWIQDNKGWDRGFGLSSVAVFLATIIFAAGLPLYRFQ  225

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             V+QGSS + +IIQV+VAAI NRKL+LPED  ELYEI+ DKEA  I  EFLPH D +RFLD
Sbjct  226   VVQGSSVLIEIIQVYVAAIRNRKLELPEDPMELYEINMDKEA-AIETEFLPHRDIFRFLD  284

Query  978   KAAIQTSWDEE------PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSI  1139
             KAAIQ +  E       PNPW++CRVTQVENAKI+L ++P+F CT++MTLCLAQLQTFSI
Sbjct  285   KAAIQKTSTENLEITEAPNPWKLCRVTQVENAKIILGMIPIFCCTIVMTLCLAQLQTFSI  344

Query  1140  QQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRV  1319
             QQG TMD ++T SF I P+SLP LPILF+I  +P+YDR+FVP   ++TG PTGIT L RV
Sbjct  345   QQGLTMDTSVTTSFHIPPASLPILPILFMILAVPVYDRIFVPFAGKITGNPTGITHLQRV  404

Query  1320  AVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMF  1499
              VGL+LS +SMA AAI E+ RK VAR+ NMLDAIP++QPLPIS FWLSIQ+FIFGIADMF
Sbjct  405   GVGLVLSCISMAIAAIFEVIRKDVARDHNMLDAIPVVQPLPISTFWLSIQFFIFGIADMF  464

Query  1500  TYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGN  1679
             TYVGLLEFFYS+APK +KS+S+CFLW SM+LGYF S++LV +VN AT+G+T+SGGWL GN
Sbjct  465   TYVGLLEFFYSEAPKGIKSLSTCFLWCSMALGYFFSTILVNIVNSATRGITQSGGWLAGN  524

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             N+NRNHL LF+ LLS LSF+NF VYLF+S RY YR Q
Sbjct  525   NINRNHLNLFFWLLSALSFINFSVYLFMSSRYNYRPQ  561



>ref|XP_010059065.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Eucalyptus grandis]
Length=605

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/589 (63%), Positives = 464/589 (79%), Gaps = 9/589 (2%)
 Frame = +3

Query  42    SLFLFNFLINSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVT  221
             S F  N +I   E  E ++GKVDW+GR A K KHGG+R S+ IL  FGFEN+A + L V 
Sbjct  19    SFFQLNVVIQETEA-EFVEGKVDWKGRKALKHKHGGMRVSLLILAAFGFENLANVALAVN  77

Query  222   LVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLG  401
             LVTY NGVM+  LA+AAN +TNF G ++IL I+AA+LADT+IGRF+ +LISA I+ LGL 
Sbjct  78    LVTYFNGVMHFELAEAANQLTNFMGTSHILPILAAILADTFIGRFKTLLISASIQLLGLA  137

Query  402   LLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGAD  581
             LL +QAHY KL+PPPCN + +   C++++G +AA+LF+ LY +A GSAG+KA++P+HGAD
Sbjct  138   LLTVQAHYPKLRPPPCN-VYRTSHCKKISGGDAALLFLGLYLLATGSAGMKASLPTHGAD  196

Query  582   QFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGI  761
             QFDE + +E  +MSSFFN +LL VC G  VSL+L VW+  +KGWDWGF  ST AM    I
Sbjct  197   QFDETNPREARQMSSFFNCILLSVCTGALVSLSLVVWIQVNKGWDWGFGLSTFAMILAII  256

Query  762   FFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE  941
              F +GLP YR+ ++Q S+AI +IIQV+VAAI  R LQLP+D  ELYE+ KD EA  + AE
Sbjct  257   IFAVGLPLYRIQLVQKSNAIIEIIQVYVAAISKRDLQLPKDPKELYELDKDGEA-ALEAE  315

Query  942   FLPHTDKYRFLDKAAIQTSWDEE------PNPWRVCRVTQVENAKILLNLVPVFLCTVIM  1103
             FLPHT+ +RFLDKAA+QT+  E+      PN W +CRVTQVENAKI+L +VP+F CT+IM
Sbjct  316   FLPHTESFRFLDKAAMQTASPEQYGGAKGPNRWALCRVTQVENAKIILGMVPIFCCTIIM  375

Query  1104  TLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLT  1283
             TLCLAQLQTFS+QQG TMD +IT SF I P+SLP +P  FLI +IP+YD++F+P +R+LT
Sbjct  376   TLCLAQLQTFSVQQGRTMDTSITSSFHIPPASLPIIPFAFLIVIIPVYDQVFIPFVRKLT  435

Query  1284  GIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLS  1463
             G P GIT L R+ VGL+LSS+SMA AA +E+KRK VAR  +MLDA+P LQPLPISVFWLS
Sbjct  436   GHPAGITHLQRIGVGLVLSSISMAVAAAIEVKRKAVARNHHMLDAMPALQPLPISVFWLS  495

Query  1464  IQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATK  1643
              QYFIFGIAD+FTYVGLLEFFYS+APKELKSVS+CF WSSM+LGYF S+++VK+VNG TK
Sbjct  496   FQYFIFGIADLFTYVGLLEFFYSEAPKELKSVSTCFFWSSMALGYFFSTIMVKIVNGVTK  555

Query  1644  GMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             G+T SGGWL GNN+NRNHL LFY LLS LS +NFFVYL V++RYKYR  
Sbjct  556   GITRSGGWLAGNNINRNHLNLFYLLLSMLSLINFFVYLIVARRYKYRSH  604



>gb|EYU28131.1| hypothetical protein MIMGU_mgv1a025040mg, partial [Erythranthe 
guttata]
Length=580

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/575 (65%), Positives = 466/575 (81%), Gaps = 3/575 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QE  +LI+GKVDW+G+TARKDKHGG   S+ +LG F FE+MAT+ L V LVTY  GVM+ 
Sbjct  2     QETAQLIEGKVDWKGKTARKDKHGGTSTSLLVLGAFVFESMATMALAVNLVTYFVGVMHF  61

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             +L++AAN +TN+ G +YI+T++ A LADTY+GRF+AVL+S  +EFLGL LLA+QAHY KL
Sbjct  62    DLSEAANQLTNYMGTSYIITLLIAFLADTYVGRFKAVLLSTTVEFLGLALLALQAHYPKL  121

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPP C   D    C +V G NAA+LFVALY V +GS GVKAA+PSHGADQF++ D KE  
Sbjct  122   KPPLCRIFDPTSHCVKVGGANAALLFVALYLVGLGSGGVKAALPSHGADQFEDNDPKEAR  181

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             + SS+FNWLLL +C+G A+SLT  VW+  HKGWDWGF  ST+AM FG I F +GLP YR+
Sbjct  182   QKSSYFNWLLLSLCIGAAISLTFLVWIQDHKGWDWGFTISTIAMLFGIIVFAVGLPQYRI  241

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +V+ GSSA+T+I+QVFV AI NRKL+LP D+ ELYEISKDKEA  I +EFLPHT+ +RFL
Sbjct  242   HVVNGSSALTEIVQVFVVAIRNRKLRLPADTNELYEISKDKEAAIIQSEFLPHTNIFRFL  301

Query  975   DKAAIQTSWDEEP--NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             DKAAI  + + +   + W++C VTQVEN KILLN+VP+F CT+IMTLCLAQLQTFS+QQG
Sbjct  302   DKAAIIQTPESQGRISQWKLCTVTQVENVKILLNMVPIFCCTIIMTLCLAQLQTFSVQQG  361

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  I  +FQI P+SLP +PI+FLI +IPLYD++ VP +R+ TGIPTGIT L R+ VG
Sbjct  362   VTMDKTIANNFQIPPASLPIIPIMFLIIIIPLYDQIIVPFIRKFTGIPTGITHLQRIGVG  421

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQ-PLPISVFWLSIQYFIFGIADMFTY  1505
             L+LSSLSMA AA++E+KRK+VA +  MLDA+P+   P+PISVFWLS QYFIFGIADMFTY
Sbjct  422   LILSSLSMAVAAVVEVKRKRVAGDHGMLDAVPLRDPPIPISVFWLSFQYFIFGIADMFTY  481

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             VGLLEFFYSQ P+++KS+SSCFLW+SMSLGYF S++LVK+VN ATK +T SGGWLGGNN 
Sbjct  482   VGLLEFFYSQVPQDIKSMSSCFLWTSMSLGYFCSTILVKIVNAATKDVTRSGGWLGGNNF  541

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NRNHL LFY LLS LS +NF +YLFVS RYKYR++
Sbjct  542   NRNHLNLFYWLLSLLSLLNFCIYLFVSTRYKYREE  576



>gb|KHN48035.1| Putative peptide/nitrate transporter [Glycine soja]
Length=588

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/577 (62%), Positives = 448/577 (78%), Gaps = 7/577 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             ++ +++DGKVDW+GR A K KHGG++ S+ ILG F  ENMAT+ L V  V+Y  G+M+  
Sbjct  2     QEEKVVDGKVDWKGRRALKHKHGGMKVSLLILGAFAVENMATLSLAVNFVSYFTGIMHYE  61

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LADAAN VT++ G +Y+L+IV AV+ADT+IGR+++V+IS +IE LGL LL +QAH   L 
Sbjct  62    LADAANIVTDYMGVSYMLSIVVAVVADTWIGRYKSVVISGFIESLGLALLTVQAHMGSLT  121

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PP CN   K   C +++G+  A  F++LY +A GSAG+KA++PSHGADQFDE+D KE  +
Sbjct  122   PPICNVYVKDAHCAKLSGKQEAFFFISLYLLAFGSAGLKASLPSHGADQFDERDPKEAMQ  181

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFN LLL VC+GGAVSLT  V++    GWDWGF  ST A+  G I F  GLP YR++
Sbjct  182   MSSFFNGLLLAVCIGGAVSLTFNVYIQDRYGWDWGFGISTFAIVLGTILFAFGLPLYRIH  241

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             V    + I +IIQV+VAAIHNR L LPED  ELYEI +DKEA  +  E  PH D +RFLD
Sbjct  242   VAHTKNGIIEIIQVYVAAIHNRNLSLPEDPIELYEIEQDKEA-AMEIEHQPHRDIFRFLD  300

Query  978   KAAIQTSWD------EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSI  1139
             KAAIQ   D      E PNPW++CRVTQVENAKI+L+++P+F C++IMTLCLAQLQTFS+
Sbjct  301   KAAIQRKSDVQPENQETPNPWKLCRVTQVENAKIILSMLPIFCCSIIMTLCLAQLQTFSV  360

Query  1140  QQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRV  1319
             QQGSTMD  ITK F I P+SLP +P+ FLI ++P +DR+ VP +R+ TGIPTGIT L R+
Sbjct  361   QQGSTMDTRITKHFNIPPASLPIIPVGFLIIIVPFHDRICVPFLRKFTGIPTGITHLQRI  420

Query  1320  AVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMF  1499
              VGL+LS +SMA AAI+E+KRK VAR+ NMLDA+P+ QPLP+S+FWL+ QYFIFGIADMF
Sbjct  421   GVGLILSCISMAIAAIIEVKRKGVARDNNMLDALPVKQPLPLSIFWLAFQYFIFGIADMF  480

Query  1500  TYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGN  1679
             TYVGLLEFFYS+APK LKS S+CFLW SM+LGYF SS+LVK+VN ATK +T SGGWL GN
Sbjct  481   TYVGLLEFFYSEAPKGLKSTSTCFLWCSMALGYFLSSILVKIVNSATKNITSSGGWLAGN  540

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             N+NRNHL LFY  LS LS +NFFVYLFVSKRYKYR Q
Sbjct  541   NINRNHLNLFYLFLSILSLINFFVYLFVSKRYKYRPQ  577



>ref|XP_003532772.2| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Glycine max]
Length=603

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/579 (63%), Positives = 448/579 (77%), Gaps = 8/579 (1%)
 Frame = +3

Query  75    QEKYELI-DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMN  251
             +EK EL+ DGKVDW+GR A K KHGG++ S+ ILG F  ENMAT+ L V  V+Y  G+M+
Sbjct  15    EEKAELVVDGKVDWKGRRALKHKHGGMKVSLLILGAFAVENMATLSLAVNFVSYFTGIMH  74

Query  252   VNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAK  431
               LADAAN VT++ G +Y+L+IV AV+ADT+IGR+++V+IS +IE LGL LL +QAH   
Sbjct  75    YELADAANIVTDYMGVSYMLSIVVAVVADTWIGRYKSVVISGFIESLGLALLTVQAHMGS  134

Query  432   LKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEG  611
             L PP CN   K   C +++G+  A  F++LY +A GSAG+KA++PSHGADQFDE+D KE 
Sbjct  135   LTPPICNVYVKDAHCAKLSGKQEAFFFISLYLLAFGSAGLKASLPSHGADQFDERDPKEA  194

Query  612   SEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYR  791
              +MSSFFN LLL VC+GGAVSLT  V++    GWDWGF  ST A+  G I F  GLP YR
Sbjct  195   MQMSSFFNGLLLAVCIGGAVSLTFNVYIQDRYGWDWGFGISTFAIVLGTILFAFGLPLYR  254

Query  792   VYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRF  971
             ++V    + I +IIQV+VAAI NR L LPED  ELYEI +DKEA  +  E  PH D +RF
Sbjct  255   IHVAHTKNGIIEIIQVYVAAIRNRNLSLPEDPIELYEIEQDKEA-AMEIEHQPHRDIFRF  313

Query  972   LDKAAIQTSWD------EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTF  1133
             LDKAAIQ   D      E PNPW++CRVTQVENAKI+L+++P+F C++IMTLCLAQLQTF
Sbjct  314   LDKAAIQRKSDVQPENQETPNPWKLCRVTQVENAKIILSMLPIFCCSIIMTLCLAQLQTF  373

Query  1134  SIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLH  1313
             S+QQGSTMD  ITK F I P+SLP +P+ FLI ++P YDR+ VP +R+ TGIPTGIT L 
Sbjct  374   SVQQGSTMDTRITKHFNIPPASLPIIPVGFLIIIVPFYDRICVPFLRKFTGIPTGITHLQ  433

Query  1314  RVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIAD  1493
             R+ VGL+LS +SMA AAI+E+KRK VAR+ NMLDA+P+ QPLP+S+FWL+ QYFIFGIAD
Sbjct  434   RIGVGLILSCISMAIAAIIEVKRKGVARDHNMLDALPVKQPLPLSIFWLAFQYFIFGIAD  493

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             MFTYVGLLEFFYS+APK LKS S+CFLW SM+LGYF SS+LVK+VN ATK +T SGGWL 
Sbjct  494   MFTYVGLLEFFYSEAPKGLKSTSTCFLWCSMALGYFLSSILVKIVNSATKNITSSGGWLA  553

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             GNN+NRNHL LFY  LS LS +NFFVYLFVSKRYKYR Q
Sbjct  554   GNNINRNHLNLFYLFLSILSLINFFVYLFVSKRYKYRPQ  592



>ref|XP_008358638.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Malus domestica]
Length=722

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/576 (65%), Positives = 460/576 (80%), Gaps = 4/576 (1%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             +N Q+K+EL++GKVDW+GR+A K KHGG++ ++ ILG   FE+MA++ L V  VTY N V
Sbjct  129   VNLQDKFELVEGKVDWKGRSAVKYKHGGMKTAVLILGTLAFESMASLALAVNXVTYFNEV  188

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  LADAAN +TN+ G  +IL+I+ A+LADT+ GRF+ +LIS   EF+GL L+ +QAHY
Sbjct  189   MHFELADAANELTNYMGTGFILSILMAILADTFFGRFKILLISGCFEFVGLALMTVQAHY  248

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              KL+PP CN  D   KCE+V G NAA+LF+ALYT+A  +AG+KA +PSHGADQFDE D +
Sbjct  249   PKLRPPVCNVFDPTAKCEKVEGGNAALLFIALYTMAAAAAGLKATLPSHGADQFDESDPR  308

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             E  +MSSFFN+LLL VC+GG VSLTL VW+  +KGWDWGF   T AMF G + F  GLP 
Sbjct  309   ETGQMSSFFNFLLLSVCLGGVVSLTLIVWVQDNKGWDWGFGLCTXAMFLGVVIFLAGLPV  368

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             YR+ V +G+SAI +IIQV+VAAI NR L LPED+ ELYEISKDKE  ++  EFLPH   +
Sbjct  369   YRIQVJRGTSAIVEIIQVYVAAIRNRNLSLPEDATELYEISKDKEX-SLEQEFLPHRPIF  427

Query  966   RFLDKAAIQTSWDEE---PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
             RFLDKA+IQ    +E   PNPW++CRVTQVENAKILL LVP+F CT+IMTLCLAQLQTFS
Sbjct  428   RFLDKASIQRGEVDEQQPPNPWKLCRVTQVENAKILLGLVPIFCCTIIMTLCLAQLQTFS  487

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             IQQ  TMD +ITK F+I P+SLP +P++FLI +IP+YDR+FVP   + TGIP+GIT L R
Sbjct  488   IQQALTMDTSITKHFKIPPASLPIIPLVFLIIIIPVYDRVFVPIASKFTGIPSGITHLQR  547

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADM  1496
             + VGL+LS +SM  A I+E+KRK VARE NML A P+LQPLPIS FWLS QYFIFGIADM
Sbjct  548   IGVGLVLSCVSMGVAGIMEVKRKDVAREHNMLLARPVLQPLPISTFWLSFQYFIFGIADM  607

Query  1497  FTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGG  1676
             FTYVGLLEFFYS+APK LKS+S+CFLWSSM+LGYF S++LVK+VN ATKG T+SGGWL G
Sbjct  608   FTYVGLLEFFYSEAPKGLKSISTCFLWSSMALGYFFSTILVKIVNNATKGNTKSGGWLAG  667

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             NN+N NHL LFY LLS +S +NFF+Y+FV+KRYKYR
Sbjct  668   NNINLNHLNLFYWLLSLMSLINFFIYVFVTKRYKYR  703



>ref|XP_008383580.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Malus domestica]
Length=598

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/572 (65%), Positives = 457/572 (80%), Gaps = 4/572 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             +K+EL++GKVDW+GR+A K KHGG++ ++ ILG   FE+MA++ L V  VTY N VM+  
Sbjct  9     DKFELVEGKVDWKGRSAVKYKHGGMKTAVLILGTLAFESMASLALAVNXVTYFNEVMHFE  68

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LADAAN +TN+ G  +IL+I+ A+LADT+ GRF+ +LIS   EF+GL L+ +QAHY KL+
Sbjct  69    LADAANELTNYMGTGFILSILMAILADTFFGRFKILLISGCFEFVGLALMTVQAHYPKLR  128

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PP CN  D   KCE+V G NAA+LF+ALYT+A  +AG+KA +PSHGADQFDE D +E  +
Sbjct  129   PPVCNVFDPTAKCEKVEGGNAALLFIALYTMAAAAAGLKATLPSHGADQFDESDPRETGQ  188

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFN+LLL VC+GG VSLTL VW+  +KGWDWGF   T AMF G + F  GLP YR+ 
Sbjct  189   MSSFFNFLLLSVCLGGVVSLTLIVWVQDNKGWDWGFGLCTXAMFLGVVIFLAGLPVYRIQ  248

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             V +G+SAI +IIQV+VAAI NR L LPED+ ELYEISKDKE  ++  EFLPH   +RFLD
Sbjct  249   VJRGTSAIVEIIQVYVAAIRNRNLSLPEDATELYEISKDKEX-SLEQEFLPHRPIFRFLD  307

Query  978   KAAIQTSWDEE---PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             KA+IQ    +E   PNPW++CRVTQVENAKILL LVP+F CT+IMTLCLAQLQTFSIQQ 
Sbjct  308   KASIQRGEVDEQQPPNPWKLCRVTQVENAKILLGLVPIFCCTIIMTLCLAQLQTFSIQQA  367

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD +ITK F+I P+SLP +P++FLI +IP+YDR+FVP   + TGIP+GIT L R+ VG
Sbjct  368   LTMDTSITKHFKIPPASLPIIPLVFLIIIIPVYDRVFVPIASKFTGIPSGITHLQRIGVG  427

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS +SM  A I+E+KRK VARE NML A P+LQPLPIS FWLS QYFIFGIADMFTYV
Sbjct  428   LVLSCVSMGVAGIMEVKRKDVAREHNMLLARPVLQPLPISTFWLSFQYFIFGIADMFTYV  487

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYS+APK LKS+S+CFLWSSM+LGYF S++LVK+VN ATKG T+SGGWL GNN+N
Sbjct  488   GLLEFFYSEAPKGLKSISTCFLWSSMALGYFFSTILVKIVNNATKGNTKSGGWLAGNNIN  547

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
              NHL LFY LLS +S +NFF+Y+FV+KRYKYR
Sbjct  548   LNHLNLFYWLLSLMSLINFFIYVFVTKRYKYR  579



>gb|KCW74201.1| hypothetical protein EUGRSUZ_E02847, partial [Eucalyptus grandis]
Length=599

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/584 (63%), Positives = 461/584 (79%), Gaps = 9/584 (2%)
 Frame = +3

Query  42    SLFLFNFLINSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVT  221
             S F  N +I   E  E ++GKVDW+GR A K KHGG+R S+ IL  FGFEN+A + L V 
Sbjct  19    SFFQLNVVIQETEA-EFVEGKVDWKGRKALKHKHGGMRVSLLILAAFGFENLANVALAVN  77

Query  222   LVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLG  401
             LVTY NGVM+  LA+AAN +TNF G ++IL I+AA+LADT+IGRF+ +LISA I+ LGL 
Sbjct  78    LVTYFNGVMHFELAEAANQLTNFMGTSHILPILAAILADTFIGRFKTLLISASIQLLGLA  137

Query  402   LLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGAD  581
             LL +QAHY KL+PPPCN + +   C++++G +AA+LF+ LY +A GSAG+KA++P+HGAD
Sbjct  138   LLTVQAHYPKLRPPPCN-VYRTSHCKKISGGDAALLFLGLYLLATGSAGMKASLPTHGAD  196

Query  582   QFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGI  761
             QFDE + +E  +MSSFFN +LL VC G  VSL+L VW+  +KGWDWGF  ST AM    I
Sbjct  197   QFDETNPREARQMSSFFNCILLSVCTGALVSLSLVVWIQVNKGWDWGFGLSTFAMILAII  256

Query  762   FFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE  941
              F +GLP YR+ ++Q S+AI +IIQV+VAAI  R LQLP+D  ELYE+ KD EA  + AE
Sbjct  257   IFAVGLPLYRIQLVQKSNAIIEIIQVYVAAISKRDLQLPKDPKELYELDKDGEA-ALEAE  315

Query  942   FLPHTDKYRFLDKAAIQTSWDEE------PNPWRVCRVTQVENAKILLNLVPVFLCTVIM  1103
             FLPHT+ +RFLDKAA+QT+  E+      PN W +CRVTQVENAKI+L +VP+F CT+IM
Sbjct  316   FLPHTESFRFLDKAAMQTASPEQYGGAKGPNRWALCRVTQVENAKIILGMVPIFCCTIIM  375

Query  1104  TLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLT  1283
             TLCLAQLQTFS+QQG TMD +IT SF I P+SLP +P  FLI +IP+YD++F+P +R+LT
Sbjct  376   TLCLAQLQTFSVQQGRTMDTSITSSFHIPPASLPIIPFAFLIVIIPVYDQVFIPFVRKLT  435

Query  1284  GIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLS  1463
             G P GIT L R+ VGL+LSS+SMA AA +E+KRK VAR  +MLDA+P LQPLPISVFWLS
Sbjct  436   GHPAGITHLQRIGVGLVLSSISMAVAAAIEVKRKAVARNHHMLDAMPALQPLPISVFWLS  495

Query  1464  IQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATK  1643
              QYFIFGIAD+FTYVGLLEFFYS+APKELKSVS+CF WSSM+LGYF S+++VK+VNG TK
Sbjct  496   FQYFIFGIADLFTYVGLLEFFYSEAPKELKSVSTCFFWSSMALGYFFSTIMVKIVNGVTK  555

Query  1644  GMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             G+T SGGWL GNN+NRNHL LFY LLS LS +NFFVYL V++RY
Sbjct  556   GITRSGGWLAGNNINRNHLNLFYLLLSMLSLINFFVYLIVARRY  599



>ref|XP_007159501.1| hypothetical protein PHAVU_002G243000g [Phaseolus vulgaris]
 gb|ESW31495.1| hypothetical protein PHAVU_002G243000g [Phaseolus vulgaris]
Length=602

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/578 (62%), Positives = 442/578 (76%), Gaps = 7/578 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             +E+ E++ GKVDW+GR A K KHGGI+ S+ IL     ENMAT+ L V LV+Y N  M+ 
Sbjct  15    EERAEVVHGKVDWKGRKALKHKHGGIKVSLLILAAIAIENMATLSLAVNLVSYFNRNMHY  74

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             +LADAAN VTN+ G +Y+L+IV AVLADT+IGR++ V+IS + E LGL LL +QAH   L
Sbjct  75    DLADAANMVTNYMGVSYMLSIVVAVLADTWIGRYKCVVISGFFESLGLSLLTIQAHMKSL  134

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KP  CN   K   CE+++G+  A LF+ LY +A GS+G+KA++PSHGADQFDE+D +E  
Sbjct  135   KPLICNVYVKNADCEKLSGKKEAFLFIGLYLLAFGSSGLKASLPSHGADQFDERDPREAK  194

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFN LLL VC+GGAVSLT  V++  H GWDWGF  STVA+    I F  GLP YR+
Sbjct  195   QMSSFFNSLLLAVCIGGAVSLTFNVYVQDHNGWDWGFGISTVAIVLATIIFAFGLPLYRI  254

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             +V    + I +IIQV++AA  NR L LPED  ELYEI +DKEA  +  E+ PH D YRFL
Sbjct  255   HVAHAKNGIIEIIQVYIAATRNRNLPLPEDPMELYEIEQDKEA-AVDVEYQPHRDIYRFL  313

Query  975   DKAAIQTSWDEE------PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
             DKAAIQ   DE+       NPW++CRVTQVENAKI+L+++PVF C++IMTLCLAQLQTFS
Sbjct  314   DKAAIQRKSDEQHEKQEASNPWKLCRVTQVENAKIILSMLPVFCCSIIMTLCLAQLQTFS  373

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             +QQGSTMD  ITK F I P+SLP +P+ FLI +IP YDR+ VP +R+ TGIPTGIT L R
Sbjct  374   VQQGSTMDTRITKHFNIPPASLPIIPVAFLIIIIPFYDRICVPFLRKCTGIPTGITHLQR  433

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADM  1496
             + +GL+LSS+SMA AAI+E+KRK VAR+ NMLDA+P+ QPLP+S+FWLS QYFIFGIADM
Sbjct  434   IGIGLILSSISMAIAAIIEVKRKGVARDNNMLDAVPVKQPLPLSIFWLSFQYFIFGIADM  493

Query  1497  FTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGG  1676
             FTYVGLLEFFYS+APK LKS S+CFLW SM+ GYF SS+LVK+VN ATK  T SGGWL G
Sbjct  494   FTYVGLLEFFYSEAPKGLKSTSTCFLWCSMATGYFLSSILVKIVNIATKNTTTSGGWLAG  553

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NN+NRNHL LFY  LS LS  NF VYL VSKRYKYR Q
Sbjct  554   NNINRNHLNLFYLFLSILSLTNFSVYLLVSKRYKYRPQ  591



>ref|XP_003629872.1| Nitrate/chlorate transporter [Medicago truncatula]
 gb|AET04348.1| peptide/nitrate transporter [Medicago truncatula]
Length=587

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/575 (63%), Positives = 451/575 (78%), Gaps = 8/575 (1%)
 Frame = +3

Query  87    ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLAD  266
             EL+DGKVDWRGR A + KHGG++ S+ +LG F FE+MAT+ L V  V+Y  G+M+  LAD
Sbjct  4     ELVDGKVDWRGRRAVRHKHGGMKVSLLVLGAFAFESMATLALAVNFVSYFIGIMHYELAD  63

Query  267   AANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPP  446
             AAN VTNF G + +L+IV AVLAD++IGR++ VLIS + E LGL LL +QAHY  LKP  
Sbjct  64    AANMVTNFMGVSNLLSIVVAVLADSFIGRYKTVLISGFFECLGLALLTVQAHYPNLKPAI  123

Query  447   CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             CN LDK   CE++ G + A LF++LY +A GSAG+KA++P+HGADQFDEKD KE  +MSS
Sbjct  124   CNLLDKNAVCEKINGNHEAFLFISLYLLAFGSAGLKASLPAHGADQFDEKDPKETRQMSS  183

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFN LLL VC+GG+VSLT  VW+   KGWDWGF  ST+A+ F  I F LGLP YR++  Q
Sbjct  184   FFNALLLAVCIGGSVSLTFNVWIQNSKGWDWGFGISTIAIVFAMIIFALGLPLYRIHAAQ  243

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA  986
              ++ I +I+QV++AAI NR L  P DS ELYEI  DKEA  +  E+LPH D +RFLDKAA
Sbjct  244   RTNCIIEILQVYIAAIRNRNLPHPADSEELYEIEHDKEA-AVEIEYLPHRDIFRFLDKAA  302

Query  987   IQTSWD-------EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             I+   D       E PNPW++CRVTQVENAKI+L+++P+F CT+IMTLCLAQLQTFS+QQ
Sbjct  303   IERKSDDLQSEKQEIPNPWKLCRVTQVENAKIILSMIPIFCCTIIMTLCLAQLQTFSVQQ  362

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             G TMD  ITK F I P SLP +PI FL+ +IP+YDR+ VP +R+ TGIPTG+T L R+ V
Sbjct  363   GFTMDTRITKHFNIPPPSLPIIPIGFLVIIIPVYDRICVPVLRKFTGIPTGVTHLQRIGV  422

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTY  1505
             GL+LS +SMA AAI+E+KRK VAR+ NMLDA+P +QPLP+S+FWLS QYF+FGIADMFTY
Sbjct  423   GLILSCISMAIAAIIEVKRKNVARDNNMLDAVPGVQPLPLSIFWLSFQYFVFGIADMFTY  482

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             VGLLEFFYS+APK LKS S+CFLWSSM+LGYF SS++V++VN ATK +T SGGWL GNN+
Sbjct  483   VGLLEFFYSEAPKGLKSTSTCFLWSSMALGYFLSSIMVQIVNNATKNVTASGGWLAGNNI  542

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NRNHL LFY LLS +S +NFFVYL +SKRYKYR Q
Sbjct  543   NRNHLNLFYLLLSLISLINFFVYLVISKRYKYRPQ  577



>ref|XP_004504417.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Cicer arietinum]
Length=588

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/573 (63%), Positives = 453/573 (79%), Gaps = 3/573 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             ++ EL+DGKVDWRGR A + KHGG++ S+ +LG F FENMAT+ L V LV+Y N +M+  
Sbjct  2     QEEELVDGKVDWRGRVAVRHKHGGMKVSLLVLGAFAFENMATLSLAVNLVSYFNSIMHYE  61

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LADAAN VTNF G +YIL+IV AVLADT+IGR+++VL S + E LGL LL +QAH   L+
Sbjct  62    LADAANMVTNFMGVSYILSIVVAVLADTWIGRYKSVLFSGFFECLGLALLTVQAHSTNLR  121

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             P  CN  DK   CE+++G + A LF+ LY +A GSAG+KA++PSHGADQFDE+D KE  +
Sbjct  122   PALCNLYDKNAVCEKISGNHEAFLFIGLYLLAFGSAGLKASLPSHGADQFDERDPKEAKQ  181

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFN LLL VCVGG+VSLT  VW+   KGWDWGF  ST+A+    I F  GLP YR++
Sbjct  182   MSSFFNGLLLAVCVGGSVSLTFNVWIQNSKGWDWGFGVSTIAIVLATIIFAFGLPLYRIH  241

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             V Q ++ I +I+QV++AAI NR + LP DS ELYEI +DKEA  +  E++PH D +RFLD
Sbjct  242   VAQRTNCIIEILQVYIAAIRNRNIPLPADSIELYEIEQDKEA-AMELEYVPHRDIFRFLD  300

Query  978   KAAIQ--TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             KAAI+  +   E PNPW++CRVTQVENAKI+L+++P+F CT+IMTLCLAQLQTFS+QQG 
Sbjct  301   KAAIERKSEKQEVPNPWKLCRVTQVENAKIILSMIPIFCCTIIMTLCLAQLQTFSVQQGF  360

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             TMD  ITK F I P+SLP +P+ FLI +IP YDR+ VP +R+ TGIPTG+T L R+ VGL
Sbjct  361   TMDTRITKHFNIPPASLPIIPVAFLIIIIPFYDRICVPLLRKFTGIPTGVTHLQRIGVGL  420

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
             +LS +SM  A+I+E+KRK VAR+ NMLDA+P +QPLP+S+FWLS QYF+FGIADMFTYVG
Sbjct  421   ILSCISMGIASIIEVKRKTVARDNNMLDAVPGVQPLPLSIFWLSFQYFVFGIADMFTYVG  480

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             LLEFFYS+APK LKS S+CFLWSSM+LGYF SS++V++VN ATK +T SGGWL GNN+NR
Sbjct  481   LLEFFYSEAPKGLKSTSTCFLWSSMALGYFLSSIMVQIVNSATKNVTASGGWLAGNNINR  540

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NHL LFY LLS LS +NFFVYL VSKRYKYR Q
Sbjct  541   NHLNLFYLLLSLLSLINFFVYLLVSKRYKYRPQ  573



>ref|XP_010088624.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB36786.1| putative peptide/nitrate transporter [Morus notabilis]
Length=603

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/583 (62%), Positives = 447/583 (77%), Gaps = 9/583 (2%)
 Frame = +3

Query  69    NSQEKY--ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             N ++K   E+++GKVDW+GR A K KHGGIRAS+ IL  FGFEN+AT+   V +VTY  G
Sbjct  6     NQEDKKLPEIVEGKVDWKGRVAIKYKHGGIRASLLILATFGFENLATLGPAVNMVTYFIG  65

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
             +++  +ADA+N +TNF G +YIL+IV AV ADT++GRF+  +  A +E LGLGLLA+QAH
Sbjct  66    LLHFGVADASNTLTNFMGTSYILSIVMAVFADTFVGRFKITVAGACLEILGLGLLAIQAH  125

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
             Y  LKP PCN  D    CE+++G   A+LF+ LY  A+G    KA +P+HGADQFDEKD 
Sbjct  126   YPSLKPAPCNAFDPTANCEKLSGSQKALLFIGLYLWAIGGGATKAGLPAHGADQFDEKDP  185

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             KE  +MS+FFN LLL VC+GGAVS+TL VW+  +KGWDWGF  ST+AM      F  GLP
Sbjct  186   KEAKQMSTFFNSLLLAVCIGGAVSITLLVWIQDNKGWDWGFGVSTIAMILAVFLFVAGLP  245

Query  783   FYRVYVI-QGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTD  959
              YR+ +I   ++   +II+VFVAAI NR L LPED  +LYE++KDKEA  +  EFLPHTD
Sbjct  246   MYRLQIIGDPTNPAAEIIRVFVAAIRNRNLSLPEDPTDLYELNKDKEA-ALETEFLPHTD  304

Query  960   KYRFLDKAAI--QTSWDEE---PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
              +RFLDKAAI    ++  E   PNPWR+CRVTQVENAK L  ++P+F CT+IMTLCLAQL
Sbjct  305   TFRFLDKAAIISDVTYQPETSPPNPWRLCRVTQVENAKTLHGMIPIFGCTIIMTLCLAQL  364

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFSIQQ  TMD +I  +F+I  +SLP LP+ FLI +IP YDR+ VP +R+ TG+PTGIT
Sbjct  365   QTFSIQQAQTMDKSINSNFEIPAASLPILPVAFLIVIIPFYDRIAVPFIRKFTGVPTGIT  424

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
              L R+ VGL+LS++SMA AAILE+KRK VARE N+LDA P  QPLPIS+FWLS Q+FIFG
Sbjct  425   HLQRIGVGLVLSAISMAVAAILEVKRKAVAREHNLLDANPKTQPLPISIFWLSFQFFIFG  484

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGG  1664
             IADMFTYVGLLEFFYS+APK LKS+S+CFLW SM+LGYF S+VLVK+VN ATKG+T SGG
Sbjct  485   IADMFTYVGLLEFFYSEAPKALKSLSTCFLWCSMALGYFCSTVLVKMVNRATKGITRSGG  544

Query  1665  WLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             WL GNN+NRNHL LFY LLS LS +NF VYLF + RYKYR QI
Sbjct  545   WLAGNNINRNHLNLFYWLLSILSLINFSVYLFAAWRYKYRAQI  587



>ref|XP_003541681.1| PREDICTED: nitrate transporter 1.2-like [Glycine max]
Length=596

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/583 (62%), Positives = 441/583 (76%), Gaps = 7/583 (1%)
 Frame = +3

Query  66    INSQEKYELID-GKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             +  + + EL+D  KVDW+GR A K K+GG+ AS+ IL + GFEN+ T  L V  V Y +G
Sbjct  10    VKEEAEIELVDENKVDWKGRQALKFKYGGMSASVLILAMIGFENLGTFSLAVNSVPYFSG  69

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
             +M+ ++ DAAN +TN+ G  YIL I  AVLADT+IGR+R+VLIS   EFLGL LL  QAH
Sbjct  70    IMHYSIPDAANMLTNYMGTGYILAIPVAVLADTWIGRYRSVLISGVFEFLGLALLTAQAH  129

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
             Y  LKPP CN  D    CE  +G   A+LF+ LY +A GSAGVKAA+PSHGADQFDEKD 
Sbjct  130   YPSLKPPLCNIYDITAHCETPSGGQEALLFIGLYLLAFGSAGVKAALPSHGADQFDEKDP  189

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             +E   MS+FFN LLL +C+GGA SLT  VW+  +KGWDWGF   T+A+F G + F  GLP
Sbjct  190   REARLMSTFFNTLLLAICLGGAFSLTFIVWIQINKGWDWGFGIGTIAIFLGIVLFAAGLP  249

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
              YR  V QG++A  +IIQV+VA I NR L LPED  ELYEI +DKEA     EFLPH D 
Sbjct  250   LYRFRVGQGTNAFIEIIQVYVATIRNRNLPLPEDPIELYEIEQDKEAAEEI-EFLPHRDT  308

Query  963   YRFLDKAAIQTSW----DEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
              RFLD+AAIQ       ++ P+PW++CRVTQVENAKI+L + P+F CT+IMTLCLAQLQT
Sbjct  309   LRFLDRAAIQIKQGVQSEKPPSPWKLCRVTQVENAKIVLGMTPIFCCTIIMTLCLAQLQT  368

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FSIQQG TMD   TK F I P+SLP +PI FLI ++P+YD +FVP MR++TGIPTG+T L
Sbjct  369   FSIQQGYTMDTTFTKHFHIPPASLPIIPISFLIIIMPIYDFIFVPVMRKITGIPTGVTHL  428

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQ-PLPISVFWLSIQYFIFGI  1487
              R+ VGL+LS +SMA A+I+E+KRK+VAR+ NMLDA+PIL  PLPIS FWLS QYFIFGI
Sbjct  429   QRIGVGLVLSCISMAVASIIEVKRKRVARDNNMLDAVPILMPPLPISTFWLSFQYFIFGI  488

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ADMFTYVGLL+FFYS+APK LKS S+CFLWSSM+LGYF S+++VK VNGATK +T SGGW
Sbjct  489   ADMFTYVGLLQFFYSEAPKGLKSTSTCFLWSSMALGYFASTIVVKCVNGATKHITSSGGW  548

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQIG  1796
             L GNN+NRNHL LFY  LS +S +NFF+YL VS RYKYR Q G
Sbjct  549   LAGNNINRNHLNLFYLFLSIVSLINFFIYLIVSMRYKYRSQPG  591



>gb|AET04345.2| peptide/nitrate transporter [Medicago truncatula]
Length=586

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/574 (64%), Positives = 449/574 (78%), Gaps = 7/574 (1%)
 Frame = +3

Query  87    ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLAD  266
             EL+DGKVDW+GR A + KHGG++ S+ ILG F  ENMAT  L V  V+Y  G M+  LAD
Sbjct  4     ELVDGKVDWKGRRAVRHKHGGMKVSLVILGAFALENMATFALAVNFVSYFVGFMHYELAD  63

Query  267   AANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPP  446
             AAN VTNF G  Y+L+IV AV ADT+IGR ++VLIS   EFLGL LL +QAHY  LKP  
Sbjct  64    AANMVTNFMGVCYMLSIVVAVFADTWIGRHKSVLISGCFEFLGLALLTVQAHYPNLKPAI  123

Query  447   CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             CN  DK   CE+++G + A L + LY +A GSAG+KA++P+HGADQFDEKD KE  +MSS
Sbjct  124   CNLYDKNAVCEKISGNHEAFLLIGLYLLAFGSAGLKASLPAHGADQFDEKDPKETRQMSS  183

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFN LLL +CVGG+VSLT  VW+  +KGWD G   ST+A+ F  I F  GLP YR++V Q
Sbjct  184   FFNGLLLAICVGGSVSLTFNVWIQDNKGWDLGLGISTIAIVFAMITFAFGLPLYRIHVAQ  243

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA  986
              ++ I +I+QV++AAI NR L LP DSGELYEI +DKEA+ +  E+LPH D YRFLDKAA
Sbjct  244   RTNPIVEILQVYIAAIRNRNLSLPADSGELYEIEQDKEAL-MEIEYLPHRDIYRFLDKAA  302

Query  987   IQTSWD------EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             I+   D      E P+PW++CRVTQVENAKI L+++PVF CT+IMTLCLAQLQTFS+QQG
Sbjct  303   IERKSDVQLEKQENPSPWKLCRVTQVENAKIFLSMIPVFFCTIIMTLCLAQLQTFSVQQG  362

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  ITK F I P+SLP +P++FLIF+IP YDR+ VP +R+ TGIPTGIT L R+ VG
Sbjct  363   FTMDTRITKHFNIPPASLPIIPVVFLIFIIPFYDRICVPLLRKFTGIPTGITHLQRIGVG  422

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS +SMA AAI+E+KRK VAR+ NMLDA+P +QPLP+S+FWLS QYF+FGIADMFTYV
Sbjct  423   LILSCISMAIAAIIEVKRKNVARDNNMLDAVPGVQPLPLSIFWLSFQYFVFGIADMFTYV  482

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYS+APK LKS S+CFLWSSM+LGYF SS++V++VN ATK +T SGGWL GNN+N
Sbjct  483   GLLEFFYSEAPKGLKSTSTCFLWSSMALGYFLSSIMVQIVNSATKNVTASGGWLAGNNIN  542

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             RNHL LFY LLS LS +NFFVYL VSKRYKYR Q
Sbjct  543   RNHLNLFYLLLSLLSLINFFVYLVVSKRYKYRPQ  576



>ref|XP_003547187.2| PREDICTED: nitrate transporter 1.2-like [Glycine max]
Length=599

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/581 (62%), Positives = 442/581 (76%), Gaps = 7/581 (1%)
 Frame = +3

Query  66    INSQEKYELID-GKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             +  +  ++L+D  KVDW+GR A K K+GG+ AS+ IL + GFEN+ T  L V  V Y +G
Sbjct  9     VKEEADFQLVDENKVDWKGRRALKFKYGGMCASVLILAMIGFENLGTFSLAVNSVPYFSG  68

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
             +M+ ++ DAAN +TN+ G  YIL I  AVLADT+IGR+R+VLIS   EF+GL LL  QAH
Sbjct  69    IMHYSIPDAANMLTNYMGTGYILAIPVAVLADTWIGRYRSVLISGVFEFVGLALLTAQAH  128

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
             Y  LKPP CN  D    C+  +G   A+LF+ LY +A G+AGVKAA+PSHGADQFDEKD 
Sbjct  129   YPSLKPPLCNIYDITAHCKTPSGGQEALLFIGLYLLAFGTAGVKAALPSHGADQFDEKDP  188

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             +E   MS+FFN LLL +C GGAVSLT  VW+  +KGWDWGF   T+A+F G + F  GLP
Sbjct  189   REERRMSTFFNTLLLAICFGGAVSLTFIVWIQINKGWDWGFGIGTIAIFLGIVIFAAGLP  248

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
              YR  V QG++A  +IIQV+VAAI NR L LPED  ELYEI +DKEA     EFLPH D 
Sbjct  249   LYRFRVGQGTNAFNEIIQVYVAAIRNRNLPLPEDPTELYEIEQDKEAAEEI-EFLPHRDT  307

Query  963   YRFLDKAAIQTS---WDEEP-NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
              RFLD+AAIQ       E+P +PW++CRVTQVENAKI+L ++P+F CT+IMTLCLAQLQT
Sbjct  308   LRFLDRAAIQIKHGVQSEKPSSPWKLCRVTQVENAKIVLGMIPIFCCTIIMTLCLAQLQT  367

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FSIQQG TMD   TK F I P+SLP +P+ FLI ++P+YD +FVP MR++TGIPTG+T L
Sbjct  368   FSIQQGYTMDTTFTKHFHIPPASLPIIPVSFLIIIVPIYDFIFVPVMRKITGIPTGVTHL  427

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQ-PLPISVFWLSIQYFIFGI  1487
              R+ VGL+LS +SMA A+++E+KRK+VAR+ NMLDA+PIL  PLPIS FWLS QYFIFGI
Sbjct  428   QRIGVGLVLSCISMAVASVIEVKRKRVARDNNMLDAVPILMPPLPISTFWLSFQYFIFGI  487

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ADMFTYVGLL+FFYS+APK LKS S+CFLWSSM+LGYF S+++VK VNGATK +T SGGW
Sbjct  488   ADMFTYVGLLQFFYSEAPKGLKSTSTCFLWSSMALGYFASTIVVKSVNGATKHITSSGGW  547

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L GNN+NRNHL LFY  LS +S +NFF+YL VS RYKYR Q
Sbjct  548   LAGNNINRNHLNLFYLFLSIVSLINFFIYLLVSMRYKYRSQ  588



>gb|KHN06924.1| Nitrate transporter 1.2 [Glycine soja]
Length=600

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/581 (62%), Positives = 442/581 (76%), Gaps = 7/581 (1%)
 Frame = +3

Query  66    INSQEKYELID-GKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             +  +  ++L+D  KVDW+GR A K K+GG+ AS+ IL + GFEN+ T  L V  V Y +G
Sbjct  10    VKEEADFQLVDENKVDWKGRRALKFKYGGMCASVLILAMIGFENLGTFSLAVNSVPYFSG  69

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
             +M+ ++ DAAN +TN+ G  YIL I  AVLADT+IGR+R+VLIS   EF+GL LL  QAH
Sbjct  70    IMHYSIPDAANMLTNYMGTGYILAIPVAVLADTWIGRYRSVLISGVFEFVGLALLTAQAH  129

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
             Y  LKPP CN  D    C+  +G   A+LF+ LY +A GSAGVKAA+PSHGADQFDEKD 
Sbjct  130   YPSLKPPLCNIYDITAHCKTPSGGQEALLFIGLYLLAFGSAGVKAALPSHGADQFDEKDP  189

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             +E   MS+FFN LLL +C GGAVSLT  VW+  +KGWDWGF   T+A+F G + F  GLP
Sbjct  190   REERRMSTFFNTLLLAICFGGAVSLTFIVWIQINKGWDWGFGIGTIAIFLGIVIFAAGLP  249

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
              YR  V QG++A  +IIQV+VAAI NR L LPE+  ELYEI +DKEA     EFLPH D 
Sbjct  250   LYRFRVGQGTNAFNEIIQVYVAAIRNRNLPLPENPTELYEIEQDKEAAEEI-EFLPHRDT  308

Query  963   YRFLDKAAIQTS---WDEEP-NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
              RFLD+AAIQ       E+P +PW++CRVTQVENAKI+L ++P+F CT+IMTLCLAQLQT
Sbjct  309   LRFLDRAAIQIKHGVQSEKPSSPWKLCRVTQVENAKIVLGMIPIFCCTIIMTLCLAQLQT  368

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FSIQQG TMD   TK F I P+SLP +P+ FLI ++P+YD +FVP MR++TGIPTG+T L
Sbjct  369   FSIQQGYTMDTTFTKHFHIPPASLPIIPVSFLIIIVPIYDFIFVPVMRKITGIPTGVTHL  428

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQ-PLPISVFWLSIQYFIFGI  1487
              R+ VGL+LS +SMA A+++E+KRK+VAR+ NMLDA+PIL  PLPIS FWLS QYFIFGI
Sbjct  429   QRIGVGLVLSCISMAVASVIEVKRKRVARDNNMLDAVPILMPPLPISTFWLSFQYFIFGI  488

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ADMFTYVGLL+FFYS+APK LKS S+CFLWSSM+LGYF S+++VK VNGATK +T SGGW
Sbjct  489   ADMFTYVGLLQFFYSEAPKGLKSTSTCFLWSSMALGYFASTIVVKSVNGATKHITSSGGW  548

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L GNN+NRNHL LFY  LS +S +NFF+YL VS RYKYR Q
Sbjct  549   LAGNNINRNHLNLFYLFLSIVSLINFFIYLLVSMRYKYRSQ  589



>ref|XP_007147975.1| hypothetical protein PHAVU_006G170100g [Phaseolus vulgaris]
 gb|ESW19969.1| hypothetical protein PHAVU_006G170100g [Phaseolus vulgaris]
Length=589

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/581 (61%), Positives = 441/581 (76%), Gaps = 10/581 (2%)
 Frame = +3

Query  75    QEKYELID----GKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             QEK E++D     K DW+GR A K ++GG+ A++ +L + GFEN+ T  L V  V Y +G
Sbjct  2     QEKLEVVDVVDENKEDWKGRRALKLEYGGMSAAVLVLVMIGFENLGTFALAVNSVPYFSG  61

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
             +M+ ++ DAAN +TN+ G  YIL I  A+LADT+IGR+R VLIS  +EFLGL L+  QAH
Sbjct  62    IMHYSIPDAANMLTNYMGTGYILAIPVAILADTWIGRYRTVLISGVVEFLGLALITAQAH  121

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
             Y+ LKPP CN  D    C+       A+L++ LY +A GSAG KA++PSHGADQFDE D 
Sbjct  122   YSSLKPPSCNVYDITAHCKTPNDGQEALLYIGLYLLAFGSAGAKASLPSHGADQFDETDP  181

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             +E S+MS+FFN LLL VC+GGAVSLT  VW+  +KGWDWGF   T+A+  G I F  GLP
Sbjct  182   EEASKMSTFFNTLLLAVCMGGAVSLTFIVWIQINKGWDWGFGIGTIAILLGIIIFAAGLP  241

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
              YR  V QG++   +IIQV+VAA  NR L LPED  ELYEI++DKEA  +  EFLPH D 
Sbjct  242   LYRFRVGQGTNDFVEIIQVYVAATLNRNLLLPEDPAELYEINQDKEA-AVEIEFLPHRDF  300

Query  963   YRFLDKAAIQTSWDEE----PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
              RFLD+AAIQ   D E    P+PW++CRVTQVENAKI+L+++P+F CT+IMTLCLAQLQT
Sbjct  301   LRFLDRAAIQVKHDVESEKPPSPWKLCRVTQVENAKIVLSMIPIFCCTIIMTLCLAQLQT  360

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FSIQQG TMD   TK F I P+SLP +PI FLI  +P+YDR+FVP MR++TGIPTG+T L
Sbjct  361   FSIQQGYTMDNTFTKHFHIPPASLPIIPICFLIITVPIYDRIFVPVMRKVTGIPTGVTHL  420

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQ-PLPISVFWLSIQYFIFGI  1487
              R+ VGL+LS +SMA A+I+E+KRK+VAR+ NMLDA+PIL  PLPIS FWLS QYFIFGI
Sbjct  421   QRIGVGLVLSCISMAVASIVEVKRKRVARDNNMLDAVPILMPPLPISTFWLSFQYFIFGI  480

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ADMFTYVGLL+FFYS+APK LKS S+CFLWSSM+LGYF S+++VK VNGATK +T SGGW
Sbjct  481   ADMFTYVGLLQFFYSEAPKGLKSTSTCFLWSSMALGYFASTIVVKSVNGATKHITRSGGW  540

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L GNN+NRNHL LFY  LS +S +NFF+YL VS RYKYR Q
Sbjct  541   LAGNNINRNHLNLFYLFLSIVSLLNFFIYLVVSTRYKYRSQ  581



>ref|XP_003593801.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES64052.1| peptide/nitrate transporter [Medicago truncatula]
Length=602

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/581 (61%), Positives = 451/581 (78%), Gaps = 11/581 (2%)
 Frame = +3

Query  75    QEKYELIDG-KVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMN  251
             + + +L+DG KVDW+GR+A K K+GG++A++ +L   G EN+AT  L V  V Y  G+M+
Sbjct  12    EAELQLVDGNKVDWKGRSALKFKYGGMKAALLMLVTLGLENLATFSLAVNSVPYFMGIMH  71

Query  252   VNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAK  431
               L DAAN +TN+ G +YIL+I+ A++ADT+IGR+++VL S + EFLGL LL +QAHY  
Sbjct  72    YQLEDAANMLTNYMGVSYILSILVAIVADTWIGRYKSVLFSGFFEFLGLALLTVQAHYPS  131

Query  432   LKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEG  611
             LKP  CN  D    C+  +    AILF+ LY +A GSAG KAA+PSHGADQFDE D KE 
Sbjct  132   LKPKECNVNDITVHCKTPSRGQEAILFIGLYLLAFGSAGTKAALPSHGADQFDESDPKEE  191

Query  612   SEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYR  791
              +MS+FFN LLL VC+GGAVSLT  VW+  +KGWDWGF   T+A+F G + F  GLP YR
Sbjct  192   KKMSTFFNVLLLAVCMGGAVSLTFIVWIQINKGWDWGFGIGTIAIFLGTVIFAAGLPLYR  251

Query  792   VYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRF  971
             + V  G+S + +IIQV+VAAI NR L LPED  ELYEI +DKEA +   EFLPH D +RF
Sbjct  252   IQVATGNSVLLEIIQVYVAAIRNRNLHLPEDPKELYEIEQDKEA-SEEIEFLPHRDIFRF  310

Query  972   LDKAAIQTSWD------EEP--NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             LDKAAI +  D      E P  +PW++CRVTQVENAKILL++VP+F CT+IMTLCLAQLQ
Sbjct  311   LDKAAIDSKPDMQSGKSEAPSTSPWKLCRVTQVENAKILLSMVPIFCCTIIMTLCLAQLQ  370

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFSI+QG TMD  +TK F I P+SLPF+PI+FLI L+P+YDR+FVP +R+ TGIPTG+T 
Sbjct  371   TFSIEQGYTMDTKVTKHFHIPPASLPFIPIMFLIILVPIYDRIFVPVIRKFTGIPTGVTH  430

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+ VGL+L+S+SMA A+I+E+KRK+VA + NMLDA+P+ QPLPIS FWLS QYFIFGI
Sbjct  431   LQRIGVGLILASVSMAVASIIEVKRKRVANDNNMLDALPVYQPLPISTFWLSFQYFIFGI  490

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             AD+FTY+GLL+FFYS+APK LKS S+CFLW+SM+LGYF S+++VK +NGATK  T+SGGW
Sbjct  491   ADIFTYIGLLQFFYSEAPKGLKSTSTCFLWTSMALGYFLSTIVVKCINGATK-HTKSGGW  549

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L GNN+NRNHL LFY  LS +S +NFFVYLFVSKRYKYR Q
Sbjct  550   LIGNNINRNHLNLFYLFLSIVSLINFFVYLFVSKRYKYRPQ  590



>ref|XP_004486281.1| PREDICTED: nitrate transporter 1.2-like [Cicer arietinum]
Length=602

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/581 (61%), Positives = 448/581 (77%), Gaps = 12/581 (2%)
 Frame = +3

Query  78    EKYELIDG-KVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             ++ +L+DG KVDW+GR+A K K+GG++A+  IL   G EN+AT  L V  V Y NGVM+ 
Sbjct  9     DRNQLVDGNKVDWKGRSALKFKYGGMKAAFLILTTLGLENLATFSLAVNSVPYFNGVMHY  68

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              L DAAN +TN+ G +YIL+I+ AVLADT+IGR+++VL S + EFLGL LL  QAHY  L
Sbjct  69    ELEDAANMLTNYMGVSYILSILVAVLADTWIGRYKSVLFSGFFEFLGLALLTTQAHYPSL  128

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPP CN  D    C+  +      LF+ LY +A GS+G KAA+PSHGADQFDE D KE +
Sbjct  129   KPPFCNVNDPTTICKIPSVGQKYFLFIGLYLLAFGSSGAKAALPSHGADQFDESDPKEAN  188

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MS++FN LLL VC+GGAVSLT  VW+  +KGWDWGF   T+A+F G I F  GLP YR+
Sbjct  189   QMSTYFNTLLLAVCMGGAVSLTFIVWIQINKGWDWGFGIGTIAIFLGTIIFAAGLPLYRI  248

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
              V  G+S + +I+QV+VAAI NR L LPED  +LYEI +DKEA  +  EFLPH D +RFL
Sbjct  249   QVAIGTSGLIEIMQVYVAAIRNRNLPLPEDPADLYEIEQDKEA-AMEIEFLPHRDIFRFL  307

Query  975   DKAAIQTSWD------EEP---NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             D+AAI +  D      + P   +PW++CRVTQVENAKI+L++VP+F CT+IMTLCLAQLQ
Sbjct  308   DRAAINSKPDIQLEKSQAPSTTSPWKLCRVTQVENAKIILSMVPIFCCTIIMTLCLAQLQ  367

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFSIQQG TMD ++TK F I P+SLP +PI+FLI L+P+YDR+FVP  R+ TGIPTG+T 
Sbjct  368   TFSIQQGYTMDTSLTKHFHIPPASLPIIPIMFLIILVPIYDRVFVPLTRKFTGIPTGVTQ  427

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+ VGL+L+SLSMA A+I+E+KRK VAR+ NMLDA P+LQPLPI+ FWLS QYFIFGI
Sbjct  428   LQRIGVGLILASLSMAVASIIEVKRKTVARDHNMLDAFPVLQPLPITTFWLSFQYFIFGI  487

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ADMFTY+GLL+FFYS+APK LKS S+CFLWSSM+LGYF S+++VK +NG TK  +++GGW
Sbjct  488   ADMFTYIGLLQFFYSEAPKGLKSTSTCFLWSSMALGYFLSTIVVKSINGVTK-HSKNGGW  546

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L GNN+NRNHL LFY  LS +S +NFFVYLFVSKRYKYR Q
Sbjct  547   LEGNNINRNHLNLFYLFLSIVSLINFFVYLFVSKRYKYRPQ  587



>ref|XP_007159500.1| hypothetical protein PHAVU_002G242900g [Phaseolus vulgaris]
 gb|ESW31494.1| hypothetical protein PHAVU_002G242900g [Phaseolus vulgaris]
Length=601

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/573 (62%), Positives = 443/573 (77%), Gaps = 7/573 (1%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             L+DGKVDW+GR A K KHGG++ S+ IL  FG EN+AT+ L V LV+Y N  M+  LADA
Sbjct  22    LVDGKVDWKGRKALKHKHGGMKVSLLILAAFGMENLATLSLAVNLVSYFNQNMHYELADA  81

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VT++ G +Y+L+IV AVLADT+IGR+++V+IS + E LGL LL +QAH A ++ P C
Sbjct  82    ANMVTDYMGVSYMLSIVVAVLADTWIGRYKSVVISGFFESLGLALLTIQAHRASIESPIC  141

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             N  +K   CE+V+G+  A LF+ LY +A GS+GVKA++PSHGADQFDEKD KE  +MS+F
Sbjct  142   NVYEKGVVCEKVSGKLEAFLFIGLYLLAFGSSGVKASLPSHGADQFDEKDPKEALQMSTF  201

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN L L +C+GGAVSLT  V++  + GW WGF  ST A+ F  + F LGLP Y ++V + 
Sbjct  202   FNSLFLALCIGGAVSLTFNVYIQNNNGWVWGFGISTAAIVFATLIFALGLPLYPIHVARI  261

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
             ++ I +I QV+VAAI NR L LP +  ELYEI KDKEA  +  E  PHTD YRFLDKAAI
Sbjct  262   TNGIMEIAQVYVAAIRNRNLPLPPNPNELYEIDKDKEA-AVEIECQPHTDIYRFLDKAAI  320

Query  990   QTS---WDEE---PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             Q      DE    PNPW++CRVTQVENAKI+L+++P+F C++IMTLCLAQLQTFSIQQGS
Sbjct  321   QRKSNVQDENQKTPNPWKLCRVTQVENAKIILSMLPIFCCSIIMTLCLAQLQTFSIQQGS  380

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             TM+  I K F I P+S+P  P++FLI  +P YDR+ VP + R TGI TGIT L R+ VGL
Sbjct  381   TMNTRIAKHFHIPPASIPIFPVVFLILFVPFYDRICVPFLSRFTGISTGITHLQRIGVGL  440

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
             +LSSLSMAAAAI+E+KRK VAR+ NMLDA P+LQPLP+S+FWLS QYF+F IADMFTYVG
Sbjct  441   VLSSLSMAAAAIIEVKRKGVARDSNMLDAFPVLQPLPLSIFWLSFQYFLFAIADMFTYVG  500

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             LLEFFYS+APK LKS S+CFLW +M++GYF SS+LVK+VN ATK +T SGGWL GNN+NR
Sbjct  501   LLEFFYSEAPKSLKSTSTCFLWCAMAIGYFLSSILVKIVNSATKNITASGGWLAGNNINR  560

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NHL LFY LLS LS +NFF+YL VSKRYKYR Q
Sbjct  561   NHLNLFYWLLSILSLINFFLYLLVSKRYKYRAQ  593



>ref|XP_003629869.1| Nitrate/chlorate transporter [Medicago truncatula]
Length=602

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/590 (62%), Positives = 449/590 (76%), Gaps = 23/590 (4%)
 Frame = +3

Query  87    ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLAD  266
             EL+DGKVDW+GR A + KHGG++ S+ ILG F  ENMAT  L V  V+Y  G M+  LAD
Sbjct  4     ELVDGKVDWKGRRAVRHKHGGMKVSLVILGAFALENMATFALAVNFVSYFVGFMHYELAD  63

Query  267   AANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPP  446
             AAN VTNF G  Y+L+IV AV ADT+IGR ++VLIS   EFLGL LL +QAHY  LKP  
Sbjct  64    AANMVTNFMGVCYMLSIVVAVFADTWIGRHKSVLISGCFEFLGLALLTVQAHYPNLKPAI  123

Query  447   CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             CN  DK   CE+++G + A L + LY +A GSAG+KA++P+HGADQFDEKD KE  +MSS
Sbjct  124   CNLYDKNAVCEKISGNHEAFLLIGLYLLAFGSAGLKASLPAHGADQFDEKDPKETRQMSS  183

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFN LLL +CVGG+VSLT  VW+  +KGWD G   ST+A+ F  I F  GLP YR++V Q
Sbjct  184   FFNGLLLAICVGGSVSLTFNVWIQDNKGWDLGLGISTIAIVFAMITFAFGLPLYRIHVAQ  243

Query  807   GSSAITQIIQ----------------VFVAAIHNRKLQLPEDSGELYEISKDKEAVTICA  938
              ++ I +I+Q                V++AAI NR L LP DSGELYEI +DKEA+ +  
Sbjct  244   RTNPIVEILQVYYIKLARVQTATNMVVYIAAIRNRNLSLPADSGELYEIEQDKEAL-MEI  302

Query  939   EFLPHTDKYRFLDKAAIQTSWD------EEPNPWRVCRVTQVENAKILLNLVPVFLCTVI  1100
             E+LPH D YRFLDKAAI+   D      E P+PW++CRVTQVENAKI L+++PVF CT+I
Sbjct  303   EYLPHRDIYRFLDKAAIERKSDVQLEKQENPSPWKLCRVTQVENAKIFLSMIPVFFCTII  362

Query  1101  MTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRL  1280
             MTLCLAQLQTFS+QQG TMD  ITK F I P+SLP +P++FLIF+IP YDR+ VP +R+ 
Sbjct  363   MTLCLAQLQTFSVQQGFTMDTRITKHFNIPPASLPIIPVVFLIFIIPFYDRICVPLLRKF  422

Query  1281  TGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWL  1460
             TGIPTGIT L R+ VGL+LS +SMA AAI+E+KRK VAR+ NMLDA+P +QPLP+S+FWL
Sbjct  423   TGIPTGITHLQRIGVGLILSCISMAIAAIIEVKRKNVARDNNMLDAVPGVQPLPLSIFWL  482

Query  1461  SIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT  1640
             S QYF+FGIADMFTYVGLLEFFYS+APK LKS S+CFLWSSM+LGYF SS++V++VN AT
Sbjct  483   SFQYFVFGIADMFTYVGLLEFFYSEAPKGLKSTSTCFLWSSMALGYFLSSIMVQIVNSAT  542

Query  1641  KGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             K +T SGGWL GNN+NRNHL LFY LLS LS +NFFVYL VSKRYKYR Q
Sbjct  543   KNVTASGGWLAGNNINRNHLNLFYLLLSLLSLINFFVYLVVSKRYKYRPQ  592



>ref|XP_006580182.1| PREDICTED: nitrate transporter 1.2-like [Glycine max]
Length=606

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/574 (61%), Positives = 445/574 (78%), Gaps = 8/574 (1%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             ++ GKVDW+GR A K KHGG++ S+ +L  FG EN+AT+ L V  V+Y  G+M+  LADA
Sbjct  23    VVHGKVDWKGRKALKHKHGGMKVSLLVLAAFGMENLATLSLAVNFVSYFTGIMHYELADA  82

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTN+ G  Y+L+IV AVLADT+IGR+++V+IS  +E LGL LL +QA    L PP C
Sbjct  83    ANMVTNYMGVNYMLSIVVAVLADTWIGRYKSVVISGIVESLGLALLTIQARVGSLTPPIC  142

Query  450   NPLD-KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             +  + +   CE+++G+  A LF+ LY +A GSAG+KA++PSHGADQFDE+D KE  +MSS
Sbjct  143   DLYNVRDAHCEKLSGKQEAFLFIGLYLLAFGSAGLKASLPSHGADQFDERDPKEAMQMSS  202

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFN L L +CVGGAVSLT  V++  + GW WGF  STVA+  G I F  GLP YR++   
Sbjct  203   FFNGLFLALCVGGAVSLTFNVYIQDNNGWIWGFGISTVAIVLGTIIFASGLPLYRIHAAH  262

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA  986
              ++ I +IIQV+VAAI NR L LP +  +LYEI +DKEA  +  E+ PH D +RFLDKAA
Sbjct  263   STNGILEIIQVYVAAIRNRNLPLPANPIQLYEIQQDKEA-AVEIEYQPHRDIFRFLDKAA  321

Query  987   IQTSWDEEP------NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             I++  DE+P      NPW++CRVTQVENAKI+L+++P+F C++IMTLCLAQLQTFSIQQG
Sbjct  322   IKSRSDEQPENQETPNPWKLCRVTQVENAKIILSMLPIFCCSIIMTLCLAQLQTFSIQQG  381

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
             STM+  I K F I P+S+P +P+ FLI  +P YDR+ VP +R+ TGIPTGIT L R+ VG
Sbjct  382   STMNTRIAKHFNIPPASIPIIPVAFLIVFVPFYDRICVPFLRKFTGIPTGITHLQRIGVG  441

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LSS+SMA AAI+E+KRK VAR+ NML+A+P+LQPLPIS+FW+S QYF+FGIADMFTYV
Sbjct  442   LILSSISMAVAAIIEVKRKGVARDNNMLNALPVLQPLPISIFWISFQYFVFGIADMFTYV  501

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYS+APK LKS ++CFLW +M+LGYF SS++VK+VN ATK +T SGGWL GNN+N
Sbjct  502   GLLEFFYSEAPKSLKSTATCFLWCAMALGYFLSSIMVKIVNSATKNITASGGWLQGNNIN  561

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             RNHL LFY LLS LS +NFFVYLFVSKRYKYR Q
Sbjct  562   RNHLNLFYLLLSILSLINFFVYLFVSKRYKYRPQ  595



>gb|KHN06438.1| Nitrate transporter 1.2 [Glycine soja]
Length=594

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/574 (61%), Positives = 445/574 (78%), Gaps = 8/574 (1%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             ++ GKVDW+GR A K KHGG++ S+ +L  FG EN+AT+ L V  V+Y  G+M+  LADA
Sbjct  11    VVHGKVDWKGRKALKHKHGGMKVSLLVLAAFGMENLATLSLAVNFVSYFTGIMHYELADA  70

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTN+ G  Y+L+IV AVLADT+IGR+++V+IS  +E LGL LL +QA    L PP C
Sbjct  71    ANMVTNYMGVNYMLSIVVAVLADTWIGRYKSVVISGIVESLGLALLTIQARVGSLTPPIC  130

Query  450   NPLD-KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             +  + +   CE+++G+  A LF+ LY +A GSAG+KA++PSHGADQFDE+D KE  +MSS
Sbjct  131   DLYNVRDAHCEKLSGKQEAFLFIGLYLLAFGSAGLKASLPSHGADQFDERDPKEAMQMSS  190

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFN L L +CVGGAVSLT  V++  + GW WGF  STVA+  G I F  GLP YR++   
Sbjct  191   FFNGLFLALCVGGAVSLTFNVYIQDNNGWIWGFGISTVAIVLGTIIFASGLPLYRIHAAH  250

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA  986
              ++ I +IIQV+VAAI NR L LP +  +LYEI +DKEA  +  E+ PH D +RFLDKAA
Sbjct  251   TTNGILEIIQVYVAAIRNRNLPLPANPIQLYEIQQDKEA-AVEIEYQPHRDIFRFLDKAA  309

Query  987   IQTSWDEEP------NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             I++  DE+P      NPW++CRVTQVENAKI+L+++P+F C++IMTLCLAQLQTFSIQQG
Sbjct  310   IKSRSDEQPENQETPNPWKLCRVTQVENAKIILSMLPIFCCSIIMTLCLAQLQTFSIQQG  369

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
             STM+  I K F I P+S+P +P+ FLI  +P YDR+ VP +R+ TGIPTGIT L R+ VG
Sbjct  370   STMNTRIAKHFNIPPASIPIIPVAFLIVFVPFYDRICVPFLRKFTGIPTGITHLQRIGVG  429

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LSS+SMA AAI+E+KRK VAR+ NML+A+P+LQPLPIS+FW+S QYF+FGIADMFTYV
Sbjct  430   LILSSISMAVAAIIEVKRKGVARDNNMLNALPVLQPLPISIFWISFQYFVFGIADMFTYV  489

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYS+APK LKS ++CFLW +M+LGYF SS++VK+VN ATK +T SGGWL GNN+N
Sbjct  490   GLLEFFYSEAPKSLKSTATCFLWCAMALGYFLSSIMVKIVNSATKNITASGGWLQGNNIN  549

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             RNHL LFY LLS LS +NFFVYLFVSKRYKYR Q
Sbjct  550   RNHLNLFYLLLSILSLINFFVYLFVSKRYKYRPQ  583



>gb|KHN47373.1| Nitrate transporter 1.2 [Glycine soja]
Length=558

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/554 (63%), Positives = 422/554 (76%), Gaps = 6/554 (1%)
 Frame = +3

Query  150   IRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAV  329
             + AS+ IL + GFEN+ T  L V  V Y +G+M+ ++ DAAN +TN+ G  YIL I  AV
Sbjct  1     MSASVLILAMIGFENLGTFSLAVNSVPYFSGIMHYSIPDAANMLTNYMGTGYILAIPVAV  60

Query  330   LADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAIL  509
             LADT+IGR+R+VLIS   EFLGL LL  QAHY  LKPP CN  D    CE  +G   A+L
Sbjct  61    LADTWIGRYRSVLISGVFEFLGLALLTAQAHYPSLKPPLCNIYDITAHCETPSGGQEALL  120

Query  510   FVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFV  689
             F+ LY +A GSAGVKAA+PSHGADQFDEKD +E   MS+FFN LLL +C+GGA SLT  V
Sbjct  121   FIGLYLLAFGSAGVKAALPSHGADQFDEKDPREARLMSTFFNTLLLAICLGGAFSLTFIV  180

Query  690   WLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKL  869
             W+  +KGWDWGF   T+A+F G + F  GLP YR  V QG++A  +IIQV+VAAI NR L
Sbjct  181   WIQINKGWDWGFGIGTIAIFLGIVLFAAGLPLYRFRVGQGTNAFIEIIQVYVAAIRNRNL  240

Query  870   QLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSW----DEEPNPWRVCRV  1037
              LPED  ELYEI +DKEA     EFLPH D  RFLD+AAIQ       ++ P+PW++CRV
Sbjct  241   PLPEDPIELYEIEQDKEAAEEI-EFLPHRDTLRFLDRAAIQIKQGVQSEKPPSPWKLCRV  299

Query  1038  TQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpi  1217
             TQVENAKI+L + P+F CT+IMTLCLAQLQTFSIQQG TMD   TK F I P+SLP +PI
Sbjct  300   TQVENAKIVLGMTPIFCCTIIMTLCLAQLQTFSIQQGYTMDTTFTKHFHIPPASLPIIPI  359

Query  1218  lflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVAR  1397
              FLI ++P+YD +FVP MR++TGIPTG+T L R+ VGL+LS +SMA A+I+E+KRK+VAR
Sbjct  360   SFLIIIMPIYDFIFVPVMRKITGIPTGVTHLQRIGVGLVLSCISMAVASIIEVKRKRVAR  419

Query  1398  ERNMLDAIPILQ-PLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFL  1574
             + NMLDA+PIL  PLPIS FWLS QYFIFGIADMFTYVGLL+FFYS+APK LKS S+CFL
Sbjct  420   DNNMLDAVPILMPPLPISTFWLSFQYFIFGIADMFTYVGLLQFFYSEAPKGLKSTSTCFL  479

Query  1575  WSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVY  1754
             WSSM+LGYF S+++VK VNGATK +T SGGWL GNN+NRNHL LFY  LS +S +NFF+Y
Sbjct  480   WSSMALGYFASTIVVKCVNGATKHITSSGGWLAGNNINRNHLNLFYLFLSIVSLINFFIY  539

Query  1755  LFVSKRYKYRQQIG  1796
             L VS RYKYR Q G
Sbjct  540   LIVSMRYKYRSQPG  553



>emb|CDO96897.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/517 (67%), Positives = 421/517 (81%), Gaps = 3/517 (1%)
 Frame = +3

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             MN+N+ADAAN +TN++G +YILTI+ A LADTY+GRF+A+LI+A IEF GLGLLA+QAHY
Sbjct  1     MNLNIADAANQITNYSGTSYILTILVAALADTYLGRFKAILITACIEFFGLGLLALQAHY  60

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
             AKL+PP CN  D    C EV G +AA LFVALY VA+GS G+KAA+PSHGADQF+E D K
Sbjct  61    AKLRPPLCNNRDPNAHCVEVHGGDAAFLFVALYLVALGSGGIKAALPSHGADQFEEDDPK  120

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             E  +MS+ FNWLLL VC+GGA+S+TL VW+  HKGWD GF  ST AMF G +    GLP 
Sbjct  121   EAKQMSTLFNWLLLVVCIGGAISVTLIVWIQDHKGWDIGFGLSTFAMFLGIVVLVAGLPH  180

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             YR++V++GSSAIT++IQV+VAA  NRKLQLP+D   LYE+S D EA T  AEFLPHT   
Sbjct  181   YRIHVVKGSSAITEVIQVYVAAFRNRKLQLPDDPSMLYEMSLDNEAATK-AEFLPHTSDL  239

Query  966   RFLDKAAIQT--SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSI  1139
             +FLDKAAIQT  +  EE NPW +CRVTQVENAKILL ++P+F C++IMTLCLAQLQTF +
Sbjct  240   KFLDKAAIQTPPTESEETNPWELCRVTQVENAKILLKMLPIFCCSIIMTLCLAQLQTFCV  299

Query  1140  QQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRV  1319
              QG+TMD NITK FQ+ P+SLP +PI FLI L+P+YD L VP +RR TG+PTGIT L RV
Sbjct  300   LQGTTMDTNITKHFQVPPASLPIIPIFFLIILVPIYDGLIVPFIRRFTGLPTGITYLQRV  359

Query  1320  AVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMF  1499
              VGL+LS++SMA AA +E+KRK VAR  NMLDAIP+LQPLPI V WLS QYFIFGIADMF
Sbjct  360   GVGLVLSAVSMAVAAFVEVKRKNVARSHNMLDAIPLLQPLPIHVLWLSFQYFIFGIADMF  419

Query  1500  TYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGN  1679
             TYVGLLEFFYSQ PK+LK++SSCFLW++M++GYF S++LV +VNGATK +T+SGGWL GN
Sbjct  420   TYVGLLEFFYSQTPKKLKALSSCFLWTAMAIGYFLSTILVNIVNGATKRITKSGGWLAGN  479

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             N+NRNHL LFY LLS LS +NF +YLF + RYKYR Q
Sbjct  480   NLNRNHLNLFYWLLSTLSIINFLIYLFFAMRYKYRPQ  516



>gb|KGN49340.1| hypothetical protein Csa_6G520380 [Cucumis sativus]
Length=551

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/538 (64%), Positives = 426/538 (79%), Gaps = 7/538 (1%)
 Frame = +3

Query  195   MATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLIS  374
             MA   L V L+TY N VM+  LADAAN +TN+ G  YIL+I+ A+LADTY GR + V+IS
Sbjct  1     MAIFALAVNLITYFNSVMHFELADAANQLTNYMGTGYILSILMAILADTYFGRVKTVIIS  60

Query  375   AWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVK  554
               +EFL L LL +QAHY KLKPPPCN  DK   CE V G++A +L++ALY +A G+AG+K
Sbjct  61    GCLEFLALILLMIQAHYPKLKPPPCNMFDKQSHCETVEGKSAVVLYIALYILATGTAGIK  120

Query  555   AAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAAS  734
             AA+PSHGADQFDEKD KE  +MSSFFN LLLG+C+GGAVSLTL VW+  +KGWDWG   S
Sbjct  121   AALPSHGADQFDEKDPKEAMQMSSFFNKLLLGLCLGGAVSLTLIVWIQDYKGWDWGLGVS  180

Query  735   TVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKD  914
               AMFF  + F  G+P YR++++ GSS I QI+QV+VAAI NRKL LPEDS  LYEI +D
Sbjct  181   AAAMFFSVVIFVAGMPLYRIHIVSGSSTILQILQVYVAAIRNRKLILPEDSTHLYEIERD  240

Query  915   KEAVTICAEFLPHTDKYRFLDKAAIQTSWD------EEPNPWRVCRVTQVENAKILLNLV  1076
             KE   +  +FLPH + YRFLDKAAIQ +        E  + W++C VTQVENAKI+L++V
Sbjct  241   KEN-AMEDDFLPHRNIYRFLDKAAIQQTPSRQVGNPEASSAWKLCTVTQVENAKIVLSMV  299

Query  1077  PVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRL  1256
             P+F CT+IMTLCLAQLQTFSIQQG TMD  +T SF I P+SLP +P+ F+I ++P+YD++
Sbjct  300   PIFCCTIIMTLCLAQLQTFSIQQGLTMDTKLTNSFSIPPASLPIIPVSFIILIVPIYDKI  359

Query  1257  FVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQP  1436
             FVP  R+ TGIPTGIT L RV VGL+LSS+SMA AA++E+KRK VAR+ NMLDA P+ QP
Sbjct  360   FVPFARKFTGIPTGITHLQRVGVGLVLSSISMAVAALVEVKRKGVARDHNMLDATPVSQP  419

Query  1437  LPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVL  1616
             LPIS FWLS Q+FIFGIAD+FTYVGLLEFFYS+APK LKSVS+CFLWSSM+LGYF S+++
Sbjct  420   LPISTFWLSFQFFIFGIADLFTYVGLLEFFYSEAPKALKSVSTCFLWSSMALGYFLSTIV  479

Query  1617  VKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             VK+VN AT+G+T SGGWL GNN+NRNHL LFY +LS LS +NFF+Y+FV+K+YKYR Q
Sbjct  480   VKIVNRATEGITRSGGWLVGNNINRNHLNLFYWMLSILSLINFFIYVFVAKKYKYRNQ  537



>ref|XP_010925175.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Elaeis guineensis]
Length=786

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/576 (60%), Positives = 439/576 (76%), Gaps = 4/576 (1%)
 Frame = +3

Query  72    SQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMN  251
             S EK ++++GKVDWRGR  RK +HGG+ +S+ +L  F FENMA++ L V LVTY   VM+
Sbjct  201   SMEKGKVVEGKVDWRGRPVRKGEHGGVSSSLLVLAAFMFENMASLALAVNLVTYFTEVMH  260

Query  252   VNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAK  431
             +++ADA+N +TN+ G  Y++++  AV AD +IGR+++V+ISA IEF+GL LL +QAH+ K
Sbjct  261   MDVADASNALTNYMGTNYMVSVAIAVFADIFIGRYKSVIISACIEFMGLLLLTLQAHFPK  320

Query  432   LKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEG  611
             LKPPPCN  D    C +V G NA  L+++LY VA+GSAG+KA++P H ADQFDEKD +E 
Sbjct  321   LKPPPCNIFDTTAHCLKVDGGNAVFLYISLYLVAIGSAGIKASLPVHSADQFDEKDPQEA  380

Query  612   SEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYR  791
              +MSSFFNWLLL VC+GGA+SLT  VW+   KGWD GF  ST AM    + F  G+P YR
Sbjct  381   RQMSSFFNWLLLSVCLGGAISLTFVVWVQNEKGWDRGFGISTGAMLIALVVFLAGVPKYR  440

Query  792   VYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRF  971
             + +IQG++A+ +IIQV VAA  N  L LPED  ELYEI + KE++    EFLPH DK+R 
Sbjct  441   MAIIQGTNALLEIIQVCVAAFRNWNLDLPEDPTELYEIDRMKESLEE-VEFLPHRDKFRL  499

Query  972   LDKAAIQ---TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             LDKAAIQ   T+    P+PW++CRVTQVE AK +L ++P+F  T+IM+ CLAQLQTFSIQ
Sbjct  500   LDKAAIQTSSTTHTTSPSPWKLCRVTQVEKAKTILGMIPIFCSTIIMSTCLAQLQTFSIQ  559

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QG+TMD  IT  F I P+SLP +PI F+I LIPLYDRLFVP  RR+TG  TGIT   R+ 
Sbjct  560   QGTTMDTRITHKFHIPPASLPIIPISFMIILIPLYDRLFVPFARRITGHITGITHFQRIG  619

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
             VGL+LS +SMA AA++E+KRK VAR   MLDA+P+LQPLPI+VFWLS QYFIFGIADMFT
Sbjct  620   VGLVLSCISMATAAVVEVKRKNVARSHGMLDALPVLQPLPITVFWLSFQYFIFGIADMFT  679

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
             YVGLLEFFYS+AP  LKS+S+ FLW SMSLGYF S++LV++VN ATK  T+SGGWL GNN
Sbjct  680   YVGLLEFFYSEAPNALKSISTSFLWCSMSLGYFLSTILVQIVNAATKNHTKSGGWLAGNN  739

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             +NRNH+ LFY LL  LSF+NF  YLF +  YKY+ Q
Sbjct  740   LNRNHVNLFYWLLCILSFINFLNYLFWASWYKYKPQ  775



>ref|XP_008792400.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Phoenix dactylifera]
Length=616

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/571 (59%), Positives = 435/571 (76%), Gaps = 4/571 (1%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             L++GK+DWRG+  RK +HGG+ +S+ IL  F FE++AT+ L   L+TY   VM++++A A
Sbjct  34    LVEGKLDWRGKPVRKGEHGGVGSSLLILAAFMFESVATLALAANLITYFTEVMHLDIAVA  93

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             +N +TN+ G +YI+++  AV AD +IGR+++V+ISA IE +GL LL +QAH+  LKPP C
Sbjct  94    SNALTNYMGTSYIVSVAIAVFADIFIGRYKSVIISASIELVGLLLLTLQAHFPSLKPPLC  153

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             N  D    C +V G NA +LF++LY VA+GSAG+KA++P H ADQFDEKD +E  +MSSF
Sbjct  154   NLFDPTGHCLKVDGANAVLLFISLYLVAIGSAGIKASLPVHCADQFDEKDPQEARQMSSF  213

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FNWLLL +C+GGA+SLTL VW+   KGWD GF  STVA+    + F  G+P YR+ +IQG
Sbjct  214   FNWLLLSICLGGAISLTLVVWVQNEKGWDRGFGISTVALLSALVVFLAGVPKYRIAIIQG  273

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
             ++A+ +IIQV+VAA  NR L LPED  ELYEI   KE++    EFLPH DK+RFLDKAAI
Sbjct  274   TNALLEIIQVYVAAFRNRNLDLPEDPSELYEIDGTKESLE-EVEFLPHRDKFRFLDKAAI  332

Query  990   QTSW---DEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMD  1160
             +TS       P+PW++CRVTQVENAK +L ++P+F   +IM+ CLAQLQTFSIQQGSTMD
Sbjct  333   RTSTTIRSSSPSPWKLCRVTQVENAKTILGMIPIFCSAIIMSTCLAQLQTFSIQQGSTMD  392

Query  1161  LNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGllls  1340
               +T  F I P+SLP +P+ F+I +IP+YDRLFVP  RR+TG  TGIT   R+ VGL+LS
Sbjct  393   TRVTSKFHIPPASLPIIPLTFMIIMIPVYDRLFVPFARRITGHTTGITHFQRIGVGLVLS  452

Query  1341  slsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLE  1520
              +SMA AA++E+KRK  A+   MLDA+P+LQPLPISVFWLS QYFIFGIADMFT VGLLE
Sbjct  453   CISMATAAVVEVKRKNAAKSHGMLDALPVLQPLPISVFWLSFQYFIFGIADMFTSVGLLE  512

Query  1521  FFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHL  1700
             FFYS+AP  LKS+S+ FLW SMSLGYF S++LV++VN ATK  T+S GWL GNN+NRNH+
Sbjct  513   FFYSEAPMALKSISTSFLWCSMSLGYFLSTILVELVNAATKNRTKSRGWLAGNNLNRNHV  572

Query  1701  ELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
              LFY LL  LSF+NF  YLF +K YKYR Q+
Sbjct  573   NLFYWLLCILSFINFLNYLFWAKWYKYRPQV  603



>ref|XP_003567115.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Brachypodium distachyon]
Length=629

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/571 (57%), Positives = 427/571 (75%), Gaps = 6/571 (1%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             Q++Y  ++GKVDWRGR A + +HGG+  S FIL  FG E +A++ L V L+ Y   +M+V
Sbjct  44    QKRYGFVEGKVDWRGRPAVRGRHGGVGNSFFILVNFGLEGLASLSLAVNLIMYFMLIMHV  103

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              LADA+N +TN+ G +Y++ ++  V ADT IGR++ V+IS+ IE +GL LL +QAH +KL
Sbjct  104   GLADASNLLTNYMGTSYMIAVLITVFADTVIGRYQTVIISSLIELVGLLLLTLQAHSSKL  163

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             KPP C  +  +  C++V+G NA  L+V LY VA+GSAG+KAA+P+H ADQFDEKD KE  
Sbjct  164   KPPEC--IFPSPTCQKVSGDNAVHLYVGLYLVAIGSAGIKAALPAHCADQFDEKDPKEKR  221

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFNWLLL +C+GGA S+T+FVW+   +GWD GF A+T  M    + F +GLP YR+
Sbjct  222   QMSSFFNWLLLSICIGGAFSVTVFVWIQNKRGWDKGFGAATGVMGLALVAFVIGLPRYRI  281

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRF  971
               +QGSSA+ +I +V+VAAI NR L+LPE+  ELYEIS+ K +     EF+ H DK +RF
Sbjct  282   STVQGSSALLEIFRVYVAAIRNRNLRLPENPEELYEISRSKASPE--TEFVAHRDKPFRF  339

Query  972   LDKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             L+KAAI QT+  E PNPWR CRVTQVENA+ +L +VP+F C +IM  CLAQ QTFSIQQG
Sbjct  340   LNKAAIVQTTTGEMPNPWRQCRVTQVENARTMLAMVPIFCCAIIMGTCLAQFQTFSIQQG  399

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
             +TMD  I K  Q+ P++LP +P+  LI  +P+Y+RLFVP  RR+TG P GI  L R+ VG
Sbjct  400   ATMDTRIAKHVQMPPATLPIIPLGMLICAVPIYERLFVPYARRITGHPNGILYLQRIGVG  459

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS +SM  AA++E+ RK+VA   NMLDAIP LQ LPIS FWL+ QY +FGIADMFT++
Sbjct  460   LVLSIVSMCIAAVVEMYRKRVATRNNMLDAIPQLQMLPISCFWLAPQYGVFGIADMFTFI  519

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFYSQAP  LKS+SS FLW SMSLGY+ SS++V+ VN ATK  T SGGWL GNN+N
Sbjct  520   GLLEFFYSQAPPALKSMSSAFLWCSMSLGYYFSSIIVRAVNVATKNSTASGGWLAGNNIN  579

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             RNHL+LF+ LL+ LSF+NF  YL+ S+ YKY
Sbjct  580   RNHLDLFFWLLAVLSFLNFLNYLYWSRWYKY  610



>dbj|BAD86972.1| putative nitrate transporter [Oryza sativa Japonica Group]
Length=595

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/575 (56%), Positives = 425/575 (74%), Gaps = 9/575 (2%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             E  E+++GKVDWRGR A +  HGG+  S FIL  FG EN+A++ L V L+ Y   VM++ 
Sbjct  15    ETREVVEGKVDWRGRPAIRGSHGGVANSFFILVNFGLENLASLSLAVNLIIYFMTVMHIG  74

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             L D +N +TN+ G +Y++ ++ +V ADT+IGR++ V+IS+ IE +GL +L +QAH  KLK
Sbjct  75    LTDGSNLLTNYMGTSYMVAVLISVFADTFIGRYKTVIISSVIELVGLLILTLQAHSNKLK  134

Query  438   PPPCN-PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             PP C  P D   KCE V+G     L+V LY VA+GSAG+KAA+P+H ADQFDEK   E  
Sbjct  135   PPYCVFPFD--PKCETVSGDGRTHLYVGLYLVAIGSAGIKAALPAHCADQFDEKHPTEKL  192

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFNWLLL +C GGA+S+T+FVW+  +KGWD GF A+T  M    + F  GLP YR+
Sbjct  193   QMSSFFNWLLLSLCTGGAISVTVFVWIQSYKGWDKGFGAATGVMGLALLVFIAGLPGYRI  252

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRF  971
              V+QGS+A+ +I+QV+VAAI NR ++LPE+  ELYEISK K       +F+ H DK +RF
Sbjct  253   SVVQGSTALLEILQVYVAAIRNRNMKLPENPDELYEISKSKAPPD--TDFMAHRDKPFRF  310

Query  972   LDKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             LDKAAI Q   DE P+PWR CRVTQVE+AK +L +VP+F   +IM+ CLAQLQTFSIQQG
Sbjct  311   LDKAAIVQAPTDEAPSPWRQCRVTQVEHAKTVLAMVPIFCSAIIMSTCLAQLQTFSIQQG  370

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  I  +F++ P+SLP +P++ L+F +P+Y+R FVP  RR+TG P GI  L RV VG
Sbjct  371   VTMDRTI-GTFKMPPASLPIIPLIVLVFAVPIYERGFVPFARRITGHPNGIPHLQRVGVG  429

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPIL-QPLPISVFWLSIQYFIFGIADMFTY  1505
             L+LS +SMA AA++E++RK+VA    MLDA PIL + LPIS FWL+ Q+ +FG+ADMFT+
Sbjct  430   LVLSIVSMAIAAVVEVRRKRVAARHGMLDANPILGKQLPISCFWLAPQFTVFGVADMFTF  489

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             +GLLEFFYSQAP  LKS+SS FLW  MSLGYF S+++VK VN AT+G T SGGWL GNN+
Sbjct  490   IGLLEFFYSQAPPALKSMSSSFLWCPMSLGYFLSTIIVKAVNAATRGATASGGWLAGNNI  549

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NRNHL+LF+ LL+ LSF+NF  YLF +  YKY+ Q
Sbjct  550   NRNHLDLFFWLLAVLSFLNFLNYLFWASWYKYKPQ  584



>ref|XP_003567116.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Brachypodium distachyon]
Length=774

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/570 (58%), Positives = 421/570 (74%), Gaps = 6/570 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             +KY  I+GKVDWRGR A + +HGG+  S FIL  FG E++A++ L V L+ Y   +M+V 
Sbjct  190   QKYGFIEGKVDWRGRPAVRGRHGGVGNSFFILVNFGLESVASLSLAVNLIMYFMLIMHVG  249

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LADA+N +TN+ G +Y++ ++  V ADT IGR++ V+IS+ IE +GL LL +QAH  KLK
Sbjct  250   LADASNLLTNYMGTSYMIAVLITVFADTVIGRYQTVIISSLIELVGLLLLTLQAHSPKLK  309

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PP C     A  C++V+G N  +L++ LY VA+GSAG+KAA+P+H ADQFD+K  KE  +
Sbjct  310   PPEC--FFPAPTCQKVSGDNEVLLYIGLYLVAIGSAGIKAALPAHCADQFDDKHPKEKRQ  367

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFNWLLL +C+GGA S+T+FVW+   KGWD GF A+T  M    I F +GLP YR++
Sbjct  368   MSSFFNWLLLSMCIGGAFSVTIFVWIQNKKGWDKGFGAATGVMGLAVIAFVIGLPRYRIF  427

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRFL  974
              +QGSSA+ +I +V+VAAI NR LQLPE+  ELYEIS+ K +     EF+ H DK +RFL
Sbjct  428   TVQGSSALLEIFRVYVAAIRNRNLQLPENPDELYEISRSKASPE--TEFVAHRDKPFRFL  485

Query  975   DKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             D+AAI Q    E PNPWR CRVTQVENAK +L +VP+F   +IM   LAQ QTFSIQQG+
Sbjct  486   DRAAIVQAPTGETPNPWRQCRVTQVENAKTMLAMVPIFCSAIIMGTVLAQFQTFSIQQGA  545

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             TMD  I K  Q+ P++LP +P+  LIF +P+Y+RLFVP  RR+TG P GI  L RV VGL
Sbjct  546   TMDTRIAKHVQMPPATLPIIPLGMLIFAVPIYERLFVPFARRITGHPNGIPYLQRVGVGL  605

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
             +LS LSM  AAI+E++RK+VA   NMLDAIP LQ LP+S FWL+ QY +FGIADMFT +G
Sbjct  606   VLSILSMCIAAIVEMRRKRVAVRHNMLDAIPQLQMLPMSCFWLAPQYGVFGIADMFTLIG  665

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             LLEFFYSQAP  LKS+SS FLW SMSLGYF  ++LVK VN ATK  T SGGWLGGNN+NR
Sbjct  666   LLEFFYSQAPPALKSMSSAFLWCSMSLGYFLCTILVKAVNAATKNYTASGGWLGGNNINR  725

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             NHL+LF+ LL+ LSF+NF  YL+ S  YKY
Sbjct  726   NHLDLFFWLLAVLSFLNFLNYLYWSSWYKY  755



>ref|XP_006646322.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide/nitrate transporter 
At1g59740-like [Oryza brachyantha]
Length=605

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/579 (55%), Positives = 422/579 (73%), Gaps = 9/579 (2%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             +  + KYE+++GKVDWRGR A + +HGG+  S FIL  FG ENMA++ L V L+ Y   V
Sbjct  19    VAGENKYEVVEGKVDWRGRPALRGRHGGVANSFFILVNFGLENMASLSLAVNLIIYFMTV  78

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M++ L D +N +TN+ G +Y++ ++ +V ADT+IGR++ V+IS+ IE +GL +L +QA  
Sbjct  79    MHIGLTDGSNLLTNYMGTSYMVAVLISVFADTFIGRYKTVIISSVIELVGLLILTLQARS  138

Query  426   AKLKPPPCN-PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
              KL PP C  P D A  C  V+G   A L+V LY VA+GSAG+KAA+P+H ADQFDEK  
Sbjct  139   KKLTPPSCKFPFDPA--CRTVSGDGKAHLYVGLYLVAIGSAGIKAALPAHCADQFDEKHP  196

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
              E  +MSSFFNWLLL +C GGA+S+T+FVW+    GWD GF A+T  M      F  GLP
Sbjct  197   TEKLQMSSFFNWLLLSLCTGGAISVTVFVWIQNSIGWDKGFGAATGVMGLALFVFVAGLP  256

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
              YR+ V+QG SA+ +I QV+VAAI NR ++LPE+  ELYEISK K       EF+ H  K
Sbjct  257   RYRISVVQGRSALLEIFQVYVAAIRNRAVKLPENPDELYEISKSKAPPD--TEFMAHRSK  314

Query  963   -YRFLDKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
              +RFLDKAAI Q   D  P+PWR CRVTQVE+AK +L +VP+F   +IM+ CLAQLQTFS
Sbjct  315   PFRFLDKAAIVQEPTDAAPSPWRQCRVTQVEHAKTVLAMVPIFCSAIIMSTCLAQLQTFS  374

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             IQQG+TM+ +I + F++ P++LP +P++ LIF +P+Y+R FVP  RR+TG P GI  L R
Sbjct  375   IQQGATMNTHIGQ-FKMPPATLPIIPLIILIFAVPIYERGFVPLARRITGHPNGIPHLQR  433

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPIL-QPLPISVFWLSIQYFIFGIAD  1493
             V VGL+LS +SMA AA++E++RK+VA    MLDA P+L + LPIS FWL+ Q+ +FG+AD
Sbjct  434   VGVGLVLSIISMAIAAVVEVRRKEVAARHGMLDANPMLGEQLPISCFWLAPQFTVFGVAD  493

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             MFT++GLLEFFYSQAP  LKS+SS FLW  MSLGYF S+++VK VN AT+G T SGGWL 
Sbjct  494   MFTFIGLLEFFYSQAPPALKSMSSSFLWCPMSLGYFLSTIIVKAVNVATRGSTASGGWLA  553

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             GNN+NRNHL+LF+ LL+ LSF+NF  YLF +  Y+Y+ Q
Sbjct  554   GNNINRNHLDLFFWLLAVLSFLNFLNYLFWASWYRYKPQ  592



>ref|XP_004972177.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Setaria italica]
Length=607

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/574 (55%), Positives = 422/574 (74%), Gaps = 5/574 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
              +YE+I+GKVDWRGR A + +HGG   S+FIL  FG ENMA++ L V L+ Y   VM++ 
Sbjct  25    NRYEVIEGKVDWRGRPALRGRHGGALNSLFILANFGLENMASLSLAVNLILYFMEVMHIP  84

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             L+DA+N +TN+ G +Y++ ++ +V AD +IGR+  V+IS+ IE +GL LL +QAH  +L 
Sbjct  85    LSDASNLLTNYMGTSYMVAVLISVFADIFIGRYMTVIISSLIELVGLLLLMLQAHNDRLL  144

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PP C  L     C+ V G N   L++ALY +A+GSAG+KAA+P+H ADQFDEK  KE  +
Sbjct  145   PPKCESLLD-PNCQRVHGSNEVHLYLALYLIAIGSAGIKAALPAHCADQFDEKHPKEKLQ  203

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSS FNWLLL +C+GGA+S+T+FV++    GW  GFAA+T  M    I F  GLP YR+ 
Sbjct  204   MSSCFNWLLLSLCIGGAISVTVFVYIQNRWGWYRGFAAATGVMGLAIIVFIAGLPKYRIA  263

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRFL  974
              +QGSSA+T+I QV+VAA  NR L LPE+  ELYEIS++K +     EF+ H D+ +RFL
Sbjct  264   TVQGSSALTEIFQVYVAAFRNRNLPLPENPDELYEISRNKASPD--TEFVAHRDRPFRFL  321

Query  975   DKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             D+AAI QT+ D  PNPWR CRVTQVE+AK +L +VP+F   +IM  CLAQLQTFSI QG+
Sbjct  322   DRAAIVQTAKDAAPNPWRQCRVTQVEHAKTVLAMVPIFCSAIIMGTCLAQLQTFSIGQGN  381

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             TMD  ++K F +  +S+P +P++FL+F +P+Y+ LFVP  R LTGIPTGIT L RV VGL
Sbjct  382   TMDTRLSKRFSMPVASMPIIPLVFLMFAVPIYEILFVPIARHLTGIPTGITHLQRVGVGL  441

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
             +LS +SM+ AA++E+KRK+VA    M+D IP    LP+S FWL +Q+ +FGIADMFTYVG
Sbjct  442   VLSIVSMSIAAVVEVKRKKVAARHGMMDMIPGRDYLPMSCFWLGLQFSVFGIADMFTYVG  501

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFYSQAP+ LKS+SS FLW S+S GYF S+++V+ VN ATKG T SGGWL  NN+NR
Sbjct  502   LMEFFYSQAPRALKSMSSSFLWCSLSFGYFMSTIIVQAVNAATKGSTASGGWLASNNINR  561

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             +HL+LF+ LL+ LS +NFF Y+F +  YKYR  +
Sbjct  562   DHLDLFFWLLAVLSTLNFFNYIFWASWYKYRNAL  595



>gb|EEC71475.1| hypothetical protein OsI_03732 [Oryza sativa Indica Group]
Length=1182

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/575 (56%), Positives = 425/575 (74%), Gaps = 9/575 (2%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             E  E+++GKVDWRGR A +  HGG+  S FIL  FG EN+A++ L V L+ Y   VM++ 
Sbjct  602   ETREVVEGKVDWRGRPAIRGSHGGVANSFFILVNFGLENLASLSLAVNLIIYFMTVMHIG  661

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             L D +N +TN+ G +Y++ ++ +V ADT+IGR++ V+IS+ IE +GL +L +QAH  KLK
Sbjct  662   LTDGSNLLTNYMGTSYMVAVLISVFADTFIGRYKTVIISSVIELVGLLILTLQAHSNKLK  721

Query  438   PPPCN-PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             PP C  P D   KCE V+G     L+V LY VA+GSAG+KAA+P+H ADQFDEK   E  
Sbjct  722   PPYCVFPFDP--KCETVSGDGRTHLYVGLYLVAIGSAGIKAALPAHCADQFDEKHPTEKL  779

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFNWLLL +C GGA+S+T+FVW+  +KGWD GF A+T  M    + F  GLP YR+
Sbjct  780   QMSSFFNWLLLSLCTGGAISVTVFVWIQNYKGWDKGFGAATGVMGLALLVFIAGLPGYRI  839

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRF  971
              V+QGS+A+ +I+QV+VAAI NR ++LPE+  ELYEISK K       +F+ H DK +RF
Sbjct  840   SVVQGSTALLEILQVYVAAIRNRNMKLPENPDELYEISKSKAPPD--TDFMAHRDKPFRF  897

Query  972   LDKAA-IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             LDKAA +Q   DE P+PWR CRVTQVE+AK +L +VP+F   +IM+ CLAQLQTFSIQQG
Sbjct  898   LDKAAVVQAPTDEAPSPWRQCRVTQVEHAKTVLAMVPIFCSAIIMSTCLAQLQTFSIQQG  957

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  I  +F++ P+SLP +P++ L+F +P+Y+R FVP  RR+TG P GI  L RV VG
Sbjct  958   VTMDRTI-GTFEMPPASLPIIPLIVLVFAVPIYERGFVPFARRITGHPNGIPHLKRVGVG  1016

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPIL-QPLPISVFWLSIQYFIFGIADMFTY  1505
             L+LS +SMA AA++E++RK+VA    MLDA P+L + LPIS FWL+ Q+ +FG+ADMFT+
Sbjct  1017  LVLSIVSMAIAAVVEVRRKRVAARHGMLDANPMLGKQLPISCFWLAPQFTVFGVADMFTF  1076

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             +GLLEFFYSQAP  LKS+SS FLW  MSLGYF S+++VK VN ATKG T SGGWL GNN+
Sbjct  1077  IGLLEFFYSQAPPALKSMSSSFLWCPMSLGYFLSTIIVKAVNAATKGATASGGWLAGNNI  1136

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NRNHL+LF+ LL+ LSF+NF  YLF +  YKY+ Q
Sbjct  1137  NRNHLDLFFWLLAVLSFLNFLNYLFWASWYKYKPQ  1171



>gb|EMT19989.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=614

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/570 (55%), Positives = 418/570 (73%), Gaps = 7/570 (1%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             ++YE+I+GKV+WRGR A + +HGG+  S FIL  FG EN+A++ L V L+ Y   VM++N
Sbjct  32    KQYEVIEGKVNWRGRPAVRGRHGGVANSFFILVNFGLENLASLSLAVNLIMYFMLVMHIN  91

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             LADA+N +T++ G +Y++ ++  V ADT++GR++ V+IS+ +E +GL L+ +QAH  KL 
Sbjct  92    LADASNLLTDYMGTSYMIAVLITVFADTFVGRYQTVIISSVVELIGLLLMTLQAHSPKLL  151

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             P  C   +    CE   G +   L+V LY VA+GSAG+KAA+P+H ADQF+ K  +E  +
Sbjct  152   PEGCKWPEPT--CERGGGHSETRLYVGLYLVAIGSAGIKAALPAHCADQFEAKHPRERRQ  209

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             MSSFFNWLLL +C+GGAVS+T+FVW+   KGWD GF A+T  M    I F  G+P YR++
Sbjct  210   MSSFFNWLLLSLCIGGAVSVTVFVWIQNVKGWDKGFGAATGVMGLALIAFLAGMPRYRIF  269

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRFL  974
               QGSSA+ +I +V+VAAI NR LQLPE+  ELYEIS+ K +     EF+ H D+ +RFL
Sbjct  270   TAQGSSALLEIFRVYVAAIRNRNLQLPENPAELYEISRSKASPE--EEFVSHRDRPFRFL  327

Query  975   DKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             D+AAI Q    E P+PWR CRVT VE+AK +L +VP+F   +IM  CLAQ QTFSIQQGS
Sbjct  328   DRAAIVQAPTAEAPSPWRQCRVTHVEHAKTVLAMVPIFCSAIIMGTCLAQFQTFSIQQGS  387

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             TM+  +   FQ+ P++LP +P+  LIF +P+Y+RLFVP  R +TG P GI  L RV VGL
Sbjct  388   TMNTWVGD-FQMQPATLPIIPLTMLIFAVPIYERLFVPFARGITGHPNGIPYLQRVGVGL  446

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
             +LS +SM  AA++E+ RK+VA    MLDA P+LQPLP+SVFWL+ QY +FGIADMFTY+G
Sbjct  447   VLSVVSMCIAAVVEMHRKKVAVRHGMLDAFPMLQPLPMSVFWLAPQYGVFGIADMFTYIG  506

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             LLEFFYSQAP  LKS+SS FLW+SMSLGY+ S+++VK VN ATK  T SGGWL GNN+NR
Sbjct  507   LLEFFYSQAPPALKSMSSAFLWASMSLGYYFSTIIVKAVNAATKKHTLSGGWLNGNNINR  566

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             NHL+LF+ LL+ LSF+NF  YL+ +  YKY
Sbjct  567   NHLDLFFWLLAVLSFINFLNYLYWASWYKY  596



>gb|EEE55380.1| hypothetical protein OsJ_03453 [Oryza sativa Japonica Group]
Length=1264

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/575 (56%), Positives = 425/575 (74%), Gaps = 9/575 (2%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             E  E+++GKVDWRGR A +  HGG+  S FIL  FG EN+A++ L V L+ Y   VM++ 
Sbjct  684   ETREVVEGKVDWRGRPAIRGSHGGVANSFFILVNFGLENLASLSLAVNLIIYFMTVMHIG  743

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             L D +N +TN+ G +Y++ ++ +V ADT+IGR++ V+IS+ IE +GL +L +QAH  KLK
Sbjct  744   LTDGSNLLTNYMGTSYMVAVLISVFADTFIGRYKTVIISSVIELVGLLILTLQAHSNKLK  803

Query  438   PPPCN-PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
             PP C  P D   KCE V+G     L+V LY VA+GSAG+KAA+P+H ADQFDEK   E  
Sbjct  804   PPYCVFPFDP--KCETVSGDGRTHLYVGLYLVAIGSAGIKAALPAHCADQFDEKHPTEKL  861

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             +MSSFFNWLLL +C GGA+S+T+FVW+  +KGWD GF A+T  M    + F  GLP YR+
Sbjct  862   QMSSFFNWLLLSLCTGGAISVTVFVWIQSYKGWDKGFGAATGVMGLALLVFIAGLPGYRI  921

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRF  971
              V+QGS+A+ +I+QV+VAAI NR ++LPE+  ELYEISK K       +F+ H DK +RF
Sbjct  922   SVVQGSTALLEILQVYVAAIRNRNMKLPENPDELYEISKSKAPPD--TDFMAHRDKPFRF  979

Query  972   LDKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             LDKAAI Q   DE P+PWR CRVTQVE+AK +L +VP+F   +IM+ CLAQLQTFSIQQG
Sbjct  980   LDKAAIVQAPTDEAPSPWRQCRVTQVEHAKTVLAMVPIFCSAIIMSTCLAQLQTFSIQQG  1039

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
              TMD  I  +F++ P+SLP +P++ L+F +P+Y+R FVP  RR+TG P GI  L RV VG
Sbjct  1040  VTMDRTI-GTFKMPPASLPIIPLIVLVFAVPIYERGFVPFARRITGHPNGIPHLQRVGVG  1098

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPIL-QPLPISVFWLSIQYFIFGIADMFTY  1505
             L+LS +SMA AA++E++RK+VA    MLDA PIL + LPIS FWL+ Q+ +FG+ADMFT+
Sbjct  1099  LVLSIVSMAIAAVVEVRRKRVAARHGMLDANPILGKQLPISCFWLAPQFTVFGVADMFTF  1158

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNV  1685
             +GLLEFFYSQAP  LKS+SS FLW  MSLGYF S+++VK VN AT+G T SGGWL GNN+
Sbjct  1159  IGLLEFFYSQAPPALKSMSSSFLWCPMSLGYFLSTIIVKAVNAATRGATASGGWLAGNNI  1218

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             NRNHL+LF+ LL+ LSF+NF  YLF +  YKY+ Q
Sbjct  1219  NRNHLDLFFWLLAVLSFLNFLNYLFWASWYKYKPQ  1253



>tpg|DAA57644.1| TPA: hypothetical protein ZEAMMB73_431416 [Zea mays]
Length=610

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/571 (56%), Positives = 423/571 (74%), Gaps = 4/571 (1%)
 Frame = +3

Query  84    YELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLA  263
             YE+I+GKVDWRGR A + +HGG+    FIL  FGFENMA++ L V L+ Y  GVM++NL 
Sbjct  27    YEVIEGKVDWRGRPALRGRHGGLGNCFFILVNFGFENMASLSLAVNLMMYFLGVMHLNLE  86

Query  264   DAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPP  443
             DA+N +TN+ GA+Y+++++ +V AD ++GR+  V++S+ +E +GL LL +QA   +LKPP
Sbjct  87    DASNLLTNYMGASYMISVLISVFADVFVGRYMTVILSSLVELVGLLLLMLQARSDRLKPP  146

Query  444   PCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMS  623
             PC        C  V G N   L++ALY +A+GS G+KAA+P+H ADQFD K  +E  +MS
Sbjct  147   PCKDPRDPTTCPRVHGSNEVHLYLALYLIALGSGGIKAALPAHCADQFDAKHPREKLQMS  206

Query  624   SFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVI  803
             S FN+LLL +C GGA S+T+FVW+ ++KGW  GFAA+T  M    I F  GLP YR+  +
Sbjct  207   SCFNYLLLSLCTGGAFSVTVFVWIQENKGWAKGFAAATGVMGLAVIVFIAGLPRYRIATV  266

Query  804   QGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRFLDK  980
             QGSSA+ +I QV+VAA+ NRK QLPE+  ELYEISK+K +     EF+ H D+ +RFLD+
Sbjct  267   QGSSALKEIFQVYVAAVRNRKQQLPENPDELYEISKNKASPD--TEFVAHRDRPFRFLDR  324

Query  981   AAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTM  1157
             AAI QT+ D   +PWR CRVTQVE+AK +L +VP+F   +IM  CLAQLQTFS+ QGSTM
Sbjct  325   AAIVQTAKDAAADPWRQCRVTQVEHAKTVLAMVPIFCSAIIMGTCLAQLQTFSMVQGSTM  384

Query  1158  DLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlll  1337
             D  + + FQ+  +S+P +P++FLIF +P+Y++LFVP  RRLTGIPTGIT L RV VGL+L
Sbjct  385   DTALGRHFQMPVASMPIIPLVFLIFAVPIYEQLFVPFARRLTGIPTGITYLQRVGVGLVL  444

Query  1338  sslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLL  1517
             S +SM  AA++E++RK+VA    MLD IP  Q LP+S FWL+ Q+ +FGIADMFTYVGL+
Sbjct  445   SIVSMVMAAVVEVQRKKVAERHGMLDMIPGFQHLPMSCFWLAPQFAVFGIADMFTYVGLM  504

Query  1518  EFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNH  1697
             EFFYSQAP+ LKS+SS FLW S+SLGYF S+V+VK VN ATK  T SGGWL G N+NRNH
Sbjct  505   EFFYSQAPQALKSMSSSFLWCSLSLGYFMSTVIVKAVNKATKKKTASGGWLAGENINRNH  564

Query  1698  LELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L+LF+ LL+ LS VN F YLF +  YKY+ Q
Sbjct  565   LDLFFWLLAVLSTVNLFNYLFWASWYKYKPQ  595



>ref|XP_002456356.1| hypothetical protein SORBIDRAFT_03g034595 [Sorghum bicolor]
 gb|EES01476.1| hypothetical protein SORBIDRAFT_03g034595 [Sorghum bicolor]
Length=573

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/577 (54%), Positives = 414/577 (72%), Gaps = 13/577 (2%)
 Frame = +3

Query  87    ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLAD  266
             E+I+GKVDWRGR A + +HGG+    FIL  FGFENMAT+ L V LV Y  GVM++N  D
Sbjct  1     EVIEGKVDWRGRPALRGRHGGLGNCFFILANFGFENMATLSLAVNLVLYFIGVMHMNAED  60

Query  267   AANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPP  446
             ++N +TN+ GA+Y++ ++ +V AD ++GR+  V++S+ +E +G+ LL +QA   +LKPP 
Sbjct  61    SSNLLTNYMGASYMIAVLISVFADVFVGRYMTVILSSLVELVGILLLFLQARSDRLKPPM  120

Query  447   CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             C+P  +   C  V G N   L++ALY +A+GS G+KAA+P+H ADQFD K  KE  +MSS
Sbjct  121   CDP-RQPLTCLRVHGGNEVHLYLALYLIALGSGGIKAALPAHCADQFDAKHPKEKQQMSS  179

Query  627   FFNWLLLGVCVGGAVSLTLFVWL--IQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYV  800
              FN+LLL +C GG VS+TLF+W+  +  +GW+ GFAA+T  M    I F  G+P YR+  
Sbjct  180   CFNYLLLSLCTGGVVSVTLFLWIQGLPDRGWEKGFAAATGVMGLAVIVFIAGMPRYRIAT  239

Query  801   IQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRF--  971
             +QGSSA+ +I QV+VAAI NRK QLPED  ELYEIS+ K +  +  EFL H D+ +R   
Sbjct  240   VQGSSALKEICQVYVAAIRNRKQQLPEDPDELYEISRSKASPDM--EFLSHRDRPFRLTL  297

Query  972   ---LDKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSI  1139
                LD+AAI QT  D   NPWR CRVTQVE AK +L +VP+F   +IM  CLAQLQTFS+
Sbjct  298   TTVLDRAAIVQTDKDAAANPWRQCRVTQVEQAKTVLAMVPIFCSAIIMGTCLAQLQTFSM  357

Query  1140  QQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRV  1319
              QGSTMD  +   F++  +S+  +P+  LIF +P+Y++LFVP  RRLTGIPTGIT L RV
Sbjct  358   VQGSTMDTTLGPHFKMPVASMLIIPLGLLIFAVPIYEQLFVPLARRLTGIPTGITYLQRV  417

Query  1320  AVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMF  1499
              VGL+LS +SM  AA++E +RK+VA    MLD I  +Q LP+S FWL+ Q+ +FGIADMF
Sbjct  418   GVGLVLSIVSMVIAAVVEAQRKKVATRNGMLDMIVGVQHLPMSCFWLAPQFAVFGIADMF  477

Query  1500  TYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGN  1679
             TYVGL+EFFYSQAP  LKS+SS FLW S+SLGYF S+++VK VN AT+  T SGGWL G 
Sbjct  478   TYVGLMEFFYSQAPAALKSMSSSFLWCSLSLGYFMSTIIVKAVNAATRRSTASGGWLAG-  536

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             ++NRNHL+LF+ LL+ LS +N F YLF ++ YKYR Q
Sbjct  537   SINRNHLDLFFWLLAVLSTLNLFNYLFWARWYKYRPQ  573



>emb|CDM83976.1| unnamed protein product [Triticum aestivum]
Length=533

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 288/519 (55%), Positives = 380/519 (73%), Gaps = 7/519 (1%)
 Frame = +3

Query  231   YLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLA  410
             Y   VM++NLADA+N +T++ G +Y++ ++  V ADT++GR++ V+IS+ +E +GL L+ 
Sbjct  2     YFMLVMHINLADASNLLTDYMGTSYMIAVLITVFADTFVGRYQTVIISSLVELIGLLLMT  61

Query  411   MQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFD  590
             +QAH  KL P  C   +    C+ V G +   L+V LY VA+GSAG+KAA+P+H ADQFD
Sbjct  62    LQAHSPKLLPKGCKWPEPT--CQRVGGHSETRLYVGLYLVAIGSAGIKAALPAHCADQFD  119

Query  591   EKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFT  770
              K  +E  +MSSFFNWLLL +C+GGAVS+T+FVW+   KGWD GF A+T  M    I F 
Sbjct  120   AKHPRERRQMSSFFNWLLLSLCIGGAVSVTVFVWIQNVKGWDKGFGAATGVMGLALIAFL  179

Query  771   LGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLP  950
             +G+P YR++  QGSSA+ +I +V+VAAI NR LQLPE+  ELYE+S+ K +     EF+ 
Sbjct  180   VGMPRYRIFTAQGSSALLEIFRVYVAAIRNRNLQLPENPAELYEMSRSKASPE--EEFVS  237

Query  951   HTDK-YRFLDKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
             H D+ +RFLD+AAI Q    E PNPWR CRVT VE+AK +L +VP+F   +IM  CLAQ 
Sbjct  238   HRDRPFRFLDRAAIVQAPTAEAPNPWRQCRVTHVEHAKTVLAMVPIFCSAIIMGTCLAQF  297

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFSIQQGSTM+  +   FQ+ P++LP +P+  LIF +P+Y+RLFVP  R +TG P GI 
Sbjct  298   QTFSIQQGSTMNTWVGG-FQMQPATLPIIPLAMLIFAVPIYERLFVPFARGITGHPNGIP  356

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
              L RV VGL+LS  SM  AA++E+ RK+VA     LDAIP+L PLP+SVFWL+ QY +FG
Sbjct  357   YLQRVGVGLVLSIFSMCIAAVVEMHRKKVAVRHGKLDAIPMLDPLPMSVFWLAPQYGVFG  416

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGG  1664
             IADMFTY+GLLEFFYSQAP  LKS+SS FLW+SMSLGY+ S+++VK VN ATK  T SGG
Sbjct  417   IADMFTYIGLLEFFYSQAPPALKSMSSAFLWASMSLGYYFSTIIVKAVNAATKKHTLSGG  476

Query  1665  WLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             WL GNN+NRNHL+LF+ LL+ LSF+NF  YL+ +  YKY
Sbjct  477   WLNGNNINRNHLDLFFWLLAVLSFINFLNYLYWASWYKY  515



>ref|XP_010908386.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Elaeis guineensis]
Length=644

 Score =   487 bits (1254),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 277/557 (50%), Positives = 373/557 (67%), Gaps = 18/557 (3%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             K +HGG RA++F+  + G ENM+ +   V+LV Y  G MN  L  +A  +TNF G +++L
Sbjct  84    KQRHGGTRAALFVYAMEGLENMSFVSNAVSLVIYFFGYMNFGLTKSATTLTNFMGTSFLL  143

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             T++   ++DTY+ RF+  +I   IE LG  LL +QA +   +P PC+      +CE+  G
Sbjct  144   TLLGGFISDTYLSRFKTCVIFGCIELLGYVLLTLQASFPSWRPAPCHG-QITNQCEQAEG  202

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
               AAIL+  LY VA+G++GVKAA+P+ GADQFDE D +E   +SSFFNW L  + VG AV
Sbjct  203   GQAAILYAGLYMVALGTSGVKAALPALGADQFDENDPRELPALSSFFNWFLFSLTVGAAV  262

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +TL VW+  ++GWDWGF    V++ F  +F ++G   +R  V  G SA+T+I+QV VA+
Sbjct  263   GVTLVVWISTNQGWDWGFGVCAVSILFAVVFLSMGRSSFRNNV-PGGSALTRILQVLVAS  321

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD-----EEPN  1016
               N +  +P    EL+E+  DKEA     E L  TD++RFLD+AAI T+ D       P+
Sbjct  322   ARNWRRPVPAMIDELHEV-DDKEAAP-NTELLQRTDQFRFLDRAAITTNPDGTPYSTTPS  379

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
              WR+C VTQVE  KILL +VP+ L TV M +CLAQLQTFS+QQG+TMD  I   F+I  +
Sbjct  380   SWRMCTVTQVEETKILLRMVPIILSTVCMNICLAQLQTFSVQQGTTMDTRIAAHFRIPSA  439

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             SLP +P+LF++ LIP+YDR FVP  RRLTGIPTGI  L R+ VGL+LS++SMA A  +E 
Sbjct  440   SLPIIPLLFMMLLIPIYDRFFVPLARRLTGIPTGIRHLQRIGVGLVLSAISMAVAGFIER  499

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
             +RK VA E  ++D+     PLPISVFWLS QY IFG ADMFT VGLLEFFY+++   +KS
Sbjct  500   RRKSVAVEHGLVDSA---APLPISVFWLSFQYGIFGAADMFTLVGLLEFFYAESSAGMKS  556

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             +S+   W S+ LGYF SSV V+VVN        SGGWL  NN+NR+ L+ FY LL+GLS 
Sbjct  557   LSTAISWCSLGLGYFGSSVTVEVVNKV------SGGWLAENNLNRDRLDYFYWLLAGLSA  610

Query  1737  VNFFVYLFVSKRYKYRQ  1787
             VNF VYL  +  Y+Y++
Sbjct  611   VNFGVYLVCASWYRYKK  627



>ref|XP_007017375.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY14600.1| Major facilitator superfamily protein [Theobroma cacao]
Length=582

 Score =   479 bits (1233),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 275/567 (49%), Positives = 380/567 (67%), Gaps = 20/567 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D++ +  ++ + GG RA+IF+  + G ENMA I   ++LVTY  G MN +L  +A  +TN
Sbjct  6     DFKAQATQEIRLGGQRATIFVYAMEGLENMAFIANAISLVTYFYGYMNFSLTKSATTLTN  65

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--D  461
             F G +++L +    ++DTY+ RF+  ++   IE LG  LLA+QAH+ +L+P PC  L   
Sbjct  66    FMGISFLLALFGGFISDTYLSRFKTCVLFGCIELLGYALLAVQAHFHQLRPTPCQGLAAS  125

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
             +  +C+      AAILF  LY VA+G++GVKAA+PS GADQFDEKD KE +++SS+FNW 
Sbjct  126   QTNQCQAADSGQAAILFTGLYLVALGTSGVKAALPSLGADQFDEKDPKESAQLSSYFNWF  185

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             LL + VG  V +T  VW+  ++GWDW F   TVA+ F  +  ++G   YR  V +GS  +
Sbjct  186   LLSLTVGAIVGVTFVVWISSNQGWDWAFGVCTVAVLFALVCVSMGKSLYRNNVPKGSP-L  244

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI----  989
              +IIQV V AI NRKL LPE + EL+EI  DKEA  +  E LP TD++RFLD+AAI    
Sbjct  245   LRIIQVLVVAIRNRKLPLPEMADELHEI-HDKEA-GVQNETLPRTDQFRFLDRAAIGPTP  302

Query  990   -QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLN  1166
                S      PWR+C +TQVE  KIL+ ++P+ L TV M  CLAQLQTF+IQQ +TMD  
Sbjct  303   GDASTSISAGPWRLCTITQVEETKILIRMLPIVLSTVFMNTCLAQLQTFTIQQSTTMDTR  362

Query  1167  ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssl  1346
             I   F++   S+P +P+ F+   IP+YDR+FVP  R++TGIPTGI  L R+ VGL+LS++
Sbjct  363   ILG-FKMPGPSIPVIPLAFMFVFIPIYDRIFVPIARKVTGIPTGIRYLQRIGVGLVLSAI  421

Query  1347  smaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             SMA A I+E +RK VA + NM+D+   LQPLP+SVFWL  QY IFG+ADMFT VGLLEFF
Sbjct  422   SMAVAGIVETRRKSVAIQHNMVDS---LQPLPMSVFWLGYQYAIFGLADMFTLVGLLEFF  478

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLEL  1706
             Y+++   +KS+S+   W S++ GYF SSV+V+VV         SGGWL  NN+NR+ L  
Sbjct  479   YAESSARMKSLSTAISWCSLAFGYFLSSVVVEVV------NKVSGGWLANNNLNRDKLNY  532

Query  1707  FYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             FY LL+ +S VNF +YL  +  Y+Y++
Sbjct  533   FYWLLAAVSVVNFGIYLVCASWYRYKK  559



>ref|XP_008220717.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Prunus mume]
Length=577

 Score =   478 bits (1230),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 271/566 (48%), Positives = 380/566 (67%), Gaps = 20/566 (4%)
 Frame = +3

Query  111   WRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNF  290
             ++G+  +  + GG RA++F+    G ENM+ +   V+LVTY  G MN++L  +A  +TNF
Sbjct  7     FKGQPKQAARLGGNRAALFVYATEGLENMSFVANAVSLVTYFYGYMNLSLTKSATTLTNF  66

Query  291   AGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE  470
              G  +ILT+V   ++DTY  RF+  ++  +IE LGLGLL +QAH+ +L+P PC  +   +
Sbjct  67    MGTAFILTLVGGFISDTYWSRFKTCVVFGFIELLGLGLLTVQAHFHQLRPFPCQNVTPDQ  126

Query  471   KCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLG  650
              CE       AIL+  LY +A+G++GVK+A+P+ GADQFDEKD   G+++SSFFNW L  
Sbjct  127   TCEAADTNQLAILYTGLYLIALGTSGVKSALPALGADQFDEKDPNGGAQLSSFFNWFLFS  186

Query  651   VCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQI  830
             + +G    +T+ VW+  ++GWD  FA  T+A+FF  +F  +G   YR  V +GS  ++ I
Sbjct  187   LTIGAIFGVTIVVWISSNRGWDLAFALCTMAVFFAVVFVCMGKSLYRNNVPKGSPLLS-I  245

Query  831   IQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI-------  989
             +QV VAA  NRKL +PE++ EL+EI  DKEA     E L  TD++RFLD+AAI       
Sbjct  246   LQVLVAATKNRKLPIPENADELHEI-HDKEAGE-QNEILQRTDQFRFLDRAAIFGATTAD  303

Query  990   QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNI  1169
              +S  +    W +C VTQVE  K L+ ++P+   TV M  C+AQLQTFSIQQ +TMD +I
Sbjct  304   GSSTSKAHGSWNLCTVTQVEETKHLIRMLPIIFSTVFMNTCMAQLQTFSIQQSNTMDTHI  363

Query  1170  TKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssls  1349
                F+I   S+P +P+LF+ FLIP+Y+R+FVP  R+ TGIPTGI  L R+AVGL+LS +S
Sbjct  364   LG-FKIPGPSIPVIPLLFMFFLIPIYERVFVPIARKFTGIPTGIRHLQRIAVGLVLSVIS  422

Query  1350  maaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFY  1529
             MA AA++E +RK VA E NM+D+I   +PLP+SVFWL +QY IFG ADMFT VGLLEFFY
Sbjct  423   MAVAALIETRRKSVAIEHNMVDSI---EPLPMSVFWLGLQYAIFGAADMFTLVGLLEFFY  479

Query  1530  SQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELF  1709
             +++   +KS+S+   W SM+ GYF SS++V+VVN        SGGWL  NN+NR+ L  F
Sbjct  480   AESAAGMKSLSTAISWCSMAFGYFLSSMVVEVVNKV------SGGWLASNNLNRDKLNYF  533

Query  1710  YALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             Y LL+GLS +NF  YL  +  YKY++
Sbjct  534   YWLLAGLSVLNFVAYLICASWYKYKK  559



>ref|XP_004238589.2| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Solanum lycopersicum]
Length=571

 Score =   477 bits (1228),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 268/568 (47%), Positives = 386/568 (68%), Gaps = 22/568 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +    +  + GG RA++F   I G + MA    GV+LVTY  G MN ++ ++A  VTN
Sbjct  6     DVKTEPKQPPRLGGNRAALFAYAIAGIDVMAFFATGVSLVTYFYGYMNFSITESATAVTN  65

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN--PLD  461
             F G  + L++  A L+DTY+ RF+  ++   IE +G  LLA+QAH+ +L+P PC   PL 
Sbjct  66    FMGTAFFLSLFGAFLSDTYLSRFKTCVLFGCIEVVGYALLAVQAHFRQLRPFPCKDVPLS  125

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
             +  +CE       AIL+V LY VA+G++GVKAA P  GADQ+DEKD KE +++SS+FNWL
Sbjct  126   QMNQCESANKGQLAILYVGLYLVAIGTSGVKAAAPPLGADQYDEKDPKEAAKLSSYFNWL  185

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             +  +  G    +T  VW+ +++GWDW FA  ++ + F  +F TLG   YR  V +G S +
Sbjct  186   MFFLTTGALFGVTFVVWISENQGWDWSFAVCSIVVGFAILFLTLGKSLYRNNVTKG-SPL  244

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSW  1001
             T+I+QVFV A+ NR L+LPE+  EL+EI +DKEA     E L  T++++FLD+AAI  + 
Sbjct  245   TRIMQVFVVALRNRNLRLPENEHELHEI-QDKEA-RYHTEILQKTEQFKFLDRAAINRT-  301

Query  1002  DEEPN------PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
             D+E +      PW++C VTQVE  KI++ ++P+ L TV M  CLAQLQTF+IQQ +TMD 
Sbjct  302   DQEASTSNAHGPWKLCTVTQVEETKIVIRMLPIILSTVFMNTCLAQLQTFTIQQSTTMDR  361

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              I K F++  +S+P +P+LF+I LIP+Y+R+F+P  R+ TGIPTGI  L R+ +GL+LSS
Sbjct  362   KIHK-FEVPGASIPAIPLLFMIILIPIYERVFIPIARKFTGIPTGIRQLQRIGIGLVLSS  420

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
             +SMA AAI+E  RK +A + NM+++     PLP+SVFWL  QY IFG+ADMFT VGLL+F
Sbjct  421   ISMAVAAIVEKHRKSIAIKHNMVESA---APLPMSVFWLGYQYAIFGLADMFTLVGLLDF  477

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FYS++   +K++S+   WSS+++GY+TSS++V +VN        SGGWL  NN+N++ L+
Sbjct  478   FYSESSSSMKALSTAISWSSLAIGYYTSSIIVSLVNKV------SGGWLANNNLNKDELD  531

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
              FY LLSGLS +NF  YL  +  YKY++
Sbjct  532   YFYWLLSGLSVLNFGFYLLCASWYKYKK  559



>ref|XP_006434871.1| hypothetical protein CICLE_v10003139mg, partial [Citrus clementina]
 gb|ESR48111.1| hypothetical protein CICLE_v10003139mg, partial [Citrus clementina]
Length=572

 Score =   476 bits (1224),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 265/565 (47%), Positives = 378/565 (67%), Gaps = 22/565 (4%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
             +  ++ + GG RA +F+  + G E+M+ +   V+LVTY +G MN +L  +A  +TNF G 
Sbjct  16    KPKQERRLGGSRAVLFVYAMEGLESMSFVANMVSLVTYFHGYMNFSLTKSATTLTNFTGT  75

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--DKAEK  473
             +++L +    ++DTY+ RF+  ++   IE LGL +LA+QAH  +L+P PC  +  +   +
Sbjct  76    SFLLALFGGFISDTYLSRFKTCVLFGCIELLGLAILAIQAHAHQLRPKPCVGVAPNLVNQ  135

Query  474   CEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGV  653
             C++  G   AILF  LY  A G+ GVKAA+PS GADQFDE+D KE ++ SSFFNW L  +
Sbjct  136   CDDADGTQVAILFTGLYLFACGTGGVKAALPSLGADQFDERDPKEAAKFSSFFNWFLFSL  195

Query  654   CVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQII  833
              VG  + +T  VW+  ++GWDW F   T+A+ F  +F  +G   YR  V +G S I +I+
Sbjct  196   TVGSIIGVTFIVWISTNQGWDWSFGVCTIAVLFATVFVIMGKSLYRHNVPKG-SPIIRIL  254

Query  834   QVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI-------Q  992
             QVFVAAIHNR L  PE + +L+EI  D+EA  +  E L  TD++RFLD+AAI       +
Sbjct  255   QVFVAAIHNRNLPKPEMADQLHEI-HDREA-GLDTEILKRTDQFRFLDRAAITRTACDGR  312

Query  993   TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNIT  1172
              S    P PWR+C VTQVE  KILL ++P+ + T+ M  CLAQLQTF IQQ +TMD N+ 
Sbjct  313   ASTSINPGPWRLCTVTQVEETKILLRMLPIIVSTLFMNTCLAQLQTFCIQQSTTMDRNLF  372

Query  1173  KsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsm  1352
               F++   SLP +P++F+  L+P+YDR+F+P  R++TGIPTGI  L R+ VGL+LS++SM
Sbjct  373   G-FKVPGPSLPVIPLVFMFILVPIYDRVFIPIARKITGIPTGIRQLQRIGVGLVLSAVSM  431

Query  1353  aaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYS  1532
             A AA++E KRK VA E NM+D+I   +PLP+SVFWL  QY IFG ADMFT VGLL+FFY+
Sbjct  432   AVAAVVETKRKSVAVEHNMVDSI---EPLPMSVFWLGFQYAIFGAADMFTLVGLLDFFYA  488

Query  1533  QAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFY  1712
             ++   +KS+S+   W S++ GYF SS++V++VN        SGGWL  NN+NR+ L  FY
Sbjct  489   ESSAGMKSLSTAISWCSIAFGYFLSSLVVEIVNKV------SGGWLASNNLNRDKLNYFY  542

Query  1713  ALLSGLSFVNFFVYLFVSKRYKYRQ  1787
              LL+G+S +NF  YL  +  Y+Y++
Sbjct  543   WLLAGISVLNFGFYLACASWYRYKE  567



>ref|XP_008792636.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Phoenix dactylifera]
Length=593

 Score =   474 bits (1220),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 266/557 (48%), Positives = 373/557 (67%), Gaps = 17/557 (3%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             K + GG RA++F+  + G ENM+ + + V+LV Y  G MN  L  +AN +TNF G +++L
Sbjct  33    KQRLGGTRAALFVYAMEGLENMSFVSIAVSLVIYFFGYMNFGLTKSANTLTNFMGTSFLL  92

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             T++   ++DTY+ RF+  +I   IE LG  LL +QA +   +P PC+ L    +C+   G
Sbjct  93    TLLGGFISDTYLSRFKTCVIFGCIELLGYILLTLQASFPSWRPEPCHGL-ITNQCKPAEG  151

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
               AAIL+  LY VA+G++GVKAA+P+ GADQFDE D +E   +SSFFNW L  +  G AV
Sbjct  152   GQAAILYAGLYMVALGTSGVKAALPALGADQFDENDPRELPSLSSFFNWFLFSLSTGAAV  211

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +TL VW+  ++GW+WGF    V++ F   F ++G   +R  V  G SA+T+I+QV VA+
Sbjct  212   GVTLVVWISTNQGWEWGFGVCAVSILFAVSFLSMGRSSFRNNV-PGGSALTRILQVLVAS  270

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD-----EEPN  1016
             + NR+  +P  + EL+E+   KEA     E L  TD++ FLD+AAI T+ D       P+
Sbjct  271   VRNRRRPVPAMTDELHEVDFGKEAGP-NTELLQRTDQFGFLDRAAIATNPDGTPYATPPS  329

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
              W +C VTQVE  KILL +VP+ L TV M +CLAQLQTFS+QQG+TMD  I   F+I  +
Sbjct  330   SWWMCTVTQVEETKILLRMVPIILSTVCMNVCLAQLQTFSVQQGTTMDTRIAGHFRIPSA  389

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             SLP +P++F++ LIP+YDR+FVP  RRLTGIPTGI  L R+ +GL+L+++SMA A  +E 
Sbjct  390   SLPIIPLVFMMLLIPIYDRIFVPLARRLTGIPTGIRHLQRIGIGLVLAAISMAVAGFVER  449

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
             +R+ VA E  ++D+     PLP+SVFWLS QY IFG ADMFT VGLLEFFY+++   +KS
Sbjct  450   RRRSVAFEHGLVDSA---APLPVSVFWLSFQYGIFGAADMFTLVGLLEFFYAESSAGMKS  506

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             +S+   W S+ LGYF SSV V+VVN        S GWL GNN+NR+ L+ FY LL+GLS 
Sbjct  507   LSTAISWCSLGLGYFGSSVAVEVVNKV------SAGWLAGNNLNRDRLDYFYWLLAGLSA  560

Query  1737  VNFFVYLFVSKRYKYRQ  1787
             VNF +YL  +  Y++++
Sbjct  561   VNFGIYLACASWYRHKK  577



>ref|XP_002282221.2| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Vitis vinifera]
Length=576

 Score =   473 bits (1217),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 277/567 (49%), Positives = 376/567 (66%), Gaps = 20/567 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +    R+   GG RA+IF+  + G ENMA +   V+LVTY  G MN +L  +A  +TN
Sbjct  6     DAKTGPRREAMTGGTRAAIFVYAMEGLENMAYVANAVSLVTYFYGYMNFSLTKSATTLTN  65

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--D  461
             F G + +LT++   + DTY+ RF+  ++   IE +G  LL +QAH+++L+P PC  +  D
Sbjct  66    FMGTSLLLTLLGGFICDTYLSRFKTCVLFGCIELVGYALLTVQAHFSQLRPFPCKNVARD  125

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
             K ++CE       AILF  LY VA+G++GVKAA+P+ GADQFDEKD KE   +S+FFNW 
Sbjct  126   KMDQCEAADSGQVAILFTGLYLVALGTSGVKAALPALGADQFDEKDPKEAPLISTFFNWF  185

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             L  + VG    +T  VW+  ++GWD  F  ST+ + F  IF  +G   YR    +GS  I
Sbjct  186   LFSLTVGAIFGVTFVVWISSNQGWDLAFGVSTLVVLFSIIFLCMGKSVYRHNAPKGSP-I  244

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI----  989
              +I+QVFVAAI NR L +PE S EL+EI  DKE V +  E L  TD++RFLD+AAI    
Sbjct  245   LRIVQVFVAAIRNRALPVPEKSEELHEI-HDKE-VGMENEILARTDQFRFLDRAAIVSTA  302

Query  990   -QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLN  1166
               TS    P PWR+C VTQVE  KIL+ ++P+ L T  M  CLAQLQTFSIQQ +TMD N
Sbjct  303   SGTSPSITPRPWRMCTVTQVEETKILIRMLPIILSTFFMNTCLAQLQTFSIQQSTTMDRN  362

Query  1167  ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssl  1346
             +   FQ+   S+P +P+LF+  LIP+Y+R+FVP  R++TGIPTGI  L R+A+GL+LS++
Sbjct  363   LLG-FQVPGPSIPLIPLLFMFILIPIYERIFVPLARKVTGIPTGIRHLQRIAIGLVLSTI  421

Query  1347  smaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             SMA A ++E +RK  A + NM+D+     PLPISVFWL  QY IFG ADMFT VGLLEFF
Sbjct  422   SMAVAGVVETRRKSAAIQHNMVDSP---DPLPISVFWLGFQYAIFGAADMFTLVGLLEFF  478

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLEL  1706
             Y+++   +KS+S+   W S++ GYFTS+++V+VVN        SGGWL  NN+NR+ L  
Sbjct  479   YAESSLGMKSLSTAIAWCSVAFGYFTSTIVVEVVNRV------SGGWLASNNLNRDKLNY  532

Query  1707  FYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             FY LL+GLS VNF VYL  +  Y+Y++
Sbjct  533   FYWLLAGLSVVNFGVYLVCASWYRYKK  559



>emb|CBI19585.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   473 bits (1216),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 277/567 (49%), Positives = 376/567 (66%), Gaps = 20/567 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +    R+   GG RA+IF+  + G ENMA +   V+LVTY  G MN +L  +A  +TN
Sbjct  66    DAKTGPRREAMTGGTRAAIFVYAMEGLENMAYVANAVSLVTYFYGYMNFSLTKSATTLTN  125

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--D  461
             F G + +LT++   + DTY+ RF+  ++   IE +G  LL +QAH+++L+P PC  +  D
Sbjct  126   FMGTSLLLTLLGGFICDTYLSRFKTCVLFGCIELVGYALLTVQAHFSQLRPFPCKNVARD  185

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
             K ++CE       AILF  LY VA+G++GVKAA+P+ GADQFDEKD KE   +S+FFNW 
Sbjct  186   KMDQCEAADSGQVAILFTGLYLVALGTSGVKAALPALGADQFDEKDPKEAPLISTFFNWF  245

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             L  + VG    +T  VW+  ++GWD  F  ST+ + F  IF  +G   YR    +G S I
Sbjct  246   LFSLTVGAIFGVTFVVWISSNQGWDLAFGVSTLVVLFSIIFLCMGKSVYRHNAPKG-SPI  304

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI----  989
              +I+QVFVAAI NR L +PE S EL+EI  DKE V +  E L  TD++RFLD+AAI    
Sbjct  305   LRIVQVFVAAIRNRALPVPEKSEELHEI-HDKE-VGMENEILARTDQFRFLDRAAIVSTA  362

Query  990   -QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLN  1166
               TS    P PWR+C VTQVE  KIL+ ++P+ L T  M  CLAQLQTFSIQQ +TMD N
Sbjct  363   SGTSPSITPRPWRMCTVTQVEETKILIRMLPIILSTFFMNTCLAQLQTFSIQQSTTMDRN  422

Query  1167  ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssl  1346
             +   FQ+   S+P +P+LF+  LIP+Y+R+FVP  R++TGIPTGI  L R+A+GL+LS++
Sbjct  423   LLG-FQVPGPSIPLIPLLFMFILIPIYERIFVPLARKVTGIPTGIRHLQRIAIGLVLSTI  481

Query  1347  smaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             SMA A ++E +RK  A + NM+D+     PLPISVFWL  QY IFG ADMFT VGLLEFF
Sbjct  482   SMAVAGVVETRRKSAAIQHNMVDSP---DPLPISVFWLGFQYAIFGAADMFTLVGLLEFF  538

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLEL  1706
             Y+++   +KS+S+   W S++ GYFTS+++V+VVN        SGGWL  NN+NR+ L  
Sbjct  539   YAESSLGMKSLSTAIAWCSVAFGYFTSTIVVEVVNRV------SGGWLASNNLNRDKLNY  592

Query  1707  FYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             FY LL+GLS VNF VYL  +  Y+Y++
Sbjct  593   FYWLLAGLSVVNFGVYLVCASWYRYKK  619



>ref|XP_004501602.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Cicer arietinum]
Length=576

 Score =   469 bits (1207),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 264/552 (48%), Positives = 365/552 (66%), Gaps = 18/552 (3%)
 Frame = +3

Query  144   GGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVA  323
             GG RA+IF+  + G ENMA +   V+L+TY  G MN++L  +A  +TNF G  ++L ++ 
Sbjct  18    GGNRAAIFVYAMEGLENMAFVANAVSLITYFLGYMNLSLTKSATTLTNFMGTAFLLPLIG  77

Query  324   AVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE--KCEEVAGRN  497
               + DTY+ RF+  ++ A +E LG GLL  QA + +L+P PC  +   +  +CE   G  
Sbjct  78    GFICDTYLSRFKTCVLFACMELLGYGLLTFQARFQQLRPIPCKNVASIDTNQCEAATGGQ  137

Query  498   AAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSL  677
             AAIL+  LY VA+G++GVKAA+P+ GADQFD+KD KE +++SSFFNW L  +  G  + +
Sbjct  138   AAILYTGLYLVALGTSGVKAALPALGADQFDDKDPKEAAQLSSFFNWFLFSLTSGAILGV  197

Query  678   TLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIH  857
             T  VW+  ++GW W F   T+A+ F  I   +G  FYR    +GS  I +IIQVFVAA  
Sbjct  198   TFIVWISANQGWYWSFTVCTIAVLFSIISICMGKSFYRNNTPKGSPLI-RIIQVFVAAFR  256

Query  858   NRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI---QTSWDEEPNPWRV  1028
             NRKLQ+PED+ E++EI + +       E L  T+++RFLD+AAI    T+       W +
Sbjct  257   NRKLQIPEDADEMHEIPEKERGEN--NEILKRTEQFRFLDRAAIGRVSTAVTASTGSWNL  314

Query  1029  CRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpf  1208
             C VTQVE  KIL+ ++P+ L T+ M  CLAQLQTFSIQQ +T++ NI   F++   SLP 
Sbjct  315   CTVTQVEETKILIRMLPIILSTIFMNTCLAQLQTFSIQQSTTLNTNIMG-FKMPGPSLPV  373

Query  1209  lpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQ  1388
             +P+LF+  LIPLYDR FVP  RR+TGIPTGI  L R+ +GL+LS++SMA A  +E  RK 
Sbjct  374   IPLLFMFVLIPLYDRFFVPLARRITGIPTGIRHLQRIGIGLVLSAVSMAIAGFIETHRKS  433

Query  1389  VARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSC  1568
             VA + NM+D+I   +PLP++VFWL  QY IFG ADMFT VGLLEFFY+++   +KS+S+ 
Sbjct  434   VAVKHNMVDSI---EPLPMTVFWLGFQYAIFGAADMFTLVGLLEFFYAESSAGMKSLSTA  490

Query  1569  FLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFF  1748
               W S++ GYFTS+V V+VVN        SGGWL  NN+NR+ L  FY LLS +S VNF 
Sbjct  491   ISWCSVAFGYFTSTVAVEVVNKV------SGGWLASNNLNRDKLNYFYWLLSIISVVNFG  544

Query  1749  VYLFVSKRYKYR  1784
              YL  +  Y+Y+
Sbjct  545   FYLICASWYRYK  556



>ref|XP_011017254.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X2 [Populus 
euphratica]
Length=578

 Score =   468 bits (1205),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 270/571 (47%), Positives = 378/571 (66%), Gaps = 19/571 (3%)
 Frame = +3

Query  93    IDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAA  272
             +D   D +    R+ + GG RA++F+    G ENMA I + V+LVTY  G MN +L  +A
Sbjct  1     MDVSRDIKVEPKRERRLGGNRAALFVFAAEGLENMAFICMAVSLVTYFYGYMNFSLTKSA  60

Query  273   NHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN  452
               +TNF G ++++ +    + DTY+ RF+A ++   +EF+G GLL +QAH+  L+P PC 
Sbjct  61    TTLTNFMGTSFLVALFGGFICDTYMTRFKACVLFGCVEFMGYGLLTVQAHFHHLRPSPCK  120

Query  453   PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFF  632
              +   ++CE   G  AAILF  LY +A G++GVKA++PS GADQFDE D KE S +SSFF
Sbjct  121   GVSP-DQCEGADGSQAAILFAGLYLIAFGTSGVKASLPSLGADQFDENDPKEASRLSSFF  179

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             NWL+  + +G  + +T+ VW+  ++GWD GF  S +A+     F ++G   YR  V +G 
Sbjct  180   NWLMFSITIGAILGVTVIVWISTNQGWDLGFGVSAIAVLLAIFFASMGKSLYRNNVPKG-  238

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQ  992
             S +T   QVFVAAI NR L +PE + +L+EI  DK+A  +  E LP TD++RFLD+AAI 
Sbjct  239   SPLTSFAQVFVAAIRNRGLPIPEKAEDLHEI-HDKDA-GVKREILPWTDQFRFLDRAAIA  296

Query  993   TSWDEEPN-----PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTM  1157
              + ++        PWR+C VTQ+E  KIL+ ++P+ L TV M  CLAQLQTFS+QQ  TM
Sbjct  297   KTTNDASTSISHGPWRLCSVTQIEQTKILIRMLPIILSTVFMNTCLAQLQTFSVQQSITM  356

Query  1158  DLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlll  1337
             D  +   FQ+   SLP +P+LF+  LIP+Y+R+FVP  R++TGIPTGI  L RV VGL+L
Sbjct  357   DTRVFG-FQVPGPSLPVIPLLFMFVLIPIYERVFVPLARKITGIPTGIRQLQRVGVGLVL  415

Query  1338  sslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLL  1517
             S++SMA A ++E  RK VA E NM+D+    +PLP+S  WL  QY IFG ADMFT VGLL
Sbjct  416   SAISMAVAGVVETSRKSVAVEHNMVDST---EPLPMSFLWLGFQYAIFGAADMFTLVGLL  472

Query  1518  EFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNH  1697
             EFFY+++   +KS+S+   W S++ GYF SSV+V+VVN  T      GGWL  NN+NR+ 
Sbjct  473   EFFYAESSAGMKSLSTAISWCSLAFGYFLSSVVVEVVNKVT------GGWLANNNLNRDK  526

Query  1698  LELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L  FY LL+G+S VNF VYL  +  Y+Y+++
Sbjct  527   LNYFYWLLAGISIVNFGVYLACASWYRYKKR  557



>ref|XP_011017253.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X1 [Populus 
euphratica]
Length=586

 Score =   468 bits (1205),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 270/570 (47%), Positives = 377/570 (66%), Gaps = 19/570 (3%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D   D +    R+ + GG RA++F+    G ENMA I + V+LVTY  G MN +L  +A 
Sbjct  10    DVSRDIKVEPKRERRLGGNRAALFVFAAEGLENMAFICMAVSLVTYFYGYMNFSLTKSAT  69

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              +TNF G ++++ +    + DTY+ RF+A ++   +EF+G GLL +QAH+  L+P PC  
Sbjct  70    TLTNFMGTSFLVALFGGFICDTYMTRFKACVLFGCVEFMGYGLLTVQAHFHHLRPSPCKG  129

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +   ++CE   G  AAILF  LY +A G++GVKA++PS GADQFDE D KE S +SSFFN
Sbjct  130   VSP-DQCEGADGSQAAILFAGLYLIAFGTSGVKASLPSLGADQFDENDPKEASRLSSFFN  188

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             WL+  + +G  + +T+ VW+  ++GWD GF  S +A+     F ++G   YR  V +G S
Sbjct  189   WLMFSITIGAILGVTVIVWISTNQGWDLGFGVSAIAVLLAIFFASMGKSLYRNNVPKG-S  247

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
              +T   QVFVAAI NR L +PE + +L+EI  DK+A  +  E LP TD++RFLD+AAI  
Sbjct  248   PLTSFAQVFVAAIRNRGLPIPEKAEDLHEI-HDKDA-GVKREILPWTDQFRFLDRAAIAK  305

Query  996   SWDEEPN-----PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMD  1160
             + ++        PWR+C VTQ+E  KIL+ ++P+ L TV M  CLAQLQTFS+QQ  TMD
Sbjct  306   TTNDASTSISHGPWRLCSVTQIEQTKILIRMLPIILSTVFMNTCLAQLQTFSVQQSITMD  365

Query  1161  LNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGllls  1340
               +   FQ+   SLP +P+LF+  LIP+Y+R+FVP  R++TGIPTGI  L RV VGL+LS
Sbjct  366   TRVFG-FQVPGPSLPVIPLLFMFVLIPIYERVFVPLARKITGIPTGIRQLQRVGVGLVLS  424

Query  1341  slsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLE  1520
             ++SMA A ++E  RK VA E NM+D+    +PLP+S  WL  QY IFG ADMFT VGLLE
Sbjct  425   AISMAVAGVVETSRKSVAVEHNMVDST---EPLPMSFLWLGFQYAIFGAADMFTLVGLLE  481

Query  1521  FFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHL  1700
             FFY+++   +KS+S+   W S++ GYF SSV+V+VVN  T      GGWL  NN+NR+ L
Sbjct  482   FFYAESSAGMKSLSTAISWCSLAFGYFLSSVVVEVVNKVT------GGWLANNNLNRDKL  535

Query  1701  ELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
               FY LL+G+S VNF VYL  +  Y+Y+++
Sbjct  536   NYFYWLLAGISIVNFGVYLACASWYRYKKR  565



>gb|KHN04528.1| Putative peptide/nitrate transporter [Glycine soja]
Length=568

 Score =   466 bits (1198),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 263/556 (47%), Positives = 372/556 (67%), Gaps = 18/556 (3%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + + GG RA++F+  + G ENMA +   V+LVTY  G MN +L  +A  +TNF G  ++L
Sbjct  8     QRRLGGNRATLFVYAMEGLENMAFVANAVSLVTYFFGYMNFSLTKSATTLTNFMGTAFLL  67

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE--KCEEV  485
              +V  +++DTY+ RF+  ++ A +E LG G+L +QA + +L+P PC  L   +  +CE  
Sbjct  68    ALVGGLISDTYLSRFKTCVLFACMELLGYGILTVQARFHQLRPIPCKDLATTQMSQCEAA  127

Query  486   AGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGG  665
              G +AAIL+  LY VA+G+ G+KAA+P+ GADQFDEKD KE +++SSFFNW L  + +G 
Sbjct  128   TGGHAAILYTGLYLVALGTGGIKAALPALGADQFDEKDPKEATQLSSFFNWFLFSLTIGA  187

Query  666   AVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFV  845
              + +T  VW+  + GWDW F   T+ + F  +F  +G   YR  V +G S + +IIQVFV
Sbjct  188   IIGVTFIVWIGVNLGWDWSFIVCTLTILFAIVFICMGNSLYRNNVPKG-SPLVRIIQVFV  246

Query  846   AAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI---QTSWDEEPN  1016
             AA  NRKL +P+++ EL+EI + +       E +  TD++RFLD+AAI    T       
Sbjct  247   AAFRNRKLLIPDNTDELHEIHEKQGGDYY--EIIKSTDQFRFLDRAAIARSSTGARTTSG  304

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
             PWR+C VTQVE  KIL+ ++P+ L T+ M  CLAQLQTF+IQQ +TMD N+   F++   
Sbjct  305   PWRLCTVTQVEETKILVRMLPIILSTIFMNTCLAQLQTFTIQQSTTMDTNL-GGFKVPGP  363

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             S+P +P+LF+  LIPLYDR+FVP  RR+TGIPTGI  L R+ +GL+LS++SMA A  +E 
Sbjct  364   SVPVIPLLFMFVLIPLYDRVFVPLARRITGIPTGIRHLQRIGIGLVLSAVSMAVAGFVET  423

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
             +RK VA + NM+D+    +PLPISVFWL  QY IFG ADMFT +GLLEFFY+++   +KS
Sbjct  424   RRKSVAIQHNMVDST---EPLPISVFWLGFQYAIFGAADMFTLIGLLEFFYAESSAGMKS  480

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             + +   WSS++ GYFTS+V+V+VV         SGGWL  NN+NR++L  FY LLS LS 
Sbjct  481   LGTAISWSSVAFGYFTSTVVVEVV------NKVSGGWLASNNLNRDNLNYFYWLLSVLSV  534

Query  1737  VNFFVYLFVSKRYKYR  1784
             VNF  YL  +  Y+Y+
Sbjct  535   VNFGFYLVCASWYRYK  550



>ref|XP_007136650.1| hypothetical protein PHAVU_009G062200g [Phaseolus vulgaris]
 gb|ESW08644.1| hypothetical protein PHAVU_009G062200g [Phaseolus vulgaris]
Length=594

 Score =   466 bits (1200),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 260/556 (47%), Positives = 375/556 (67%), Gaps = 17/556 (3%)
 Frame = +3

Query  129   RKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYI  308
             ++ + GG RA++F+  + G E+MA +   V+LVTY  G MN ++  +A  +TNF G  ++
Sbjct  34    QQRRLGGNRAALFVYAMEGLESMAFVSSAVSLVTYFFGYMNFSITKSATTLTNFLGTAFL  93

Query  309   LTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE--KCEE  482
             L +   ++ D Y+ RF++ ++ A +EFLG G+LA+QA   +L+P PC     A+  +C+ 
Sbjct  94    LALFGGIINDAYLSRFKSCVLFACMEFLGYGILAVQAWSHQLRPIPCQDRAVAQISECKA  153

Query  483   VAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVG  662
               G  AA+L+  LY VA+GS G+KAA+P+ GADQFDEKD KE +++SSFFNW L  + +G
Sbjct  154   ATGGQAAMLYSGLYLVALGSGGIKAALPALGADQFDEKDPKEATQLSSFFNWFLFSLTIG  213

Query  663   GAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVF  842
               + +T  VW+  ++GWDW F   T+A+ F  +F  +G   YR  V +G S + +IIQVF
Sbjct  214   SIIGVTFIVWIGANQGWDWSFVVCTIAILFAILFICMGNSLYRHNVPKG-SPLLRIIQVF  272

Query  843   VAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI-QTSWDEEPN-  1016
             VAA  NRKLQ+P+ + EL+EI +++    I  E L  T+++RFLD+AAI  +S D E + 
Sbjct  273   VAAFRNRKLQIPDSNDELHEIHEEQRGDNI--EILKRTEQFRFLDRAAIVASSTDRETSG  330

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
              WR+C VTQVE  KIL+ ++P+ L T+ M  CLAQLQTF++QQ +TM+  I   F++  +
Sbjct  331   HWRLCTVTQVEETKILIRMLPIILSTIFMNTCLAQLQTFTVQQSTTMNAKI-GGFKVPGA  389

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             SLP +P+LF+  LIPLYDR+FVP  RR+TGIPTGI  L R+ +GL+LS+ SMA A  +E 
Sbjct  390   SLPVIPLLFMFVLIPLYDRVFVPVARRITGIPTGIRQLQRIGIGLVLSAASMAVAGFVET  449

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
             +RK VA E NM+D+    +PLP+SVFWL  QY IFG ADMFT +GLLEFFY+++   +KS
Sbjct  450   RRKSVAIEHNMVDST---EPLPMSVFWLGYQYGIFGAADMFTLIGLLEFFYAESSAGMKS  506

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             + +   W S++ GYFTS+++V+VVN        SGGWL  NN+NR+ L  FY +LS +S 
Sbjct  507   LGTAISWCSVAFGYFTSTLVVEVVNKV------SGGWLASNNLNRDKLNYFYWMLSVISV  560

Query  1737  VNFFVYLFVSKRYKYR  1784
             VNF  YL  +  Y Y+
Sbjct  561   VNFGFYLLCASWYTYK  576



>gb|KDO84362.1| hypothetical protein CISIN_1g008651mg [Citrus sinensis]
Length=558

 Score =   464 bits (1195),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 260/544 (48%), Positives = 365/544 (67%), Gaps = 22/544 (4%)
 Frame = +3

Query  183   GFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRA  362
             G E+M+ +   V+LVTY +G MN +L  +A  +TNF G  ++L +    ++DTY+ RF+ 
Sbjct  3     GLESMSFVANMVSLVTYFHGYMNFSLTKSATTLTNFTGTAFLLALFGGFISDTYLSRFKT  62

Query  363   VLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--DKAEKCEEVAGRNAAILFVALYTVAM  536
              ++   IE LGL +LA+QAH  +L+P PC  +  +   +C++  G   AILF  LY  A 
Sbjct  63    CVLFGCIELLGLAILAIQAHAHQLRPKPCVGVAPNLVNQCDDADGTQVAILFTGLYLFAC  122

Query  537   GSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWD  716
             G+ GVKAA+PS GADQFDE+D KE ++ SSFFNW L  + VG  + +T  VW+  ++GWD
Sbjct  123   GTGGVKAALPSLGADQFDERDPKEAAKFSSFFNWFLFSLTVGSIIGVTFIVWISTNQGWD  182

Query  717   WGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL  896
             W F   T+A+ F  +F  +G   YR  V +G S I +I+QVFVAAIHNR L  PE + +L
Sbjct  183   WSFGVCTIAVLFATVFVIMGKSLYRHNVPKG-SPIIRILQVFVAAIHNRNLPKPEMADQL  241

Query  897   YEISKDKEAVTICAEFLPHTDKYRFLDKAAI-------QTSWDEEPNPWRVCRVTQVENA  1055
             +EI  D+EA  +  E L  TD++RFLD+AAI       + S    P PWR+C VTQVE  
Sbjct  242   HEI-HDREA-GLDTEILKRTDQFRFLDRAAITRTACDGRASTSINPGPWRLCTVTQVEET  299

Query  1056  KILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifl  1235
             KILL ++P+ + T+ M  CLAQLQTF IQQ +TMD N+   F++   SLP +P++F+  L
Sbjct  300   KILLRMLPIIVSTLFMNTCLAQLQTFCIQQSTTMDRNLFG-FKVPGPSLPVIPLVFMFIL  358

Query  1236  iplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLD  1415
             +P+YDR+F+P  R++TGIPTGI  L R+ VGL+LS++SMA AA++E KRK VA E NM+D
Sbjct  359   VPIYDRVFIPIARKITGIPTGIRQLQRIGVGLVLSAVSMAVAAVVETKRKSVAVEHNMVD  418

Query  1416  AIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLG  1595
             +I   +PLP+SVFWL  QY IFG ADMFT VGLL+FFY+++   +KS+S+   W S++ G
Sbjct  419   SI---EPLPMSVFWLGFQYAIFGAADMFTLVGLLDFFYAESSAGMKSLSTAISWCSIAFG  475

Query  1596  YFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             YF SS++V++VN        SGGWL  NN+NR+ L  FY LL+G+S +NF  YL  +  Y
Sbjct  476   YFLSSLVVEIVNKV------SGGWLASNNLNRDKLNYFYWLLAGISVLNFGFYLACASWY  529

Query  1776  KYRQ  1787
             +Y++
Sbjct  530   RYKE  533



>ref|XP_006473393.1| PREDICTED: nitrate transporter 1.2-like [Citrus sinensis]
Length=558

 Score =   464 bits (1194),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 259/544 (48%), Positives = 365/544 (67%), Gaps = 22/544 (4%)
 Frame = +3

Query  183   GFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRA  362
             G E+M+ +   V+LVTY +G MN +L  +A  +TNF G  ++L +    ++DTY+ RF+ 
Sbjct  3     GLESMSFVANMVSLVTYFHGYMNFSLTKSATTLTNFTGTAFLLALFGGFISDTYLSRFKT  62

Query  363   VLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--DKAEKCEEVAGRNAAILFVALYTVAM  536
              ++   IE LGL +LA+QAH  +L+P PC  +  +   +C++  G   AILF  LY  A 
Sbjct  63    CVLFGCIELLGLAILAIQAHAHQLRPKPCVGVAPNLVNQCDDADGTQVAILFTGLYLFAC  122

Query  537   GSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWD  716
             G+ GVKAA+PS GADQFDE+D KE ++ SSFFNW L  + VG  + +T  VW+  ++GWD
Sbjct  123   GTGGVKAALPSLGADQFDERDPKEAAKFSSFFNWFLFSLTVGSIIGVTFIVWISTNQGWD  182

Query  717   WGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL  896
             W F   T+A+ F  +F  +G   YR  V +G S I +++QVFVAAIHNR L  PE + +L
Sbjct  183   WSFGVCTIAVLFATVFVIMGKSLYRHNVPKG-SPIIRVLQVFVAAIHNRNLPKPEMADQL  241

Query  897   YEISKDKEAVTICAEFLPHTDKYRFLDKAAI-------QTSWDEEPNPWRVCRVTQVENA  1055
             +EI  D+EA  +  E L  TD++RFLD+AAI       + S    P PWR+C VTQVE  
Sbjct  242   HEI-HDREA-GLDTEILKRTDQFRFLDRAAITRTACDGRASTSINPGPWRLCTVTQVEET  299

Query  1056  KILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifl  1235
             KILL ++P+ + T+ M  CLAQLQTF IQQ +TMD N+   F++   SLP +P++F+  L
Sbjct  300   KILLRMLPIIVSTLFMNTCLAQLQTFCIQQSTTMDRNLFG-FKVPGPSLPVIPLVFMFIL  358

Query  1236  iplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLD  1415
             +P+YDR+F+P  R++TGIPTGI  L R+ VGL+LS++SMA AA++E KRK VA E NM+D
Sbjct  359   VPIYDRVFIPIARKITGIPTGIRQLQRIGVGLVLSAVSMAVAAVVETKRKSVAVEHNMVD  418

Query  1416  AIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLG  1595
             +I   +PLP+SVFWL  QY IFG ADMFT VGLL+FFY+++   +KS+S+   W S++ G
Sbjct  419   SI---EPLPMSVFWLGFQYAIFGAADMFTLVGLLDFFYAESSAGMKSLSTAISWCSIAFG  475

Query  1596  YFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             YF SS++V++VN        SGGWL  NN+NR+ L  FY LL+G+S +NF  YL  +  Y
Sbjct  476   YFLSSLVVEIVNKV------SGGWLASNNLNRDKLNYFYWLLAGISVLNFGFYLACASWY  529

Query  1776  KYRQ  1787
             +Y++
Sbjct  530   RYKE  533



>ref|XP_003523589.2| PREDICTED: nitrate transporter 1.2-like [Glycine max]
Length=612

 Score =   466 bits (1198),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 263/556 (47%), Positives = 372/556 (67%), Gaps = 18/556 (3%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + + GG RA++F+  + G ENMA +   V+LVTY  G MN +L  +A  +TNF G  ++L
Sbjct  52    QRRLGGNRATLFVYAMEGLENMAFVANAVSLVTYFFGYMNFSLTKSATTLTNFMGTAFLL  111

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE--KCEEV  485
              +V  +++DTY+ RF+  ++ A +E LG G+L +QA + +L+P PC  L   +  +CE  
Sbjct  112   ALVGGLISDTYLSRFKTCVLFACMELLGYGILTVQARFHQLRPIPCKDLATTQMSQCEAA  171

Query  486   AGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGG  665
              G +AAIL+  LY VA+G+ G+KAA+P+ GADQFDEKD KE +++SSFFNW L  + +G 
Sbjct  172   TGGHAAILYTGLYLVALGTGGIKAALPALGADQFDEKDPKEATQLSSFFNWFLFSLTIGA  231

Query  666   AVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFV  845
              + +T  VW+  + GWDW F   T+ + F  +F  +G   YR  V +G S + +IIQVFV
Sbjct  232   IIGVTFIVWIGVNLGWDWSFIVCTLTILFAIVFICMGNSLYRNNVPKG-SPLVRIIQVFV  290

Query  846   AAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI---QTSWDEEPN  1016
             AA  NRKL +P+++ EL+EI + +       E +  TD++RFLD+AAI    T       
Sbjct  291   AAFRNRKLLIPDNTDELHEIHEKQGGDYY--EIIKSTDQFRFLDRAAIARSSTGARTTSG  348

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
             PWR+C VTQVE  KIL+ ++P+ L T+ M  CLAQLQTF+IQQ +TMD N+   F++   
Sbjct  349   PWRLCTVTQVEETKILVRMLPIILSTIFMNTCLAQLQTFTIQQSTTMDTNL-GGFKVPGP  407

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             S+P +P+LF+  LIPLYDR+FVP  RR+TGIPTGI  L R+ +GL+LS++SMA A  +E 
Sbjct  408   SVPVIPLLFMFVLIPLYDRVFVPLARRITGIPTGIRHLQRIGIGLVLSAVSMAVAGFVET  467

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
             +RK VA + NM+D+    +PLPISVFWL  QY IFG ADMFT +GLLEFFY+++   +KS
Sbjct  468   RRKSVAIQHNMVDST---EPLPISVFWLGFQYAIFGAADMFTLIGLLEFFYAESSAGMKS  524

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             + +   WSS++ GYFTS+V+V+VV         SGGWL  NN+NR++L  FY LLS LS 
Sbjct  525   LGTAISWSSVAFGYFTSTVVVEVV------NKVSGGWLASNNLNRDNLNYFYWLLSVLSV  578

Query  1737  VNFFVYLFVSKRYKYR  1784
             VNF  YL  +  Y+Y+
Sbjct  579   VNFGFYLVCASWYRYK  594



>gb|KDP38407.1| hypothetical protein JCGZ_04332 [Jatropha curcas]
Length=1131

 Score =   481 bits (1238),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 265/561 (47%), Positives = 375/561 (67%), Gaps = 21/561 (4%)
 Frame = +3

Query  129   RKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYI  308
             ++ K GG RA++F+  +   ENMA + + ++LVTY  G MN +L  +A  VTNF G +++
Sbjct  564   QERKLGGNRAALFVYAMEALENMAFLSISISLVTYFYGYMNFSLTRSATSVTNFLGTSFL  623

Query  309   LTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--DKAEKCEE  482
             L++    ++DTY+ RF+  ++   IE LG  +L +QAH+ +L+P PC  +  DK  +CE 
Sbjct  624   LSLFGGFISDTYLSRFKTSVLFGCIELLGYAILTVQAHFHQLRPTPCQGVSPDKTNQCEA  683

Query  483   VAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVG  662
               G   A+LF  LY VA+G+ GVKA +PS GADQFDE D KE +E+SS+FNW L  + VG
Sbjct  684   ATGGQEAVLFTGLYLVAIGTGGVKAGLPSLGADQFDENDPKEAAELSSYFNWFLFSITVG  743

Query  663   GAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVF  842
               + +T  VW+  ++GW+W +A  T+A+ F  I   +G   YR+ V +G S I + +QVF
Sbjct  744   NIIGVTFVVWISTNQGWEWSYAICTMALLFSVILLCMGKSLYRINVPKG-SPIIRFMQVF  802

Query  843   VAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI------QTSWD  1004
             VAAI NR L +P+ + EL+EI  DKE +    E L  TD++RFLD+AAI        S  
Sbjct  803   VAAIRNRNLPIPDMTDELHEI-HDKE-IGKQDEILKRTDQFRFLDRAAILRTDNNGASTS  860

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
               P PWR+C VTQ+E  KIL+ +VP+ L TV M  CLAQLQTF+IQQG+TMD N    F 
Sbjct  861   VTPGPWRLCTVTQIEETKILIRMVPIILSTVFMNTCLAQLQTFTIQQGTTMDTNFFG-FH  919

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I   S+P +P+LF+  L+P+YDR+FVP  R++TGIPTGI  L R+ VGL+LS++SMA A 
Sbjct  920   IPAPSIPVIPLLFVFVLVPIYDRIFVPLARKITGIPTGIRYLQRIGVGLVLSAISMAVAG  979

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             I+E +RK VA + NM+D+    +PLP+S+FWL IQY IFG AD+FT +G+LEFFY+++  
Sbjct  980   IVETRRKSVAIKHNMIDST---EPLPMSLFWLGIQYSIFGAADLFTLIGVLEFFYAESSA  1036

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLS  1724
              +KS+S+   WSS++ G+F SSV+V++VN        SGGWL  NN+NR+ L  FY LL+
Sbjct  1037  GMKSISTAISWSSLAFGFFMSSVVVEIVNRV------SGGWLANNNLNRDKLNYFYWLLA  1090

Query  1725  GLSFVNFFVYLFVSKRYKYRQ  1787
             G+S VNF  YL  +  Y+Y+ 
Sbjct  1091  GMSVVNFGFYLVCASWYRYKN  1111


 Score =   453 bits (1166),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 263/560 (47%), Positives = 367/560 (66%), Gaps = 21/560 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +    ++ K GG RA++F+  + G ENMA +   ++LVTY  G MN +L  +A  +TN
Sbjct  8     DVKTGPEQERKLGGNRAALFVYAMEGLENMAFVANAISLVTYFYGYMNFSLTKSATSLTN  67

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--D  461
             F G +++LT+    ++DTY+ RF+  ++   IE LG  +L +QAH  +L+P PC  +  D
Sbjct  68    FMGTSFLLTLFGGFISDTYLSRFKTSVLFGCIELLGYAILTVQAHLHQLRPIPCQGVAPD  127

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
                +CE   G   AILF  LY VA+G++GVK+ +PS GADQFDEKD K  +++SSFFNW 
Sbjct  128   NTNQCEAATGGQEAILFTGLYLVALGTSGVKSGLPSLGADQFDEKDPKGAAQLSSFFNWF  187

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             L  +  G  + +T  VW+  ++GWDW FA  T+A+ F  IF  +G   YR  V +GS  +
Sbjct  188   LFSLTTGAIIGVTFLVWISTNQGWDWSFAICTIAVLFSIIFLCMGKSLYRNNVPKGSPFL  247

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI----  989
              + IQVFVAAI NR   +P+ + EL+EI + + A     E L  TD++RFLD+AAI    
Sbjct  248   -RFIQVFVAAIRNRNHPIPDMTEELHEIHEKEIAKQ--DEILKRTDQFRFLDRAAILRTD  304

Query  990   --QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
                 S    P PWR+C VTQ+E  KIL+ ++P+ L TV M  CLAQLQTF+IQQG+TMD 
Sbjct  305   SNGASTSVTPGPWRLCTVTQIEETKILIRMLPIILSTVFMNTCLAQLQTFTIQQGTTMDT  364

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
             N+   F +   S+P +P+LF+  LIP+YDR+FVP  R++TGIPTGI  L R+ VGL+LS+
Sbjct  365   NLFG-FHVPAPSIPVIPLLFMFILIPIYDRIFVPFARKITGIPTGIRHLQRIGVGLVLSA  423

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
             +SM  A I+E  RK VA + NM+D+    +PLP+S+FWL IQY IFG AD+FT VGLLEF
Sbjct  424   ISMGIAGIVETHRKSVAIKHNMVDST---EPLPMSLFWLGIQYSIFGAADLFTLVGLLEF  480

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY+++   +KS+S+   W S++ GYF SSV+V+VV         SGGWL  NN+NR+ L 
Sbjct  481   FYAESSAGMKSISTAISWCSLAFGYFMSSVVVEVV------NKVSGGWLADNNLNRDKLS  534

Query  1704  LFYALLSGLSFVNFFVYLFV  1763
              FY LL+G+S VNF  YL++
Sbjct  535   YFYWLLAGMSVVNFGFYLWL  554



>ref|XP_011083919.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Sesamum indicum]
Length=659

 Score =   466 bits (1200),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 264/563 (47%), Positives = 370/563 (66%), Gaps = 21/563 (4%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
             +  ++ + GG RA+IF+  +   E MA I  GV+LVTY  G MN +L  +A  +TNF G 
Sbjct  83    QNKQQARLGGHRATIFVFAMAALETMAFISNGVSLVTYFYGYMNFSLTKSATALTNFMGT  142

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLD--KAEK  473
              ++L++    ++DTY  RF+  +I   +E +G  LLA+QAH+  L+P PC  +D  K  +
Sbjct  143   AFLLSLFGGFISDTYFSRFKTCVIFGCLEIVGYVLLAVQAHFKHLRPFPCKDVDLSKTAQ  202

Query  474   CEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGV  653
             CE       AILF  LY VA+G+ G+KAA+PS GADQFDE D KE + +SS+FNWL+  +
Sbjct  203   CERATSSQEAILFTGLYLVALGTGGIKAALPSLGADQFDETDPKEAASLSSYFNWLMFSI  262

Query  654   CVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQII  833
               G  + +T  VW+  ++GWDW F    +A+    +F ++G   YR  + +G S + +I+
Sbjct  263   TFGAMLGVTFLVWISTNQGWDWSFGVCAIAVALAILFLSMGKSVYRTNIPKG-SPLVRIL  321

Query  834   QVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEP  1013
             QVFV A+ NR L +P  + EL+EI  DKEA     E L  TD+++ LD+AAI  S  + P
Sbjct  322   QVFVVAVRNRNLPVPNMAQELHEI-YDKEAGR--NEILQRTDQFKCLDRAAILRSSQDSP  378

Query  1014  N-----PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                    W++C VTQVE  KIL+ ++P+ L TV M  CLAQLQTFSIQQ +TMD  I   
Sbjct  379   TYSTSGSWKLCTVTQVEETKILVRMLPIILSTVFMNTCLAQLQTFSIQQTTTMDRKIGN-  437

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
             FQI   SLP +P++F+  L+P+YDRLFVP  R+ TGIPTGIT L RVAVGL+LS++SMA 
Sbjct  438   FQIPGPSLPVIPLVFMFILLPIYDRLFVPLARKFTGIPTGITQLQRVAVGLVLSAISMAV  497

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             + I+E  RK+VA + NM+D+     PLP+S+FW+ IQY IFG+ADMFT VGL+EFFY ++
Sbjct  498   SGIIETHRKRVAIKHNMVDSP---GPLPMSIFWIGIQYAIFGMADMFTIVGLMEFFYGES  554

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYAL  1718
                +KS+S+   W S++ GY+TS+V+V +VN        SGGWL  NN+NR+ LE FY L
Sbjct  555   SLGMKSLSTAISWCSLAFGYYTSTVVVNLVNKV------SGGWLANNNLNRDKLEYFYWL  608

Query  1719  LSGLSFVNFFVYLFVSKRYKYRQ  1787
             L+G+S VNF VYL  +  Y+Y++
Sbjct  609   LAGVSVVNFGVYLVCASWYRYKK  631



>ref|XP_006375010.1| hypothetical protein POPTR_0014s03550g [Populus trichocarpa]
 gb|ERP52807.1| hypothetical protein POPTR_0014s03550g [Populus trichocarpa]
Length=611

 Score =   463 bits (1192),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 262/566 (46%), Positives = 368/566 (65%), Gaps = 19/566 (3%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +  +  + + GG RA+ F+  + G ENMA + +  +L+TY +G MN +L  +A   TN
Sbjct  37    DVKIESKPERRLGGNRAAFFVYTMEGLENMAFVCMVASLMTYFSGYMNFSLTKSATTFTN  96

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKA  467
             F G +++L +    + DTY  RF+  ++   +EFLG  LL +QAH+ +L+P PC  +  +
Sbjct  97    FVGTSFLLALFGGFICDTYWTRFKTCVLFGCVEFLGYALLTVQAHFHQLRPIPCKGVS-S  155

Query  468   EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLL  647
             ++CE   G  +AILF  LY +A G++G+KAA+PS GADQFDE D KE  ++SSFFNW L 
Sbjct  156   DQCEAADGSQSAILFTGLYLIAFGTSGIKAALPSLGADQFDENDPKEAIQLSSFFNWFLF  215

Query  648   GVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQ  827
              + +G  + +T+ VWL  ++GWD GF    +A+FF  IF ++    YR  V +G S + +
Sbjct  216   SLTIGAIIGVTVIVWLSANQGWDLGFGVCAIAVFFAIIFVSMRKSLYRNNVPKG-SPLAR  274

Query  828   IIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDE  1007
             I QVFVAAI NR L +PE   EL+EI  DKEA  +  E LP T ++RFLD+AAI  + D 
Sbjct  275   IAQVFVAAIRNRDLPIPERDEELHEI-HDKEA-GVKQEILPRTGQFRFLDRAAIANTTDC  332

Query  1008  EPN-----PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNIT  1172
                     PWR+C VTQVE  KILL ++PV L TV M  C AQLQTFS+QQ +TMD N+ 
Sbjct  333   ASTSINHGPWRLCTVTQVEETKILLRMLPVILSTVFMNTCFAQLQTFSVQQSTTMDTNVF  392

Query  1173  KsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsm  1352
               F++   SLP +P+LF+  +IP+Y+R FVP  R++TGIPTGI  L RV VGL+LS +SM
Sbjct  393   G-FKVPGPSLPVIPLLFIFVMIPIYERFFVPLARKITGIPTGIRHLQRVGVGLVLSVISM  451

Query  1353  aaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYS  1532
               + ++E  RK VA E NM+D+    +PLP+S  WL  Q+ IFG ADMFT VGLLEFFY+
Sbjct  452   GVSGVVETWRKSVAIEHNMVDST---EPLPMSFLWLGFQFAIFGAADMFTLVGLLEFFYA  508

Query  1533  QAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFY  1712
             ++   +KS+ +   W S++ GYF SS++V+VVN  T      GGWL  +N+NR+ L  FY
Sbjct  509   ESSAGMKSLGTAISWCSVAFGYFLSSLVVQVVNKVT------GGWLASDNLNRDKLNYFY  562

Query  1713  ALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              LL+G+S VNF VYL  +  Y+Y+ +
Sbjct  563   WLLAGISTVNFGVYLTCASWYRYKDR  588



>ref|XP_006848555.1| hypothetical protein AMTR_s00169p00048300 [Amborella trichopoda]
 gb|ERN10136.1| hypothetical protein AMTR_s00169p00048300 [Amborella trichopoda]
Length=540

 Score =   461 bits (1185),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 259/538 (48%), Positives = 365/538 (68%), Gaps = 12/538 (2%)
 Frame = +3

Query  189   ENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVL  368
             ENMA I   V+LVTY +G MN +L  +AN +TNF G +++L I+   ++DT++ RF+  +
Sbjct  5     ENMAFIASAVSLVTYFSGYMNFDLTKSANTLTNFMGTSFLLPIMGGFISDTFLSRFKTCI  64

Query  369   ISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--DKAEKCEEVAGRNAAILFVALYTVAMGS  542
             I  +IE +G  LL +QAH+  ++P  C  L  +    CE   G  AAILF  LY VA+G+
Sbjct  65    IFGFIELIGYALLTVQAHFDFMRPKMCPILGNNSQSNCESAHGGQAAILFSGLYLVALGT  124

Query  543   AGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWG  722
              GVKAA+P+ GADQFD++D +E  ++SSFFNW L  + +G +  +T  VW+  ++GW+WG
Sbjct  125   GGVKAALPALGADQFDKRDEREAPDLSSFFNWFLFSLTIGASFGVTFVVWVSVNQGWEWG  184

Query  723   FAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYE  902
             F   TVA+        LG   YRVYV  G S + +I+QVFVA   N +L +P++SGELYE
Sbjct  185   FGICTVAILLAIFSLYLGRSNYRVYVPVGRSPVLRILQVFVATARNWRLSVPKNSGELYE  244

Query  903   ISKDKEAVTICAEFLPHTDKYRFLDKAAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVP  1079
             +  DKEA     E L  TD++RFLD+AAI + S     +PW +C +TQVE  KIL+ ++P
Sbjct  245   L-HDKEAGP-QGETLKRTDQFRFLDRAAIPKDSITHTTHPWHLCTMTQVEETKILMRMLP  302

Query  1080  VFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLF  1259
             +   T+ M  CLAQLQTFSIQQG TM+ ++ K F++  SS+P +P++F+  L+P+Y+++F
Sbjct  303   IIASTIFMNTCLAQLQTFSIQQGVTMEPHLGK-FKVPASSIPVIPLIFMAILVPIYEKVF  361

Query  1260  VPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPL  1439
             VP  R++TGIPTGI+ L R+ VGL+LS +SM+ A ++E KRK VA E NM+D   I+ PL
Sbjct  362   VPVARKMTGIPTGISHLQRIGVGLVLSIISMSIAGVIETKRKSVAIEHNMVDTNNIMNPL  421

Query  1440  PISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLV  1619
             P+SVFWL  QY IFG ADMFT VGLLEFFYS++   +K++ +   W S++ GY+TS+V+V
Sbjct  422   PMSVFWLGFQYAIFGAADMFTLVGLLEFFYSESSIGMKTLGTSISWCSLAFGYYTSTVVV  481

Query  1620  KVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             +VV         S GWL GNN+NR+HL  FY LL+GLS VNF  YL+ +K YKY+  +
Sbjct  482   EVV------NKVSDGWLAGNNLNRDHLSYFYWLLAGLSAVNFGNYLYWAKWYKYKSVV  533



>ref|XP_009761039.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Nicotiana sylvestris]
Length=579

 Score =   461 bits (1187),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 261/567 (46%), Positives = 372/567 (66%), Gaps = 23/567 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D      +  + GG RA++F+  + G + MA    GV+LVTY  G MN N+  +A  VTN
Sbjct  6     DVNTEPKQPPRVGGNRATLFVYAMAGIDVMAFFATGVSLVTYFYGFMNFNITKSATAVTN  65

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN--PLD  461
             F G  ++L +  A L+DTY+ RF+  ++    E +G  LLA+QAH+ +L+P PC   PL 
Sbjct  66    FMGTAFLLALFGAFLSDTYLSRFKTCVLFGCFEVVGYALLAVQAHFRQLRPFPCKDVPLS  125

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
             +  +CE       AIL+  LY VA+G+ GVKAA P  GADQ+DEKD KE +++SS+FNWL
Sbjct  126   QLNQCESANKGQLAILYAGLYLVAIGTGGVKAATPPLGADQYDEKDPKEAAKLSSYFNWL  185

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             +  +  G    +T  VW+ +++GWDW FAA ++ +    +F T+G   YR     G S I
Sbjct  186   MFFLTTGALFGVTFVVWISENQGWDWSFAACSIVVGLAILFLTMGKSLYRNNASNG-SPI  244

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI----  989
             T+I+QVFV A+ NR L LPE+  E++    DKE+     E L  TD++RFLD+A I    
Sbjct  245   TRIMQVFVVALRNRNLPLPENEHEIH----DKESRN-DTEILRKTDQFRFLDRATIMRTD  299

Query  990   -QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLN  1166
               T       PW++C VTQVE  KI++ ++P+ L TV M  CLAQLQTF+IQQ +TMD  
Sbjct  300   QNTFTSSAHGPWKLCTVTQVEETKIVVRMLPIILSTVFMNTCLAQLQTFTIQQSTTMDRK  359

Query  1167  ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssl  1346
             I K F++  +S+P +P+LF+I LIP+Y+R+F+P  R+ TGIPTGI  L R+ VGL+LS++
Sbjct  360   IHK-FEVPGASIPAIPLLFMIILIPIYERVFIPIARKFTGIPTGIRQLQRIGVGLVLSAM  418

Query  1347  smaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             SMA AAI+E  RK VA + NM+++     PLP+SVFWL  QY IFG+ADMFT+VGL++FF
Sbjct  419   SMAVAAIVEKHRKTVAIKHNMVESA---TPLPMSVFWLGYQYAIFGLADMFTFVGLMDFF  475

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLEL  1706
             YS++   +K++S+   WSS+++GY+TSSV+V +VN        SGGWL  NN+N++ L+ 
Sbjct  476   YSESSSSMKALSTAISWSSLAIGYYTSSVVVSIVNKV------SGGWLDNNNLNKDKLDY  529

Query  1707  FYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             FY LL+GLS +NF  YL  +  YKY++
Sbjct  530   FYWLLAGLSVLNFGFYLLCASWYKYKK  556



>ref|XP_006354962.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Solanum tuberosum]
Length=551

 Score =   460 bits (1183),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 259/539 (48%), Positives = 371/539 (69%), Gaps = 22/539 (4%)
 Frame = +3

Query  195   MATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLIS  374
             MA    GV+LVTY  G MN ++ ++A  VTNF G  ++L++  A L+DTY+ RF+  ++ 
Sbjct  1     MAFFATGVSLVTYFYGFMNFSITESATAVTNFMGTAFLLSLFGAFLSDTYLSRFKTCVLF  60

Query  375   AWIEFLGLGLLAMQAHYAKLKPPPCN--PLDKAEKCEEVAGRNAAILFVALYTVAMGSAG  548
               IE +G  LLA+QAH+ +L+P PC   PL +  +CE       AIL+  LY VA+G++G
Sbjct  61    GCIEVVGYALLAVQAHFRQLRPFPCKDVPLSQMNQCESANKGQLAILYAGLYLVAIGTSG  120

Query  549   VKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFA  728
             VKAA P  GADQ+DEKD KE +++SS+FNWL+  +  G    +T  VW+ +++GWDW FA
Sbjct  121   VKAAAPPLGADQYDEKDPKEAAKLSSYFNWLMFFLTTGALFGVTFVVWISENQGWDWSFA  180

Query  729   ASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEIS  908
               ++ + F  +F TLG   YR  V +G S +T+I+QVFV A+ NR L+LP++  EL+EI 
Sbjct  181   VCSIVVGFSILFLTLGKSLYRNNVTKG-SPLTRIMQVFVVALRNRNLRLPQNEHELHEI-  238

Query  909   KDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPN------PWRVCRVTQVENAKILLN  1070
             +DKEA     E L  T++++FLD+AAI  + D+E +      PW++C VTQVE  KI++ 
Sbjct  239   QDKEA-RYDTEILRKTEQFKFLDRAAINRT-DQEASTSNAHGPWKLCTVTQVEETKIVVR  296

Query  1071  LVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYD  1250
             ++P+ L TV M  CLAQLQTF+IQQ +TMD  I K F++  +S+P +P+LF+I LIP+Y+
Sbjct  297   MLPIILSTVFMNTCLAQLQTFTIQQSTTMDRKIHK-FEVPGASIPAIPLLFMIILIPMYE  355

Query  1251  RLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPIL  1430
             R+F+P  R+ TGIPTGI  L R+ VGL+LSSLSMA AAI+E  RK +A + NM+++    
Sbjct  356   RVFIPIARKFTGIPTGIRQLQRIGVGLVLSSLSMAVAAIVEKHRKSIAIKHNMVESA---  412

Query  1431  QPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSS  1610
              PLP+SVFWL  QY IFG+ADMFT VGLL+FFYS++   +K++S+   WSS+++GY+TSS
Sbjct  413   APLPMSVFWLGYQYAIFGLADMFTLVGLLDFFYSESSSSMKALSTAISWSSLAIGYYTSS  472

Query  1611  VLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             ++V  VN        SGGWL  NN+N++ L+ FY LL+GLS +NF  YL  +  YKY++
Sbjct  473   IVVSTVNKV------SGGWLANNNLNKDKLDYFYWLLAGLSVLNFGFYLLCASWYKYKK  525



>emb|CDP07606.1| unnamed protein product [Coffea canephora]
Length=592

 Score =   461 bits (1187),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 266/560 (48%), Positives = 375/560 (67%), Gaps = 20/560 (4%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + K GG RA++F+  +   ENMA I   V+L TY +G MN +L  +A  +TN  G  ++L
Sbjct  27    RAKLGGTRAALFVYSMASLENMAFISNAVSLFTYFHGYMNFSLTKSATTLTNLMGTAFLL  86

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLD--KAEKCEEV  485
             ++    ++DTY+ RF+  ++   IE +GL +L +QAH+ +L+P  C      K+ +CE +
Sbjct  87    SLFGGFISDTYLSRFKTSILFGCIEAVGLAVLTVQAHFPQLRPILCKDAATLKSTQCETI  146

Query  486   AGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGG  665
                  A+LF  LY  A G++GVKAA+PS GADQFDE+   E  +++SFFNWLL  + +G 
Sbjct  147   TRSQEALLFAGLYLFAFGNSGVKAALPSLGADQFDERSPLEAPKLASFFNWLLFSITIGA  206

Query  666   AVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFV  845
              + +T  VW+  ++GWDW F   T+A+  G +F ++G   YR  V +GS  + +I QVFV
Sbjct  207   MLGVTFLVWISANQGWDWSFGVCTIAVTMGLLFLSMGRSIYRNNVPKGSPFV-RIAQVFV  265

Query  846   AAIHNRKLQLPEDSGELYEISKDKEAVTICA-EFLPHTDKYRFLDKAAIQTSWDEE----  1010
             AAI NR L +PE + +L++I +DKEA      E L  TD+++ LD+AAI  S ++     
Sbjct  266   AAIRNRNLPIPEMADDLHQI-RDKEARKGNEIEILDRTDQFKILDRAAIVRSTEDSTTVI  324

Query  1011  -PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqi  1187
              P PWR+C VTQVE  KIL+ ++PV L TV M  CLAQLQTFSIQQG+TMD +I + FQ+
Sbjct  325   VPGPWRLCTVTQVEETKILIRMLPVILSTVFMNTCLAQLQTFSIQQGTTMDRSI-RGFQV  383

Query  1188  lpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaai  1367
               +S+PF+P+ F+  LIP+Y+ +FVP  R+ TGIPTGI  L RV VGL+LS++SMA A +
Sbjct  384   PAASIPFIPLFFMFVLIPVYEHVFVPIARKFTGIPTGIRQLQRVGVGLVLSAISMAVAGV  443

Query  1368  lelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKE  1547
             +E +RK VA E NM+D+   L+PLPISVFWL IQY IFG+ADMFT VGLL+FFY+++   
Sbjct  444   IETRRKSVAVEHNMVDS---LEPLPISVFWLGIQYAIFGMADMFTLVGLLDFFYAESSSG  500

Query  1548  LKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSG  1727
             +KS+S+   W S++ GY+TS+V+V VV         SGGWL  NN+NR++L  FY LL+G
Sbjct  501   MKSLSTAISWCSLAFGYYTSTVVVNVV------NKVSGGWLASNNLNRDNLNYFYWLLAG  554

Query  1728  LSFVNFFVYLFVSKRYKYRQ  1787
             LS  NF VYL  S  YKY++
Sbjct  555   LSVANFGVYLMCSSWYKYKK  574



>gb|KCW85044.1| hypothetical protein EUGRSUZ_B01888 [Eucalyptus grandis]
Length=395

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 249/420 (59%), Positives = 304/420 (72%), Gaps = 32/420 (8%)
 Frame = +3

Query  549   VKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFA  728
             +KA++P+HGADQFDE+D +E  +MSSFFN +LL VC G  VSL+L VW+  +KGWDWGF 
Sbjct  1     MKASLPAHGADQFDERDPREARQMSSFFNCILLSVCTGAVVSLSLVVWIQVNKGWDWGFG  60

Query  729   ASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEIS  908
              ST AM    I F +GLP YR+  +Q SSAI +IIQV+VAAI  R LQLP+D  ELYE+ 
Sbjct  61    LSTFAMILAIIIFAVGLPLYRIQTVQKSSAIIKIIQVYVAAISKRDLQLPKDPKELYELD  120

Query  909   KDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEE------PNPWRVCRVTQVENAKILLN  1070
             KD EA  + AEFLPHT+ +RFLDKAA+QT+  E+      PN W +CRVTQVENAKI+L 
Sbjct  121   KDGEA-ALEAEFLPHTESFRFLDKAAMQTASLEQYGGAKGPNRWALCRVTQVENAKIILG  179

Query  1071  LVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYD  1250
             +VP+F CT+IMTLCLAQLQTFSIQQG TMD +IT SF I P+SLP +P  FLI +IP+YD
Sbjct  180   MVPIFCCTIIMTLCLAQLQTFSIQQGQTMDTSITSSFHIPPASLPIIPFAFLIIIIPVYD  239

Query  1251  RLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPIL  1430
             + FVP  R+LTG P GIT L R+ VGL+LSS+SMA            A    +L  +P+L
Sbjct  240   QGFVPFARKLTGHPAGITHLQRIGVGLVLSSISMAV----------AAAVECVLAVLPVL  289

Query  1431  QPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSS  1610
                             FGIAD FTYVGLLEFFYS+APK+LKSVS+C  WSS +LGYF S+
Sbjct  290   H---------------FGIADSFTYVGLLEFFYSEAPKDLKSVSTCVFWSSAALGYFCST  334

Query  1611  VLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             ++VK+VNG T G+T SGGWL GNN+NRNHL LFY LLS LS +NFFVYL V++ YKYR  
Sbjct  335   IMVKIVNGVTNGITRSGGWLAGNNINRNHLNLFYLLLSMLSLINFFVYLIVARGYKYRSH  394



>ref|XP_009605561.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Nicotiana tomentosiformis]
Length=582

 Score =   456 bits (1173),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 258/568 (45%), Positives = 373/568 (66%), Gaps = 22/568 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +    +    GG RA++F+  + G + MA I  GV+LVTY  G MN +L  +A  VTN
Sbjct  6     DTQTEPKQLPSKGGTRATLFVYAVAGIDTMAFISNGVSLVTYFYGYMNFSLIKSATTVTN  65

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN--PLD  461
             F G  ++L++  A L+DTY  RF+  ++   I+ LG  LLA+QAH+++L+P PC   PL 
Sbjct  66    FMGTAFLLSLFGAFLSDTYFSRFKTCVLFGSIQVLGYALLAVQAHFSQLRPFPCKNVPLS  125

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
              + +CE       AIL+  +Y +A+G++GVKAA+PS GADQFDEKD K  +++SS+FNWL
Sbjct  126   LSNQCESADTGQLAILYGGIYLIALGNSGVKAALPSLGADQFDEKDPKGVAKLSSYFNWL  185

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             L  + VG  + +T FVW+   +GWDW F    VA+    +  T+G PFYR  + +G S +
Sbjct  186   LFCITVGAMLGVTFFVWISDSQGWDWSFGVCCVAVGLAILLLTMGKPFYRNNIPKG-SPL  244

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEI-SKDKEAVTICAEFLPHTDKYRFLDKAAI---  989
              +I QVFVAA  NR L LP++  +LY+I S++ E  T   E L  TD+++FLD+AAI   
Sbjct  245   MRIAQVFVAAFTNRNLPLPQNKEDLYQIKSREPENET---EILQRTDQFKFLDRAAILRT  301

Query  990   --QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
               + S       W +C ++QVE  KI++ ++P+ L TV M  C+AQLQTF+IQQ  TM+ 
Sbjct  302   KQEASTSSAHGQWSLCTISQVEETKIVVRMLPIILSTVFMNTCMAQLQTFTIQQSLTMNR  361

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              I ++F+I   S+P +P LF +FLIP+YDR+F+P  R+ TGIP+GI  L R+ VGL+L++
Sbjct  362   KI-RNFEIPGPSIPIIPQLFQLFLIPVYDRIFIPIARKFTGIPSGIRQLQRIGVGLVLTA  420

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
             +SM  AA++E  RK VA E+NM+D+     PLP+SVFWL  QY IF  A++FT VGLL+F
Sbjct  421   VSMVVAAVVESHRKSVAIEQNMVDSA---SPLPMSVFWLGYQYVIFATAEIFTLVGLLDF  477

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY+++   +KS+S    WSS++ GYFTSS++V V+N        SGGWL  NN+NR+ L+
Sbjct  478   FYAESTSGMKSLSMAISWSSLAFGYFTSSLVVSVINKV------SGGWLANNNLNRDKLD  531

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
              FY LL+G+S +NF  YL  +  YKY++
Sbjct  532   YFYWLLAGVSVLNFGFYLLCASWYKYKK  559



>ref|XP_007017376.1| Nitrate transporter 1:2, putative [Theobroma cacao]
 gb|EOY14601.1| Nitrate transporter 1:2, putative [Theobroma cacao]
Length=537

 Score =   454 bits (1169),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 258/535 (48%), Positives = 350/535 (65%), Gaps = 18/535 (3%)
 Frame = +3

Query  195   MATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLIS  374
             MA I   V+LVTY  G MN +L  +AN VTNF G ++IL ++  ++ADTY+ RF   ++ 
Sbjct  1     MAFIANAVSLVTYFMGYMNFSLTKSANAVTNFMGTSFILALLGGLIADTYLTRFTTCVLF  60

Query  375   AWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVK  554
              ++E LG  LL +QAH+ +L+P PC   D +++CE      AAIL+  LY VA+G++GVK
Sbjct  61    GFLELLGYALLTIQAHFDQLRPTPCT--DVSKQCEAAKSGQAAILYTGLYLVALGTSGVK  118

Query  555   AAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAAS  734
             AA+P  GADQFD  D KE +++SSFFNW +  +  G    +T  VW+  +KGWDW F   
Sbjct  119   AALPLLGADQFDRNDPKEAAQLSSFFNWFVFSLTGGSIAGVTFVVWISSNKGWDWAFGVC  178

Query  735   TVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKD  914
              +A+    +   +G PFYR    +G S I +I+QVFVAAI N+ L  P+   EL+EI  D
Sbjct  179   GLAVLLAIMSVCIGKPFYRDNAPRG-SPIIRILQVFVAAIRNQDLPKPKKEDELHEI-YD  236

Query  915   KEAVTICAEFLPHTDKYRFLDKAAI-QTSWDEE---PNPWRVCRVTQVENAKILLNLVPV  1082
             K  V +  E L  T+++RFLD+AA+ +  WDE    P PWR+  VTQVE  KILL ++P+
Sbjct  237   KGTVVMPTEILQRTNEFRFLDRAAVSRIPWDESAVTPGPWRLSTVTQVEETKILLRMLPI  296

Query  1083  FLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFV  1262
              L TV +   LAQLQTFSIQQ  TMD +I   F+I   SLP +P+ F    I +YDR+FV
Sbjct  297   VLSTVFINTSLAQLQTFSIQQSMTMDTHILG-FKIPAPSLPVIPLGFNFIFIAIYDRIFV  355

Query  1263  PSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLP  1442
             P  RR+TGIPTGI  L R+ VGL+LS++SMA A ++E +RK VA   NM+D+    +PLP
Sbjct  356   PIARRITGIPTGIRYLQRIGVGLVLSTISMAIAGVMETRRKSVAVRHNMVDST---EPLP  412

Query  1443  ISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVK  1622
             +SVFWL  QY +FG+ADMFT VGLLEFF++++   +K  S+   W S++ GY+ SSV+V+
Sbjct  413   MSVFWLGFQYAVFGLADMFTLVGLLEFFHAESSDGMKGTSTAISWFSLAFGYYISSVVVE  472

Query  1623  VVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             VVN A      SGGWL  NN+NR+ L  FY LLS LS VNF +YL  +  YKY+ 
Sbjct  473   VVNKA------SGGWLASNNLNRDKLNYFYWLLSALSAVNFVIYLVCASWYKYKN  521



>ref|XP_009766629.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Nicotiana sylvestris]
Length=582

 Score =   455 bits (1170),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 255/568 (45%), Positives = 374/568 (66%), Gaps = 22/568 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +    +  + GG RA++F+  + G + MA   +GV+LVTY  G MN +L  +A  VTN
Sbjct  6     DIKTEAQQLPRKGGTRAALFVYAVAGIDTMAFTSIGVSLVTYFYGYMNFSLTKSATTVTN  65

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN--PLD  461
             F G  ++L++  A L+DTY  RF+  ++   I+ LG  LLA+QAH+++L+P PC   PL 
Sbjct  66    FMGTAFLLSLFGAFLSDTYFSRFKTYVLFGSIQVLGYALLAVQAHFSQLRPFPCKNVPLS  125

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
             ++ +CE       AIL+  +Y +A+G++GVKAA+PS GADQFDEKD KE +++SS+FNWL
Sbjct  126   QSNQCESADIGQLAILYGGIYLIALGNSGVKAALPSLGADQFDEKDPKEAAKLSSYFNWL  185

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
             L  + VG  + +T  VW+   +GWDW F    +A+    +  T+G PFYR  + +G S +
Sbjct  186   LFFITVGVMLGVTFLVWISDSQGWDWSFGVCCIAVGLAILLLTMGKPFYRNNIPKG-SPL  244

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEI-SKDKEAVTICAEFLPHTDKYRFLDKAAI---  989
              +I QVFVAA  NR L LP++  +L++I S++ E  T   E L  TD+++FLD+AAI   
Sbjct  245   MRITQVFVAAFRNRNLPLPQNKEDLHQIKSREPENGT---EILQRTDQFKFLDRAAILRT  301

Query  990   --QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
               + S       W +C ++QVE  KI++ ++P+ L TV M  C+AQLQTF+IQQ  TM+ 
Sbjct  302   KQEASTSSAHGQWSLCTISQVEETKIVVRMLPIILSTVFMNTCMAQLQTFTIQQSLTMNR  361

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              I ++F+I   S+  +P LF +FLIP+YDR+FVP  R+LT IP+GI  L R+ VGL++++
Sbjct  362   KI-RNFEIPGPSITVIPQLFQLFLIPVYDRIFVPIARKLTEIPSGIRQLQRIGVGLVITA  420

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
             +SMA AA++E  RK VA E NM+D+     PLP+SVFWL  QY IF  A++FT VGLL+F
Sbjct  421   VSMAVAAVVESHRKSVAIEHNMVDSA---SPLPMSVFWLGYQYVIFATAEIFTLVGLLDF  477

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY+++   +KS+S    WSS++ GYFTSS++V V+N        SGGWL  NN+NR+ L+
Sbjct  478   FYAESTSGMKSLSMAISWSSLAFGYFTSSLVVSVINKV------SGGWLANNNLNRDKLD  531

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
              FY LL+G+S +NF  YL  +  YKY++
Sbjct  532   YFYWLLAGVSVLNFGFYLLCASWYKYKK  559



>ref|XP_010059778.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Eucalyptus grandis]
 gb|KCW66213.1| hypothetical protein EUGRSUZ_F00037 [Eucalyptus grandis]
Length=596

 Score =   455 bits (1171),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 258/565 (46%), Positives = 370/565 (65%), Gaps = 17/565 (3%)
 Frame = +3

Query  114   RGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFA  293
             R    ++ + GG RA++F+    G ENMA I   V+LVTY  G MN +L  +A  +TNF 
Sbjct  16    RTHPQKEARRGGNRAALFVYATEGLENMAFISNAVSLVTYFYGYMNFSLTKSATTLTNFM  75

Query  294   GATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--DKA  467
             G +++L +    ++DTY+ RF+  ++   IE +G  LLA+QAH+ +L+P PC  +  D+ 
Sbjct  76    GTSFLLALFGGFISDTYLSRFKTCVLFGCIELVGYALLAVQAHFHQLRPIPCKGIAPDQM  135

Query  468   EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLL  647
              +C       AAILF  LY +A G++GVKAA+PS GADQF+EKD KE +++SS+FNWLL 
Sbjct  136   NQCHAADSTQAAILFTGLYLIAFGTSGVKAALPSLGADQFNEKDPKEVTQLSSYFNWLLF  195

Query  648   GVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQ  827
              + +G  + +T  VW+  ++GWDW F   T+A+ F  +F  +G   YR  V +GS  + +
Sbjct  196   SLTIGAIIGVTFVVWIGTNQGWDWSFGVCTIAVLFAMVFVCMGKSLYRNNVPRGSPFV-R  254

Query  828   IIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTS--W  1001
             I+QV VAAI  R L +P  + EL+E+   +  V    E LP TD++RFLD+AA+  S   
Sbjct  255   IMQVLVAAIKKRSLPIPTMTDELHEVHDREPGVN--DEILPRTDQFRFLDRAAVAPSPGS  312

Query  1002  DEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsf  1181
                  PW +C V+QVE  KI+L ++P+ L TV M  CLAQLQTF+IQQ +TM+ +I   F
Sbjct  313   GSTAGPWSLCTVSQVEETKIMLRMLPIVLSTVFMNTCLAQLQTFTIQQSTTMNPHILG-F  371

Query  1182  qilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaa  1361
             ++   S+P +P+LF+  L+P+Y+R+FVP  R+ TGIPTGI  L R+AVGL+LS++SMA A
Sbjct  372   KVPGPSVPVIPLLFMFILVPMYERIFVPIARKFTGIPTGIRHLQRIAVGLVLSAISMAVA  431

Query  1362  ailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAP  1541
              ++E  RK VA   NM+D+    +PLP+S+FWL  QY IFG ADMFT VGLLEFFY+++ 
Sbjct  432   GVVETHRKSVAIHHNMVDST---EPLPMSMFWLGFQYAIFGAADMFTLVGLLEFFYAESS  488

Query  1542  KELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALL  1721
               +KS+S+   WSS++ GYF S+V+V+VV         SGGWL  NN+NR+ L  FY LL
Sbjct  489   AGMKSLSTAVSWSSLAFGYFLSTVVVQVV------NKVSGGWLTNNNLNRDKLNYFYWLL  542

Query  1722  SGLSFVNFFVYLFVSKRYKYRQQIG  1796
             +GLS +NF  YL  +  Y+Y+ + G
Sbjct  543   AGLSVLNFGFYLVCASWYRYKTKEG  567



>ref|XP_009605560.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Nicotiana tomentosiformis]
Length=582

 Score =   454 bits (1169),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 257/557 (46%), Positives = 370/557 (66%), Gaps = 20/557 (4%)
 Frame = +3

Query  138   KHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTI  317
             + GG RA++F+  + G + MA    GV+LVTY  G MN ++  +A  VTNF G  ++L +
Sbjct  16    RLGGNRATLFVYAMAGIDVMAFFATGVSLVTYFYGFMNFSITKSATAVTNFMGTAFMLAL  75

Query  318   VAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP--LDKAEKCEEVAG  491
               A L+DTY+ RF+  ++    E +G  LLA+QAH+ +L+P PC    L +  +C+    
Sbjct  76    FGAFLSDTYLSRFKTCVLFGCFEVVGYALLAVQAHFRQLRPFPCKDVLLIQLNQCQSANK  135

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
                AIL+V LY VA+G+ GVKAA P  GADQ+DEKD KE +++SS+FNWL+  +  G   
Sbjct  136   GQLAILYVGLYLVAIGTGGVKAAAPPLGADQYDEKDPKEAAKLSSYFNWLMFFLTTGALF  195

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +T  VW+ +++GWDW FA  ++ +    +F T+G   YR  V  G S +T+I+QVF  A
Sbjct  196   GVTFIVWIGENQGWDWSFAVCSIVVGLAILFLTMGKSLYRNNVSNG-SPLTRIMQVFFVA  254

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI-----QTSWDEEPN  1016
             + NR L LPE+  EL+EI  DKEA    AE L  TD+++FLD+A I      TS      
Sbjct  255   LRNRNLPLPENEHELHEI-HDKEARN-DAEILRKTDQFKFLDRATIMRTDQNTSTSSAHG  312

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
             PW++C VTQVE  KI++ ++P+ L TV M  CLAQLQTF+IQQ +TM+  I K F++  +
Sbjct  313   PWKLCTVTQVEETKIVVRMLPIILSTVFMNTCLAQLQTFTIQQSTTMNRKIHK-FEVPGA  371

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             S+P +P+LF+I LIP+Y+R+F+P  R+ TGIPTGI  L R+  GL+LS++SM  AAI+E 
Sbjct  372   SIPAIPLLFMIILIPIYERVFIPIARKFTGIPTGIRQLQRIGAGLVLSAVSMVVAAIVEK  431

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
              RK VA + +M++      PLP+SVFWL  QY IFG+ADMFT+VGL++FFYS++   +K+
Sbjct  432   HRKTVAIKHSMVETA---TPLPMSVFWLGYQYAIFGLADMFTFVGLMDFFYSESSSSMKA  488

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             +S+   WSS+++GY+TSSV+V +VN        SGGWL  NN+N++ L+ FY LL+GLS 
Sbjct  489   LSTAISWSSLAIGYYTSSVVVSIVNKV------SGGWLDNNNLNKDKLDYFYWLLAGLSV  542

Query  1737  VNFFVYLFVSKRYKYRQ  1787
             +NF  YL  +  YKY++
Sbjct  543   LNFGFYLLCASWYKYKK  559



>ref|XP_011030670.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X1 [Populus 
euphratica]
Length=603

 Score =   455 bits (1170),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 264/566 (47%), Positives = 372/566 (66%), Gaps = 19/566 (3%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             D +  +  + + GG RA+ F+  + G ENMA + +  +L+TY +G MN +L  +A  + N
Sbjct  29    DVKIESKPERRLGGNRAAFFVYTVEGLENMAFVCMITSLMTYFSGYMNFSLTKSATTLAN  88

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKA  467
             F G ++++ +    + DTY  RF+  ++   +EFLG  LL +QAH+ +L+P PC  +  +
Sbjct  89    FVGTSFLVALFGGFICDTYWTRFKTCVLFGCVEFLGYALLTVQAHFHQLRPIPCKGVS-S  147

Query  468   EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLL  647
             ++CE   G  +AILF  LY +A G++G+KAA+PS GADQFDE D KE  ++SSFFNW LL
Sbjct  148   DQCEAADGSQSAILFTGLYLIAFGTSGIKAALPSLGADQFDENDPKEAIQLSSFFNWFLL  207

Query  648   GVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQ  827
              + VG  + +T+ VWL  ++GWD GF    +A+FF  IF ++G   YR  V +G S + +
Sbjct  208   SLTVGAIIGVTVIVWLSDNQGWDLGFGVCAIAVFFAIIFVSMGKSLYRNNVPKG-SPLAR  266

Query  828   IIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDE  1007
             I QVFVAAI NR L +PE + EL+EI  DKEA  +  E LP T ++ FLD+AAI  + D 
Sbjct  267   IAQVFVAAIRNRDLPIPERAEELHEI-HDKEA-GVKQEILPRTGQFSFLDRAAIANTTDL  324

Query  1008  EPN-----PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNIT  1172
                     PWR+C VTQVE  KILL ++PV L TV M  CLAQLQTFS+QQ +TMD N+ 
Sbjct  325   ASTSINHGPWRLCTVTQVEETKILLRMLPVILSTVFMNTCLAQLQTFSVQQSTTMDTNVF  384

Query  1173  KsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsm  1352
               F++   SLP +P+LF+  +IP+Y+R FVP  R++TGIPTGI  L RV VGL+LS +SM
Sbjct  385   G-FKVPGPSLPVIPLLFIFVMIPIYERFFVPLARKITGIPTGIRHLQRVGVGLVLSVISM  443

Query  1353  aaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYS  1532
             A + ++E  RK VA E NM+D+    +PLP+S  WL  Q+ IFG ADMFT VGLLEFFY+
Sbjct  444   AVSGVVETWRKSVAIEHNMVDST---EPLPMSFLWLGFQFAIFGAADMFTLVGLLEFFYA  500

Query  1533  QAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFY  1712
             ++   +KS+ +   W S++ GYF SSV+V+VVN  T      GGWL  +N+NR+ L  FY
Sbjct  501   ESSTGMKSLGTAISWCSVAFGYFLSSVVVQVVNKVT------GGWLASDNLNRDKLNYFY  554

Query  1713  ALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              LL+G+S +NF VYL  +  Y+Y+ +
Sbjct  555   WLLAGISTLNFGVYLTCASWYRYKDR  580



>gb|ABR16528.1| unknown [Picea sitchensis]
Length=628

 Score =   455 bits (1171),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 248/573 (43%), Positives = 370/573 (65%), Gaps = 17/573 (3%)
 Frame = +3

Query  102   KVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHV  281
              VDW+GR    D+HGG+RA++F++G+  FE MA   +G  L+TY+   M+ +L  +AN V
Sbjct  30    SVDWKGRATLHDRHGGMRAAVFVMGLQAFEIMAIAAVGNNLITYVFNDMHYSLPKSANIV  89

Query  282   TNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLD  461
             TNF G  ++L+I+   LAD+Y+G F  +++   IE  G  ++A+QAH  +LKP  CN + 
Sbjct  90    TNFVGTIFLLSILGGFLADSYLGSFLTIIVFGLIELTGYIIMAVQAHVPRLKPESCNIMK  149

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
               E C++  G  A  LF+ LY VA+GS  +K  + +HG DQFD  D K+  +MS++FN+ 
Sbjct  150   SEETCKQPQGVQAFFLFLGLYLVALGSGCLKPNMIAHGGDQFDANDAKDRRKMSTYFNFA  209

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
              L  C+G  ++LT  VW+    G D GFA S   M  G +  T G PFYR  + QG S +
Sbjct  210   YLSFCIGELIALTFLVWIQSRCGMDVGFAVSASVMVLGLVSITTGTPFYRNRLPQG-SVL  268

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE------------FLPHTDKY  965
             T+  QV VAA H R+L+ P D G L+E+ +D        E             L HTD++
Sbjct  269   TRFAQVLVAAAHKRRLRCPSDPGMLHEL-RDSYPYNYHMEKSILKNTQPDRQLLFHTDQF  327

Query  966   RFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             RFLD+AAI    +E+ +PW++C VTQVE  K+++ ++P+F CT++M   LAQLQTFS+QQ
Sbjct  328   RFLDRAAI-VDQNEDGSPWKLCTVTQVEQVKLVIRVIPIFACTIVMNCILAQLQTFSVQQ  386

Query  1146  GSTMDLNITKsf-qilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             GSTMD  + +S   + P+SL  +P + L+ L+PLYD +FVP +R +TG  TGI+ L R+ 
Sbjct  387   GSTMDNRLGRSSFHVPPASLQAIPYIMLVILVPLYDAVFVPFLRGITGKETGISQLQRIG  446

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
             +GL +S+ SM  AA++E KRK+VAR+  +++    L  LP+++FW++ Q+ +FG+++MFT
Sbjct  447   IGLFISTFSMVTAALVEAKRKRVARDTELMENPDNLMSLPLTIFWVAPQFLVFGLSEMFT  506

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGL+EFFYSQ+P  ++S+ +   + S S G++ S VLV +VN  T   +  GGWL  NN
Sbjct  507   AVGLIEFFYSQSPAGMQSLLTALTYCSYSFGFYLSGVLVSIVNKVTSTGSH-GGWLSDNN  565

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             +N++ L+LFY LL+ LSF+NF  Y+F S+ YKY
Sbjct  566   LNKDQLDLFYWLLAVLSFINFLNYIFWSRWYKY  598



>ref|XP_004152790.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Cucumis sativus]
 ref|XP_004170059.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Cucumis sativus]
Length=570

 Score =   452 bits (1163),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 364/559 (65%), Gaps = 19/559 (3%)
 Frame = +3

Query  129   RKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYI  308
              + K GG +A+IFI    G ENMA + + ++LVTY +G MN +L  +   +TNF G T++
Sbjct  6     NEAKRGGNKAAIFIYVCEGLENMAFVSVALSLVTYFSGYMNFSLTKSVTTLTNFMGTTFL  65

Query  309   LTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVA  488
             LT++   +++TY+ RF+  L+ A+ E +G  LL +QAH+  L+P PC       +CE   
Sbjct  66    LTLLGGFISETYLSRFKTCLLFAFFELMGYCLLTVQAHFPHLRPAPCKEAPAGSECEAAG  125

Query  489   GRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGA  668
                 A L+  LY +A+G++GVKAA+P+ GADQFD+KD  E  ++SSFFNW L  + +G  
Sbjct  126   SSQEAFLYTGLYLIALGTSGVKAALPALGADQFDDKDPSEAGKVSSFFNWFLFSLTIGSI  185

Query  669   VSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVA  848
             V LTL VW+    GWDW F   ++++        LG  FYR  V QG S I + +QVFVA
Sbjct  186   VGLTLIVWINTEVGWDWAFVVCSISVLAAIFVVFLGKSFYRHNVPQG-SPILRFLQVFVA  244

Query  849   AIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA------IQTSWDEE  1010
             +I NRKL LP ++ EL+EI +DKEA  I  E L  TD++RFLD+AA      I +    +
Sbjct  245   SIRNRKLPLPVNANELHEI-RDKEA-AIPYEILEKTDQFRFLDRAAIIRNDTIASISTNQ  302

Query  1011  PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqil  1190
               PWR+C VTQVE  KIL+ ++P+ L T+ M  C+AQLQTFSIQQ  TMD      F+I 
Sbjct  303   QGPWRLCTVTQVEETKILIRMLPIILSTIFMATCMAQLQTFSIQQSITMDSQFLG-FKIP  361

Query  1191  psslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaail  1370
               S+P +P+LF+ F IP Y+R+FVP  R++TGIPTGI  L R+ +GL+L++ SMA A  +
Sbjct  362   GPSIPVIPLLFMFFFIPFYERVFVPLARKITGIPTGIRHLQRIGIGLVLTAASMAIAGFV  421

Query  1371  elKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKEL  1550
             E +RK VA + NM+D+    +PLPISVFWL  Q+ +FG+ D+FT VGLLEFFY+++   +
Sbjct  422   ETRRKNVAIKHNMVDST---EPLPISVFWLGFQFCVFGMGDIFTLVGLLEFFYAESSAGM  478

Query  1551  KSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGL  1730
             KS+S+   W +++ GYFTS+V+V VVN A      SGGWL  NN+N++ L+ FY LLS L
Sbjct  479   KSLSTAIAWCAIAFGYFTSTVVVTVVNKA------SGGWLASNNLNKDKLDYFYWLLSVL  532

Query  1731  SFVNFFVYLFVSKRYKYRQ  1787
             S +NF  YL  +  Y+Y+ 
Sbjct  533   SVLNFGFYLVCASWYRYKN  551



>ref|XP_008676281.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Zea mays]
Length=578

 Score =   451 bits (1161),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 276/571 (48%), Positives = 371/571 (65%), Gaps = 65/571 (11%)
 Frame = +3

Query  84    YELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLA  263
             YE+I+GKVDWRGR A + +HGG       L  FGFENMA++ L V L+ Y  GVM++NL 
Sbjct  56    YEVIEGKVDWRGRPALRGRHGG-------LVNFGFENMASLSLAVNLMMYFLGVMHLNLE  108

Query  264   DAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPP  443
             DA+N +TN+ GA+Y+++++ +V AD ++GR+  V++S+ +E +GL LL +QA   +LKPP
Sbjct  109   DASNLLTNYMGASYMISVLISVFADVFVGRYMTVILSSLVELVGLLLLMLQARSDRLKPP  168

Query  444   PCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMS  623
             PC        C  V G N   L++ALY +A+GS G+KAA+P+H ADQFD K  +E  +MS
Sbjct  169   PCKDPRDPTTCPRVHGSNEVHLYLALYLIALGSGGIKAALPAHCADQFDAKHPREKLQMS  228

Query  624   SFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVI  803
             S FN+LLL +C GGA S+T+FVW+ ++KGW  GFAA+T  M    I F  GLP YR+  +
Sbjct  229   SCFNYLLLSLCTGGAFSVTVFVWIQENKGWAKGFAAATGVMGLAVIVFIAGLPRYRIATV  288

Query  804   QGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK-YRFLDK  980
             QGSSA+ +I QV+VAA+ NRK QLPE+  ELYEISK+K +     EF+ H D+ +RFLD+
Sbjct  289   QGSSALKEIFQVYVAAVRNRKQQLPENPDELYEISKNKASPD--TEFVAHRDRPFRFLDR  346

Query  981   AAI-QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTM  1157
             AAI QT+ D   +PWR CRVTQVE+AK +L +VP+F   +IM  CLAQLQTFS+ QGSTM
Sbjct  347   AAIVQTAKDAAADPWRQCRVTQVEHAKTVLAMVPIFCSAIIMGTCLAQLQTFSMVQGSTM  406

Query  1158  DLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlll  1337
             D  + + FQ+  +S+P +P++FLIF +P+Y++LFVP  RRLTGIPTGIT L RV VGL+L
Sbjct  407   DTALGRHFQMPVASMPIIPLVFLIFAVPIYEQLFVPFARRLTGIPTGITYLQRVGVGLVL  466

Query  1338  sslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLL  1517
             S +SM  AA              +++A   L+ +  S  W S                  
Sbjct  467   SIVSMVMAA--------------VVEAPQALKSMSSSFLWCS------------------  494

Query  1518  EFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNH  1697
                                   +SLGYF S+V+VK VN ATK  T SGGWL G N+NRNH
Sbjct  495   ----------------------LSLGYFMSTVIVKAVNKATKKKTASGGWLAGENINRNH  532

Query  1698  LELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             L+LF+ LL+ LS VN F YLF +  YKY+ Q
Sbjct  533   LDLFFWLLAVLSTVNLFNYLFWASWYKYKPQ  563



>ref|XP_003602970.1| Peptide transporter PTR3-A [Medicago truncatula]
 gb|AES73221.1| peptide/nitrate transporter [Medicago truncatula]
Length=568

 Score =   449 bits (1155),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 257/554 (46%), Positives = 367/554 (66%), Gaps = 20/554 (4%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + + GG RA++F+  + G ENMA +   V+L+TY  G MN +L  +A  +TN  G  ++L
Sbjct  14    QRRLGGKRAALFVYAMEGLENMAFVANAVSLITYFTGSMNFSLTKSATTLTNLMGTAFLL  73

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN---PLDKAEKCEE  482
              ++  +++DTY+ RF+  ++ A +E LG G+L +QA + +L+P PC    P+D   +CE 
Sbjct  74    PLLGGLISDTYLSRFKTCVLFASMELLGYGILTIQARFQQLRPIPCKDIAPID-MNQCEP  132

Query  483   VAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVG  662
               G  AAIL+  LY  A+G++GVKAA+P+ GADQFD+KD KE +++SSFFNW LL +  G
Sbjct  133   ANGSQAAILYTGLYLFALGTSGVKAALPALGADQFDDKDPKEAAQLSSFFNWFLLSLTTG  192

Query  663   GAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVF  842
                 +T   W+  ++GW W F   T+A+F   +   +G  FYR    +GS  I +IIQVF
Sbjct  193   AIFGVTFINWISSNQGWYWSFTVCTIAVFLSILSICMGKSFYRNNTPKGSPLI-RIIQVF  251

Query  843   VAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPW  1022
             VAA  NRKL++PE++ E++EI + +   +   E L  TD++RFLD+AA+          W
Sbjct  252   VAAFKNRKLEIPENAEEMHEIHEKERGDSY--EILKRTDQFRFLDRAAVG---GNSTGSW  306

Query  1023  RVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpssl  1202
              +C VTQVE  KIL+ ++P+ L T+ M  CLAQLQTFSIQQ +T+D NI   F++   SL
Sbjct  307   NLCTVTQVEETKILVRMLPIILSTIFMNTCLAQLQTFSIQQSTTLDTNILG-FKMPGPSL  365

Query  1203  pflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKR  1382
             P +P+LF+  LIPLYDR+FVP +RR+TGIPTGI  L R+ +GL+LS++SM  A  +E +R
Sbjct  366   PVIPLLFMFVLIPLYDRVFVPLIRRITGIPTGIRHLQRIGIGLVLSAISMLVAGFVETRR  425

Query  1383  KQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVS  1562
             K VA E NM+D+    +PLP+SVFWL  QY IFG ADMFT +GLLEFFY+++   +KS+S
Sbjct  426   KSVAIEHNMVDST---EPLPMSVFWLGFQYAIFGAADMFTLIGLLEFFYAESSAGMKSLS  482

Query  1563  SCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVN  1742
             +   W S++ GYFTSSV+V+VV         SGGWL  NN+NR+ L  FY LLS +S +N
Sbjct  483   TAISWCSVAFGYFTSSVVVEVV------NKVSGGWLASNNLNRDKLNYFYWLLSIISVIN  536

Query  1743  FFVYLFVSKRYKYR  1784
             F  YL  +  Y+Y+
Sbjct  537   FVFYLVCASWYRYK  550



>ref|XP_002301204.2| hypothetical protein POPTR_0002s13090g [Populus trichocarpa]
 gb|EEE80477.2| hypothetical protein POPTR_0002s13090g [Populus trichocarpa]
Length=544

 Score =   447 bits (1151),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 259/536 (48%), Positives = 356/536 (66%), Gaps = 19/536 (4%)
 Frame = +3

Query  195   MATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLIS  374
             MA I + V+LVTY  G MN +L  +A  +TNF G ++++ +    + DTY+ RF+A ++ 
Sbjct  1     MAFISMAVSLVTYFYGYMNFSLTKSATTLTNFMGTSFLVALFGGFICDTYMTRFKACVLF  60

Query  375   AWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVK  554
               +EF+G GLL +QAH+  L+P PC  +   ++CE   G  AAILF  LY +A G++GVK
Sbjct  61    GCVEFMGYGLLTVQAHFHHLRPSPCKGVSP-DQCEGADGSQAAILFAGLYLIAFGTSGVK  119

Query  555   AAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAAS  734
             A++PS GADQFDE D KE S++SSFFNW L  + +G  + +T+ VW+  ++GWD GF   
Sbjct  120   ASLPSLGADQFDENDPKEASQLSSFFNWFLFSITIGAILGVTIIVWISTNQGWDLGFGVC  179

Query  735   TVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKD  914
              +A+    IF ++G   YR  V +G S +T   QVFVAAI NR L +PE + EL+EI   
Sbjct  180   AIAVLLAIIFASMGKSLYRNNVPKG-SPLTSFAQVFVAAIRNRGLPIPEKAEELHEIHNK  238

Query  915   KEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPN-----PWRVCRVTQVENAKILLNLVP  1079
                V    E LP TD++RFLD+AAI  + ++        PWR+C VTQVE  KIL+ ++P
Sbjct  239   DAGVK--REILPWTDQFRFLDRAAIAKTTNDASTSISHRPWRLCTVTQVEETKILIRMLP  296

Query  1080  VFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLF  1259
             + L TV M  CLAQLQTFS+QQ  TMD  +   FQ+   SLP +P+LF+  LIP+Y+R+F
Sbjct  297   IILSTVFMNTCLAQLQTFSVQQSITMDTRVFG-FQVPGPSLPVIPLLFMFVLIPIYERVF  355

Query  1260  VPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPL  1439
             VP  R++TGIPTGI  L RV VGL+LS++SMA A I+E  RK VA E NM+D+    +PL
Sbjct  356   VPLARKITGIPTGIRQLQRVGVGLVLSAISMAVAGIVETSRKSVAVEHNMVDST---EPL  412

Query  1440  PISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLV  1619
             P+S  WL  QY IFG ADMFT VGLLEFFY+++   +KS+S+   W S++ GYF+S+V+V
Sbjct  413   PMSFLWLGFQYAIFGAADMFTLVGLLEFFYAESSAGMKSLSTAISWCSLAFGYFSSTVVV  472

Query  1620  KVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             +VVN  T      GGWL  NN+NR+ L  FY LL+G+S VNF VYL  +  Y+Y++
Sbjct  473   EVVNKVT------GGWLANNNLNRDKLNYFYWLLAGISIVNFGVYLACASWYRYKK  522



>ref|XP_010089930.1| Nitrate transporter 1.2 [Morus notabilis]
 gb|EXB38626.1| Nitrate transporter 1.2 [Morus notabilis]
Length=579

 Score =   445 bits (1144),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 260/556 (47%), Positives = 372/556 (67%), Gaps = 20/556 (4%)
 Frame = +3

Query  144   GGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVA  323
             GG RA++F+    G ENMA I   ++LVTY  G MN +L  ++  +TNF G  ++LT+V 
Sbjct  22    GGNRATLFVYATEGLENMAFIANAISLVTYFYGYMNFSLTKSSTTLTNFMGTAFLLTLVG  81

Query  324   AVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC---NPLDKAEKCEEVAGR  494
               ++DTY+ RF+  +I A IE +G  LL +QAH   L+P PC   +P  + + CE  +  
Sbjct  82    GFISDTYLSRFKTCVIFASIELIGYVLLTVQAHLPDLRPFPCKNVSPDQRNQLCENASTG  141

Query  495   NAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVS  674
               AIL+  +Y +A+G++GVKAA+P+ GADQFDEKD KE S++SSFFNW +  + +G    
Sbjct  142   QLAILYGGIYLIALGTSGVKAALPALGADQFDEKDPKEASQLSSFFNWFMFSLTIGAMFG  201

Query  675   LTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAI  854
             +T  VW+  +KGWDW F   T+A+ F  +F  +G   YR  + +G S + + +QVFVAA 
Sbjct  202   VTFVVWISTNKGWDWAFGVCTIAVLFAAVFVCMGKSLYRHNIPKG-SPLLRFLQVFVAAY  260

Query  855   HNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPN-----P  1019
              NRKL +P+++GEL+EI  DKEA  +  E +  T+++RFLD+AA+    D+  +     P
Sbjct  261   RNRKLAIPDNAGELHEIQSDKEA-ALHNEIIQRTEQFRFLDRAAVAIRSDDASSTIPQGP  319

Query  1020  WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpss  1199
             WR+C VTQVE  KIL+ ++P+   TV M  C+AQLQTFSIQQ +TMD ++   F+I  +S
Sbjct  320   WRLCTVTQVEETKILIRMLPIIFSTVFMNTCMAQLQTFSIQQSTTMDTDLFG-FKIPSAS  378

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
             +P +P+LF+  LIP+YD++ VP  R++TGIPTGI  L R+AVGL+LS++SMA A ++E  
Sbjct  379   IPIIPLLFMFILIPIYDKILVPIARKITGIPTGIRHLQRIAVGLVLSAVSMAVAGVVETW  438

Query  1380  RKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             RK VA + NM+D+    +PLPISVFWL +QY IFG ADMF+ VGLLEFFY ++   +KS+
Sbjct  439   RKSVAFQHNMVDST---EPLPISVFWLGLQYAIFGAADMFSVVGLLEFFYEESSDGMKSL  495

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFV  1739
             S+   W S++ GYF SSV+V+VV         SGGWL  NN+NR+ L  FY LLS LS +
Sbjct  496   STAISWCSIAFGYFLSSVVVEVV------NKVSGGWLASNNLNRDKLNYFYWLLSVLSVL  549

Query  1740  NFFVYLFVSKRYKYRQ  1787
             N  +Y+  +  YKY++
Sbjct  550   NLGIYVMCASWYKYKK  565



>ref|XP_004238192.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Solanum lycopersicum]
Length=579

 Score =   442 bits (1138),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 253/561 (45%), Positives = 366/561 (65%), Gaps = 22/561 (4%)
 Frame = +3

Query  129   RKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYI  308
             +    GG RA++F+  + G   MA I  GV+LV Y NG MN +L  +AN VTNF G  ++
Sbjct  13    KLQSKGGTRAALFVYVMAGINTMALISNGVSLVIYFNGYMNFSLTKSANTVTNFMGTAFL  72

Query  309   LTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN--PLDKAEKCEE  482
             L++  A L+DTY  RF+  ++   I+ LG  LL +QAH+++L+P PC   PL + ++CE 
Sbjct  73    LSLFGAFLSDTYFSRFKTCVLFGIIKVLGFALLGVQAHFSQLRPFPCRDVPLSQNDRCES  132

Query  483   VAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVG  662
                   AIL+  +Y +A+G++GVKAA+PS GADQFDEKD KE +++SS+FNWLL    +G
Sbjct  133   ADAGQLAILYGGVYLIALGNSGVKAALPSLGADQFDEKDPKEAAKLSSYFNWLLFYNTIG  192

Query  663   GAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVF  842
               + +T+ VW+  ++GWDW F   +VA+    +  T+G  FYR  V +G S + +I QVF
Sbjct  193   AILGITVLVWISDNQGWDWSFGICSVAVGLSILLLTMGKQFYRCNVPKG-SPLMRIPQVF  251

Query  843   VAAIHNRKLQLPEDSGELYEI-SKDKEAVTICAEFLPHTDKYRFLDKAAI-----QTSWD  1004
             VAA  NR L LP++  +L++I S + E  T   E L  TD+++FLD+AAI     + S  
Sbjct  252   VAAFRNRNLPLPQNKDDLHQIRSGEPENGT---EILQRTDQFKFLDRAAILRNNQEASTT  308

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
                 PW +C ++QVE  KI++ ++P+ L TV M  C+AQ QTF+IQQ  TM+  I ++F+
Sbjct  309   SAHGPWSLCTISQVEETKIVVRMLPIILSTVFMNTCMAQFQTFTIQQSMTMNRKI-QNFE  367

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I   S+P +P LF +FLIP+YDR+FVP  R+ TGIP+GI  L R+  G +LS++SMA AA
Sbjct  368   IPGPSIPVIPQLFQLFLIPVYDRIFVPIARKFTGIPSGIQQLQRIGAGQVLSAVSMAVAA  427

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             ++E  RK V+ + NM+D+     PLP+SVFWL  Q+ I  +A +FT VGL+ FFY+++  
Sbjct  428   VVESHRKSVSIKHNMVDSA---SPLPMSVFWLGYQFVIAAMAQIFTIVGLMNFFYAESTS  484

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLS  1724
              LKS+S    WSS + GYFTSSV+V V+N        SGGWL  NN+NR+ L+ FY LL+
Sbjct  485   GLKSLSMAISWSSTAFGYFTSSVVVSVINKV------SGGWLANNNLNRDKLDYFYWLLA  538

Query  1725  GLSFVNFFVYLFVSKRYKYRQ  1787
             G+S +NF  YL  +  YKY++
Sbjct  539   GVSVLNFGFYLLCASWYKYKK  559



>ref|XP_009365671.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Pyrus x bretschneideri]
Length=644

 Score =   443 bits (1140),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 258/573 (45%), Positives = 374/573 (65%), Gaps = 21/573 (4%)
 Frame = +3

Query  93    IDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAA  272
             I  + + + + A   + GG RA++F+    G ENMA I   ++LVTY  G MN++L  +A
Sbjct  67    ICQRFEGKPKQAAAARLGGNRAALFVFATEGLENMAFIANAMSLVTYFYGYMNLSLTKSA  126

Query  273   NHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN  452
               +TNF G  +ILT+V   ++DTY  RF+  ++   IE +GLGLL +QAH+ +L+P PC 
Sbjct  127   TTLTNFMGTAFILTLVGGFISDTYWSRFKTCVVFICIELVGLGLLTIQAHFPQLRPFPCK  186

Query  453   PLDKAE--KCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
              +  ++  KCE        +L+  LY +A+G++GVKAA+P+ GADQ+DEKD K  +++SS
Sbjct  187   GVAPSQMYKCEAPNTSQLVMLYTGLYLMALGTSGVKAALPALGADQYDEKDPKGAAQLSS  246

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFNW L  + +G    +T  VW+  + GWD  F   T+A+ F  +F  +G   YR  V +
Sbjct  247   FFNWFLFSLTIGAIFGVTFVVWISTNHGWDLSFVVCTIAVLFALLFVCMGKSLYRNNVPK  306

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA  986
             GS  ++ I+QV V AI NRKLQ+PE++ EL+EI  DKEA     E L  TD++R+LD+AA
Sbjct  307   GSPLLS-ILQVCVVAIKNRKLQIPENTDELHEI-HDKEAGEQ-HEILQRTDQFRWLDRAA  363

Query  987   IQTSWDEE------PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             I +    +         W +C VTQVE  K+L+ ++P+ L TV M  C+AQLQTFSIQQ 
Sbjct  364   ISSGTTADGATPTVHGSWSLCTVTQVEETKLLIRMLPIILSTVFMNTCMAQLQTFSIQQS  423

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
             +TM+ N+   F++   S+P +P+ F+ FLIP+Y+R+FVP  R++TGIPTGI  L R+AVG
Sbjct  424   TTMNRNLLG-FKVPGPSIPAIPLTFMFFLIPIYERIFVPIARKITGIPTGIRHLQRIAVG  482

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L+LS++SM  A  +E +RK VA + NM+D+    +PLP+SV WL +QY IFG ADMFT V
Sbjct  483   LVLSAISMVVAGFIETRRKHVAFQHNMVDSA---EPLPMSVLWLGLQYAIFGAADMFTLV  539

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GLLEFFY+++   +KS+S+   W S++ GYF S+V+V+VV         SGGWL  NN+N
Sbjct  540   GLLEFFYAESAVGMKSLSTAISWCSIAFGYFLSTVVVEVV------NKVSGGWLASNNLN  593

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             R+ L  FY LL+GLS +NF  Y+  +  YKY++
Sbjct  594   RDKLNYFYWLLAGLSVLNFGGYVLCASWYKYKK  626



>ref|XP_002510282.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF52469.1| nitrate transporter, putative [Ricinus communis]
Length=545

 Score =   439 bits (1130),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 247/537 (46%), Positives = 353/537 (66%), Gaps = 19/537 (4%)
 Frame = +3

Query  183   GFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRA  362
             G ENMA +   ++LVTY  G MN +L  +A  +TNF G +++L +    ++DTY+ RF+ 
Sbjct  3     GLENMAFVSNALSLVTYFYGYMNFSLTKSATSLTNFMGFSFLLALFGGFISDTYLSRFKT  62

Query  363   VLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--DKAEKCEEVAGRNAAILFVALYTVAM  536
              ++   IE LG GLL +QAH+ +L+P PC  +  D+  +C+       AIL++ +Y +A+
Sbjct  63    AVLFGCIELLGYGLLTVQAHFHQLRPVPCKGVAPDQTNQCDAATSSQEAILYIGVYLIAL  122

Query  537   GSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWD  716
             G++GVK+++PS GADQFDE D KE +++SSFFNW L  + +GG   +T  VW+  ++GWD
Sbjct  123   GTSGVKSSLPSMGADQFDENDPKEAAQLSSFFNWFLFSLTIGGIFGVTFLVWISTNQGWD  182

Query  717   WGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL  896
               F   T+A+ F  IF  +G   YR    +GS  + +I QV V A+ NR L +PE + EL
Sbjct  183   LSFGVCTIAVLFAIIFLCMGKSLYRNNKPKGSPFL-RIAQVLVVAVRNRNLPIPEMTDEL  241

Query  897   YEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLV  1076
             +EI  DKE      E L  T+++RFLD+AAI  +     +   +C VTQVE  KILL ++
Sbjct  242   HEI-HDKETGK-QDEILKRTNQFRFLDRAAIVRT----DHGASLCTVTQVEETKILLRML  295

Query  1077  PVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRL  1256
             P+ L TV M  CLAQLQTF++QQ +TMD N+   F I   S+P +P+LF+  LIP+YDR+
Sbjct  296   PIILSTVFMNTCLAQLQTFTVQQSTTMDTNLLG-FHIPGPSIPVIPLLFMFALIPIYDRI  354

Query  1257  FVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQP  1436
             FVP  RRLTGIPTG+  L R+ VGL+LS++SMA + ++E  RK VA + NM+D+    +P
Sbjct  355   FVPLARRLTGIPTGVRHLQRIGVGLVLSAISMAVSGVVETHRKSVAIKHNMVDSA---EP  411

Query  1437  LPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVL  1616
             LP+SVFWL  QY IFG ADMFT +GLLEF YS++   +KS+S+   W S+++GYF SS +
Sbjct  412   LPMSVFWLGFQYAIFGAADMFTLIGLLEFLYSESSAGMKSLSTAISWCSLAIGYFISSAV  471

Query  1617  VKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             V++VN        SGGWL  NN+NR+ L  FY LL+ LS +NF +YL  +  YKY++
Sbjct  472   VEIVNKV------SGGWLANNNLNRDKLNYFYWLLAALSILNFGLYLVCASWYKYKK  522



>ref|XP_011030677.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like isoform X2 [Populus 
euphratica]
 ref|XP_011030684.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like isoform X2 [Populus 
euphratica]
Length=546

 Score =   439 bits (1129),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 255/537 (47%), Positives = 356/537 (66%), Gaps = 19/537 (4%)
 Frame = +3

Query  195   MATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLIS  374
             MA + +  +L+TY +G MN +L  +A  + NF G ++++ +    + DTY  RF+  ++ 
Sbjct  1     MAFVCMITSLMTYFSGYMNFSLTKSATTLANFVGTSFLVALFGGFICDTYWTRFKTCVLF  60

Query  375   AWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVK  554
               +EFLG  LL +QAH+ +L+P PC  +  +++CE   G  +AILF  LY +A G++G+K
Sbjct  61    GCVEFLGYALLTVQAHFHQLRPIPCKGV-SSDQCEAADGSQSAILFTGLYLIAFGTSGIK  119

Query  555   AAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAAS  734
             AA+PS GADQFDE D KE  ++SSFFNW LL + VG  + +T+ VWL  ++GWD GF   
Sbjct  120   AALPSLGADQFDENDPKEAIQLSSFFNWFLLSLTVGAIIGVTVIVWLSDNQGWDLGFGVC  179

Query  735   TVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKD  914
              +A+FF  IF ++G   YR  V +G S + +I QVFVAAI NR L +PE + EL+EI  D
Sbjct  180   AIAVFFAIIFVSMGKSLYRNNVPKG-SPLARIAQVFVAAIRNRDLPIPERAEELHEI-HD  237

Query  915   KEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPN-----PWRVCRVTQVENAKILLNLVP  1079
             KEA  +  E LP T ++ FLD+AAI  + D         PWR+C VTQVE  KILL ++P
Sbjct  238   KEA-GVKQEILPRTGQFSFLDRAAIANTTDLASTSINHGPWRLCTVTQVEETKILLRMLP  296

Query  1080  VFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLF  1259
             V L TV M  CLAQLQTFS+QQ +TMD N+   F++   SLP +P+LF+  +IP+Y+R F
Sbjct  297   VILSTVFMNTCLAQLQTFSVQQSTTMDTNVFG-FKVPGPSLPVIPLLFIFVMIPIYERFF  355

Query  1260  VPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPL  1439
             VP  R++TGIPTGI  L RV VGL+LS +SMA + ++E  RK VA E NM+D+    +PL
Sbjct  356   VPLARKITGIPTGIRHLQRVGVGLVLSVISMAVSGVVETWRKSVAIEHNMVDST---EPL  412

Query  1440  PISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLV  1619
             P+S  WL  Q+ IFG ADMFT VGLLEFFY+++   +KS+ +   W S++ GYF SSV+V
Sbjct  413   PMSFLWLGFQFAIFGAADMFTLVGLLEFFYAESSTGMKSLGTAISWCSVAFGYFLSSVVV  472

Query  1620  KVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             +VVN  T      GGWL  +N+NR+ L  FY LL+G+S +NF VYL  +  Y+Y+ +
Sbjct  473   QVVNKVT------GGWLASDNLNRDKLNYFYWLLAGISTLNFGVYLTCASWYRYKDR  523



>ref|XP_003527710.2| PREDICTED: nitrate transporter 1.2-like [Glycine max]
Length=572

 Score =   439 bits (1128),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 259/556 (47%), Positives = 369/556 (66%), Gaps = 18/556 (3%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + + GG RA++F+  + G ENMA +   V+LVTY  G MN +L  +A  +TNF G  ++L
Sbjct  14    QRRLGGNRAALFVYAMEGLENMAFVANAVSLVTYFFGYMNFSLTKSATTLTNFLGTAFLL  73

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE--KCEEV  485
              +V  +++DTY+ RF+  ++ A +E LG G+L +QA + +L+P PC  L   +  +CE  
Sbjct  74    ALVGGLISDTYLSRFKTCVLFACMELLGYGILTVQARFHQLRPIPCKDLAPTQMSQCEAA  133

Query  486   AGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGG  665
              G +AAIL+  LY VA+G+ G+KAA+P+ GADQFDEKD KE +++SSFFNW L  + +G 
Sbjct  134   TGGHAAILYTGLYLVALGTGGIKAALPALGADQFDEKDPKEAAQLSSFFNWFLFSLTIGA  193

Query  666   AVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFV  845
              + +T  VW+  + GWDW F   T+ + F  +F  +G   YR  V +GS  I +IIQVFV
Sbjct  194   IIGVTFIVWIGVNLGWDWSFIVCTLTILFAIVFICMGNSLYRNNVPKGSPLI-RIIQVFV  252

Query  846   AAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI---QTSWDEEPN  1016
             AA  NRKL +P+++ +L+EI + +       E L  TD++RF D+AAI    T       
Sbjct  253   AAFRNRKLPIPDNTDKLHEIHEKRGGDNF--EILKRTDQFRFFDRAAIARSSTGAATNSG  310

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
             PWR+C VTQVE  KIL+ ++P+ + T+ M  CLAQLQTF+IQQ +TM+ N+   F++   
Sbjct  311   PWRLCTVTQVEETKILIRMLPIIVSTIFMNTCLAQLQTFTIQQSTTMNTNL-GGFKVPGP  369

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             S+P +P++F+  LIPLYDR+FVP  RR+TGIPTGI  L R+ +GL+LS++SMA A  +E 
Sbjct  370   SVPVIPLMFMFVLIPLYDRVFVPLARRITGIPTGIRHLQRIGIGLVLSAVSMAVAGFVET  429

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
              RK VA + NM+D+    +PLPISVFWL  QY IFG ADMFT +GLLEFFY+++   +KS
Sbjct  430   HRKSVAIKHNMVDS---REPLPISVFWLGFQYAIFGAADMFTLIGLLEFFYAESSAGMKS  486

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             + +   W S++ GYFTS+V+V+VV         SGGWL  NN+NR++L  FY LLS LS 
Sbjct  487   LGTAISWCSVAFGYFTSTVVVEVV------NKVSGGWLANNNLNRDNLNYFYWLLSVLSV  540

Query  1737  VNFFVYLFVSKRYKYR  1784
             VNF  YL  +  Y+Y+
Sbjct  541   VNFGFYLVCASWYRYK  556



>gb|KEH35736.1| peptide/nitrate transporter [Medicago truncatula]
Length=596

 Score =   436 bits (1120),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 255/581 (44%), Positives = 370/581 (64%), Gaps = 46/581 (8%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + + GG RA++F+  + G ENMA +   V+L+TY  G MN +L  +A  +TN  G  ++L
Sbjct  14    QRRLGGKRAALFVYAMEGLENMAFVANAVSLITYFTGSMNFSLTKSATTLTNLMGTAFLL  73

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN---PLDKAEKCEE  482
              ++  +++DTY+ RF+  ++ A +E LG G+L +QA + +L+P PC    P+D   +CE 
Sbjct  74    PLLGGLISDTYLSRFKTCVLFASMELLGYGILTIQARFQQLRPIPCKDIAPID-MNQCEP  132

Query  483   VAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVG  662
               G  AAIL+  LY  A+G++GVKAA+P+ GADQFD+KD KE +++SSFFNW LL +  G
Sbjct  133   ANGSQAAILYTGLYLFALGTSGVKAALPALGADQFDDKDPKEAAQLSSFFNWFLLSLTTG  192

Query  663   GAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYR---------VYVIQGSS  815
                 +T   W+  ++GW W F   T+A+F   +   +G  FYR         + +IQ ++
Sbjct  193   AIFGVTFINWISSNQGWYWSFTVCTIAVFLSILSICMGKSFYRNNTPKGSPLIRIIQVNN  252

Query  816   AITQII------------------QVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE  941
              I +++                  QVFVAA  NRKL++PE++ E++EI + +   +   E
Sbjct  253   IILKMLLYFIGKFNYDAYLNLLNFQVFVAAFKNRKLEIPENAEEMHEIHEKERGDSY--E  310

Query  942   FLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQ  1121
              L  TD++RFLD+AA+          W +C VTQVE  KIL+ ++P+ L T+ M  CLAQ
Sbjct  311   ILKRTDQFRFLDRAAVG---GNSTGSWNLCTVTQVEETKILVRMLPIILSTIFMNTCLAQ  367

Query  1122  LQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGI  1301
             LQTFSIQQ +T+D NI   F++   SLP +P+LF+  LIPLYDR+FVP +RR+TGIPTGI
Sbjct  368   LQTFSIQQSTTLDTNILG-FKMPGPSLPVIPLLFMFVLIPLYDRVFVPLIRRITGIPTGI  426

Query  1302  TPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIF  1481
               L R+ +GL+LS++SM  A  +E +RK VA E NM+D+    +PLP+SVFWL  QY IF
Sbjct  427   RHLQRIGIGLVLSAISMLVAGFVETRRKSVAIEHNMVDST---EPLPMSVFWLGFQYAIF  483

Query  1482  GIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG  1661
             G ADMFT +GLLEFFY+++   +KS+S+   W S++ GYFTSSV+V+VV         SG
Sbjct  484   GAADMFTLIGLLEFFYAESSAGMKSLSTAISWCSVAFGYFTSSVVVEVV------NKVSG  537

Query  1662  GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             GWL  NN+NR+ L  FY LLS +S +NF  YL  +  Y+Y+
Sbjct  538   GWLASNNLNRDKLNYFYWLLSIISVINFVFYLVCASWYRYK  578



>ref|XP_006354936.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Solanum tuberosum]
Length=548

 Score =   433 bits (1113),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 241/538 (45%), Positives = 354/538 (66%), Gaps = 20/538 (4%)
 Frame = +3

Query  195   MATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLIS  374
             MA I  GV+LVTY +G MN +L  +AN VTNF G  ++L++  A L+DTY  RF+  ++ 
Sbjct  1     MAFISKGVSLVTYFSGYMNFSLTKSANTVTNFMGTAFLLSLFGAFLSDTYFSRFKTCVLF  60

Query  375   AWIEFLGLGLLAMQAHYAKLKPPPCN--PLDKAEKCEEVAGRNAAILFVALYTVAMGSAG  548
             + I+ LG  LL +QAH+++L+P PC   PL + ++CE       AIL+  +Y +A+G++G
Sbjct  61    SIIQVLGYALLGVQAHFSQLRPFPCKDVPLSQNDRCESADAGQLAILYGGVYLIALGNSG  120

Query  549   VKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFA  728
             VKAA+PS GADQFDEKD K  +++SS+FNWLL  + +G  + +TLFVW+  ++GWDW F 
Sbjct  121   VKAALPSLGADQFDEKDPKGAAKLSSYFNWLLFFITIGAMLGVTLFVWIGDNQGWDWSFG  180

Query  729   ASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEIS  908
              S+VA+    +  T+G  FYR  V +G S + +I QV VAA  NR L LP++  +L++I 
Sbjct  181   ISSVAVGLSILLLTMGKQFYRYNVPKG-SPLMRISQVLVAAFRNRNLPLPQNKEDLHQIR  239

Query  909   KDKEAVTICAEFLPHTDKYRFLDKAAI-----QTSWDEEPNPWRVCRVTQVENAKILLNL  1073
               +    I  E +  TD+++ LD+AAI     + S      PW +C ++QVE  KI++ +
Sbjct  240   SGEAENGI--EIIQRTDQFKCLDRAAIPRNNQEASTSNAHGPWSLCTISQVEETKIVVRM  297

Query  1074  VPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDR  1253
             +P+ L TV M  C+AQLQTF+IQQ  TM+  I   F++   S+P +P +F + +IP+YDR
Sbjct  298   LPIILSTVFMNTCMAQLQTFTIQQSMTMNRKIGN-FELPAPSIPVIPQIFQLIMIPVYDR  356

Query  1254  LFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQ  1433
             +FVP  R+ TGIP+GI  L R+ VGL+LS +SMA +A++E +RK VA E NM+D+     
Sbjct  357   IFVPIARKFTGIPSGIRQLQRIGVGLILSIVSMAVSAVVESRRKSVAIEHNMVDSA---N  413

Query  1434  PLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSV  1613
              LP+SVFWL  Q+ IF  A++ T VGLL+FFY+++   +KS+S    W S++ GYFTSSV
Sbjct  414   QLPMSVFWLGFQFVIFATAEILTLVGLLDFFYAESTSGMKSLSMAITWCSLAFGYFTSSV  473

Query  1614  LVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             +V V+N        SGGWL  NN+NR+ L+ FY LL+ +S +NF  YL  +  YKY++
Sbjct  474   VVSVINKV------SGGWLANNNLNRDKLDYFYWLLAAVSVLNFGFYLLCASWYKYKK  525



>ref|XP_004238191.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5 [Solanum lycopersicum]
Length=582

 Score =   433 bits (1113),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 249/559 (45%), Positives = 369/559 (66%), Gaps = 20/559 (4%)
 Frame = +3

Query  135   DKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILT  314
              K GG RA++F+  + G + MA I  GV+LVTY +G MN +L  +AN VTNF G  ++L+
Sbjct  15    QKKGGTRAALFVYVVAGIDTMAFISKGVSLVTYFSGYMNFSLTKSANTVTNFMGTAFLLS  74

Query  315   IVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN--PLDKAEKCEEVA  488
             +  A L+DTY  RF+  ++ + I+ LG  LL +QAH+++L+P PC   PL + ++CE   
Sbjct  75    LFGAFLSDTYFSRFKTCVLFSIIQVLGFALLGVQAHFSQLRPFPCKDVPLSQNDQCESAD  134

Query  489   GRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGA  668
                 AIL+  +Y VA+G++GVKAA+PS GADQFDEK  K  +++SS+FNWLL  + +G  
Sbjct  135   AGQLAILYGGVYLVALGNSGVKAALPSLGADQFDEKGPKGAAKLSSYFNWLLFFITIGAM  194

Query  669   VSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVA  848
             + +TLFVW+  ++GWDW F   +VA+    +  T+G  FYR  V +G S + +I QV VA
Sbjct  195   LGVTLFVWIGDNQGWDWSFGICSVAIGLSTLLLTMGKQFYRNNVPKG-SPLMRISQVLVA  253

Query  849   AIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI-----QTSWDEEP  1013
             A  NR L LP+++ +L++I  ++    I  E +  TD+++ LD+AAI     + S     
Sbjct  254   AFRNRNLPLPQNNEDLHQIRSEEAENGI--EIIQRTDQFKCLDRAAIPRNNHEASTSNSH  311

Query  1014  NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilp  1193
              PW +C ++QVE  KI++ ++P+ L TV M  C+AQLQTF+IQQ  TM+  I ++F+I  
Sbjct  312   GPWSLCTISQVEETKIVVRMLPIILSTVFMNTCMAQLQTFTIQQSMTMNRKI-RNFEIPG  370

Query  1194  sslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaaile  1373
              S+P +P +F + +IP+YDR+FVP  R+ TGIP+GI  L R+ VGL+ S +SMA AA++E
Sbjct  371   PSIPVIPQVFQLIMIPVYDRIFVPIARKFTGIPSGIRQLQRIGVGLVFSVVSMAVAAVVE  430

Query  1374  lKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELK  1553
               RK VA E NM+D+      +P+SVFWL  Q+ IF IA++ T +GLL+FFY+++   +K
Sbjct  431   SHRKSVAIEHNMVDSS---SQIPMSVFWLGFQFVIFSIAEVLTLIGLLDFFYAESTSGMK  487

Query  1554  SVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLS  1733
             S+S    W S++ GYFTSSV+V VV         SGGWLG NN+NR+ L+ FY LL+G+S
Sbjct  488   SLSMAITWCSLAFGYFTSSVVVSVV------NKVSGGWLGNNNLNRDKLDYFYWLLAGVS  541

Query  1734  FVNFFVYLFVSKRYKYRQQ  1790
              +NF  YL  +  YKY+++
Sbjct  542   VLNFGFYLLCASWYKYKKR  560



>ref|XP_004293234.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Fragaria vesca subsp. vesca]
Length=580

 Score =   431 bits (1107),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 250/554 (45%), Positives = 353/554 (64%), Gaps = 20/554 (4%)
 Frame = +3

Query  129   RKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYI  308
             ++   GG RA +F+    G ENMA I   ++LVTY  G MN+++  +A  +TNF G  ++
Sbjct  11    KQASRGGRRAVLFVYATEGLENMAFIANALSLVTYFYGYMNMSMTKSATTLTNFMGTAFL  70

Query  309   LTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVA  488
             LT+V   ++DTY  RF+  LI   IE +G  +L +QAH+ +L+P PC        CE   
Sbjct  71    LTLVGGYVSDTYWSRFKTCLIFILIELMGYVILTVQAHFPQLRPTPCKLGVAEPHCEAAD  130

Query  489   GRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGA  668
                 A+L+  LY +A+G++GVK+A+P+ GADQFD+ D K+  ++SSFFNW L  + +G  
Sbjct  131   RGQLALLYTGLYLIALGTSGVKSALPALGADQFDKNDPKQAGQLSSFFNWFLFSLTIGAI  190

Query  669   VSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ-GSSAITQIIQVFV  845
               +T  VW+  + GWD  F  S VA+ F  +   +G   YR        S ++ I+QV V
Sbjct  191   FGVTFVVWIGANHGWDLAFGVSAVAVLFALLSLCMGKSVYRNNKFNPKGSPLSSILQVLV  250

Query  846   AAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQ-------TSWD  1004
             A+I NRKL +PE + +L+EI  DKEA     E++  T+++RFLD+AA+        +S  
Sbjct  251   ASIRNRKLPIPEKAEDLHEI-HDKEAGEE-HEYIQRTEQFRFLDRAAVNCCPTIEGSSTS  308

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
               P  WR+C VTQVE  K+L+ ++P+ L TV M  C+AQLQTFSIQQ  TMD ++   F+
Sbjct  309   TNPGAWRLCTVTQVEEVKLLIRMLPIILSTVFMNTCIAQLQTFSIQQSMTMDRHLIG-FK  367

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I   S+P +P+LF+ FLIP YDR+ VP +R++TGIPTGI  L R+AVGL+LS +SMA A 
Sbjct  368   IPGPSIPVIPLLFMFFLIPFYDRVMVPLLRKITGIPTGIRHLQRIAVGLVLSCISMAIAG  427

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             ++E +R  VA + NM+D+    +PLP+SVFWL  QY IFG ADMFT VGLLEFFY+++  
Sbjct  428   VVETRRISVAVKHNMVDSG---EPLPMSVFWLGFQYAIFGAADMFTLVGLLEFFYAESAA  484

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLS  1724
              +KS+ +   W S++ GYF SSV+V+ VN        SGGWLG NN+NR+ L  FY LLS
Sbjct  485   GMKSLGTAISWCSIAFGYFLSSVVVETVNKV------SGGWLGSNNLNRDKLNYFYWLLS  538

Query  1725  GLSFVNFFVYLFVS  1766
             GLS +N   YL  +
Sbjct  539   GLSVINLGAYLLCA  552



>gb|KHN22290.1| Nitrate transporter 1.2 [Glycine soja]
Length=555

 Score =   429 bits (1102),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 255/556 (46%), Positives = 364/556 (65%), Gaps = 29/556 (5%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + + GG RA++F+  + G ENMA +   V+LVTY  G MN +L  +A  +TNF G  ++L
Sbjct  8     QRRLGGNRAALFVYAMEGLENMAFVANAVSLVTYFFGYMNFSLTKSATTLTNFLGTAFLL  67

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE--KCEEV  485
              +V  +++DTY+ RF+  ++ A +E LG G+L +QA + +L+P PC  L   +  +CE  
Sbjct  68    ALVGGLISDTYLSRFKTCVLFACMELLGYGILTVQARFHQLRPIPCKDLAPTQMSQCEAA  127

Query  486   AGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGG  665
              G +AAIL+  LY VA+G+ G+KAA+P+ GADQFDEKD KE +++SSFFNW L  + +G 
Sbjct  128   TGGHAAILYTGLYLVALGTGGIKAALPALGADQFDEKDPKEAAQLSSFFNWFLFSLTIGA  187

Query  666   AVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFV  845
              + +T  VW+  + GWDW F   T+ + F  +F  +G   YR  V +GS  I +IIQVFV
Sbjct  188   IIGVTFIVWIGVNLGWDWSFIVCTLTILFAIVFICMGNSLYRNNVPKGSPLI-RIIQVFV  246

Query  846   AAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI---QTSWDEEPN  1016
             AA  NRKL +P+++ +L+EI + +       E L  TD++RF D+AAI    T       
Sbjct  247   AAFRNRKLPIPDNTDKLHEIHEKRGGDNF--EILKRTDQFRFFDRAAIARSSTGAATNSG  304

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
             PWR+C VTQVE  KIL+ ++P+ + T+ M  CLAQLQTF+IQQ +TM+ N+   F++   
Sbjct  305   PWRLCTVTQVEETKILIRMLPIIVSTIFMNTCLAQLQTFTIQQSTTMNTNL-GGFKVPGP  363

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
             S+P +P++F+  LIPLYDR+FVP  RR+TGIPTGI  L R+ +GL+LS++SMA       
Sbjct  364   SVPVIPLMFMFVLIPLYDRVFVPLARRITGIPTGIRHLQRIGIGLVLSAVSMA-------  416

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
                 VA + NM+D+    +PLPISVFWL  QY IFG ADMFT +GLLEFFY+++   +KS
Sbjct  417   ----VAIKHNMVDS---REPLPISVFWLGFQYAIFGAADMFTLIGLLEFFYAESSAGMKS  469

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSF  1736
             + +   W S++ GYFTS+V+V+VV         SGGWL  NN+NR++L  FY LLS LS 
Sbjct  470   LGTAISWCSVAFGYFTSTVVVEVV------NKVSGGWLANNNLNRDNLNYFYWLLSVLSV  523

Query  1737  VNFFVYLFVSKRYKYR  1784
             VNF  YL  +  Y+Y+
Sbjct  524   VNFGFYLVCASWYRYK  539



>ref|XP_008790065.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Phoenix dactylifera]
Length=614

 Score =   429 bits (1103),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 254/560 (45%), Positives = 361/560 (64%), Gaps = 22/560 (4%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
               A   K GG RA++F+    GFENM  I    +LV Y +GVM+ +L+D+A  +TNF GA
Sbjct  41    HAAWNPKQGGFRAAMFVFAFAGFENMGFIANMASLVLYFSGVMHFDLSDSATTLTNFMGA  100

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCE  479
             T++LTI+   ++DTY+ R   +L+   IE  G  LL +QA Y  L+P      D+     
Sbjct  101   TFLLTIIGGFISDTYMTRLNTILMFGLIEIWGYILLTLQARYRSLQP------DQNCLTC  154

Query  480   EVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCV  659
              + G NA + ++ L  +A+G  G++  VP+ GADQFD+   KE   ++S+FNWLLL V  
Sbjct  155   HLKGGNAWMFYITLCLLALGCGGIRGCVPALGADQFDKNHPKERKHLTSYFNWLLLSVTS  214

Query  660   GGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQV  839
             G  + +T+ VW+   K W  G+  S +    G IF TLG PFYRV    G   + +I+QV
Sbjct  215   GATLGVTVIVWVYTEKSWSMGYFISMLLALVGFIFITLGKPFYRVR-FAGEGPLLRILQV  273

Query  840   FVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNP  1019
                AI NRKL LPE+S +L+EI+ +KE+     + +PH++++RFLDKAA+         P
Sbjct  274   IELAIRNRKLSLPENSNQLFEIN-EKES-EFVEDKIPHSNQFRFLDKAAVLPK-GTTTEP  330

Query  1020  WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpss  1199
              +VC VTQVE  KIL+ ++P+   T++M  CLAQLQTFS+QQG+ MDL++   F++  +S
Sbjct  331   LKVCSVTQVEEVKILVRMLPILASTILMNTCLAQLQTFSVQQGNIMDLHLGS-FKVPAAS  389

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
             +P +P+ F+  LIP+Y+  F+P  RR+TG P+GIT L RV VGL+LS +SMA AA++E+K
Sbjct  390   IPVIPLFFMSLLIPVYELSFIPLARRITGHPSGITHLQRVGVGLVLSIVSMAVAAVVEVK  449

Query  1380  RKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             R      RN  +         IS+FWLS QY IFGIADMFT VGL+EFFYS+AP  ++S+
Sbjct  450   R------RNAFNH----HLKQISLFWLSFQYGIFGIADMFTLVGLMEFFYSEAPAGMRSL  499

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYALLSGLSF  1736
             S+ F W S+SLGYF S+  V+ +NG TK +  S  GWL G ++N+N+L+LFY  L+ LS 
Sbjct  500   STSFSWLSLSLGYFVSTAFVRAINGITKRLAPSRHGWLYGKDLNKNNLDLFYWFLAILSC  559

Query  1737  VNFFVYLFVSKRYKYRQQIG  1796
             +NF VYLF +K YKYR++ G
Sbjct  560   LNFLVYLFCAKWYKYRKEGG  579



>ref|XP_004134923.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like, 
partial [Cucumis sativus]
Length=349

 Score =   419 bits (1077),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 207/342 (61%), Positives = 256/342 (75%), Gaps = 7/342 (2%)
 Frame = +3

Query  168   ILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYI  347
             +L  FGFE+MA   L V L+TY N VM+  LADAAN +TN+ G  YIL+I+ A+LADTY 
Sbjct  4     VLTTFGFESMAIFALAVNLITYFNSVMHFELADAANQLTNYMGTGYILSILMAILADTYF  63

Query  348   GRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYT  527
             GR + V+IS  +EFL L LL +QAHY KLKPPPCN  DK   CE V G++A +L++ALY 
Sbjct  64    GRVKTVIISGCLEFLALILLMIQAHYPKLKPPPCNMFDKQSHCETVEGKSAVVLYIALYI  123

Query  528   VAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHK  707
             +A G+AG+KAA+PSHGADQFDEKD KE  +MSSFFN LLLG+C+GGAVSLTL VW+  +K
Sbjct  124   LATGTAGIKAALPSHGADQFDEKDPKEAMQMSSFFNKLLLGLCLGGAVSLTLIVWIQDYK  183

Query  708   GWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDS  887
             GWDWG   S  AMFF  + F  G+P YR++++ GSS I QI+QV+VAAI NRKL LPEDS
Sbjct  184   GWDWGLGVSAAAMFFSVVIFVAGMPLYRIHIVSGSSTILQILQVYVAAIRNRKLILPEDS  243

Query  888   GELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD------EEPNPWRVCRVTQVE  1049
               LYEI +DKE   +  +FLPH + YRFLDKAAIQ +        E  + W++C VTQVE
Sbjct  244   THLYEIERDKEN-AMEDDFLPHRNIYRFLDKAAIQQTPSRQVGNPEASSAWKLCTVTQVE  302

Query  1050  NAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
             NAKI+L++VP+F CT+IMTLCLAQLQTFSIQQG TMD  +T 
Sbjct  303   NAKIVLSMVPIFCCTIIMTLCLAQLQTFSIQQGLTMDTKLTN  344



>ref|XP_009341381.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Pyrus x bretschneideri]
Length=612

 Score =   427 bits (1099),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 258/579 (45%), Positives = 362/579 (63%), Gaps = 23/579 (4%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             IN+ +  E  +  VDWRGR +   KHGG+RA+ F+LG+  FE M    +G  L+TY+   
Sbjct  15    INTSDMAE--EMTVDWRGRPSNPTKHGGMRAAAFVLGLQSFEIMGIAAVGNNLITYVINE  72

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+++AN VTNF G  ++L +V   L+D+Y+G F  +LI  ++E  G  LL++QAH 
Sbjct  73    MHFPLSNSANVVTNFIGTVFLLALVGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHV  132

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPPPCN ++  E+C E  G  + I FVALY VA+GS  VK  + +HGADQF+  D K
Sbjct  133   PQLKPPPCN-VNNGEECVEAKGFKSLIFFVALYLVALGSGCVKPNMIAHGADQFNPDDPK  191

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +  ++S++FN       +G  V+LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  192   QSKKLSTYFNAAYFAFSMGELVALTLLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLY  251

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYE-----ISKDKEAVTICAEFLP  950
             YR    QG S +T I QVFVAA+  RK   P +   L+      +  +    +  A FL 
Sbjct  252   YRNKRPQG-SILTPIAQVFVAAMLKRKQACPSNPQLLHGNQNNVLHDNTTFFSDAASFL-  309

Query  951   HTDKYRFLDKAA--IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
             HT+K+RFLDKA   IQ   + + +PWR+C VTQV+  KILL+++P+F  T+I    LAQL
Sbjct  310   HTEKFRFLDKACIKIQDGTNSKESPWRLCTVTQVKQVKILLSVIPIFASTIIFNTILAQL  369

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFS+QQGS MD  +TKSF I P+SL  +P + LI L+PLYD  FVP  R+ TG  +GI+
Sbjct  370   QTFSVQQGSMMDTKLTKSFHIPPASLQSIPYIILIVLVPLYDTFFVPFARKFTGHDSGIS  429

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
             PL R+  GL  ++ SM AAAI+E KR+  A   N +          IS+FW++ Q+ IFG
Sbjct  430   PLMRIGFGLFFATFSMIAAAIMEEKRRDAAVHSNKI----------ISIFWITPQFLIFG  479

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGG  1664
             +++MFT VGL+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T   +  GG
Sbjct  480   LSEMFTAVGLIEFFYKQSLKGMQAFLTALTYCSYSFGFYLSSLLVSLVNKITTS-SRGGG  538

Query  1665  WLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             WLG NN+N++ L+LFY LL+GLSF+NF  YLF S  Y +
Sbjct  539   WLGDNNLNKDRLDLFYWLLAGLSFLNFLNYLFWSHWYSH  577



>ref|XP_010042512.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Eucalyptus grandis]
Length=586

 Score =   426 bits (1095),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 249/552 (45%), Positives = 351/552 (64%), Gaps = 20/552 (4%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             K   GG RAS FI    G +NM  +    TLV Y   VM+ ++A A+N +T+F G+T++L
Sbjct  19    KKGKGGFRASAFIFVQSGLDNMGFVANMATLVLYFLYVMHFDVATASNTLTDFMGSTFLL  78

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             T+V   ++DTY+ RF   LI   IE LGL +L ++AH   L P P        K   + G
Sbjct  79    TLVGGFISDTYLSRFTTCLIFGSIEVLGLAMLTIEAHSKHLHPDPRG------KSSCIHG  132

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
               A   +  L  +A+G  GV+ A P+ GADQFD++D  E   +++FFN+L L    G  +
Sbjct  133   GTATYFYATLCLLALGYGGVRGAFPALGADQFDQRDPTEAGALATFFNYLTLCTTAGATI  192

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +T  VW+  +KGW WGF  +T+A F   +   +G PFYR+    G S + +I QV + A
Sbjct  193   GVTAIVWVSMNKGWHWGFLMATIASFISFVVLAMGKPFYRLQR-PGDSPLVRIWQVVLLA  251

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVC  1031
             I NRKL LPE+S +LYEI  DKE+  +    + HTD++RFLDKAAI    + +P PW+VC
Sbjct  252   IKNRKLPLPENSADLYEIG-DKESSALAVAKIAHTDQFRFLDKAAILLK-ESKPEPWKVC  309

Query  1032  RVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpfl  1211
              VTQVE  K+L  ++P+   T+IM  C+AQLQTFS+QQG  M+ ++  + ++   S+P +
Sbjct  310   TVTQVEEVKVLTRMLPILASTIIMNTCMAQLQTFSVQQGQLMEPHL-GTLKVPAPSIPVI  368

Query  1212  pilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQV  1391
             P+LF+  LIP+Y+ +FVP  R+LTG P+GIT L RV VGL+LS +SMA A I+E+KR   
Sbjct  369   PLLFMSILIPIYEFIFVPFARKLTGHPSGITQLQRVGVGLVLSVISMAVAGIVEVKR---  425

Query  1392  ARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCF  1571
                RN  +  P   P  IS+FWLS+QY IFGIADMFT VGL+EFFY +AP  ++S+S+ F
Sbjct  426   ---RNEFNKTP---PHVISLFWLSLQYGIFGIADMFTLVGLMEFFYKEAPVGMRSLSTSF  479

Query  1572  LWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFF  1748
              W S+S GYF SS+ V ++N  T+ ++ S  GWL G N+N+N++ LFY  L+ LS +NF 
Sbjct  480   TWLSLSFGYFLSSIFVNIINAVTEKISPSKQGWLHGLNINKNNVNLFYWFLAVLSTLNFG  539

Query  1749  VYLFVSKRYKYR  1784
             VYL  +  YKY+
Sbjct  540   VYLLAASWYKYK  551



>ref|XP_007201615.1| hypothetical protein PRUPE_ppa019863mg [Prunus persica]
 gb|EMJ02814.1| hypothetical protein PRUPE_ppa019863mg [Prunus persica]
Length=608

 Score =   427 bits (1097),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 246/574 (43%), Positives = 354/574 (62%), Gaps = 20/574 (3%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VDWRGR  +  KHGG++A++F+LG+ GFE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  17    DMSVDWRGRPCKPTKHGGMKAAVFVLGLQGFEMMAIAAVGNNLITYVLNEMHFSLSKSAN  76

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L++    L+D+Y+G F  ++I   +E  G  LL +QAH  +L+PPPC  
Sbjct  77    IVTNFIGTVFLLSLFGGYLSDSYLGSFWTMIIFGLVELSGFMLLCVQAHLPELRPPPCKI  136

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +   E C E  G  A I F A+Y VA+GS  +K  + SHGADQF   D K+  ++SS+FN
Sbjct  137   MSH-EYCPEAKGYKALIFFAAIYLVALGSGCLKPNIISHGADQFRRDDSKQSKKLSSYFN  195

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                   C+G  ++LT+ VW+  H G D GF  S  AM  G I  T G P YR    +G S
Sbjct  196   CAYFAFCIGELIALTVLVWVQTHSGMDVGFGVSAAAMAMGLICLTFGTPLYRNKPPRG-S  254

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEA---VTICAEFLP--HTDKYRFLDK  980
               T I QVFVAA   RK   P ++  L+    +      V +     P  HT+K+RFLDK
Sbjct  255   IFTPIAQVFVAAFTKRKQICPSNTEMLHGNQNNVPNHLFVPMSPNISPLLHTEKFRFLDK  314

Query  981   AAIQTSWDEEPN--PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
             A I+     + N  PWR+C V QVE  KI++++VP+F CT+I    LAQLQTFS+QQ + 
Sbjct  315   ACIKIEDGTQRNESPWRLCTVAQVEQVKIIISVVPIFACTIIFNTILAQLQTFSVQQATA  374

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             M+  IT+ F+I P+SL  +P + LIF++PLY+ +FVP+ R+LTG  +GI+PL RV  GL 
Sbjct  375   MNTRITRGFKIPPASLQAIPYIMLIFVVPLYEIVFVPAARKLTGRDSGISPLQRVGTGLF  434

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
             +++ SM +AA++E KR+ +A   N           P+S+FW++ Q+ IFG+++MFT VGL
Sbjct  435   IATFSMVSAALIEQKRRNLALSSNE----------PLSIFWIAPQFLIFGLSEMFTAVGL  484

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRN  1694
             +EFFY Q+ + ++S  +   + S S G++ SS+LV VVN  T   +  GGWL  N++NR+
Sbjct  485   IEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSILVSVVNKLT-STSSRGGWLSDNDLNRD  543

Query  1695  HLELFYALLSGLSFVNFFVYLFVSKRYKYRQQIG  1796
              L+ FY LL+ LS +NFF YLF S  Y Y   + 
Sbjct  544   RLDRFYWLLAALSLINFFNYLFWSNWYSYNPSLS  577



>emb|CBI39681.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   427 bits (1098),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 256/554 (46%), Positives = 349/554 (63%), Gaps = 21/554 (4%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
              +  GG RAS+FI  +   ENM  +   V+L +Y  G+M+ +L+ AAN +TNF GAT++L
Sbjct  27    NNGKGGFRASMFIYILTSLENMGFVANMVSLFSYFYGLMHFDLSGAANTLTNFMGATFLL  86

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             ++V   ++DT + R    LI   IE LGL L+ +QA+  KL P  C       K   V G
Sbjct  87    SLVGGFVSDTLLSRLNTCLIFGTIELLGLMLMTIQAYSNKLHPADCG------KPSCVEG  140

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
               A + +V+L   A+GS GV+ A+P+ GADQF++KD  E   ++SFFNW++L   VG +V
Sbjct  141   GTAVMFYVSLCLYALGSGGVRGALPALGADQFNQKDPNEAEALASFFNWVILSATVGASV  200

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +T+ VW+     W WGF  S V  F G I   LG  FYR+    G S I + +QV V A
Sbjct  201   GVTVIVWVSSTVTWYWGFFISLVTAFIGFIVLALGRRFYRIQP-HGQSPIIRTVQVIVVA  259

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVC  1031
             I NR L  PE  GELYEI  + +        L HTD++R LDKAAI    D EP PW VC
Sbjct  260   IKNRSLSPPESPGELYEI--NDQVTDFTDPKLAHTDQFRCLDKAAILGK-DSEPRPWEVC  316

Query  1032  RVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpfl  1211
              VTQVE  KIL  ++P+   T+IM  CLAQLQTFS+ QG+ MD     SF++  SS+P +
Sbjct  317   TVTQVEEVKILTRMLPILFSTIIMNTCLAQLQTFSVHQGNEMD-RFLGSFEVPASSIPII  375

Query  1212  pilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQV  1391
             P++F+  LIP+Y+ +FVP  R++TG P GIT L RV +GL+LS++SMA A ++E+KR+  
Sbjct  376   PLVFMSILIPIYEFVFVPFARKITGHPAGITQLQRVGIGLVLSAISMAVAGLVEVKRRNE  435

Query  1392  ARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCF  1571
             A E      IP   P  IS+FWLS QY IFGIADMFT VGLLEFFY +APK ++S+S+ F
Sbjct  436   ALE------IP---PRKISLFWLSFQYGIFGIADMFTLVGLLEFFYKEAPKGMRSLSTSF  486

Query  1572  LWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFF  1748
              W S+S GYF S++ V ++N  TK +  S  GWL G+ +N+N+L LFY  L+ LS +NF 
Sbjct  487   TWVSLSFGYFLSTIFVDIINSVTKRIAPSKQGWLHGSYINKNNLNLFYYFLAILSCINFV  546

Query  1749  VYLFVSKRYKYRQQ  1790
              YL+ +  YKY+ +
Sbjct  547   NYLYWASWYKYKAE  560



>gb|AEK82130.1| dicarboxylate transporter [Datisca glomerata]
Length=547

 Score =   424 bits (1089),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 342/539 (63%), Gaps = 22/539 (4%)
 Frame = +3

Query  195   MATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLIS  374
             MA +   V+L+TY  G +N  L D+A  +TNF GA YILT+V A ++DTY+ RF   ++ 
Sbjct  1     MAFVANAVSLITYFYGYINFGLKDSATSLTNFTGAAYILTLVGAFISDTYMSRFTTCVLF  60

Query  375   AWIEFLGLGLLAMQAHYAKLKPPPCN--PLDKAEKCEEVAGRNAAILFVALYTVAMGSAG  548
             A IE LG  LL +QA   +L+P P    PL + E+ E       AIL+  LY VA+G+ G
Sbjct  61    ASIELLGYALLTVQACSQQLRPFPRMDLPLSQMEQSEPADAGQKAILYAGLYLVALGTGG  120

Query  549   VKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFA  728
             VKAA+P  GA+QFD  D KE + +SSFFNW +  + +G    +T  VW+   KGW WGF 
Sbjct  121   VKAALPILGAEQFDVNDPKEAARVSSFFNWFVFSLVIGAIFGVTFVVWISTFKGWSWGFG  180

Query  729   ASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEIS  908
               T+A+    +   +G PFY+   +   S + +I QV V ++  RKL +PE+  ELYEI 
Sbjct  181   VCTIAILLSIVMLCIGKPFYKDNSMPKESPLLRITQVIVVSVQKRKLPIPENDDELYEI-  239

Query  909   KDKEAVTICAEFLPHTDKYRFLDKAAI-------QTSWDEEPNPWRVCRVTQVENAKILL  1067
               ++ V    E L  T ++RFLD+AA+       Q +       W +C +TQVE  KIL+
Sbjct  240   --RDKVGANYEILQRTSQFRFLDRAAVVKKINGSQVATTTVNGSWSLCTITQVEETKILI  297

Query  1068  NLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplY  1247
              ++P+ L TV M  CLAQLQTFSI QG+TMD  +   F++   S+P +P++F+ F IPLY
Sbjct  298   RMLPIILSTVFMNTCLAQLQTFSIYQGTTMDPYMMG-FKVPIPSIPVIPLIFMFFFIPLY  356

Query  1248  DRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPI  1427
             DR+FVP  R++TGIPTGI  L RV +GL+LS++SMA A  +E  RK VA + +M+++   
Sbjct  357   DRIFVPIARKITGIPTGIRHLQRVGIGLVLSAISMAVAGFVETHRKNVAVQHDMVES---  413

Query  1428  LQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTS  1607
              + LP+S+FWL  QY IFG+ADMFT VGL+EFFY Q+   +KS+S+   W S++ GYFTS
Sbjct  414   REHLPMSMFWLGSQYAIFGVADMFTLVGLMEFFYEQSSASMKSLSTSISWCSLAFGYFTS  473

Query  1608  SVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             +V+V+VVN        SGGWL  +N+N++HL  FY LLS LS +NF VYL  +  Y+Y+
Sbjct  474   TVMVEVVNKV------SGGWLARDNLNKDHLNYFYWLLSLLSVINFGVYLVFASWYRYK  526



>ref|XP_006577196.1| PREDICTED: nitrate transporter 1.2-like isoform X1 [Glycine max]
 gb|KHN14200.1| Nitrate transporter 1.2 [Glycine soja]
Length=576

 Score =   424 bits (1090),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 248/566 (44%), Positives = 340/566 (60%), Gaps = 23/566 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D K + R     +   GG  AS+FI  +   +NM  +   V++V Y  GVM+ +LA +AN
Sbjct  5     DAKEEQRPLNQWRRSKGGFMASMFIFVLSALDNMGFVANMVSIVLYFYGVMHFDLASSAN  64

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              +TNF G+TY+L++V   ++DTY+ RF   L+   +E L L +L +QA    L P  C  
Sbjct  65    TLTNFMGSTYLLSLVGGFISDTYLNRFTTCLLFGSLEVLALAMLTVQAASKHLHPEACG-  123

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
                  K   V G  A + + +L  +A+G  GV+ ++ + GADQFDEKD  E   ++SFFN
Sbjct  124   -----KSSCVKGGIAVMFYTSLCLLALGMGGVRGSMTAFGADQFDEKDPTEAKALASFFN  178

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             WLLL   VG    +T  VW+   K W WGF   T+A   G +   LG  FYR+    G S
Sbjct  179   WLLLSSTVGAITGVTGVVWVSTQKAWHWGFFIITIASSVGFVTLALGKQFYRIKT-PGDS  237

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
                +I QV V +  NRKL LPE  GELYEIS DK+A    AE + HT++ RFLDKAAI  
Sbjct  238   PTLRIAQVIVVSFKNRKLSLPESHGELYEIS-DKDAT---AEKIAHTNQMRFLDKAAIIQ  293

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                 +P  W++C VTQVE  KIL  ++P+   T+I+  C+AQLQTFS+QQG+ MDL +  
Sbjct  294   E-SSKPQAWKICTVTQVEEVKILTRMLPIVASTIILNTCMAQLQTFSVQQGNVMDLKLGS  352

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
                  PS      +   + +   Y+  FVP  R++T  P+GIT L RV VGL+LS++SMA
Sbjct  353   LTVPAPSIPVIPLVFISVLVPL-YELFFVPFARKITNHPSGITQLQRVGVGLVLSAISMA  411

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
              A I+E+KR+   R+             PIS+FWLS QY IFGIADMFT VGLLEFFY +
Sbjct  412   VAGIVEVKRRDQGRKD---------PSKPISLFWLSFQYGIFGIADMFTLVGLLEFFYRE  462

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFY  1712
             +P  +KS+S+   W S SLGYF S+V V V+N  TK +T S  GWL G ++N+N+L LFY
Sbjct  463   SPASMKSLSTSLTWLSTSLGYFLSTVFVNVINAVTKRITRSKQGWLHGFDLNQNNLNLFY  522

Query  1713  ALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
               L+ LS +NFF YL+ + RY+Y+++
Sbjct  523   WFLATLSCLNFFNYLYWASRYQYKRE  548



>ref|XP_008795325.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Phoenix dactylifera]
Length=600

 Score =   424 bits (1091),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 253/573 (44%), Positives = 362/573 (63%), Gaps = 15/573 (3%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
             N Q +  L +  VDWRG++ + +KHGG+RA+ F+LGI  FE MA   +G  L+TY+   M
Sbjct  8     NFQGESVLAEFSVDWRGKSCKPNKHGGMRAAAFVLGIQAFEIMAIAAVGNNLITYVFNEM  67

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             +  L+ +AN VTNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LLA+QAH  
Sbjct  68    HFPLSKSANIVTNFVGTIFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLAVQAHLP  127

Query  429   KLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKE  608
             +L+PP CN + K E C E  G  A + F+ALY VA+GS  +K  + +HGADQF + D K+
Sbjct  128   QLRPPQCNMISKEEHCVEAKGFKATMFFIALYLVALGSGCMKPNMIAHGADQFRKDDPKQ  187

Query  609   GSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFY  788
               ++S++FN      CVG  ++LT+ VW+    G D GF+ S  AM  G I    G+ FY
Sbjct  188   SKKLSTYFNTAYFSFCVGELIALTMLVWVQTRSGMDVGFSVSAAAMAMGLISLISGILFY  247

Query  789   RVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYR  968
             R    QG S  T I +V VAAI  RK   P  S  L++  ++     +    L HTDK+R
Sbjct  248   RNKPPQG-SIFTPIARVLVAAITKRKQVCPSRSEMLHQ-RRNNAPDHLIVSGLRHTDKFR  305

Query  969   FLDKAA--IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             FLDKA   IQ   + + +PW++C +T+VE  KI+L+++P+F CT+I    LAQLQTFS+Q
Sbjct  306   FLDKACIKIQDCSNMKESPWKLCTITEVEQVKIILSVIPIFACTIIFNTVLAQLQTFSVQ  365

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS MD  +TKSF I P+SL  +P + LI L+P+YD  FVP  RRLTG  +GITPL R+ 
Sbjct  366   QGSAMDTQLTKSFHIPPASLQAIPYIMLIILVPIYDVCFVPFARRLTGKESGITPLQRIG  425

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
             VGL   + SM AAA++E KR++VA   + L          +SVFW++ Q+ IFG+++MFT
Sbjct  426   VGLCTVTFSMIAAALVEKKRREVAIGSDKL----------LSVFWIAPQFLIFGLSEMFT  475

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGLLEFFY Q+   ++S  +   + S S G+F SS+LV +VN  T   + + GWL  N+
Sbjct  476   AVGLLEFFYKQSLSGMQSFLTAMTYCSYSFGFFLSSLLVSLVNKITS-SSSNSGWLSDND  534

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             +N++ L+ FY LL+ LS +NFF YLF S+ Y +
Sbjct  535   LNKDRLDYFYWLLAALSLLNFFNYLFWSRWYSH  567



>ref|XP_006604775.1| PREDICTED: nitrate transporter 1.2-like [Glycine max]
Length=556

 Score =   423 bits (1087),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 254/564 (45%), Positives = 346/564 (61%), Gaps = 23/564 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D K + R     +   GG  AS+FI  +   +NM  +   V++V Y  GVM+ +LA +AN
Sbjct  5     DAKEEQRPLNQWRRSKGGFMASMFIFVLSALDNMGFVANMVSIVLYFYGVMHFDLASSAN  64

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              +TNF  +TY+L++V   ++DTY+ RF   L+   +E L L +L +QA    L P  C  
Sbjct  65    TLTNFMASTYLLSLVGGFISDTYLNRFTTCLLFGSLEVLALAMLTVQAASKHLHPEACG-  123

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
                  K   V G  A + + +L  +A+G  GV+ ++ + GADQFDEKD  E   ++SFFN
Sbjct  124   -----KSSCVKGGIAVMFYTSLCLLALGMGGVRGSMTAFGADQFDEKDPTEAKALASFFN  178

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             WLLL   VG    +T  VW+   K W WGF   T+A   G +   LG PFYR+    G S
Sbjct  179   WLLLSSTVGAITGVTGVVWVSTQKAWHWGFFIITIASSVGFVTLALGKPFYRIKT-PGDS  237

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
                +I QV V A  NRKL LPE  GELYEIS DKEA     E + HT++ RFLDKAAI  
Sbjct  238   PTLRIAQVIVVAFKNRKLSLPESHGELYEIS-DKEAT---EEKIAHTNQMRFLDKAAIIQ  293

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
               + +P  W+VC VTQVE  KIL  ++P+   T+I+  C+AQLQTFS+QQG+ MDL +  
Sbjct  294   E-NSKPKAWKVCTVTQVEEVKILTRVLPIVASTIILNTCMAQLQTFSVQQGNVMDLKLGS  352

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
                +   S+P +P++F+  L+PLY+  FVP  R++T  P+GIT L RV VGL+LS++SMA
Sbjct  353   -LTVPAPSIPVIPLVFISVLVPLYELFFVPFARKITHHPSGITQLQRVGVGLVLSAISMA  411

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
              A I+E+KR+   R+             PIS+FWLS QY IFGIADMFT VGLLEFFY +
Sbjct  412   VAGIVEVKRRDQGRKD---------PSKPISLFWLSFQYGIFGIADMFTLVGLLEFFYRE  462

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFY  1712
             +P  +KS+S+   W S SLGYF S+V V V+N  +K +T S  GWL G ++N+N+L LFY
Sbjct  463   SPASMKSLSTSLTWLSTSLGYFLSTVFVNVINAVSKRITPSKQGWLHGFDLNQNNLNLFY  522

Query  1713  ALLSGLSFVNFFVYLFVSKRYKYR  1784
               L+ LS +NFF YL+ + RY+Y 
Sbjct  523   WFLATLSCLNFFNYLYWASRYQYN  546



>ref|XP_003591266.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES61517.1| peptide/nitrate transporter [Medicago truncatula]
Length=606

 Score =   424 bits (1091),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 243/554 (44%), Positives = 339/554 (61%), Gaps = 23/554 (4%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             K + GG RAS+FI  +   +NM  +   V+LV Y  GVM+ +L+ +AN +TNF G+T++L
Sbjct  17    KKQKGGFRASMFIFVLSALDNMGFVTNMVSLVLYFIGVMHFDLSSSANTLTNFMGSTFLL  76

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             ++V A ++DTY+ RF   L+   +E + L ++ +QA    L P  C       K   V G
Sbjct  77    SLVGAFISDTYLNRFTTCLVFGSLEVMALVMITVQAALDNLHPKACG------KSSCVEG  130

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
               A + + +L   A+G  GV+ ++ + GA+QFDEKD  E   +++FFNWLLL   +G  +
Sbjct  131   GIAVMFYTSLCLYALGMGGVRGSLTAFGANQFDEKDPNEAKALATFFNWLLLSSTLGSVI  190

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +T  VW+   K W WGF   TVA   G +   +G PFYR+    G S I +IIQV V A
Sbjct  191   GVTGIVWVSTQKAWHWGFFIITVASSIGFVTLAIGKPFYRIKT-PGESPILRIIQVIVVA  249

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVC  1031
               NRKLQLPE + +LYE+ KD    TI  E + HT++ RFLDKAAI     E   PW+VC
Sbjct  250   FKNRKLQLPESNEQLYEVYKD---ATI--EKIVHTNQMRFLDKAAILQENSESQQPWKVC  304

Query  1032  RVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpfl  1211
              VTQVE  KIL  ++P+   T++M  CLAQLQTFS+QQG++M+L +        S     
Sbjct  305   TVTQVEEVKILTRMLPILASTIVMNTCLAQLQTFSVQQGNSMNLKLGSFTVPASSIPVIP  364

Query  1212  pilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQV  1391
              I     +   Y+  FVP +R++T  P+G+T L RV VGL+LS++SM  A  +E+KR+  
Sbjct  365   LIFLCTLIPI-YELFFVPFIRKITHHPSGVTQLQRVGVGLVLSAISMTIAGFIEVKRRDQ  423

Query  1392  ARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCF  1571
              R+             PIS+FWLS QY IFGIADMFT VGLLEFFY +AP  +KS+S+ F
Sbjct  424   GRKD---------PSKPISLFWLSFQYAIFGIADMFTLVGLLEFFYREAPSTMKSLSTSF  474

Query  1572  LWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFF  1748
              + SMSLGYF S+V V V+N  TK +T S  GWL G ++N+N+L LFY  L+ LS +NFF
Sbjct  475   TFLSMSLGYFLSTVFVNVINTVTKRITPSKQGWLQGFDLNQNNLNLFYWFLAILSCLNFF  534

Query  1749  VYLFVSKRYKYRQQ  1790
              +L+ +  YKY+ +
Sbjct  535   NFLYWASWYKYKSE  548



>ref|XP_007163280.1| hypothetical protein PHAVU_001G221300g [Phaseolus vulgaris]
 gb|ESW35274.1| hypothetical protein PHAVU_001G221300g [Phaseolus vulgaris]
Length=564

 Score =   422 bits (1086),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 248/566 (44%), Positives = 339/566 (60%), Gaps = 23/566 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D   + R     K   GG  AS+FI  +   +NM  +   V++V Y  GVM+ +LA +AN
Sbjct  5     DATEEQRPLNQWKRSKGGFMASMFIFVLSALDNMGFVANMVSIVLYFYGVMHFDLASSAN  64

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              +TNF G+TY+L++V   ++DTY+ RF   L+   +E L L +L +QA    L P  C  
Sbjct  65    TLTNFMGSTYLLSLVGGFISDTYLNRFTTCLLFGSLEVLALAMLTVQAASNHLHPEACG-  123

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
                  K   V G  A + + +L  +A+G  GV+ ++ + GADQFDEKD  E   ++SFFN
Sbjct  124   -----KSSCVKGGIAGMFYTSLCLMALGMGGVRGSMTAFGADQFDEKDPTEAKALASFFN  178

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             WLL+   VG    +T  VW+   K W WGF   T+A   G +   LG PFYR+    G S
Sbjct  179   WLLMSSTVGAITGVTGVVWVSTQKAWHWGFFIITIASSVGFVTLALGKPFYRIKT-PGDS  237

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
                +I QV V A  NRKL LPE  GELYEIS DK+A    AE + HT + R LDKAAI  
Sbjct  238   PTLRIAQVIVVAFKNRKLSLPESHGELYEIS-DKDAT---AEKIAHTSQMRILDKAAIIQ  293

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
               + +P  W+VC VTQVE  KIL  ++P+   T+I+  C+AQLQTFS+QQG+ M+L +  
Sbjct  294   E-NSKPQAWKVCTVTQVEEVKILTRMLPIVASTIILNTCMAQLQTFSVQQGNIMNLKLGS  352

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
                  PS      +   + +   Y+  FVP  R++T  P+GIT L RV VGL+LS++SMA
Sbjct  353   LTVPAPSIPVIPLVFISVLVPL-YELFFVPFARKITQHPSGITQLQRVGVGLVLSAISMA  411

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
              A I+E+KR+   R+             PIS+FWLS QY IFGIADMFT VGLLEFFY +
Sbjct  412   VAGIVEVKRRDQGRKD---------PSKPISLFWLSFQYGIFGIADMFTLVGLLEFFYRE  462

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFY  1712
             +P  +KS+S+   W S SLGYF S+V V V+N  T+ +T S  GWL G ++N+N+L LFY
Sbjct  463   SPASMKSLSTSLTWLSTSLGYFLSTVFVNVINAVTQRITPSKQGWLHGFDLNQNNLNLFY  522

Query  1713  ALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
               L+ LS +NFF YL+ + RYKY+++
Sbjct  523   WFLAALSCLNFFNYLYWASRYKYKRE  548



>ref|XP_002276071.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Vitis vinifera]
Length=736

 Score =   428 bits (1100),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 256/554 (46%), Positives = 349/554 (63%), Gaps = 21/554 (4%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
              +  GG RAS+FI  +   ENM  +   V+L +Y  G+M+ +L+ AAN +TNF GAT++L
Sbjct  137   NNGKGGFRASMFIYILTSLENMGFVANMVSLFSYFYGLMHFDLSGAANTLTNFMGATFLL  196

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             ++V   ++DT + R    LI   IE LGL L+ +QA+  KL P  C       K   V G
Sbjct  197   SLVGGFVSDTLLSRLNTCLIFGTIELLGLMLMTIQAYSNKLHPADCG------KPSCVEG  250

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
               A + +V+L   A+GS GV+ A+P+ GADQF++KD  E   ++SFFNW++L   VG +V
Sbjct  251   GTAVMFYVSLCLYALGSGGVRGALPALGADQFNQKDPNEAEALASFFNWVILSATVGASV  310

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +T+ VW+     W WGF  S V  F G I   LG  FYR+    G S I + +QV V A
Sbjct  311   GVTVIVWVSSTVTWYWGFFISLVTAFIGFIVLALGRRFYRIQP-HGQSPIIRTVQVIVVA  369

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVC  1031
             I NR L  PE  GELYEI  + +        L HTD++R LDKAAI    D EP PW VC
Sbjct  370   IKNRSLSPPESPGELYEI--NDQVTDFTDPKLAHTDQFRCLDKAAILGK-DSEPRPWEVC  426

Query  1032  RVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpfl  1211
              VTQVE  KIL  ++P+   T+IM  CLAQLQTFS+ QG+ MD     SF++  SS+P +
Sbjct  427   TVTQVEEVKILTRMLPILFSTIIMNTCLAQLQTFSVHQGNEMD-RFLGSFEVPASSIPII  485

Query  1212  pilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQV  1391
             P++F+  LIP+Y+ +FVP  R++TG P GIT L RV +GL+LS++SMA A ++E+KR+  
Sbjct  486   PLVFMSILIPIYEFVFVPFARKITGHPAGITQLQRVGIGLVLSAISMAVAGLVEVKRRNE  545

Query  1392  ARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCF  1571
             A E      IP   P  IS+FWLS QY IFGIADMFT VGLLEFFY +APK ++S+S+ F
Sbjct  546   ALE------IP---PRKISLFWLSFQYGIFGIADMFTLVGLLEFFYKEAPKGMRSLSTSF  596

Query  1572  LWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFF  1748
              W S+S GYF S++ V ++N  TK +  S  GWL G+ +N+N+L LFY  L+ LS +NF 
Sbjct  597   TWVSLSFGYFLSTIFVDIINSVTKRIAPSKQGWLHGSYINKNNLNLFYYFLAILSCINFV  656

Query  1749  VYLFVSKRYKYRQQ  1790
              YL+ +  YKY+ +
Sbjct  657   NYLYWASWYKYKAE  670



>ref|XP_007019707.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY16932.1| Major facilitator superfamily protein [Theobroma cacao]
Length=593

 Score =   423 bits (1087),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 244/563 (43%), Positives = 353/563 (63%), Gaps = 16/563 (3%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             +++  VDWRGR  + +KHGG+ A++F+LG+  FE MA   +G  L+TY+   M+  L+ +
Sbjct  11    VMELSVDWRGRPCKANKHGGMTAAVFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKS  70

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTNF G  ++L++V   L+D+Y+G F  +LI  ++E  G  LL +QAH  +L+PP C
Sbjct  71    ANIVTNFIGTVFLLSLVGGFLSDSYLGSFWTMLIFGFVELSGFILLCIQAHLPQLRPPHC  130

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             + +   E C E  G  A I F+ALY VA+GS  +K  + S GADQF   D ++   +S++
Sbjct  131   DMVSDGENCLEAKGSKALIFFLALYVVALGSGCLKPNIVSLGADQFRRGDTEQSRRLSTY  190

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN      C+G  ++LTL VW+  H G D GF  S  AM  G I    G   YR    +G
Sbjct  191   FNIAYFAFCMGELIALTLLVWVQTHSGMDVGFGVSAAAMAMGMISLISGTLLYRNKPPRG  250

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
              S  T I QVFVAAI  RK   P +   L+       A +     L HT+K+RFLDKA I
Sbjct  251   -SIFTPIAQVFVAAITKRKQICPSNVQMLHGSQNQVPATSANVSNLLHTEKFRFLDKACI  309

Query  990   QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNI  1169
             +    E+ +PWR+C VTQVE  KI++++VP+F CT+I    LAQLQTFS+QQGS M+  I
Sbjct  310   KIQDGEKESPWRLCTVTQVEQVKIIISVVPIFACTIIFNTILAQLQTFSVQQGSAMNTQI  369

Query  1170  TKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssls  1349
              K F+I P+SL  +P + LIF++PLY+ +FVP  R++TG  +GITPL RV +GL +++ S
Sbjct  370   AKGFKIPPASLQSIPYIMLIFVVPLYETVFVPVARKVTGRSSGITPLQRVGIGLFIATFS  429

Query  1350  maaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFY  1529
             M AAA++E KR+ ++ E              +S+FW++ Q+ IFG+++MFT VGL+EFFY
Sbjct  430   MVAAALVEKKRR-ISDET-------------VSIFWIAPQFLIFGLSEMFTAVGLIEFFY  475

Query  1530  SQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELF  1709
              Q+ + ++S  +   + S S G++ SS+LV +VN  T   + S GWL  N++N++ L+LF
Sbjct  476   KQSLEGMQSFLTAMTYCSYSFGFYLSSILVSLVNRITSASSHS-GWLSDNDLNKDRLDLF  534

Query  1710  YALLSGLSFVNFFVYLFVSKRYK  1778
             Y +L+GLS VNFF YLF S  Y 
Sbjct  535   YWMLAGLSLVNFFNYLFWSSYYS  557



>ref|XP_003529696.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Glycine max]
 gb|KHN40200.1| Putative peptide/nitrate transporter [Glycine soja]
Length=567

 Score =   422 bits (1084),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 246/559 (44%), Positives = 346/559 (62%), Gaps = 22/559 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             DWRGR +   KHGG+  + F+LG+  FE MA   +G  L+TY+   M+  L+ AAN VTN
Sbjct  12    DWRGRPSNPAKHGGMIPAAFVLGLQAFEIMAIAAVGNNLITYVTSEMHFPLSKAANLVTN  71

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKA  467
             F G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPPPCN  D  
Sbjct  72    FVGTIFLLALLGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHVPQLKPPPCNINDLG  131

Query  468   EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLL  647
             E+C E  G  A I FVALY VA+GS  VK  + ++G DQFD+ + K+  ++S++FN    
Sbjct  132   EQCSEAKGMKAMIFFVALYLVALGSGCVKPNMVAYGGDQFDQDNPKQLKKLSTYFNAAYF  191

Query  648   GVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQ  827
                +G  VSLT+ VW+  H G D GF  S   M  G I    G  +YR    QG S +T 
Sbjct  192   AFSLGELVSLTILVWVQTHSGMDVGFGVSAAVMAMGLISLICGTLYYRNKPPQG-SILTP  250

Query  828   IIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD-  1004
             I QV VAAI  R L LP +   L+    +          L HTDK+RFLDKA I+   + 
Sbjct  251   IAQVLVAAIFKRNLLLPSNPQMLHGTQNN----------LIHTDKFRFLDKACIRVEQEG  300

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
              + + WR+C V QVE  KILL+++P+F CT++    LAQLQTFS+QQG  MD ++TKSF 
Sbjct  301   NQESAWRLCSVAQVEQVKILLSVIPIFSCTIVFNTILAQLQTFSVQQGRAMDTHLTKSFN  360

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I P+SL  +P + LI L+PLYD  FVP  R+ TG  +GI PL R+  GL L++ SM AAA
Sbjct  361   IPPASLQSIPYILLIVLVPLYDTFFVPFARKFTGHESGIPPLRRIGFGLFLATFSMVAAA  420

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             +LE KR+  A   + +          +S+FW++ QY IFG+++MFT +GLLEFFY Q+ K
Sbjct  421   LLEKKRRDEAVNHDKV----------LSIFWITPQYLIFGLSEMFTAIGLLEFFYKQSLK  470

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLS  1724
              +++  +   + S S G++ S++LV +VN  T   + + GWL  NN+N++ L+LFY LL+
Sbjct  471   GMQAFLTAITYCSYSFGFYLSTLLVSLVNKITSTSSSAAGWLHNNNLNQDRLDLFYWLLA  530

Query  1725  GLSFVNFFVYLFVSKRYKY  1781
              LSF+NF  YLF S+RY +
Sbjct  531   VLSFLNFLNYLFWSRRYSH  549



>emb|CDX93764.1| BnaA09g23640D [Brassica napus]
Length=600

 Score =   422 bits (1084),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 256/561 (46%), Positives = 355/561 (63%), Gaps = 20/561 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VD+RGR  R+DKHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ AAN VT
Sbjct  26    VDFRGRPCRQDKHGGTRAALFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKAANLVT  85

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L+++   L+D+Y+G FR +L+   IE  G  LL++QAH  +L+PP CN  + 
Sbjct  86    NFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGVIEISGFILLSVQAHLPQLRPPECNMKNT  145

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
                C E  G  AA L+ AL  VA+GS  +K  + SHGADQF  KD +   ++SSFFN   
Sbjct  146   TTHCLEANGYKAATLYAALCLVALGSGCLKPNIISHGADQFQRKDLR---KLSSFFNAAY  202

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G  ++LTL VW+  H G D GF  S   M  G I    G  FYR    +G S  T
Sbjct  203   FAFSMGQLIALTLLVWVQTHSGMDIGFGVSAAVMAAGMISLAAGTNFYRNKPPRG-SIFT  261

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD  1004
              I QVFVAAI  RK   P +   L++ S D   V    + L HT+K+RFLDKA I+T   
Sbjct  262   PISQVFVAAITKRKQICPSNPNTLHQPSTDLVGV----KPLLHTNKFRFLDKACIKTQGK  317

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
                +PWR+C V QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+MD +IT +FQ
Sbjct  318   AMESPWRLCTVEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMDTHITTTFQ  377

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I P+SL  +P + LIF++PLY+  FVP  R+LTG  +GI+PL R+  GL L++ SM AAA
Sbjct  378   IPPASLQAIPYIILIFVVPLYETFFVPLARKLTGNDSGISPLQRIGTGLFLATFSMVAAA  437

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             ++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT VGL+EFFY Q+ +
Sbjct  438   LVEKKRRESFLEQN----------VTLSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQSSQ  487

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGNNVNRNHLELFYAL  1718
              ++S  +   + S S G++ SSVLV  VN  T   G     GWLG N++N++ L+LFY L
Sbjct  488   SMQSFLTAMTYCSYSFGFYLSSVLVSAVNKVTSSNGSGTREGWLGDNDLNKDRLDLFYWL  547

Query  1719  LSGLSFVNFFVYLFVSKRYKY  1781
             L+ LSFVNFF YLF S+ Y +
Sbjct  548   LASLSFVNFFNYLFWSRWYSF  568



>ref|XP_009114795.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 [Brassica rapa]
Length=600

 Score =   421 bits (1083),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 255/561 (45%), Positives = 356/561 (63%), Gaps = 20/561 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VD+RGR  R+DKHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ AAN VT
Sbjct  26    VDFRGRPCRQDKHGGTRAALFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKAANLVT  85

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L+++   L+D+Y+G FR +L+   IE  G  LL++QAH  +L+PP CN  + 
Sbjct  86    NFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGVIEISGFILLSVQAHLPQLRPPECNMKNT  145

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
                C E  G  AA L+ AL  VA+GS  +K  + SHGADQF  KD +   ++SSFFN   
Sbjct  146   TTHCLEANGYKAATLYAALCLVALGSGCLKPNIISHGADQFQRKDLR---KLSSFFNAAY  202

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G  ++LTL VW+  H G D GF  S   M  G I    G  FYR    +G S  T
Sbjct  203   FAFSMGQLIALTLLVWVQTHSGMDIGFGVSAAVMAAGMISLAAGTNFYRNKPPRG-SIFT  261

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD  1004
              I QVFVAAI  RK   P +   L++ S D   V    + L HT+K+RFLDKA+I+T   
Sbjct  262   PIAQVFVAAITKRKQICPSNPNTLHQPSTDLVGV----KPLLHTNKFRFLDKASIKTQGK  317

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
                +PWR+C V QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+MD +IT +FQ
Sbjct  318   AMESPWRLCTVEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMDTHITTTFQ  377

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I P+SL  +P + LIF++PLY+  FVP  R+L+G  +GI+PL R+  GL L++ SM AAA
Sbjct  378   IPPASLQAIPYIILIFVVPLYETFFVPLARKLSGNDSGISPLQRIGTGLFLATFSMVAAA  437

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             ++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT VGL+EFFY Q+ +
Sbjct  438   LVEKKRRESFLEQN----------VTLSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQSSQ  487

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATK--GMTESGGWLGGNNVNRNHLELFYAL  1718
              ++S  +   + S S G++ SSVLV  VN  T   G     GWLG N++N++ L+LFY L
Sbjct  488   SMQSFLTAMTYCSYSFGFYLSSVLVSAVNKVTSSHGSGTREGWLGDNDLNKDRLDLFYWL  547

Query  1719  LSGLSFVNFFVYLFVSKRYKY  1781
             L+ LSFVNFF YLF S+ Y +
Sbjct  548   LASLSFVNFFNYLFWSRWYSF  568



>ref|XP_011087574.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Sesamum indicum]
Length=597

 Score =   421 bits (1083),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 256/565 (45%), Positives = 362/565 (64%), Gaps = 28/565 (5%)
 Frame = +3

Query  114   RGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFA  293
             R  T +    GG+RA+ FI  +   ENM  +   V+LV Y +  M  +L++AAN +TN  
Sbjct  11    RVNTPKFKGKGGLRATSFIYALVALENMGFVANMVSLVLYFSYKMYFDLSNAANTLTNLM  70

Query  294   GATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEK  473
             G+T++L+IV   ++DTYI RF   LI   IE   L ++ +QAH + L P PC        
Sbjct  71    GSTFLLSIVGGFISDTYINRFHTCLIFGTIEVSALTMMTIQAHNSSLLPLPCG----KPN  126

Query  474   CEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGV  653
             C ++ G  A   + +L  +A+G  GV+ ++P+ GADQFD KD KE   ++S+FNWLLL  
Sbjct  127   C-KLEGGMAVYFYASLCLLALGVGGVRGSLPALGADQFDAKDPKEAKGLASYFNWLLLST  185

Query  654   CVGGAVSLTLFVWLIQHK---GWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
               GG V +T+ VW+  +K    W  GF  +TV  F G IF  +G PFYR+  I   S + 
Sbjct  186   VSGGTVGVTVIVWVATNKNNQNWWKGFVITTVGAFVGFIFLAVGKPFYRLQ-IPKDSPLV  244

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEIS-KDKEAVTICAEFLPHTDKYRFLDKAAIQTSW  1001
             ++ QV V AI NR+L  PE   ELYE++ KD E+++  A    HT+++R+LDKAAI    
Sbjct  245   RVAQVIVVAIKNRRLPHPESPSELYEVNDKDPESISKIA----HTEQFRWLDKAAILPQ-  299

Query  1002  DEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsf  1181
             + +P+ W+VC VTQVE  K+L  ++P+   T+IM  C+AQLQTFS+QQG  MD  +   F
Sbjct  300   NTQPSEWKVCTVTQVEEVKVLTRMLPIIASTIIMNTCMAQLQTFSVQQGYRMDPYLGS-F  358

Query  1182  qilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaa  1361
             Q+  +S+P +P++F++ LIP+YDR+FVP  R+ T  P+GIT L RV VGL+LS+LSM+ A
Sbjct  359   QVPAASIPVIPLVFMVILIPIYDRVFVPFARKFTKHPSGITQLQRVGVGLVLSALSMSIA  418

Query  1362  ailelKRKQVARERNMLDAIPILQPL-PISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             A++E+KR+  + +           PL PIS+FWLS QY +FGIADMFT VGLLEFFY +A
Sbjct  419   ALVEVKRRHQSLK----------NPLKPISLFWLSFQYGVFGIADMFTLVGLLEFFYKEA  468

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYA  1715
             P  +KS+S+ F W S++ GYF SSVLV  +N  TK +T S  GWL G +++RN+L LFY 
Sbjct  469   PAGMKSLSTSFTWISLAFGYFLSSVLVDAINSVTKSITPSKQGWLHGQDLDRNNLNLFYW  528

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              L+ LS VNFF YL+ +  YKY++ 
Sbjct  529   FLAILSVVNFFHYLYWAVWYKYKKD  553



>ref|XP_004230414.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 [Solanum lycopersicum]
Length=606

 Score =   421 bits (1082),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 251/564 (45%), Positives = 353/564 (63%), Gaps = 17/564 (3%)
 Frame = +3

Query  102   KVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHV  281
              VDWRGR +   KHGG++A+ F+LG+ GFE M    +G  L+TY+   M+ +L+++AN V
Sbjct  27    SVDWRGRPSNPIKHGGMKAAAFVLGLQGFEIMGIAAVGNNLITYVINEMHFSLSESANIV  86

Query  282   TNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLD  461
             TNF G  +IL+++   L+D+Y+  F  +LI  +IE  G  LL++QAH  +LKPP CN L 
Sbjct  87    TNFIGTIFILSLLGGYLSDSYLASFWTILIFGFIELSGFILLSVQAHLPQLKPPKCNMLT  146

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
               EKC E  G  A I FVALY VA+GS  VK  + +HG DQFD+++ K+  ++S +FN  
Sbjct  147   DGEKCVEAKGFKALIFFVALYLVALGSGCVKPNMIAHGGDQFDQENPKQSKQLSRYFNAA  206

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
                  +G  ++LT+ V++  H G D GF  S  AM  G I    G  FYR    QG S  
Sbjct  207   YFAFSMGELIALTILVYVQTHSGMDVGFGVSAAAMALGLICLVCGTLFYRNKPPQG-SIF  265

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEF-LPHTDKYRFLDKAAIQT-  995
             T I QV VAA  NRKL  P D+  L++    K          L HT+++RFLDKA  +  
Sbjct  266   TPIAQVMVAAFLNRKLVSPSDAHMLHKAHPTKAPPNANPTINLLHTNRFRFLDKACTKMQ  325

Query  996   --SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNI  1169
               +  +E + WR+C VTQVE  KIL++++P+F CT+I    LAQLQTFS+QQGSTM+  +
Sbjct  326   DGNTTKEISRWRLCTVTQVEQVKILISVLPIFACTIIFNTILAQLQTFSVQQGSTMNTKL  385

Query  1170  TKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssls  1349
             TK+F I P+SL  +P + LIF++PLYD  FVP  R+ TG  +GITPL R+  GL  ++ S
Sbjct  386   TKNFHIPPASLQSIPYIMLIFIVPLYDTFFVPFARKFTGHESGITPLQRIGFGLFFATFS  445

Query  1350  maaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFY  1529
             M +AA++E KR+  A E N +          +S+FW++ Q+ IFGI++MFT VGL+EFFY
Sbjct  446   MVSAALMENKRRISAMESNEI----------LSIFWITPQFLIFGISEMFTAVGLIEFFY  495

Query  1530  SQAPK-ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLEL  1706
              Q+ K  ++S  +   + S S G++ SS+LV +VN  T      GGWL  NN+N++ L+L
Sbjct  496   KQSLKGSMQSFLTAITYCSYSFGFYLSSLLVSLVNKITSSH-HGGGWLSDNNLNKDRLDL  554

Query  1707  FYALLSGLSFVNFFVYLFVSKRYK  1778
             FY LL+ LS +NFF YLF +K Y 
Sbjct  555   FYWLLAILSLLNFFNYLFWAKWYS  578



>ref|XP_008339431.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Malus domestica]
Length=612

 Score =   421 bits (1083),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 257/577 (45%), Positives = 356/577 (62%), Gaps = 21/577 (4%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             IN+ +  E  +  VDWRGR +   KHGG+RA+ F+LG+  FE M    +G  L+TY+   
Sbjct  15    INTSDMAE--EMTVDWRGRPSNPTKHGGMRAAAFVLGLQSFEIMGIAAVGNNLITYVINE  72

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+++AN VTNF G  ++L +V   L+D+Y+G F  +LI  ++E  G  LL++QAH 
Sbjct  73    MHFPLSNSANVVTNFIGTVFLLALVGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHV  132

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPPPCN ++  E+C E  G  + I FVALY VA+GS  VK  + +HGADQF+  D K
Sbjct  133   PQLKPPPCNVIN-GEECVEAKGFKSLIFFVALYLVALGSGCVKPNMIAHGADQFNPDDPK  191

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +  ++S++FN       +G  V+LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  192   QYKKLSTYFNAAYFAFSMGELVALTLLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLY  251

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPED----SGELYEISKDKEAVTICAEFLPH  953
             YR    QG S +T I QVFVAA+  RK   P +     G    +  D       A    H
Sbjct  252   YRNKRPQG-SILTPIAQVFVAAMLKRKQVCPSNPQLLHGNQNNVLHDNTTFFSDAAGFLH  310

Query  954   TDKYRFLDKAA--IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             T+K+RFLDKA   IQ   + + +PW +C VTQV+  KILL+++P+F  T+I    LAQLQ
Sbjct  311   TEKFRFLDKACIKIQGGTNSKESPWTLCTVTQVKQVKILLSVIPIFASTIIFNTILAQLQ  370

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFS+QQGS MD  +TKSF I P+SL  +P + LI L+PLYD  FVP  R+ TG  +GI+P
Sbjct  371   TFSVQQGSMMDTKLTKSFHIPPASLQSIPYIILIALVPLYDTFFVPFARKFTGHNSGISP  430

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+  GL  ++ SM AAAI+E KR+  A   N +          IS+FW++ Q+ IFG+
Sbjct  431   LMRIGFGLFFATFSMIAAAIMEEKRRDAAVHSNKI----------ISIFWITPQFLIFGL  480

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ++MFT VGL+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T   +  GGW
Sbjct  481   SEMFTAVGLVEFFYKQSLKGMQAFLTALTYCSYSFGFYLSSLLVSLVNKITTS-SGGGGW  539

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             LG NN+NR+ L+LFY LL+GLSF+NF  YLF S  Y 
Sbjct  540   LGDNNLNRDRLDLFYWLLAGLSFLNFLNYLFWSHWYS  576



>ref|XP_010912660.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Elaeis guineensis]
Length=601

 Score =   419 bits (1078),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 252/564 (45%), Positives = 357/564 (63%), Gaps = 16/564 (3%)
 Frame = +3

Query  93    IDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAA  272
             ++  VDWRGR+ + +KHGG+RA++F+LGI  FE MA   +G  L+TY+   M+ +L+ +A
Sbjct  15    VEFSVDWRGRSCKPNKHGGMRAAVFVLGIQAFEIMAIAAVGNNLITYVFNEMHFSLSKSA  74

Query  273   NHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN  452
             N VTNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LLA+QAH  +L+PP CN
Sbjct  75    NIVTNFVGTIFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLAIQAHLPQLRPPQCN  134

Query  453   PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFF  632
              + K E C E  G  A I F+ALY VA+GS  +K  + +HGADQF + D K+  ++S++F
Sbjct  135   MMSKEEHCVEAQGFKAIIFFIALYLVALGSGCMKPNMIAHGADQFRKDDPKQSKKLSTYF  194

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N      CVG  ++LTL VW+    G D GF  S  AM  G I    GL FYR    Q +
Sbjct  195   NTAYFSFCVGELIALTLLVWVQTRSGMDVGFGLSATAMAMGLISLVSGLIFYRNKPPQ-A  253

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA--  986
             S  T I +VFVAAI  RK   P  S  L++   +     I +  L  TDK+RFLDKA   
Sbjct  254   SIFTPIARVFVAAIAKRKQVCPSSSEMLHQRRNNAPGHLIVSG-LQRTDKFRFLDKACIK  312

Query  987   IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLN  1166
             IQ     + +PW++C VT+VE  KI+L+++P+F CT+I    LAQLQTFS+QQGSTM+  
Sbjct  313   IQDGSGMKESPWKLCTVTEVEQVKIILSVIPIFACTIIFNTVLAQLQTFSVQQGSTMNTQ  372

Query  1167  -ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              ITKSF I P+SL  +P + LI L+P+YD  FVP  RRLTG  +GITPL R+ +GL   +
Sbjct  373   LITKSFHIPPASLQSIPYIMLIVLVPIYDMCFVPLARRLTGKESGITPLQRLGIGLCTVT  432

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM  AA++E KR++VA   N L          +S+FW++ Q+ IFG+++MFT VGL+EF
Sbjct  433   FSMVVAALVEKKRREVAIGSNKL----------LSIFWIAPQFLIFGVSEMFTAVGLIEF  482

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+   ++S  +   + S S G+F SS+LV +VN  T   +   GWL  N++N++ L+
Sbjct  483   FYKQSLYGMQSFLTAMTYCSYSFGFFLSSLLVSLVNKITS-SSSKSGWLSDNDLNKDRLD  541

Query  1704  LFYALLSGLSFVNFFVYLFVSKRY  1775
              FY LL+ LS +NFF YL+ S+ Y
Sbjct  542   YFYWLLAALSLLNFFNYLYWSRWY  565



>ref|XP_003626123.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|ABD33180.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES82341.1| peptide/nitrate transporter [Medicago truncatula]
Length=585

 Score =   419 bits (1077),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 248/573 (43%), Positives = 340/573 (59%), Gaps = 29/573 (5%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QE+ E +    +W      K K GG RAS+FI  +   +NM  +   V+LV Y  GVM+ 
Sbjct  4     QEETEELKLLTEW------KRKKGGFRASMFIFVLSALDNMGFVANMVSLVLYFYGVMHF  57

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             ++  +AN +TNF G+T++L++V   ++DTY+ RF   L+   +E L L L+  QA    L
Sbjct  58    DIPSSANTLTNFMGSTFLLSLVGGFISDTYLNRFTTCLLFGSLEVLALALVTFQAASDHL  117

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
              P  C       K   V G    + + +L  +A+G  GV+ ++ + GADQF+EKD  E  
Sbjct  118   HPNACG------KSSCVKGGIEFMFYTSLSLLALGIGGVRGSMTAFGADQFEEKDSNEAK  171

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
              ++SFFNWLLL   +G    +T  VW+   + W WGF   T+A   G +   LG PFYR+
Sbjct  172   ALASFFNWLLLSSTLGAITGVTGVVWVSTQRAWHWGFFIITIASSIGFVTLALGKPFYRI  231

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
                 G S   +I QV V A  NRKL LPE   ELYEIS DK+      E + HT + RFL
Sbjct  232   KT-PGDSPTIRIAQVIVVAFKNRKLSLPESHEELYEIS-DKDG---TVEKIVHTKQMRFL  286

Query  975   DKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
             DKAAI   + + P PW+VC VTQVE  KIL  ++P+   T+IM  CLAQLQTFS+QQG+ 
Sbjct  287   DKAAIPQEYIK-PQPWKVCTVTQVEEVKILTRMLPIVASTIIMNTCLAQLQTFSVQQGNV  345

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             M+L +        S      I   I +   Y+  FVP  R++T  P+GIT L RV VGL+
Sbjct  346   MNLKLGSFTVPASSIPVIPLIFISILVPI-YELFFVPFARKITNHPSGITQLQRVGVGLV  404

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
             LS +SM  A I+E+KR+  +R+             PIS+FWLS QY IFGIADMFT VGL
Sbjct  405   LSVISMTVAGIVEVKRRDQSRKN---------PSNPISLFWLSFQYGIFGIADMFTLVGL  455

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNR  1691
             LEFFY ++P  +KS+S+ F W SMS+GYF S+V V ++N  TK +T S  GWL G ++N+
Sbjct  456   LEFFYRESPSSMKSLSTSFTWLSMSIGYFLSTVFVNLINVVTKRITPSKQGWLHGFDLNQ  515

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             ++L LFY  L+ LS +NFF YL+ + RYKY+ +
Sbjct  516   SNLNLFYWFLAILSCLNFFNYLYWASRYKYKSE  548



>ref|XP_010548417.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 isoform X2 [Tarenaya 
hassleriana]
Length=595

 Score =   419 bits (1076),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 251/560 (45%), Positives = 348/560 (62%), Gaps = 15/560 (3%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRG+ +  DKHGG+RA+ F+LG+  FE M    +G  L+TY+   M+  L++AAN VT
Sbjct  31    VDWRGKPSDPDKHGGMRAAFFVLGLQAFEIMGIAAVGNNLITYVINEMHFPLSEAANIVT  90

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  +IL ++   LADT++G F  +LI  ++E  G  LL++QAH  +LKPP CNP+  
Sbjct  91    NFVGTIFILALLGGYLADTFLGSFWTILIFGFVELSGFILLSVQAHLPQLKPPKCNPMMA  150

Query  465   AEK--CEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNW  638
             AE+  CEE  G  A I FVA+Y VA+GS  VK  + +HGADQF     K+   +SS+FN+
Sbjct  151   AEQNSCEEAKGFKAMIFFVAIYLVALGSGCVKPNMIAHGADQFPRAHPKQSKRLSSYFNF  210

Query  639   LLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSA  818
               L   +G  V+LTL VW+  H G D GF  S   M  G +    G  +YR       S 
Sbjct  211   AYLAFSIGELVALTLLVWVQTHSGMDVGFGVSAAVMAMGLVSLVAGTMYYRNKR-PSRST  269

Query  819   ITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT-  995
              T I QV VAA+  RKL  P D   L+        V     F P+T ++RFLDKA I+T 
Sbjct  270   FTPIAQVIVAAMLKRKLVCPSDPRMLHGSLHLSNGVVPSPTF-PYTPRFRFLDKACIRTQ  328

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
               + + + WR+C VTQVE  K L++LVP+F CT+I    LAQLQTFS+QQGS+MD ++T 
Sbjct  329   DGNTKESSWRLCTVTQVEQVKTLISLVPIFACTIIFNTILAQLQTFSVQQGSSMDTHLTN  388

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             SF+I P+SL  +P + LIFL+P+YD  FVP  R++TG  +G+ PL R+ +GL LS+ SM 
Sbjct  389   SFRIPPASLQSIPYIMLIFLVPIYDSFFVPFARKITGHDSGLPPLARIGIGLFLSTFSMV  448

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             +AA+LE KR+  A          I     +S+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  449   SAALLEKKRRDTA----------IFDGKTLSIFWITPQFLIFGLSEMFTAVGLIEFFYKQ  498

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYA  1715
             + K +++      + S S G++ SSVLV VVN  T     + GWL  N++N++ L+LFY 
Sbjct  499   SVKGMEAFLMALTYCSYSFGFYLSSVLVSVVNKVTSSSRNAEGWLSENDLNKDRLDLFYW  558

Query  1716  LLSGLSFVNFFVYLFVSKRY  1775
             LL+ LS +NF  YLF S+ Y
Sbjct  559   LLAVLSLLNFVNYLFWSRWY  578



>emb|CDY50182.1| BnaCnng18870D [Brassica napus]
Length=588

 Score =   418 bits (1074),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 255/574 (44%), Positives = 360/574 (63%), Gaps = 20/574 (3%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             +N  +K +  +    +RGR  R+DKHGG RA++F+LG+  FE MA   +G  L+TY+   
Sbjct  1     MNRSKKNQSRNHITYFRGRPCRQDKHGGTRAALFVLGLQAFEMMAIAAVGNNLITYVFNE  60

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M++ L+ AAN VTNF G  ++L+++   L+D+Y+  FR +L+   IE  G  LL++QAH 
Sbjct  61    MHLPLSKAANLVTNFIGTVFLLSLLGGFLSDSYLESFRTMLVFGVIEISGFILLSVQAHL  120

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +L+PP CN  +    C E  G  AA L+ AL  VA+GS  +K  + SHGADQF  KD +
Sbjct  121   PQLRPPECNMKNTTTHCLEANGYKAATLYAALCLVALGSGCLKPNIISHGADQFQRKDLR  180

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
                ++SSFFN       +G  ++LTL VW+  H G D GF  S   M  G I    G  F
Sbjct  181   ---KLSSFFNAAYFAFSMGQLIALTLLVWVQTHSGMDIGFGVSAAVMAAGMISLAAGTNF  237

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             YR    +G S  T I QVFVAAI  RK   P +   L++ S D   V    + L H++K+
Sbjct  238   YRNKPPRG-SIFTPIAQVFVAAITKRKQICPSNPNTLHQPSTDLVGV----KPLLHSNKF  292

Query  966   RFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQ  1145
             RFLDKA I+T      +PWR+C V QV   KILL+++P+F CT+I    LAQLQTFS+QQ
Sbjct  293   RFLDKACIKTQGKARESPWRLCTVEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQ  352

Query  1146  GSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAV  1325
             GS+MD +ITK+FQI P+SL  +P + LIF++PLY+  FVP  R+LTG  +GI+PL R+  
Sbjct  353   GSSMDTHITKTFQIPPASLQAIPYIILIFVVPLYETFFVPLARKLTGNDSGISPLQRIGT  412

Query  1326  GlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTY  1505
             GL L++ SM AAA++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT 
Sbjct  413   GLFLATFSMVAAALVEKKRRESFLEQN----------VTLSIFWIAPQFLIFGLSEMFTA  462

Query  1506  VGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGN  1679
             VGL+EFFY Q+ + ++S  +   + S S G++ SSVLV  VN  T   G     GWLG N
Sbjct  463   VGLVEFFYKQSSQSMQSFLTAMTYCSYSFGFYLSSVLVSTVNKVTSSNGSWTREGWLGDN  522

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             ++N++ L+LFY LL+ LSFVNFF YLF S+ Y +
Sbjct  523   DLNKDRLDLFYWLLASLSFVNFFNYLFWSRWYSF  556



>gb|KDP42512.1| hypothetical protein JCGZ_00309 [Jatropha curcas]
Length=615

 Score =   419 bits (1076),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 245/570 (43%), Positives = 357/570 (63%), Gaps = 19/570 (3%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             +DWRGR +  +KHGG+RA+ F+LG+  FE M    +G  L+TY+   M+ +L+ +AN VT
Sbjct  27    IDWRGRPSNPNKHGGMRAATFVLGLQAFEIMGIAAVGNNLITYVMNEMHFSLSRSANIVT  86

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  +IL +    L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN ++ 
Sbjct  87    NFVGTVFILALFGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPQCN-INV  145

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
                CEE  G  A I FVALY VA+GS  VK  + +HGADQF++ ++K+  ++S++FN   
Sbjct  146   EHNCEEAKGFKALIFFVALYLVALGSGCVKPNMIAHGADQFNQNNQKQSKKLSTYFNAAY  205

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G  ++LT+ VW+  H G D GF  S  AM  G I    G  +YR    QG S  T
Sbjct  206   FAFSMGELIALTVLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLYYRNKPPQG-SIFT  264

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISK---DKEAVTICAEF--LPHTDKYRFLDKAA-  986
              I QVFVAAI  RK   P +   L+       +   + I ++   L HT ++RFLDKA  
Sbjct  265   PIAQVFVAAILKRKQICPSNPEMLHGSQNNMPNNNIIGISSDSGKLVHTQRFRFLDKACI  324

Query  987   -IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
              IQ   + + +PWR+C +TQVE  KIL++++P+F CT+I    LAQLQTFS+QQGS+MD 
Sbjct  325   KIQDGSNTKESPWRLCTITQVEQVKILISVIPIFACTIIFNTILAQLQTFSVQQGSSMDT  384

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
             ++TKSF+I P+SL  +P + LI ++PLYD  FVP  R+ TG  +GITPL R+  GL  ++
Sbjct  385   HLTKSFKIPPASLQSIPYIILIIVVPLYDTFFVPFARKFTGHESGITPLQRIGTGLFFAT  444

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM AAAI+E KR+  A + N +          IS+FW++ Q+ IFG+++M T VGL+EF
Sbjct  445   FSMVAAAIMEKKRRDEAVDSNKI----------ISIFWITPQFLIFGLSEMLTAVGLIEF  494

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ K +++  +   + S S G++ SS+LV +VN  +   +   GWL  NN+N++ L+
Sbjct  495   FYKQSLKGMQAFLTAITYCSYSFGFYLSSLLVSLVNKISSSSSTKKGWLSDNNLNKDRLD  554

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             LFY LL+ LSF+NF  YLF ++ Y Y   +
Sbjct  555   LFYWLLAVLSFLNFLNYLFWARWYSYNPSL  584



>ref|XP_002265350.3| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Vitis vinifera]
Length=609

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 249/570 (44%), Positives = 360/570 (63%), Gaps = 14/570 (2%)
 Frame = +3

Query  93    IDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAA  272
             +   VDWRGR  + +KHGG+ A+IF+LG+  FE MA   +G  L+TY+   M+  L+ +A
Sbjct  20    VKTSVDWRGRPCKANKHGGMTAAIFVLGLQAFEMMAIAAVGNNLITYVFNDMHFPLSKSA  79

Query  273   NHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN  452
             N VTNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +L+P  C 
Sbjct  80    NIVTNFIGTVFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLRPAHCT  139

Query  453   PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFF  632
              +   + C E  G  A I F+ALY VA+GS  +K  + SHGADQF ++D K+  ++SS+F
Sbjct  140   MVLDEDNCSEAKGYKALIFFLALYLVALGSGCLKPNIISHGADQFRKEDSKQSKKLSSYF  199

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N      C+G  V+LT+ VW+  H G D GF  S  AM  G I    G   Y     +G 
Sbjct  200   NAAYFAFCMGELVALTVLVWVQTHSGMDVGFGVSAAAMAMGLISLISGTLVYMNKPPRG-  258

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTIC-AEFLPHTDKYRFLDKAAI  989
             S  T I QVFVAAI  RK   P +SG L+     ++A+       L HT+K+RFLDKA I
Sbjct  259   SIFTPIAQVFVAAITKRKQICPSNSGMLHGSQLPEQALASSNVRNLLHTEKFRFLDKACI  318

Query  990   --QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
               Q       +PWR+C VTQVE  KI++++VP+F CT+I    LAQLQTFS+QQGS M+ 
Sbjct  319   KVQDGTQTSESPWRLCTVTQVEQVKIIISVVPIFACTIIFNTILAQLQTFSVQQGSAMNT  378

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              + K FQI P+SL  +P L LIFL+PLY+ +FVP  R++TG  +GI+PL R+ +GL +++
Sbjct  379   RLIKGFQIPPASLQSIPYLMLIFLVPLYETVFVPIARKITGRDSGISPLQRIGIGLFVAT  438

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
             LSM +AA++E KR+  A + N +          +S+FW++ Q+ IFG+++MFT VGL+EF
Sbjct  439   LSMVSAALVEKKRRTSALDSNRI----------LSIFWIAPQFLIFGLSEMFTAVGLIEF  488

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ + ++S  +   + S S G+F SS+LV +VN  T   + S GWLG N++N++ L+
Sbjct  489   FYKQSVEGMQSFLTAMTYCSYSFGFFLSSLLVSLVNRITSSHSSSRGWLGDNDLNKDRLD  548

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             LFY LL+ LS +NFF YLF S+ Y Y   +
Sbjct  549   LFYWLLAALSLINFFNYLFWSRWYSYNPSL  578



>ref|XP_004495820.1| PREDICTED: nitrate transporter 1.2-like [Cicer arietinum]
Length=620

 Score =   417 bits (1073),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 241/554 (44%), Positives = 336/554 (61%), Gaps = 24/554 (4%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             K + GG RAS+FI  +   +NM  +   V+LV Y  GVM+ +L+ +AN +TNF G+T++L
Sbjct  17    KKQKGGFRASMFIFVLSALDNMGFVANMVSLVLYFYGVMHFDLSSSANTLTNFMGSTFLL  76

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             ++V   ++D Y+ R    L+   +E L L +L +QA    L P  C       K   V G
Sbjct  77    SLVGGFISDAYLNRLTTCLLFGSLEVLALVILTIQASLNNLHPEACG------KSSCVKG  130

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
               A + + +L  +A+G  GV+ ++ + GADQFDEK+  E   ++SFFNWLLL   +G  +
Sbjct  131   GIAVMFYTSLSLLALGMGGVRGSMTAFGADQFDEKEPSEAKGLASFFNWLLLSSTLGSVI  190

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +T  VW+   + W WGF   TVA   G +   LG PFYR+ V  G S I +I+QV V A
Sbjct  191   GVTGVVWVSTQRAWHWGFFIITVASSIGFVTLALGKPFYRIKV-PGESPIFRILQVIVVA  249

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVC  1031
               N+KL LPE + +LYE+ KD        E + HT++ RFLDKAAI    + EP PW+VC
Sbjct  250   FKNKKLPLPESNEQLYEVYKDA-----TLEKIAHTNQMRFLDKAAILQE-NTEPQPWKVC  303

Query  1032  RVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpfl  1211
              VTQVE  KIL  ++P+   T++M  CLAQLQTFS+QQG+ M+L +        S     
Sbjct  304   TVTQVEEVKILTRMLPILASTIVMNTCLAQLQTFSVQQGNVMNLKLGSFTVPASSIPVIP  363

Query  1212  pilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQV  1391
              +     +   Y+  FVP  R++T  P+G+T L RV VGL+LSS+SM  A I+E+KR+  
Sbjct  364   LLFLCTLIPI-YELFFVPFARKITKHPSGVTQLQRVGVGLVLSSISMTIAGIIEVKRRDQ  422

Query  1392  ARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCF  1571
              R+             PIS+FWLS QY IFGIADMFT VGLLEFFY +AP  +KS+S+ F
Sbjct  423   GRKD---------PSKPISLFWLSFQYAIFGIADMFTLVGLLEFFYREAPSTMKSLSTSF  473

Query  1572  LWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFF  1748
              + SMSLGYF S+V V V+N  TK +T S  GWL G ++N+N+L LFY  L+ LS +NFF
Sbjct  474   TFLSMSLGYFLSTVFVNVINTVTKRITPSKQGWLQGFDLNQNNLNLFYWFLAILSCLNFF  533

Query  1749  VYLFVSKRYKYRQQ  1790
              +L+ +  YKY+ +
Sbjct  534   NFLYWATWYKYKSE  547



>ref|XP_004144799.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Cucumis sativus]
Length=662

 Score =   419 bits (1076),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 260/561 (46%), Positives = 366/561 (65%), Gaps = 25/561 (4%)
 Frame = +3

Query  126   ARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATY  305
             +R +  GG RA++FI G+  FE+M  +    +LV Y   VM+ +L  AAN +TNF G+ +
Sbjct  28    SRDEGKGGFRATMFIFGLLTFESMGFVANMTSLVQYFLFVMHFDLQTAANTLTNFMGSAF  87

Query  306   ILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEV  485
             +L+++   L+DTYI R    LI  ++E + L L+ +QA+   L P P  P D    C  V
Sbjct  88    LLSLLGGFLSDTYINRLNTCLIFGFLEVIALILITVQAYSHDLLPSPLCPKD----C--V  141

Query  486   AGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGG  665
              GR A + + +LY +A+GS GV+ A+P+ GADQF++KD KE   + +FFN++LL V +G 
Sbjct  142   KGRIAFVFYTSLYLLAIGSGGVRGALPALGADQFNQKDPKEAKALGTFFNYMLLSVVIGA  201

Query  666   AVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFV  845
             AV +TL VW+  +K W WGF  S +A   G I F +G PFYR+ V  G S + ++IQV V
Sbjct  202   AVGVTLIVWVAVNKAWYWGFFISALAALVGFIIFAIGKPFYRIQV-PGQSPLLRVIQVIV  260

Query  846   AAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWR  1025
              AI NR+L+LP+   ELYEIS DK  +      + HT++ RFLDKAAI    D EP PW 
Sbjct  261   VAIKNRRLRLPDTPNELYEIS-DKLHMDSNHYKIVHTNQLRFLDKAAI-VPKDIEPQPWN  318

Query  1026  VCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST--MDLNITKsfqilpss  1199
             VC VTQVE  KI+  +VP+F+ T+IM  CLAQLQTFS++QG+T  MD ++   FQ    S
Sbjct  319   VCSVTQVEEVKIITRMVPIFVSTIIMNTCLAQLQTFSVEQGNTRIMDKSLGH-FQFPAPS  377

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
             +P +P++F+ FLIPLY+  FVP  R++T  P+GIT L RV VGL+LS+++M  A ++E+K
Sbjct  378   IPVIPLVFMAFLIPLYEFFFVPFARKITHHPSGITQLQRVGVGLVLSAIAMTVAGLVEVK  437

Query  1380  RKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             R+  A E       P  Q   IS+FWL+ QY IFG+ADMFT VGLLEFFY +AP  ++S+
Sbjct  438   RRHQATEH------PDKQ---ISLFWLAFQYGIFGVADMFTLVGLLEFFYKEAPVGMRSL  488

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGG---NNVNRNHLELFYALLSG  1727
             S+ F + S++LGY+ SS+ V VVN  TK +T S  GW+ G    ++N N+L LFY  L+ 
Sbjct  489   STSFTFLSLALGYYLSSIFVNVVNKVTKNITPSKKGWVEGLIPEDLNHNNLNLFYWFLAI  548

Query  1728  LSFVNFFVYLFVSKRYKYRQQ  1790
             LS +NFF YL+ +  YKY+ +
Sbjct  549   LSVLNFFHYLYWASWYKYKTE  569



>ref|XP_006349278.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Solanum tuberosum]
Length=605

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 250/564 (44%), Positives = 353/564 (63%), Gaps = 17/564 (3%)
 Frame = +3

Query  102   KVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHV  281
              VDWRGR +   KHGG++A+ F+LG+ GFE M    +G  L+TY+   M+ +L+++AN V
Sbjct  29    SVDWRGRPSNPIKHGGMKAAAFVLGLQGFEIMGIAAVGNNLITYVINEMHFSLSESANIV  88

Query  282   TNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLD  461
             TNF G  +IL+++   L+D+Y+  F  +LI  +IE  G  LL++QAH  +LKPP CN L 
Sbjct  89    TNFIGTIFILSLLGGYLSDSYLASFWTILIFGFIELSGFILLSVQAHLPQLKPPKCNMLT  148

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
               +KC E  G  A I FVALY VA+GS  VK  + +HG DQF++++ K+  ++S +FN  
Sbjct  149   DGDKCVEAKGFKALIFFVALYLVALGSGCVKPNMIAHGGDQFNQENPKQSKQLSRYFNAA  208

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
                  +G  ++LT+ V++  H G D GF  S  AM  G I    G  FYR    QG S  
Sbjct  209   YFAFSMGELIALTILVYVQTHSGMDVGFGVSAAAMALGLICLVCGTLFYRNKPPQG-SIF  267

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEF-LPHTDKYRFLDKAAIQT-  995
             T I QV VAA  NRKL  P D+  L++    K          L HT+++RFLDKA  +  
Sbjct  268   TPIAQVMVAAFLNRKLVSPSDAHMLHKAHPTKALPNANPTINLLHTNRFRFLDKACTKMQ  327

Query  996   --SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNI  1169
               +  +E + WR+C VTQVE  KIL++++P+F CT+I    LAQLQTFS+QQGSTM+  +
Sbjct  328   DGNTTKEISRWRLCTVTQVEQVKILISVLPIFACTIIFNTILAQLQTFSVQQGSTMNTKL  387

Query  1170  TKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssls  1349
             TK+F I P+SL  +P + LIF++PLYD  FVP  R+ TG  +GITPL R+ VGL  ++ S
Sbjct  388   TKNFHIPPASLQSIPYIMLIFIVPLYDTFFVPFARKFTGHESGITPLQRIGVGLFFATFS  447

Query  1350  maaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFY  1529
             M +AA++E KR+  A E N            +S+FW++ Q+ IFGI++MFT VGL+EFFY
Sbjct  448   MVSAALMENKRRISAVELNE----------TLSIFWITPQFLIFGISEMFTAVGLIEFFY  497

Query  1530  SQAPK-ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLEL  1706
              Q+ K  ++S  +   + S S G++ SS+LV +VN  T      GGWL  NN+N++ L+L
Sbjct  498   KQSLKGSMQSFLTAITYCSYSFGFYLSSLLVSLVNKITSSH-HGGGWLSDNNLNKDRLDL  556

Query  1707  FYALLSGLSFVNFFVYLFVSKRYK  1778
             FY LL+ LS +NFF YLF +K Y 
Sbjct  557   FYWLLAILSLLNFFNYLFWAKWYS  580



>ref|XP_009803729.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Nicotiana sylvestris]
Length=604

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 253/572 (44%), Positives = 356/572 (62%), Gaps = 25/572 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR +   KHGG++A+ F+LG+ GFE M    +G  L+TY+   M+ +L+++AN VT
Sbjct  26    VDWRGRPSNSIKHGGMKAAAFVLGLQGFEIMGIAAVGNNLITYVINEMHFSLSESANIVT  85

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL--  458
             NF G  +IL+++   L+D+Y+G F  +LI A++E  G  LL++QAH  +LKPP CN +  
Sbjct  86    NFIGTIFILSLLGGYLSDSYLGSFWTLLIFAFVELSGFILLSVQAHLPQLKPPKCNNMLS  145

Query  459   -DKAEK-CEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFF  632
              D  ++ CEE  G  A I FVALY VA+GS  VK  + SHGADQF+ +  K+  ++S +F
Sbjct  146   TDNGDQLCEEAKGLKALIFFVALYLVALGSGCVKPNMISHGADQFNHQ--KQSKQLSRYF  203

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N       +G  ++LTL VW+  H G D GF  S  AM  G I    G  FYR    QG 
Sbjct  204   NAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMALGLITLVAGTLFYRNKPPQG-  262

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE----FLPHTDKYRFLDK  980
             S  T I QV VAA  NRK   P D+  L+     K      +      L HT ++RFLDK
Sbjct  263   SIFTPIAQVLVAAFLNRKHISPSDARMLHGTHTIKNVNPTLSHDNMGILLHTSRFRFLDK  322

Query  981   AAIQT---SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             A I+    +  +E + WR+C +TQVE  KIL++++P+F CT+I    LAQLQTFS+QQGS
Sbjct  323   ACIKVQDGNNTKEISRWRLCTITQVEQVKILISVIPIFACTIIFNTILAQLQTFSVQQGS  382

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
              M+  +TK+F I P+SL  +P + LIF++PLYD  FVP  R+ TG  +GITPL R+ +GL
Sbjct  383   AMNTKLTKNFHIPPASLQSIPYILLIFIVPLYDTFFVPFARKFTGHDSGITPLQRIGLGL  442

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
              +++ SM +AA++E KR+  A   N            IS+FW++ Q+ IFG+++MFT VG
Sbjct  443   FIATFSMVSAALMENKRRISAVNENK----------TISIFWITPQFLIFGLSEMFTAVG  492

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+ K ++S  +   + S S G++ SSVLV +VN  T   +  GGWL  NN+N+
Sbjct  493   LIEFFYKQSLKGMQSFLTAITYCSYSFGFYLSSVLVSLVNKITSN-SSHGGWLSDNNLNK  551

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             + L+LFY LL+ LSF+NFF YLF +  Y   Q
Sbjct  552   DRLDLFYWLLAVLSFLNFFNYLFWATWYSKNQ  583



>ref|XP_010470202.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Camelina sativa]
Length=592

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 254/572 (44%), Positives = 356/572 (62%), Gaps = 21/572 (4%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             N    +EL + + VDWRGR +  +KHGG+RA++F+LG+  FE M    +G  L+TY+   
Sbjct  18    NEMNNWELAEEESVDWRGRPSNPNKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQAHL  137

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPP CNP+   + CEE  G  A I F+ALY VA+GS  VK  + +HGADQF + D K
Sbjct  138   PQLKPPKCNPMID-QTCEEAKGFKAMIFFMALYLVALGSGCVKPNMIAHGADQFSQSDPK  196

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  197   QSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMTLGLISLVSGTMY  256

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEFLPHT  956
             +R    +  S  T I QV VAAI  RKL  P D   L   + ++ D     + +  LPHT
Sbjct  257   FRNKRPR-RSIFTPIAQVVVAAILKRKLVSPSDPRMLHGDHHVAND----VVPSSTLPHT  311

Query  957   DKYRFLDKAAIQTSWDE-EPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTF  1133
              ++RFLDKA I+      + +PWR+C VTQVE  K L++LVP+F  T++    LAQLQTF
Sbjct  312   PRFRFLDKACIKIQETNIKESPWRLCTVTQVEQVKTLISLVPIFASTIVFNTILAQLQTF  371

Query  1134  SIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLH  1313
             S+QQGS+M+  ++ SF I P+SL  +P + LIFL+PLYD L VP  R+LTG  +GI PL 
Sbjct  372   SVQQGSSMNTRLSNSFHIPPASLQAIPYILLIFLVPLYDSLLVPFARKLTGHNSGIPPLT  431

Query  1314  RVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIAD  1493
             R+ VGL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFG+++
Sbjct  432   RIGVGLFLSTFSMVSAAMLEKKR----RDSSVLDG------RILSIFWITPQFLIFGVSE  481

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             MFT VGL+EFFY Q+ K ++S      + S S G++ SSVLV VVN  T    +S GWLG
Sbjct  482   MFTAVGLIEFFYKQSAKGMESFLMALTYCSYSFGFYFSSVLVSVVNQITSTSVDSKGWLG  541

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
              N++N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  542   ENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR  573



>ref|XP_011087621.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Sesamum indicum]
Length=610

 Score =   416 bits (1069),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 247/575 (43%), Positives = 360/575 (63%), Gaps = 18/575 (3%)
 Frame = +3

Query  72    SQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMN  251
             ++E        VDWRG+ +   KHGG++A+ F+LG+ GFE MA   +G  L+TY+   M+
Sbjct  17    AEETTTTTTTTVDWRGKPSDPLKHGGMKAAAFVLGLQGFEIMAIAAVGNNLITYVINEMH  76

Query  252   VNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAK  431
              +L+ AAN VTNF G  ++L ++   L+D+Y+G F  +LI A++E  G  LL++QAH  +
Sbjct  77    FSLSKAANTVTNFIGTVFLLALLGGYLSDSYLGCFWTMLIFAFVELSGFILLSVQAHLPQ  136

Query  432   LKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEG  611
             LKPP CN L  +E C E  G  A I F+ALY VA+GS  VK  + +HGADQF++ D+K+ 
Sbjct  137   LKPPQCNMLTDSENCMEAKGFKALIFFIALYLVALGSGCVKPNMIAHGADQFNQDDQKQS  196

Query  612   SEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYR  791
              ++S +FN       +G  ++LT+ V++  H G D GF  S  AM  G I    G  FYR
Sbjct  197   KKLSRYFNAAYFAFSMGELIALTVLVYVQTHSGMDVGFGVSAAAMAMGLISLISGTVFYR  256

Query  792   VYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEI-SKDKEAVTICAEFLPH---TD  959
                 QG S +T I QVFVAA   RK   P D   L+ I SK+       ++  P+   T 
Sbjct  257   NKPPQG-SILTPIAQVFVAATLKRKQVCPSDPRMLHAIHSKEPNTDNPISDTSPNPQLTP  315

Query  960   KYRFLDKAAIQTSWD--EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTF  1133
             ++RFL+KA I+T  D   + + W +C V QVE  KIL+++VP+F CT++    LAQLQTF
Sbjct  316   RFRFLNKACIKTIQDGNSKESSWSLCTVNQVEQVKILMSVVPIFACTIVFNTILAQLQTF  375

Query  1134  SIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLH  1313
             S+QQGS+M+  +T SF I P+SL  +P + L F++PLYD  FVP  RR+TG  +GITPL 
Sbjct  376   SVQQGSSMNTQLTHSFHIPPASLQAIPYIMLTFIVPLYDAFFVPFARRITGHDSGITPLQ  435

Query  1314  RVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIAD  1493
             R+  GL L++ SM +AA++E KR++ A + + +          +S+FW++ Q+ IFGI++
Sbjct  436   RIGAGLFLATFSMISAAMMEHKRRESAVKSHEI----------LSIFWITPQFLIFGISE  485

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             M T VGL+EFFY Q+ K ++S  +   + S S G+F SS+LV +VN  T G +   GWL 
Sbjct  486   MLTAVGLIEFFYKQSLKGMQSFLTAITYCSYSFGFFLSSLLVSIVNKVTSG-SSGDGWLS  544

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
              N++N++ L+LFY  L+ LSF+NFF YLF ++ Y 
Sbjct  545   DNDLNKDRLDLFYWFLAVLSFLNFFNYLFWARWYS  579



>ref|XP_010414658.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 isoform X1 [Camelina 
sativa]
 ref|XP_010414659.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 isoform X2 [Camelina 
sativa]
Length=592

 Score =   416 bits (1068),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 254/572 (44%), Positives = 356/572 (62%), Gaps = 21/572 (4%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             N    +EL + + VDWRGR +  +KHGG+RA++F+LG+  FE M    +G  L+TY+   
Sbjct  18    NEMNNWELAEEESVDWRGRPSNPNKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQAHL  137

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPP CNPL   + CEE  G  A I F+ALY VA+GS  VK  + +HGADQF +   K
Sbjct  138   PQLKPPKCNPLID-QTCEEAKGLKAMIFFMALYLVALGSGCVKPNMIAHGADQFSQSHPK  196

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  197   QSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMTIGLISLVSGTMY  256

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEFLPHT  956
             +R    +  S  T I QV VAAI  RKL  P D   L   + ++ D     + +  LPHT
Sbjct  257   FRNKRPR-RSIFTPIAQVVVAAILKRKLVSPSDPRMLHGDHHVAND----VVPSSTLPHT  311

Query  957   DKYRFLDKAAIQ-TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTF  1133
              ++RFLDKA I+    + + +PWR+C VTQVE  K L++LVP+F  T++    LAQLQTF
Sbjct  312   PRFRFLDKACIKIQETNTKESPWRLCTVTQVEQVKTLISLVPIFASTIVFNTILAQLQTF  371

Query  1134  SIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLH  1313
             S+QQGS+M+  ++ SF I P+SL  +P + LIFL+PLYD L VP  R+LTG  +GI PL 
Sbjct  372   SVQQGSSMNTRLSNSFHIPPASLQAIPYILLIFLVPLYDSLLVPFARKLTGHNSGIPPLT  431

Query  1314  RVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIAD  1493
             R+ VGL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFG+++
Sbjct  432   RIGVGLFLSTFSMVSAAMLEKKR----RDSSVLDG------RILSIFWITPQFLIFGVSE  481

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             MFT VGL+EFFY Q+ K ++S      + S S G++ SSVLV VVN  T    +S GWLG
Sbjct  482   MFTAVGLIEFFYKQSAKGMESFLMALTYCSYSFGFYFSSVLVSVVNKITSTSVDSKGWLG  541

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
              N++N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  542   ENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR  573



>ref|XP_008237812.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Prunus mume]
Length=608

 Score =   416 bits (1069),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 246/574 (43%), Positives = 355/574 (62%), Gaps = 20/574 (3%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VDWRGR  +  KHGG+RA++F+LG+ GFE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  17    DMSVDWRGRPCKPTKHGGMRAAVFVLGLQGFEMMAIAAVGNNLITYVLNEMHFSLSKSAN  76

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L++    L+D+Y+G F  ++I  ++E  G  LL +QAH  +L+PPPC  
Sbjct  77    IVTNFIGTVFLLSLFGGYLSDSYLGSFWTMIIFGFVELSGFILLCVQAHLPELRPPPCKI  136

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +   E C E  G  A I F A+Y VA+GS  +K  + SHGADQF   D K+  ++SS+FN
Sbjct  137   MSH-EYCPEAKGYKALIFFAAIYLVALGSGCLKPNIISHGADQFRRDDSKQSKKLSSYFN  195

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                   C+G  ++LT+ VW+  H G D GF AS  AM  G I  T G P YR    +G S
Sbjct  196   CAYFAFCIGELIALTVLVWVQTHSGMDVGFGASAAAMAMGLICLTFGTPLYRNKPPRG-S  254

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEA---VTICAEFLP--HTDKYRFLDK  980
               T I QVFVAA   RK   P ++  L+    +      V +     P  HT+K+RFLDK
Sbjct  255   IFTPIAQVFVAAFTKRKQICPSNTEMLHGNQNNVPNHLFVPMSPNISPLLHTEKFRFLDK  314

Query  981   AAIQTSWDEEPN--PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
             A I+     + N  PWR+C V QVE  KI++++VP+F CT+I    LAQLQTFS+QQ + 
Sbjct  315   ACIKIEDGTQRNESPWRLCTVAQVEQVKIIISVVPIFACTIIFNTILAQLQTFSVQQATA  374

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             M+  IT+ F+I P+SL  +P + LIF++PLY+ +FVP+ R+LTG  +GI+PL RV  GL 
Sbjct  375   MNTRITRGFKIPPASLQAIPYIMLIFVVPLYEIVFVPAARKLTGRDSGISPLQRVGTGLF  434

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
             +++ SM +AA++E KR+ +A   N           P+S+FW++ Q+ IFG+++MFT VGL
Sbjct  435   IATFSMVSAALIEQKRRNLALSSNE----------PLSIFWIAPQFLIFGLSEMFTAVGL  484

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRN  1694
             +EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T   +   GWL  N++NR+
Sbjct  485   IEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSILVSLVNKLTSTSSRE-GWLSDNDLNRD  543

Query  1695  HLELFYALLSGLSFVNFFVYLFVSKRYKYRQQIG  1796
              L+ FY LL+ LS +NFF YLF S  Y Y   + 
Sbjct  544   RLDRFYWLLAALSLINFFNYLFWSNWYSYNPSLS  577



>ref|XP_006392243.1| hypothetical protein EUTSA_v10023363mg [Eutrema salsugineum]
 gb|ESQ29529.1| hypothetical protein EUTSA_v10023363mg [Eutrema salsugineum]
Length=594

 Score =   415 bits (1066),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 253/575 (44%), Positives = 355/575 (62%), Gaps = 21/575 (4%)
 Frame = +3

Query  57    NFLINSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYL  236
             N ++N+ E  E  +  VDWRGR +  +KHGG+RA++F+LG+  FE M    +G  L+TY+
Sbjct  18    NEVMNNWELAE--EESVDWRGRPSNPNKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYV  75

Query  237   NGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQ  416
                M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  ++E  G  LL++Q
Sbjct  76    INEMHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQ  135

Query  417   AHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEK  596
             AH  +LKP  CNPL     CEE  G  A I F+ALY VA+GS  VK  + +HGADQF + 
Sbjct  136   AHLPQLKPLKCNPLIDQNSCEEAKGLKAMIFFMALYLVALGSGCVKPNMIAHGADQFSKS  195

Query  597   DRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLG  776
               K+   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G
Sbjct  196   HPKQSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMTMGLISLVSG  255

Query  777   LPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEFL  947
               ++R    +  S  T I QV VAAI  RKL  P D   L   + +S D     + +  L
Sbjct  256   TMYFRNKRPR-RSIFTPIAQVVVAAILKRKLVCPSDPRMLHGDHHVSND----VVPSSTL  310

Query  948   PHTDKYRFLDKAAIQT-SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
             PHT + RFLDKA I+    + + NPWR+C VTQVE  K L++LVP+F  T++    LAQL
Sbjct  311   PHTSRLRFLDKACIKVEDTNTKENPWRLCTVTQVEQVKTLISLVPIFASTIVFNTILAQL  370

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFS+QQGS+M+  ++ SF I P+SL  +P + LIFL+P+YD  FVP  R+LTG  +GI 
Sbjct  371   QTFSVQQGSSMNTRLSNSFHIPPASLQAIPYIMLIFLVPIYDSFFVPFARKLTGHNSGIP  430

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
             PL R+ +GL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFG
Sbjct  431   PLTRIGIGLFLSTFSMVSAALLEKKR----RDSSVLDG------RVLSIFWITPQFLIFG  480

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGG  1664
             +++MFT VGL+EFFY ++ K ++S      + S S G++ SSVLV VVN  T    +S G
Sbjct  481   VSEMFTAVGLIEFFYKESAKGMESFLMALTYCSYSFGFYLSSVLVSVVNKITSTSVDSKG  540

Query  1665  WLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             WLG N++N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  541   WLGENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR  575



>ref|XP_004979163.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Setaria italica]
Length=578

 Score =   414 bits (1065),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 231/565 (41%), Positives = 345/565 (61%), Gaps = 11/565 (2%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
              G VDWRGR     KHGG+RASIFI  +    N A I   + LV+YL   M++++A A+ 
Sbjct  5     SGLVDWRGRPVNTKKHGGVRASIFIHALVLLSNAANIANILNLVSYLRNEMHMDVARAST  64

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
               +NF  A  + +I AA LAD+Y+ RF  VLI   IE LG  LLA+QAH   L+PPPC P
Sbjct  65    MASNFFAALQMFSIPAAFLADSYVKRFYTVLIFGPIEILGYILLAVQAHVPSLQPPPCTP  124

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
                A  CE V G N ++L + LY + +G    +A +P+ G +QFD  D  E ++ +SFFN
Sbjct  125   GHLATTCESVHGSNLSLLLLGLYLIPIGDGAARACLPALGGEQFDTSDPVEQTQEASFFN  184

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             W    V  GG V L   VW+   KGWD GF    + +  G + +  G PFYR  +  GS 
Sbjct  185   WYTFAVSTGGFVGLVFVVWVENSKGWDIGFFVCAICVLLGMLIWIAGFPFYRNQLPTGSP  244

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
              IT+++QV VAA   RK++LPE+  EL +I+KD+ +     E L  T+ +  LDKAA+ T
Sbjct  245   -ITRLLQVLVAAFQKRKVKLPENPSELKQINKDEASAI---EMLHKTEGFHCLDKAAVDT  300

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                 +   W +C +TQVE  KI+L +VP+FL  V+  + +  +  F++QQG+TMD  +  
Sbjct  301   G---KTGAWSLCSITQVEETKIILRMVPIFLSAVLGYIPVPLILNFTVQQGNTMDTRL-G  356

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             +  I P++L  +P +F + ++ +YDR  VP +RR+TG   G+T L R+ +G L ++++  
Sbjct  357   AIHISPATLFVIPTVFQMVILIVYDRFIVPFLRRITGYVGGVTHLQRIGIGFLSATVATG  416

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
              AA++E+KRK+VA E  ++DA      +PISVFWL++Q+F+ GI D+ ++VGLLEFFYS+
Sbjct  417   IAALVEIKRKKVAEENGLMDAT---TGIPISVFWLTVQFFLLGIVDVTSFVGLLEFFYSE  473

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYA  1715
             A   +KS+ S   +  + +  +  S+L+++ N  T+    +GGWL G N+NR  L+ FY 
Sbjct  474   ASMGMKSIGSSIFYCILGVSAWLGSLLIQLANRVTRHSDGTGGWLDGTNLNRGKLDRFYG  533

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             LL+ L  V+ F+Y+F ++RY YR  
Sbjct  534   LLAVLELVSLFIYMFFARRYVYRND  558



>ref|XP_004494500.1| PREDICTED: nitrate transporter 1.2-like [Cicer arietinum]
Length=579

 Score =   414 bits (1065),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 245/573 (43%), Positives = 338/573 (59%), Gaps = 29/573 (5%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             QE+ E +     W      K K GG RAS+FI  +   +NM  +   V+LV Y  GVM+ 
Sbjct  4     QEETEELKLLTQW------KRKKGGFRASMFIFVLSALDNMGFVANMVSLVLYFYGVMHF  57

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
             +L+ +AN +TNF G+T++L++V   ++DTY+ RF   L+   +E L L +L ++A    L
Sbjct  58    DLSSSANTLTNFMGSTFLLSLVGGFISDTYLNRFTTCLLFGSLEVLALAMLTVEAASDHL  117

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
              P  C       K   V G    + + +L  +A+G  GV+ ++   GADQF+EKD  E  
Sbjct  118   HPNACG------KSSCVKGGIGVMFYTSLCLLALGIGGVRGSMTPFGADQFEEKDPNEAK  171

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
              ++SFFNWLLL   +G    +T  VW+   + W WGF   T+A   G +   LG PFYR+
Sbjct  172   GLASFFNWLLLSSTLGAITGVTFVVWVSTQRAWHWGFFIITIASSIGFVTLALGKPFYRI  231

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
                 G S   +I QV V    NRKL +PE   ELYEIS DK+      E + HT++ RFL
Sbjct  232   KT-PGDSPTLRIAQVIVVGFKNRKLSVPESHEELYEIS-DKDTT---VEKIVHTNQMRFL  286

Query  975   DKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
             DKAAI    + +P PW+VC VTQVE  KIL  ++P+   T+IM  CLAQLQTFS+QQG+ 
Sbjct  287   DKAAILQE-NMKPQPWKVCTVTQVEEVKILTRMLPIVASTIIMNTCLAQLQTFSVQQGNV  345

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             M+L +       PS      I   I +   Y+  FVP  R++T  P+GIT L RV VGL+
Sbjct  346   MNLKLGSFTVPAPSIPVIPLIFISILVPI-YELFFVPFARKITHHPSGITQLQRVGVGLV  404

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
             LS +SM  A  +E+KR+  +R+             PIS+FWLS QY IFGIADMFT VGL
Sbjct  405   LSVISMTVAGFVEVKRRDQSRKD---------PSNPISLFWLSFQYGIFGIADMFTLVGL  455

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNR  1691
             LEFFY ++P  +KS+S+   W SMS+GYF S+V V ++N  TK +T S  GWL G ++N+
Sbjct  456   LEFFYRESPSSMKSLSTSLTWLSMSIGYFLSTVFVNLINVVTKRLTPSKQGWLQGFDLNQ  515

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             N+L LFY  L+ LS +NFF YL+ +  YKY+ +
Sbjct  516   NNLNLFYWFLAILSCLNFFNYLYWASSYKYKSE  548



>ref|XP_010511033.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Camelina sativa]
Length=592

 Score =   414 bits (1065),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 254/572 (44%), Positives = 355/572 (62%), Gaps = 21/572 (4%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             N    +EL + + VDWRGR +  +KHGG+RA++F+LG+  FE M    +G  L+TY+   
Sbjct  18    NEMNNWELAEEESVDWRGRPSNPNKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQAHL  137

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPP CNPL   + CEE  G  A I F+ALY VA+GS  VK  + +HGADQF     K
Sbjct  138   PQLKPPKCNPLID-QTCEEAKGFKAMIFFMALYLVALGSGCVKPNMIAHGADQFSHSHPK  196

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  197   QSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMTLGLISLVSGTMY  256

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEFLPHT  956
             +R    +  S  T I QV VAAI  RKL  P D   L   + ++ D     + +  LPHT
Sbjct  257   FRNKRPR-RSIFTPIAQVVVAAILKRKLVSPSDPRMLHGDHHVAND----VVPSSTLPHT  311

Query  957   DKYRFLDKAAIQ-TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTF  1133
              ++RFLDKA I+    + + +PWR+C VTQVE  K L++LVP+F  T++    LAQLQTF
Sbjct  312   PRFRFLDKACIKIQETNTKESPWRLCTVTQVEQVKTLISLVPIFASTIVFNTILAQLQTF  371

Query  1134  SIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLH  1313
             S+QQGS+M+  ++ SF I P+SL  +P + LIFL+PLYD L VP  R+LTG  +GI PL 
Sbjct  372   SVQQGSSMNTRLSNSFHIPPASLQAIPYILLIFLVPLYDSLLVPFARKLTGHNSGIPPLT  431

Query  1314  RVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIAD  1493
             R+ VGL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFG+++
Sbjct  432   RIGVGLFLSTFSMVSAAMLEKKR----RDSSVLDG------RILSIFWITPQFLIFGVSE  481

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             MFT VGL+EFFY Q+ K ++S      + S S G++ SSVLV VVN  T    +S GWLG
Sbjct  482   MFTAVGLIEFFYKQSAKGMESFLMALTYCSYSFGFYFSSVLVSVVNKITSTSVDSKGWLG  541

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
              N++N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  542   ENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR  573



>ref|XP_009776306.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Nicotiana sylvestris]
Length=595

 Score =   414 bits (1064),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 245/568 (43%), Positives = 356/568 (63%), Gaps = 20/568 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             +  +DWRG+ +   KHGG++A+ F+LG+ GFE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  15    ETTLDWRGKPSNSSKHGGMKAAAFVLGVQGFEIMAIAAVGNNLITYVINEMHFSLSKSAN  74

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN 
Sbjct  75    VVTNFIGTVFLLALLGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPNCNM  134

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR-KEGSEMSSFF  632
             +   E C E  G  A I F ALY VA+GS  VK  + +HGADQF+ +D  K+  ++S +F
Sbjct  135   VTDEEHCVEAKGFKALIFFTALYLVALGSGCVKPNMIAHGADQFNYQDNPKQSKQLSRYF  194

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N       +G  ++LT+ VW+  H G D GF  S  AM  G I    G   YR    QG 
Sbjct  195   NAAYFAFSMGELIALTVLVWVQTHSGMDLGFGISAAAMAMGLISLVGGTFLYRNKPPQG-  253

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDK---EAVTICAEF--LPHTDKYRFLD  977
             S  T + QVF+AA   RK   P D+  L+    +K      TI  +   L HT+++RFLD
Sbjct  254   SIFTPMAQVFMAAFSKRKEVCPSDARVLHGSHSNKGPNSNATISDDMGILHHTNQFRFLD  313

Query  978   KAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             KA I  Q     + +PW++C VTQVE  KIL++++P+F CT++    LAQLQTFS+QQGS
Sbjct  314   KACIKVQDGNSTKESPWKLCTVTQVEQVKILISVIPIFACTIVFNTILAQLQTFSVQQGS  373

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             +M+  +TKSF I P+SL  +P + LIFL+PLYD  FVP  R++TG  +G+TPL R+ +GL
Sbjct  374   SMNTKLTKSFHIPPASLQAIPYIMLIFLVPLYDTFFVPFARKITGHDSGVTPLQRIGLGL  433

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
              +++ SM +AA++E KR+  A   N            +S+FW++ Q+ IFG+++MFT VG
Sbjct  434   FVATFSMVSAALMEYKRRNAAVNSNK----------TLSIFWITPQFLIFGVSEMFTAVG  483

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+ K ++S  +   + S S G++ SSVLV +VN  T   +  GGWL  NN+N+
Sbjct  484   LIEFFYKQSVKGMQSFLTAITYCSYSFGFYLSSVLVSLVNKITSN-SSHGGWLSDNNLNK  542

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             + L+LFY LL+ LSF+NFF YLF ++ Y
Sbjct  543   DRLDLFYWLLAVLSFLNFFNYLFWARWY  570



>gb|KFK40857.1| hypothetical protein AALP_AA2G050600 [Arabis alpina]
Length=593

 Score =   414 bits (1064),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 255/569 (45%), Positives = 357/569 (63%), Gaps = 14/569 (2%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             +    +EL + + VDWRGR +  +KHGG+RA++F+LG+  FE M    +G  L+TY+   
Sbjct  18    DEMNNWELAEEESVDWRGRPSNPNKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQAHL  137

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPP CNPL +   CEE  G  A I F+ALY VA+GS  VK  + +HGADQF +   K
Sbjct  138   PQLKPPKCNPLVEQNSCEEAKGFKAIIFFMALYLVALGSGCVKPNMIAHGADQFSQSHPK  197

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  198   QSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDIGFGVSAAAMTMGLISLVSGTMY  257

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             +R    + S  I  I QV VAAI  RKL  P D   L+  +  +  V + +  LPHT ++
Sbjct  258   FRNKRPRRSIFIP-IAQVVVAAIVKRKLVSPSDPRMLHGDNHVRNDV-VPSTTLPHTPRF  315

Query  966   RFLDKAAIQTS-WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             RFLDKA I+    + + +PWR+C VTQV+  K L++LVP+F  T+I    LAQLQTFS+Q
Sbjct  316   RFLDKACIKIQGTNTKESPWRLCTVTQVQQVKTLISLVPIFASTIIFNTILAQLQTFSVQ  375

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS+M+  ++ SF I P+SL  +P + LIFL+PLYD LFVP  R+LTG  +GI PL R+ 
Sbjct  376   QGSSMNTVLSNSFHIPPASLQAIPYIMLIFLVPLYDSLFVPFARKLTGHNSGIPPLIRIG  435

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
             +GL LS+ SM +AA+LE KR    R+ ++LD   IL     S+FW++ Q+ IFG+++MFT
Sbjct  436   IGLFLSTFSMVSAALLEKKR----RDSSVLDG-KIL-----SIFWITPQFLIFGVSEMFT  485

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGL+EFFY Q+ K ++S      + S + G++ SSVLV VVN  T     S GWLG N+
Sbjct  486   AVGLIEFFYKQSAKGMESFLMALTYCSYAFGFYFSSVLVSVVNKITSTSVGSKGWLGEND  545

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             +N+N L+LFY LL+ LS +NF  YLF S+
Sbjct  546   LNKNRLDLFYWLLAVLSLLNFLSYLFWSR  574



>ref|XP_010930551.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like isoform X1 [Elaeis 
guineensis]
Length=600

 Score =   414 bits (1064),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 243/564 (43%), Positives = 354/564 (63%), Gaps = 15/564 (3%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             L +  VDWRG+  +  KHGG++A++F+LGI  FE MA   +G  L+TY+   M+  L+ +
Sbjct  15    LAEVSVDWRGKPCKPSKHGGMKAAVFVLGIQAFEIMAIAAVGNNLITYVFNEMHFPLSKS  74

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +L+PP C
Sbjct  75    ANIVTNFVGTIFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLRPPQC  134

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             N +   E C E  G  A I F+ALY VA+GS  +K  + +HGADQF + D K+  ++S++
Sbjct  135   NMMSIEEHCVEAKGFKATIFFIALYLVALGSGCLKPNMIAHGADQFGKDDPKQSKKLSTY  194

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN      CVG  ++LT+ VW+    G D GF  S  AM  G I    G+ FY     QG
Sbjct  195   FNTAYFSFCVGELIALTVLVWVQTRSGMDVGFGVSAAAMAMGLISLISGMVFYMNKPPQG  254

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
              S  T   +VF+AAI  RK Q+   S E+    ++     +    L HTDK+RFLDKA I
Sbjct  255   -SIFTPFARVFIAAITKRK-QVCPSSSEMLHRHRNNAPDHLVVSGLRHTDKFRFLDKACI  312

Query  990   QTSWDE--EPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
             +   D   E +PWR+C +++VE  KI+L+++P+F CT+I    LAQLQTFS+QQGS M+ 
Sbjct  313   KVQDDSNMEESPWRLCTISEVEQVKIVLSVIPIFACTIIFNTVLAQLQTFSVQQGSAMNT  372

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              +TKSF I P+SL  +P + LI L+P+Y+  FVP  RRLTG  +GITPL R+ +GL   +
Sbjct  373   QLTKSFHIPPASLQAIPYIILIVLVPIYEICFVPLARRLTGKESGITPLQRIGIGLCTVT  432

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM AAA++E KR++VA   + L          +S+FW++ Q+ IFG+++MFT VGL+EF
Sbjct  433   FSMVAAALVEKKRREVAIGTDEL----------LSIFWIAPQFLIFGVSEMFTAVGLIEF  482

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+   ++S  +   + S S G+F SS+LV +VN  T   +  GGWL  N++N++ L+
Sbjct  483   FYKQSLGGMQSFLTAITYCSYSFGFFLSSLLVSLVNKITSS-SSKGGWLSDNDLNKDRLD  541

Query  1704  LFYALLSGLSFVNFFVYLFVSKRY  1775
              FY LL+ LS +NFF YL+ S+ Y
Sbjct  542   YFYWLLAALSLLNFFNYLYWSRWY  565



>gb|KFK45078.1| hypothetical protein AALP_AA1G340600 [Arabis alpina]
Length=597

 Score =   414 bits (1064),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 253/562 (45%), Positives = 355/562 (63%), Gaps = 20/562 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VD RGR  R +KHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ +AN
Sbjct  20    DLCVDSRGRPCRPNKHGGPRAALFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKSAN  79

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G FR +LI   IE  G  LL++QAH  +LKPP CN 
Sbjct  80    LVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLIFGVIEISGFILLSVQAHLPELKPPECNM  139

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
              +    C E  G  AA L+ AL  VA+GS  +K  + SHGADQF   +RKE  ++SSFFN
Sbjct  140   KNTTTHCIEANGYKAATLYAALCLVALGSGCLKPNIISHGADQF---ERKELRKLSSFFN  196

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LTL +W+  H G D GF  S   M  G I    G  FYR    +G S
Sbjct  197   AAYFAFSMGQLIALTLLIWVQTHSGMDVGFGVSAAVMAAGVISLVAGTNFYRNKSPRG-S  255

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
               T I QVFVAAI  RK   P +   L++ S +     +  + L HT+K+RFLDKA I+ 
Sbjct  256   IFTPIAQVFVAAITKRKQICPSNPNMLHQPSTN----IVHIKPLLHTNKFRFLDKACIKA  311

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                   +PWR+C + QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+M+ +ITK
Sbjct  312   QGKAMESPWRLCTIEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMNTHITK  371

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             +FQI P+SL  +P + LIF++PLY+  FVP+ R+LTG  +GI+PL R+  GL L+S SM 
Sbjct  372   TFQIPPASLQAIPYIILIFVVPLYETFFVPTARKLTGKDSGISPLQRIGTGLFLASFSMV  431

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             AAA++E KR++   E+N+           IS+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  432   AAALVEKKRREAFLEQNVT----------ISIFWIAPQFLIFGLSEMFTAVGLVEFFYKQ  481

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGNNVNRNHLELF  1709
             + + ++S  +   + S S G++ SS+LV  VN  T   G     GWLG N++N++ L+LF
Sbjct  482   SSQSMQSFLTAMTYCSYSFGFYLSSILVSAVNRVTSSNGSGTREGWLGDNDLNKDRLDLF  541

Query  1710  YALLSGLSFVNFFVYLFVSKRY  1775
             Y LL+ +SFVNFF YLF S+ Y
Sbjct  542   YWLLASMSFVNFFNYLFWSRWY  563



>ref|XP_008218643.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Prunus mume]
Length=618

 Score =   414 bits (1065),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 253/576 (44%), Positives = 357/576 (62%), Gaps = 25/576 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  +DWRGR +   KHGG+RA+ F+LG+  FE M    +G  L+TY+   M+ +L+ +AN
Sbjct  26    DVTLDWRGRPSNPTKHGGMRAAAFVLGLQSFEIMGIAAVGNNLITYVINEMHFSLSKSAN  85

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L +V   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPPPCN 
Sbjct  86    IVTNFIGTVFLLALVGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLKPPPCNN  145

Query  456   L---DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             +   D  E+C E  G  + I FVALY VA+GS  VK  + +HGADQF+ +  ++  ++S+
Sbjct  146   ISAADNGEECIEAKGFKSLIFFVALYLVALGSGCVKPNMIAHGADQFNPESPEQSKKLST  205

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             +FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  +YR    Q
Sbjct  206   YFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLYYRNKPPQ  265

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTI------CAEFLPHTDKYR  968
             G S  T I QVFVAAI  RK   P +   L+    +    TI         FL HT+K+R
Sbjct  266   G-SIFTPIAQVFVAAILKRKHVCPSNPQLLHGSQNNVPNDTITTFSSDAGSFL-HTEKFR  323

Query  969   FLDKAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             FLDKA I  Q   + + +PWR+C VTQV+  KILL+++P+F  T++    LAQLQTFS+Q
Sbjct  324   FLDKACIKMQDGTNTKESPWRLCTVTQVKQVKILLSVIPIFASTIVFNTILAQLQTFSVQ  383

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS MD  +TKSF + P+SL  +P + LI ++PLYD  FVP  R+ TG  +GI+PL R+ 
Sbjct  384   QGSMMDTKLTKSFHVPPASLQSIPYIMLIVVVPLYDTFFVPFARKFTGHDSGISPLKRIG  443

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
              GL L++ SM AAAI+E KR+  A   N +          +S+FW++ Q+ IFG+++MFT
Sbjct  444   FGLFLATFSMIAAAIMEQKRRDAAVNSNKI----------LSIFWITPQFLIFGLSEMFT  493

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGG  1676
              VGL+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T   G +  GGWLG 
Sbjct  494   AVGLIEFFYKQSLKGMQAFLTAVTYCSYSFGFYLSSLLVSLVNNITSSSGSSGGGGWLGD  553

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             NN+N++ L+LFY LL+GLSF+NF  YLF S  Y + 
Sbjct  554   NNLNKDRLDLFYWLLAGLSFLNFLNYLFWSNWYSHN  589



>ref|XP_009757573.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X2 [Nicotiana 
sylvestris]
Length=597

 Score =   414 bits (1063),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 244/565 (43%), Positives = 351/565 (62%), Gaps = 22/565 (4%)
 Frame = +3

Query  102   KVDWRGRTARKDK-HGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANH  278
             K+++   ++ K K  GG RAS FI G  G +N+  +   V++V Y +  M+++L+ +AN 
Sbjct  6     KLEYNSVSSYKIKGKGGFRASSFIYGFVGLDNIGFVANMVSMVLYFSFKMHLDLSGSANT  65

Query  279   VTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL  458
             VTN  G+TY+L+I+   ++DTY+ RF  +LI    E L   L+ +QA Y+ L+P  C   
Sbjct  66    VTNLLGSTYLLSIIGGFISDTYLSRFHTILIFGTAEILAWTLMTIQARYSSLQPQVCG--  123

Query  459   DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNW  638
                 K   + G    + + +L  +A+G+ GV+ A+P+ GADQFD KD  E   +  +FNW
Sbjct  124   ----KSNCLEGGIGLLFYGSLCLLALGTGGVRGALPALGADQFDHKDPNEAKALGRYFNW  179

Query  639   LLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSA  818
             LLL    G A+ +T+ VW+  +KGW  GF  S V  F G + F  G PFYR+ V  G S 
Sbjct  180   LLLSSVSGSAIGVTVVVWVSTNKGWWIGFLISLVGTFLGFLIFVFGKPFYRLQV-PGESP  238

Query  819   ITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTS  998
             +T+I+QV   AI NRKLQLPE+S ELYEI+  KE+ ++  + + HT+++R+LDKAAI   
Sbjct  239   LTRILQVIKVAIRNRKLQLPENSEELYEINV-KESDSLEPK-IAHTNQFRYLDKAAILPK  296

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                EP  W VC VT+VE  KIL  ++P+   T++M  CLAQLQTFS+QQG  M+ +    
Sbjct  297   -TVEPTQWTVCTVTKVEEVKILTRMLPIIASTILMNTCLAQLQTFSVQQGYRMNRHFGSF  355

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
                 PS      +   I +   YD +FVP  R++T  P+GIT L RV VGL+LS +SM  
Sbjct  356   EVPAPSVPVIPLLFMCILIPI-YDFVFVPFARKITNHPSGITQLQRVGVGLVLSIISMGI  414

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E+KRK  +  +N L+        PI VFWLS QY IFGIADMFT VG+LEFFY +A
Sbjct  415   AALVEIKRKHQSL-KNPLE--------PIHVFWLSFQYGIFGIADMFTLVGMLEFFYKEA  465

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYA  1715
             P  ++S+S+ F W S+S GY+ SSV V ++N  TK  ++S  GWL G ++++N+L+LFY 
Sbjct  466   PAGMRSLSTSFTWISLSFGYYLSSVFVDIINSVTKRFSQSKKGWLAGQDLDQNNLQLFYW  525

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              L+ LS +NF  YL+ +  YKY+  
Sbjct  526   FLAILSCLNFINYLYWASWYKYKSD  550



>ref|XP_010252354.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 isoform X1 [Nelumbo nucifera]
Length=613

 Score =   414 bits (1064),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 257/586 (44%), Positives = 360/586 (61%), Gaps = 30/586 (5%)
 Frame = +3

Query  78    EKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVN  257
             E   + D  VDWRGR  + +KHGG+RA++F+LG+  FE MA   +G  L+TY+   M+ +
Sbjct  13    ESMAVEDVSVDWRGRPCKSNKHGGMRAAVFVLGLQAFEIMAIAAVGNNLITYVFNEMHFS  72

Query  258   LADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLK  437
             L+ +AN VTNF G  ++L++V   L+D+Y+G F  +LI  ++E  G  LL++QAH  +L+
Sbjct  73    LSKSANIVTNFIGTVFLLSLVGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLR  132

Query  438   PPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE  617
             PP CN L+  ++C    G  A I F+ALY VA+GS  +K  + SHGADQF + D K+  +
Sbjct  133   PPQCNMLE--QQCSPAKGFKALIFFMALYLVALGSGCLKPNIISHGADQFRKDDHKQSKK  190

Query  618   MSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVY  797
             +S+FFN       VG  ++LTL VW+    G D GF  S  AM  G I    G    R  
Sbjct  191   LSTFFNAAYFAFSVGELIALTLLVWIQTRSGMDVGFGVSAAAMAMGLISLISGTLVCRNK  250

Query  798   VIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELY--EISKDKEAVTICAEF--------L  947
               QG S  T I QV VAA   RK   P +S  L+   IS      T+   F        L
Sbjct  251   RPQG-SIFTPIAQVLVAAFTKRKQICPSNSDMLHGSRISTGASH-TVGGTFASASNTINL  308

Query  948   PHTDKYRFLDKAAIQTSWDEEPN--PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQ  1121
              HTD +RFLDKA I+     + N  PWR+C V+QVE  KI+++++P+F CT+I    LAQ
Sbjct  309   IHTDNFRFLDKACIKIQDGSQLNESPWRLCTVSQVEQVKIIISVIPIFACTIIFNTILAQ  368

Query  1122  LQTFSIQQGSTMDLN-ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTG  1298
             LQTFS+QQGS MD   ITKSFQI P+SL  +P L LIF++PLY+ +FVP  R++TG   G
Sbjct  369   LQTFSVQQGSVMDTRLITKSFQIPPASLQAIPYLMLIFVVPLYETVFVPLARKITGKDAG  428

Query  1299  ITPLHRVAVGlllsslsmaaaailelKRKQVARE-RNMLDAIPILQPLPISVFWLSIQYF  1475
             ITPLHR+ +GL + + SM AAA++E KR+  A E +N L           S+FW++ Q+ 
Sbjct  429   ITPLHRIGIGLFVVTFSMVAAALVEKKRRFAALESKNTL-----------SIFWIAPQFL  477

Query  1476  IFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTE  1655
             IFG+++MFT VGL+EFFY Q+   ++S  +   + S S G++ SS+LV +VN  T   + 
Sbjct  478   IFGLSEMFTAVGLIEFFYKQSLAGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITSN-SS  536

Query  1656  SGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             SGGWL  N++N++ L+ FY LL+ LS +NFF YLF S+ Y Y   +
Sbjct  537   SGGWLSDNDLNKDRLDFFYWLLAALSIINFFNYLFWSRWYSYNPSL  582



>gb|EYU36281.1| hypothetical protein MIMGU_mgv1a004263mg [Erythranthe guttata]
Length=536

 Score =   411 bits (1057),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 245/535 (46%), Positives = 349/535 (65%), Gaps = 15/535 (3%)
 Frame = +3

Query  183   GFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRA  362
               E M     GV+L +Y +G MN +L  +A  +TN+ G  ++L++    ++DTY+ RF+ 
Sbjct  3     ALETMTFSSNGVSLFSYFHGYMNFSLTKSATALTNYLGTAFLLSLFGGFISDTYLSRFKT  62

Query  363   VLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGS  542
              +I  ++E LG  LLA+QAH  +L+P PC  +     CE  +    A+LF +LY VA+G+
Sbjct  63    CVIFGFLEVLGYALLAVQAHLRQLRPFPCKDVVGPAGCEPASTNQEAMLFTSLYLVALGT  122

Query  543   AGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWG  722
              G+KAA+PS GADQFDE + +E + +SS+FNW +  + +G    +T  VW+  ++GWDW 
Sbjct  123   GGIKAALPSLGADQFDEMEPEEAAPLSSYFNWYMFFLNLGAIFGVTFVVWINTNQGWDWS  182

Query  723   FAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYE  902
             F   ++AM    +  ++G   YR     G S +T+I+QVFVAAI NR L LP  + EL+E
Sbjct  183   FGVCSIAMVISVLVLSMGRSVYRNNTPSG-SPLTRILQVFVAAIRNRNLPLPARAEELHE  241

Query  903   ISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPV  1082
             +  DKEA    +E L  TD++RFLD AAI        + W+ C VTQVE  KI++ ++P+
Sbjct  242   L-HDKEAEQ--SETLQRTDQFRFLDHAAI-VRQSAVTDTWKTCTVTQVEETKIIVRMLPI  297

Query  1083  FLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFV  1262
              L TV M  CLAQLQTFSIQQ +T D  I   FQI  SS+P +P+LF+  LIPLYD++FV
Sbjct  298   ILSTVFMNTCLAQLQTFSIQQSTTTDRKIGN-FQIPASSIPLIPLLFMSILIPLYDQVFV  356

Query  1263  PSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLP  1442
             P+ R+ TGIPTGIT L RV +GL+LS++SM  + I+E  RK VA + NM+D+     PLP
Sbjct  357   PTARKFTGIPTGITHLQRVGIGLVLSAISMGVSGIVETHRKSVAVKHNMVDSS---DPLP  413

Query  1443  ISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVK  1622
             +S+FW+ IQY IFG+AD+FT VGLL FFY+++   +KS+ +   W S + GY+TS+V+V 
Sbjct  414   MSIFWIGIQYAIFGVADIFTLVGLLNFFYAESSLGMKSLGTAISWCSFAFGYYTSTVVVN  473

Query  1623  VVNGATKGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             VV       + SGGWL  +N+NR+ LE FY LL+GLS VNF VYL  +  YK+++
Sbjct  474   VV------NSVSGGWLASDNLNRDKLEYFYWLLAGLSVVNFGVYLLCASWYKHKK  522



>ref|XP_007145059.1| hypothetical protein PHAVU_007G206400g [Phaseolus vulgaris]
 gb|ESW17053.1| hypothetical protein PHAVU_007G206400g [Phaseolus vulgaris]
Length=601

 Score =   414 bits (1063),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 250/558 (45%), Positives = 351/558 (63%), Gaps = 24/558 (4%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
             +  + ++ GG RAS+FI  +   +NM  +    +LV Y  GVM+ +L+++AN +TNF G+
Sbjct  4     KEVKDEQKGGFRASMFIFVLLALDNMGFVANMASLVLYFYGVMHFDLSNSANTLTNFLGS  63

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCE  479
             T++L++V   ++DTY  R    L    +E L L + ++QA    L P  C       K  
Sbjct  64    TFLLSLVGGFISDTYFNRLTTCLFFGSLEVLALVIFSVQAALDHLHPDVCG------KSS  117

Query  480   EVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCV  659
              V G  A + + +LY +A+G  GV+ ++ + GADQFDEK+ +E   ++SFFNWLLL   +
Sbjct  118   CVKGGIAVMFYTSLYLLALGMGGVRGSLTAFGADQFDEKNPREAKALASFFNWLLLSSTL  177

Query  660   GGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQV  839
             G  + +T  VW+   K W WGF   TVA   G +   LG PFYR+    G S I +I QV
Sbjct  178   GSVIGVTGVVWVSTQKAWHWGFIIITVASSIGFLTLALGKPFYRIKT-PGQSPILRISQV  236

Query  840   FVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNP  1019
                A  NRKL LPE   ELYE+    E+ T+  E + HT++ RFLD+A+I    + EP  
Sbjct  237   ISVAFKNRKLPLPESHEELYEV---YESATL--ERIAHTNQMRFLDRASILQQ-NIEPQE  290

Query  1020  WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpss  1199
             W+VC VTQVE  KIL  ++P+   T+IM  CLAQLQTFS+QQG+ M+L +   F + P S
Sbjct  291   WKVCTVTQVEEVKILTRMLPILASTIIMNTCLAQLQTFSVQQGNVMNLKLGS-FTVPPPS  349

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
             +P +P+LF+  LIPLY+  FVP  R++T  P+G+TPL RV VGL+LS +SMA A I+E+K
Sbjct  350   IPVIPLLFMCILIPLYEFFFVPFARKITHHPSGVTPLQRVGVGLVLSFISMAVAGIVEVK  409

Query  1380  RKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             R    R++ + D        PIS+FWLS QY IFG+ADMFT VGLLEFFY +AP+ +KS+
Sbjct  410   R----RDQGLKDP-----SRPISLFWLSFQYAIFGVADMFTLVGLLEFFYREAPETMKSL  460

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSF  1736
             S+ F + SMSLGYF S++ V V+N  TK +T S  GWL G + N N+L LFY  L+ LS 
Sbjct  461   STSFTYLSMSLGYFLSTIFVDVINAVTKRITPSKQGWLHGLDFNHNNLNLFYWFLAILSC  520

Query  1737  VNFFVYLFVSKRYKYRQQ  1790
             +NFF YL+ +  YKY+ +
Sbjct  521   INFFNYLYWASWYKYKDE  538



>ref|XP_007221822.1| hypothetical protein PRUPE_ppa002962mg [Prunus persica]
 gb|EMJ23021.1| hypothetical protein PRUPE_ppa002962mg [Prunus persica]
Length=617

 Score =   414 bits (1064),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 251/574 (44%), Positives = 353/574 (61%), Gaps = 22/574 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  +DWRGR +   KHGG+RA+ F+LG+  FE M    +G  L+TY+   M+ +L+ +AN
Sbjct  26    DITLDWRGRPSNPTKHGGMRAAAFVLGLQSFEIMGIAAVGNNLITYVINEMHFSLSKSAN  85

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L +V   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPPPCN 
Sbjct  86    IVTNFIGTVFLLALVGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHIPQLKPPPCNN  145

Query  456   L---DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             +   D  E+C E  G  + I FVALY VA+GS  VK  + +HGADQF+ +  K+  ++S+
Sbjct  146   IAAADNGEECIEAKGFKSLIFFVALYLVAIGSGCVKPNMIAHGADQFNPEIPKQSKKLST  205

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             +FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  +YR    Q
Sbjct  206   YFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLYYRNKPPQ  265

Query  807   GSSAITQIIQVFVAAIHNRKLQLPED----SGELYEISKDKEAVTICAEFLPHTDKYRFL  974
             G S  T I QVFVAA   RK   P +     G    +  D    +  A    HT+K+RFL
Sbjct  266   G-SIFTPIAQVFVAATLKRKQVRPSNPQLLHGSQNNVPNDTTTFSTDAGSFLHTEKFRFL  324

Query  975   DKAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             DKA I  Q   + + +PWR+C VTQV+  KILL+++P+F  T++    LAQLQTFS+QQG
Sbjct  325   DKACIKMQDGTNTKESPWRLCTVTQVKQVKILLSVIPIFASTIVFNTILAQLQTFSVQQG  384

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
             S MD  +TKSF I P+SL  +P + LI ++PLYD  FVP  R+ TG  +GI+PL R+  G
Sbjct  385   SMMDTKLTKSFHIPPASLQSIPYVMLIAVVPLYDTFFVPFARKFTGHDSGISPLKRIGFG  444

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L L++ SM AAAI+E KR+  A   N +          +S+FW++ Q+ IFG+++MFT V
Sbjct  445   LFLATFSMIAAAIMEEKRRDAAVNSNKI----------LSIFWITPQFLIFGLSEMFTAV  494

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGNN  1682
             GL+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T     +  GGWLG NN
Sbjct  495   GLIEFFYKQSLKGMQAFLTAVTYCSYSFGFYLSSLLVSLVNNITSSSSSSGGGGWLGDNN  554

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             +N++ L+LFY LL+GLSF+NF  YLF S  Y + 
Sbjct  555   LNKDRLDLFYWLLAGLSFLNFLNYLFWSNWYSHN  588



>ref|XP_009757572.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X1 [Nicotiana 
sylvestris]
Length=600

 Score =   414 bits (1063),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 244/565 (43%), Positives = 351/565 (62%), Gaps = 22/565 (4%)
 Frame = +3

Query  102   KVDWRGRTARKDK-HGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANH  278
             K+++   ++ K K  GG RAS FI G  G +N+  +   V++V Y +  M+++L+ +AN 
Sbjct  9     KLEYNSVSSYKIKGKGGFRASSFIYGFVGLDNIGFVANMVSMVLYFSFKMHLDLSGSANT  68

Query  279   VTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL  458
             VTN  G+TY+L+I+   ++DTY+ RF  +LI    E L   L+ +QA Y+ L+P  C   
Sbjct  69    VTNLLGSTYLLSIIGGFISDTYLSRFHTILIFGTAEILAWTLMTIQARYSSLQPQVCG--  126

Query  459   DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNW  638
                 K   + G    + + +L  +A+G+ GV+ A+P+ GADQFD KD  E   +  +FNW
Sbjct  127   ----KSNCLEGGIGLLFYGSLCLLALGTGGVRGALPALGADQFDHKDPNEAKALGRYFNW  182

Query  639   LLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSA  818
             LLL    G A+ +T+ VW+  +KGW  GF  S V  F G + F  G PFYR+ V  G S 
Sbjct  183   LLLSSVSGSAIGVTVVVWVSTNKGWWIGFLISLVGTFLGFLIFVFGKPFYRLQV-PGESP  241

Query  819   ITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTS  998
             +T+I+QV   AI NRKLQLPE+S ELYEI+  KE+ ++  + + HT+++R+LDKAAI   
Sbjct  242   LTRILQVIKVAIRNRKLQLPENSEELYEINV-KESDSLEPK-IAHTNQFRYLDKAAILPK  299

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                EP  W VC VT+VE  KIL  ++P+   T++M  CLAQLQTFS+QQG  M+ +    
Sbjct  300   -TVEPTQWTVCTVTKVEEVKILTRMLPIIASTILMNTCLAQLQTFSVQQGYRMNRHFGSF  358

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
                 PS      +   I +   YD +FVP  R++T  P+GIT L RV VGL+LS +SM  
Sbjct  359   EVPAPSVPVIPLLFMCILIPI-YDFVFVPFARKITNHPSGITQLQRVGVGLVLSIISMGI  417

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E+KRK  +  +N L+        PI VFWLS QY IFGIADMFT VG+LEFFY +A
Sbjct  418   AALVEIKRKHQSL-KNPLE--------PIHVFWLSFQYGIFGIADMFTLVGMLEFFYKEA  468

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYA  1715
             P  ++S+S+ F W S+S GY+ SSV V ++N  TK  ++S  GWL G ++++N+L+LFY 
Sbjct  469   PAGMRSLSTSFTWISLSFGYYLSSVFVDIINSVTKRFSQSKKGWLAGQDLDQNNLQLFYW  528

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              L+ LS +NF  YL+ +  YKY+  
Sbjct  529   FLAILSCLNFINYLYWASWYKYKSD  553



>gb|KCW85010.1| hypothetical protein EUGRSUZ_B01831, partial [Eucalyptus grandis]
Length=527

 Score =   411 bits (1056),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 241/532 (45%), Positives = 342/532 (64%), Gaps = 26/532 (5%)
 Frame = +3

Query  192   NMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLI  371
             NMAT+VL      Y   VM+ ++A A+N +T+F G+T++LT+V   ++DTY+ RF   LI
Sbjct  6     NMATLVL------YFLYVMHFDVATASNTLTDFMGSTFLLTLVGGFISDTYLSRFTTCLI  59

Query  372   SAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGV  551
                IE LGL +L ++AH   L P      D   K   + G  A   +  L  +A+G  GV
Sbjct  60    FGSIEVLGLAMLTIEAHSKHLHP------DPRGKSSCIHGGTATYFYATLCLLALGYGGV  113

Query  552   KAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAA  731
             + A P+ GADQFD++D  E   +++FFN+L L    G  + +T  VW+  +KGW WGF  
Sbjct  114   RGAFPALGADQFDQRDPTEAGALATFFNYLTLCTTAGATIGVTAIVWVSMNKGWHWGFLM  173

Query  732   STVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISK  911
             +T+A F   +   +G PFYR+    G S + +I QV + AI NRKL LPE+S +LYEI  
Sbjct  174   ATIASFISFVVLAMGKPFYRLQR-PGDSPLVRIWQVVLLAIKNRKLPLPENSADLYEIG-  231

Query  912   DKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLC  1091
             DKE+  +    + HTD++RFLDKAAI    + +P PW+VC VTQVE  K+L  ++P+   
Sbjct  232   DKESSALAVAKIAHTDQFRFLDKAAILLK-ESKPEPWKVCTVTQVEEVKVLTRMLPILAS  290

Query  1092  TVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSM  1271
             T+IM  C+AQLQTFS+QQG  M+ ++  + ++   S+P +P+LF+  LIP+Y+ +FVP  
Sbjct  291   TIIMNTCMAQLQTFSVQQGQLMEPHL-GTLKVPAPSIPVIPLLFMSILIPIYEFIFVPFA  349

Query  1272  RRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISV  1451
             R+LTG P+GIT L RV VGL+LS +SMA A I+E+KR      RN  +  P   P  IS+
Sbjct  350   RKLTGHPSGITQLQRVGVGLVLSVISMAVAGIVEVKR------RNEFNKTP---PHVISL  400

Query  1452  FWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVN  1631
             FWLS+QY IFGIADMFT VGL+EFFY +AP  ++S+S+ F W S+S GYF SS+ V ++N
Sbjct  401   FWLSLQYGIFGIADMFTLVGLMEFFYKEAPVGMRSLSTSFTWLSLSFGYFLSSIFVNIIN  460

Query  1632  GATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
               T+ ++ S  GWL G N+N+N++ LFY  L+ LS +NF VYL  +  YKY+
Sbjct  461   AVTEKISPSKQGWLHGLNINKNNVNLFYWFLAVLSTLNFGVYLLAASWYKYK  512



>emb|CDO97656.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   414 bits (1063),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 251/560 (45%), Positives = 346/560 (62%), Gaps = 20/560 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR +   KHGG+ A+ F+LG+  FE MA   +G  L+TY+   M+ +L+ +AN VT
Sbjct  22    VDWRGRPSNPSKHGGMGAAAFVLGLQAFEIMAIAAVGNNLITYVINEMHFSLSKSANIVT  81

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  +IL ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN L  
Sbjct  82    NFIGTVFILALLGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHIPQLKPPHCNMLTD  141

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              + C E  G  + I F+ALY VA+GS  VK  + +HGADQF+++  KE  ++S +FN   
Sbjct  142   GDNCVEAEGFKSIIFFMALYLVALGSGCVKPNMIAHGADQFNKEVPKESKKLSRYFNAAY  201

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 VG  V+LT+ VW+  H G D GF  S  AM  G I    G   YR    Q  S +T
Sbjct  202   FAFSVGELVALTILVWVQTHSGMDIGFGVSAAAMAMGLISLVGGTLLYRNKPPQ-RSILT  260

Query  825   QIIQVFVAAIHNRKLQLPED----SGELYEISKDKEAVTICAEF--LPHTDKYRFLDKAA  986
              I QV VAA   RK   P D     G  Y      + +TI      L HT+++RFLDKA 
Sbjct  261   PIAQVLVAATSKRKQVCPSDPRLLHGSHYPKLPSSDNITISENTGDLHHTERFRFLDKAC  320

Query  987   --IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMD  1160
               IQ   + + + WR+C V QVE  KIL++++P+F CT++    LAQLQTFS+QQGS M+
Sbjct  321   IRIQDGNNTKESAWRLCTVNQVEQVKILISVIPIFACTIVFNTILAQLQTFSVQQGSAMN  380

Query  1161  LNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGllls  1340
               ITKSF I P+SL  +P + LIF++PLYD LFVP  RR+TG  +GI+PL R+  GL LS
Sbjct  381   TRITKSFHIPPASLQAIPYIMLIFIVPLYDSLFVPFSRRITGHDSGISPLQRIGFGLFLS  440

Query  1341  slsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLE  1520
             + SM AAA++E KR+  A   N +          IS+FW++ Q+ IFG+++MFT VGL+E
Sbjct  441   TFSMVAAALMENKRRDAAVNSNKI----------ISIFWIAPQFLIFGLSEMFTAVGLIE  490

Query  1521  FFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHL  1700
             FFY Q+ K ++S  +   + S S G++ SSVLV VVN  T   +  GGWL  NN+N++ L
Sbjct  491   FFYKQSLKGMQSFLTAITYCSYSFGFYLSSVLVSVVNKITS-HSSGGGWLSDNNLNKDRL  549

Query  1701  ELFYALLSGLSFVNFFVYLF  1760
             +LFY +L+ LSF+NF  YLF
Sbjct  550   DLFYWMLAALSFINFLNYLF  569



>ref|XP_008459507.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 [Cucumis melo]
Length=575

 Score =   412 bits (1060),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 251/581 (43%), Positives = 357/581 (61%), Gaps = 36/581 (6%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             Q  +E  D  VDWRGR    +KHGG+ A+ F+LG+  FE MA   +G  L+TY+   M+ 
Sbjct  2     QRDHE--DIYVDWRGRACNPNKHGGMGAAAFVLGLQAFEMMAIAAVGNNLITYVFSEMHF  59

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              L+ +AN VTNF G  + L+++   L+D+Y+G FR +LI  +IE  G  +L +QAHY  L
Sbjct  60    PLSKSANVVTNFVGTVFFLSLLGGFLSDSYLGSFRTMLIFGFIELAGFTVLTIQAHYPGL  119

Query  435   KPPPCN---PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
             +P PC     LD+ ++C E  G  A + + ALY VA+GS  +K  + SHGADQF ++D K
Sbjct  120   RPSPCEMGRKLDEEDECIEAKGYEALMFYSALYLVALGSGCLKPNIISHGADQFRKEDPK  179

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +  ++S+FFN      C G  ++LTL VW+  H G D GF  ST AM    I    G  F
Sbjct  180   QFKKLSTFFNCAYFAFCTGELIALTLLVWVQTHSGMDLGFGVSTAAMLLALISLLSGTSF  239

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             YR    +G S  T I QV VAA   R LQ    + E+         V      L HTDK+
Sbjct  240   YRNNPPRG-SIFTPIAQVLVAAYRKRNLQTCASNSEMVLNGTQNGIVK-----LIHTDKF  293

Query  966   RFLDKAAIQTSWD-----EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
             RFLDKA I++  +      E +PW++C V QVE  KI+L+++P+F CT+I    LAQLQT
Sbjct  294   RFLDKACIRSEEERLGSIREESPWKLCTVKQVEQVKIILSVIPIFACTIIFNTILAQLQT  353

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FS+QQG++M+  +T SFQI P+SL  +P + LIFL+PLY+ +FVP  RRLT I +GI+PL
Sbjct  354   FSVQQGASMNTWLTNSFQIPPASLQAIPYIILIFLVPLYETVFVPLARRLTSIDSGISPL  413

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIA  1490
              RV  GL +++ SM +AA++E KR      RN   ++ IL        W++ Q+ IFG++
Sbjct  414   QRVGTGLFVATFSMVSAALVEQKR------RNSSSSLSIL--------WIAPQFVIFGVS  459

Query  1491  DMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWL  1670
             ++FT VGL+EFFY Q+ + ++S  +   + S S G++ SS+LV +VN        SGGWL
Sbjct  460   ELFTAVGLIEFFYKQSVEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKI------SGGWL  513

Query  1671  GGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
               N++N++ L+LFY LL+GLSFVNFF YLF + R+  +Q +
Sbjct  514   SHNDLNKDRLDLFYWLLAGLSFVNFFNYLFWANRFSQQQPL  554



>ref|XP_010930186.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like isoform X1 [Elaeis 
guineensis]
Length=579

 Score =   412 bits (1059),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 231/562 (41%), Positives = 345/562 (61%), Gaps = 13/562 (2%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDW+G    K KHGG+R+S FI  +    N+A +   + LV YL G M++ ++ ++  VT
Sbjct  7     VDWKGNPVNKKKHGGVRSSYFIYFMVVMGNIAFVPNMLNLVNYLQGTMHMGISSSSTTVT  66

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF GA     ++ A L+D+YI RF+ +LI   ++FLG  LLA+QAH   L P  C+   +
Sbjct  67    NFIGAACGFALLGAFLSDSYITRFKTILIFGPVDFLGYALLALQAHLPSLHPSDCDMNGQ  126

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
                CE+V G N+A+L++ALYT A+G   V+A++PS G DQFD+KD  E    +SFFNW  
Sbjct  127   QNNCEQVHGFNSALLYIALYTTALGEGCVRASLPSLGGDQFDDKDPVELQLKTSFFNWFT  186

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
              G+ +GG + LTL VW+  +KGWD GF  S +A+  G +    G+ FYR  + +G S +T
Sbjct  187   FGISLGGFIGLTLVVWIENNKGWDIGFGVSALAILLGVLAVASGVSFYRNQIPKG-SPLT  245

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD  1004
             +I+QVFVAA  NRKL LPE+  +L    +D + +    E LPHT  ++FLDKA+I     
Sbjct  246   RIVQVFVAAFKNRKLVLPENVNQLQHNCEDMDII----EVLPHTKGFKFLDKASINHG--  299

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
              +   W  C VTQVE  KI+L ++P+ + TV+  L    L TF++QQGSTM+  + K   
Sbjct  300   -DTGTWS-CTVTQVEETKIVLRMLPILISTVLGYLPTPVLLTFTVQQGSTMNTKLGK-IH  356

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I P++L  +P++F + ++ +YD+  VP  RR+TG   GIT L RV +G   S+L+   AA
Sbjct  357   ISPATLFVIPVIFQMVILVIYDQFIVPFARRITGYVGGITNLQRVGIGFAASALATCVAA  416

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             ++E KRK +  E  + D       +P+SVFWL++Q+F+ GI D+ ++VGLLEFF  +A +
Sbjct  417   LVERKRKNIVEEHGLED---FETGVPMSVFWLALQFFLLGIVDVTSFVGLLEFFNGEASR  473

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLS  1724
              +KS+ +   W  + L     + LV +VN AT+      GWL G N+N++HL+ FY L++
Sbjct  474   GMKSIGTAIFWCVLGLASLLGTFLVDMVNKATRHGASGRGWLEGANLNKSHLDWFYWLVT  533

Query  1725  GLSFVNFFVYLFVSKRYKYRQQ  1790
              L  V  F Y++ ++RY YR  
Sbjct  534   ILELVALFNYMYWARRYVYRHD  555



>gb|KHN43381.1| Nitrate transporter 1.2 [Glycine soja]
Length=539

 Score =   410 bits (1055),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 244/526 (46%), Positives = 333/526 (63%), Gaps = 23/526 (4%)
 Frame = +3

Query  216   VTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLG  395
             V++V Y  GVM+ +LA +AN +TNF  +TY+L++V   ++DTY+ RF   L+   +E L 
Sbjct  8     VSIVLYFYGVMHFDLASSANTLTNFMASTYLLSLVGGFISDTYLNRFTTCLLFGSLEVLA  67

Query  396   LGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHG  575
             L +L +QA    L P  C       K   V G  A + + +L  +A+G  GV+ ++ + G
Sbjct  68    LAMLTVQAASKHLHPEACG------KSSCVKGGIAVMFYTSLCLLALGMGGVRGSMTAFG  121

Query  576   ADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFG  755
             ADQFDEKD  E   ++SFFNWLLL   VG    +T  VW+   K W WGF   T+A   G
Sbjct  122   ADQFDEKDPTEAKALASFFNWLLLSSTVGAITGVTGVVWVSTQKAWHWGFFIITIASSVG  181

Query  756   GIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTIC  935
              +   LG PFYR+    G S   +I QV V A  NRKL LPE  GELYEIS DKEA    
Sbjct  182   FVTLALGKPFYRIKT-PGDSPTLRIAQVIVVAFKNRKLSLPESHGELYEIS-DKEAT---  236

Query  936   AEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCL  1115
             AE + HT++ RFLDKAAI    + +P  W+VC VTQVE  KIL  ++P+   T+I+  C+
Sbjct  237   AEKIAHTNQMRFLDKAAIIQE-NSKPKAWKVCTVTQVEEVKILTRVLPIVASTIILNTCM  295

Query  1116  AQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPT  1295
             AQLQTFS+QQG+ MDL +     +   S+P +P++F+  L+PLY+  FVP  R++T  P+
Sbjct  296   AQLQTFSVQQGNVMDLKLGS-LTVPAPSIPVIPLVFISVLVPLYELFFVPFARKITHHPS  354

Query  1296  GITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYF  1475
             GIT L RV VGL+LS++SMA A I+E+KR+   R+             PIS+FWLS QY 
Sbjct  355   GITQLQRVGVGLVLSAISMAVAGIVEVKRRDQGRKD---------PSKPISLFWLSFQYG  405

Query  1476  IFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTE  1655
             IFGIADMFT VGLLEFFY ++P  +KS+S+   W S SLGYF S+V V V+N  +K +T 
Sbjct  406   IFGIADMFTLVGLLEFFYRESPASMKSLSTSLTWLSTSLGYFLSTVFVNVINAVSKRITP  465

Query  1656  SG-GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             S  GWL G ++N+N+L LFY  L+ LS +NFF YL+ + RY+Y+++
Sbjct  466   SKQGWLHGFDLNQNNLNLFYWFLATLSCLNFFNYLYWASRYQYKRE  511



>ref|XP_006470829.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Citrus sinensis]
Length=605

 Score =   412 bits (1060),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 240/569 (42%), Positives = 364/569 (64%), Gaps = 16/569 (3%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
             N+ +  E+ +  VDW+GR +  +KHGG++A++F+LG+  FE MA   +G  L+TY+   M
Sbjct  9     NNNKGTEVEESTVDWKGRPSNPNKHGGMKAAVFVLGLQAFEIMAIAAVGNNLITYVINEM  68

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             + +L+++AN VTNF G  ++L ++   L+D+++G F  +LI  ++E  G  LL++QAH  
Sbjct  69    HFSLSNSANIVTNFIGTVFLLALLGGYLSDSFLGSFWTMLIFGFVELSGFILLSVQAHLP  128

Query  429   KLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKE  608
             +LKPP CN +  +E CEE  G  A+I F+ALY VA+GS  VK  + +HGADQFD+ + K+
Sbjct  129   QLKPPKCNMVTDSENCEEAKGFKASIFFLALYLVAIGSGCVKPNMIAHGADQFDQSNPKQ  188

Query  609   GSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFY  788
               ++SS+FN        G  V+LT+ VW+  H G D GF  S  AM  G      G  +Y
Sbjct  189   SKKLSSYFNAAYFAFSTGELVALTVLVWVQTHSGMDVGFGVSAAAMALGLFSVVSGTLYY  248

Query  789   RVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYR  968
             R    QG S  T I QVFVAA+  RK   P +   L+ ++++       + FL  T ++R
Sbjct  249   RNKRPQG-SIFTPIAQVFVAAMLKRKQICPSNPQMLHGLNQNNVPNDSGSVFL--TQRFR  305

Query  969   FLDKAAIQTS--WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             FLDKA I+     +++ +PWR+C VTQVE  K+L+++VP+F CT+I    LAQLQTFS+Q
Sbjct  306   FLDKACIKVEDGTNKKESPWRLCTVTQVEQVKVLISVVPIFACTIIFNTILAQLQTFSVQ  365

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS M+  +TK+F + P+SL  +P + L+ L+PLYD+ FVP  R+ TG  +GI+PL R+ 
Sbjct  366   QGSAMNNKLTKNFHVPPASLQSIPYIMLVILVPLYDKFFVPFARKYTGHESGISPLQRIG  425

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
              GL L++ SM +AA++E KR+  A     LD+   L     S+F ++ Q+ IFG+++MFT
Sbjct  426   FGLFLATFSMISAALMEKKRRDSA-----LDSGKTL-----SIFSITPQFLIFGLSEMFT  475

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGL+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T   + + GWL  N+
Sbjct  476   AVGLIEFFYKQSLKGMQAFLTAMTYCSYSFGFYLSSLLVSLVNKVTSS-SSNRGWLSEND  534

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             +N++ L+LFY LL+ LSF+NF  YLF S+
Sbjct  535   LNKDRLDLFYWLLAVLSFLNFINYLFWSR  563



>ref|XP_006415085.1| hypothetical protein EUTSA_v10007132mg [Eutrema salsugineum]
 gb|ESQ33438.1| hypothetical protein EUTSA_v10007132mg [Eutrema salsugineum]
Length=600

 Score =   412 bits (1059),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 251/566 (44%), Positives = 352/566 (62%), Gaps = 24/566 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VD+RGR  R  KHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ +AN
Sbjct  23    DLCVDFRGRPCRPSKHGGTRAALFVLGLQAFEMMAIAAVGNNLITYVFNDMHFPLSKSAN  82

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G FR +L+   IE  G  LL++QAH  +L+PP CN 
Sbjct  83    IVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGVIEISGFILLSVQAHVPQLRPPKCNM  142

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
              D   +C E  G  A  L+ AL  VA+GS  +K  + SHGADQF  KD +   ++SSFFN
Sbjct  143   KDTTTQCLEANGYKAVTLYAALCLVALGSGCLKPNIISHGADQFQRKDLR---KLSSFFN  199

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LTL VW+  H G D GF  S   M  G I    G  FYR    +GS 
Sbjct  200   AAYFAFSMGQLIALTLLVWVQTHSGMDIGFGVSAAVMAAGMISLAAGTNFYRNKPPRGSI  259

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLP--HTDKYRFLDKAAI  989
              I  I QVFVAAI  RK   P +    +++S D         F P  HT+K+RFLDKA  
Sbjct  260   FIP-IAQVFVAAITKRKQICPSNKNMHHQLSTD------LVRFKPLLHTNKFRFLDKACF  312

Query  990   QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNI  1169
             +T      +PWR+C + QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+M+ +I
Sbjct  313   KTQGKAMESPWRLCTIEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMNTHI  372

Query  1170  TKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssls  1349
             TK+FQI P+SL  +P + LIF +PLY+  FVP  R+LTG  +GI+PL R+  GL L++ S
Sbjct  373   TKTFQIPPASLQAIPYIILIFFVPLYETFFVPIARKLTGNDSGISPLQRIGTGLFLATFS  432

Query  1350  maaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFY  1529
             M AAA++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT VGL+EFFY
Sbjct  433   MVAAALVEKKRRESFLEQN----------VTLSIFWIAPQFLIFGLSEMFTAVGLVEFFY  482

Query  1530  SQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGNNVNRNHLE  1703
              Q+ + ++S  +   + S S G++ SSVLV  VN  T   G     GWLG N++N++ L+
Sbjct  483   KQSSQSMQSFLTAMTYCSYSFGFYLSSVLVSTVNRVTSSNGPGTREGWLGDNDLNKDRLD  542

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKY  1781
             LFY LL+ LSF+NFF YLF S+ Y +
Sbjct  543   LFYWLLASLSFINFFNYLFWSRWYSF  568



>ref|XP_003592869.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|ABE91872.1| TGF-beta receptor, type I/II extracellular region; ABC transporter 
related [Medicago truncatula]
 gb|AES63120.1| peptide/nitrate transporter [Medicago truncatula]
Length=592

 Score =   412 bits (1058),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 243/569 (43%), Positives = 358/569 (63%), Gaps = 27/569 (5%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             +++  VDWRGR +  + HGG RA+ F+LG+  FE MA   +G  L+TYL   M+ +L  +
Sbjct  24    IMNTTVDWRGRPSNPNNHGGTRAAAFVLGLQAFEIMAIAAVGNNLITYLINEMHFSLPHS  83

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTNF G  +++ ++   L+D+++G F  +LI A +E  G  LL+ QAH+ +LKPPPC
Sbjct  84    ANIVTNFVGTIFLIALLGGYLSDSFLGTFSTILIFALLELSGFILLSAQAHFPELKPPPC  143

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             + L    +C E  G  A I ++A+Y VA+GS  VK  + SHGA QF++   ++  ++S++
Sbjct  144   SKL--GGECIEANGLKALIFYIAIYMVALGSGCVKPNMISHGAHQFNQD--QQSKKLSTY  199

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN       +G  V+LT+ +W+  H G D GFA S  AM  G I F  G  +YR    Q 
Sbjct  200   FNAAYFAFSLGELVALTILIWVQTHSGMDAGFAVSAAAMAMGFISFISGTLYYRNKPPQ-  258

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
              +    I QVFVAAI  RK   P  S ++    ++++          H+DK RFLDKA +
Sbjct  259   PTIFLPIAQVFVAAILKRKKICP-SSLQILHGRENRQ----------HSDKLRFLDKACV  307

Query  990   QTSWDE-EPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLN  1166
             Q + +  + +PWR+C V QVE AKILL+++P+F CT+I    LAQLQTFS+QQGS MD +
Sbjct  308   QEAGNNTKESPWRLCSVAQVEQAKILLSVIPIFACTIIFNTILAQLQTFSVQQGSAMDTH  367

Query  1167  ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssl  1346
             +TKSF I P+SL  +P +FLI ++PLYD LFVP  R++TG  +GI+PL R+ +GL L++ 
Sbjct  368   VTKSFHIPPASLQSIPYIFLIVVVPLYDTLFVPFARKITGHESGISPLQRIGIGLFLATF  427

Query  1347  smaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             SM +AA++E KR+  A   N            +S+FW++ Q+ IFG+++MFT VGL+EFF
Sbjct  428   SMVSAAVMEKKRRDAAVNLNQT----------LSIFWITPQFIIFGLSEMFTAVGLIEFF  477

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLEL  1706
             Y Q+ K +++  +   + S S G++ SS+LV +VN  T   +  GGWL  NN+N++ L+L
Sbjct  478   YKQSLKGMQTFFTAITYCSYSFGFYLSSLLVSLVNKITSTSSGGGGWLHDNNLNKDKLDL  537

Query  1707  FYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             FY LL+ LSF+NF  YLF S+ Y Y   +
Sbjct  538   FYWLLAVLSFLNFINYLFWSRWYSYNPSL  566



>ref|XP_006431440.1| hypothetical protein CICLE_v10000639mg [Citrus clementina]
 gb|ESR44680.1| hypothetical protein CICLE_v10000639mg [Citrus clementina]
Length=605

 Score =   412 bits (1059),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 240/569 (42%), Positives = 363/569 (64%), Gaps = 16/569 (3%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
             N+ +  E+ +  VDW+GR +  +KHGG++A++F+LG+  FE MA   +G  L+TY+   M
Sbjct  9     NNNKGMEVEESTVDWKGRPSNPNKHGGMKAAVFVLGLQAFEIMAIAAVGNNLITYVINEM  68

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             + +L+++AN VTNF G  ++L ++   L+D+++G F  +LI  ++E  G  LL++QAH  
Sbjct  69    HFSLSNSANIVTNFIGTVFLLALLGGYLSDSFLGSFWTMLIFGFVELSGFILLSVQAHLP  128

Query  429   KLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKE  608
             +LKPP CN +  +E CEE  G  A+I F+ALY VA+GS  VK  + +HGADQFD+ + K+
Sbjct  129   QLKPPKCNMVTDSENCEEAKGFKASIFFLALYLVAIGSGCVKPNMIAHGADQFDQSNPKQ  188

Query  609   GSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFY  788
               ++SS+FN        G  V+LT+ VW+  H G D GF  S  AM  G      G  +Y
Sbjct  189   SKKLSSYFNAAYFAFSTGELVALTVLVWVQTHSGMDVGFGVSAAAMALGLFGVVSGTLYY  248

Query  789   RVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYR  968
             R    QG S  T I QVFVAA+  RK   P +   L+ ++++       + FL  T ++R
Sbjct  249   RNKRPQG-SIFTPIAQVFVAAMLKRKQICPSNPQMLHGLNQNNVPNDSGSVFL--TQRFR  305

Query  969   FLDKAAIQTS--WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             FLDKA I+     +++ +PWR+C VTQVE  K+L+++VP+F CT+I    LAQLQTFS+Q
Sbjct  306   FLDKACIKVEDGTNKKESPWRLCTVTQVEQVKVLISVVPIFACTIIFNTILAQLQTFSVQ  365

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS M+  +TK+F + P+SL  +P + L+ L+PLYD+ FVP  R+ TG  +GI+PL R+ 
Sbjct  366   QGSAMNNKLTKNFHVPPASLQSIPYIMLVILVPLYDKFFVPLARKYTGHESGISPLQRIG  425

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
              GL L++ SM +AA++E KR+  A     LD+   L     S+F ++ Q+ IFG+++MFT
Sbjct  426   FGLFLATFSMISAALMEKKRRDSA-----LDSGKTL-----SIFSITPQFLIFGLSEMFT  475

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGL+EFFY Q+ K +++  +   + S S G++ SS+LV  VN  T   + + GWL  N+
Sbjct  476   AVGLIEFFYKQSLKGMQAFLTAMTYCSYSFGFYLSSLLVSFVNKVTSS-SSNRGWLSEND  534

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             +N++ L+LFY LL+ LSF+NF  YLF S+
Sbjct  535   INKDRLDLFYWLLAVLSFLNFINYLFWSR  563



>ref|XP_004290270.1| PREDICTED: probable peptide/nitrate transporter At1g33440-like 
[Fragaria vesca subsp. vesca]
Length=608

 Score =   412 bits (1059),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 245/574 (43%), Positives = 359/574 (63%), Gaps = 25/574 (4%)
 Frame = +3

Query  96    DGKVDWRGR-TARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAA  272
             D  VDWRGR   +  KHGG++A++F+LG+ GFE MA   +G  L+TY+   M+  L+ +A
Sbjct  12    DISVDWRGRPCCKPTKHGGMKAAVFVLGLQGFEMMAIAAVGNNLITYVLNEMHFPLSKSA  71

Query  273   NHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN  452
             N VTNF G  ++L++    L+D+Y+G F  +LI  ++E  G  LL++QAH  +L+PP C 
Sbjct  72    NIVTNFIGTVFLLSLFGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLRPPSCK  131

Query  453   PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFF  632
              +  +E C+E  G  A I F A+Y VA+GS  +K  + SHGADQF ++D K+  ++S++F
Sbjct  132   VMS-SEYCQEAKGYKALIFFAAIYLVALGSGCLKPNIISHGADQFRKEDSKQSKKLSTYF  190

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N      C+G  ++LT+ VW+  H G D GF  S  AM  G I    G   YR    +G 
Sbjct  191   NCAYFSFCMGELIALTVLVWVQTHSGMDVGFGVSAAAMTLGLISLVSGTSMYRNKPPRG-  249

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEA---VTICAEF--LPHTDKYRFLD  977
             S  T I QVFVAA   RK   P ++  L+    +      VT+      L HT+K+RFLD
Sbjct  250   SIFTPIAQVFVAAFTKRKQICPSNTEMLHGNRNNVPNHLFVTMSPNVTTLLHTEKFRFLD  309

Query  978   KAAIQTSWDEE--PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             KA I+T    E   +PWR+C V+QVE  KI++++VP+F CT+I    LAQLQTFS+QQGS
Sbjct  310   KACIKTEDGTERTESPWRLCTVSQVEQVKIIISVVPIFACTIIFNTILAQLQTFSVQQGS  369

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             TM+  IT SF+I P+SL  +P + LIFL+PLY+ +FVP+ R++TG  +GI+PL RV  GL
Sbjct  370   TMNARITGSFKIPPASLQAIPYIMLIFLVPLYETVFVPTARKVTGRDSGISPLQRVGTGL  429

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
              +++ SM +AA++E KR+  A                +S+FW++ Q+ IFG+++MFT VG
Sbjct  430   FIATFSMVSAAVIERKRRNSAEA--------------LSIFWIAPQFLIFGLSEMFTAVG  475

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T   +  GGWL  N++N+
Sbjct  476   LIEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKVT-STSSRGGWLSDNDLNK  534

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             + L+ FY LL+ LS +NFF YLF S  Y+Y   +
Sbjct  535   DKLDRFYWLLAALSLINFFNYLFWSNWYRYNPSL  568



>ref|NP_176183.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q93VV5.1|PTR16_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 4.3; Short=AtNPF4.3; AltName: 
Full=Nitrate transporter 1.14 [Arabidopsis thaliana]
 gb|AAK59542.1| putative oligopeptide transporter protein [Arabidopsis thaliana]
 gb|AAK93718.1| putative oligopeptide transporter protein [Arabidopsis thaliana]
 gb|AEE33611.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=591

 Score =   412 bits (1058),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 250/573 (44%), Positives = 357/573 (62%), Gaps = 21/573 (4%)
 Frame = +3

Query  66    INSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             ++++  +EL + + VDWRGR +  +KHGG+RA++F+LG+  FE M    +G  L+TY+  
Sbjct  16    VSNENNWELAEEESVDWRGRPSNPNKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVIN  75

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
              M+  L+ AAN VTNF G  +I  ++   L+D ++G F  ++I  ++E  G  LL++QAH
Sbjct  76    EMHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTIIIFGFVELSGFILLSVQAH  135

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
               +LKPP CNPL   + CEE  G  A I F+ALY VA+GS  VK  + +HGADQF +   
Sbjct  136   LPQLKPPKCNPLID-QTCEEAKGFKAMIFFMALYLVALGSGCVKPNMIAHGADQFSQSHP  194

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             K+   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  
Sbjct  195   KQSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDIGFGVSAAAMTMGIISLVSGTM  254

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEFLPH  953
             ++R    +  S  T I  V VAAI  RKL  P D   L   + ++ D     + +  LPH
Sbjct  255   YFRNKRPR-RSIFTPIAHVIVAAILKRKLASPSDPRMLHGDHHVAND----VVPSSTLPH  309

Query  954   TDKYRFLDKAAIQ-TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
             T ++RFLDKA I+    + + +PWR+C VTQVE  K L++LVP+F  T++    LAQLQT
Sbjct  310   TPRFRFLDKACIKIQDTNTKESPWRLCTVTQVEQVKTLISLVPIFASTIVFNTILAQLQT  369

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FS+QQGS+M+  ++ SF I P+SL  +P + LIFL+PLYD   VP  R+LTG  +GI PL
Sbjct  370   FSVQQGSSMNTRLSNSFHIPPASLQAIPYIMLIFLVPLYDSFLVPFARKLTGHNSGIPPL  429

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIA  1490
              R+ +GL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFGI+
Sbjct  430   TRIGIGLFLSTFSMVSAAMLEKKR----RDSSVLDG------RILSIFWITPQFLIFGIS  479

Query  1491  DMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWL  1670
             +MFT VGL+EFFY Q+ K ++S      + S S G++ SSVLV VVN  T    +S GWL
Sbjct  480   EMFTAVGLIEFFYKQSAKGMESFLMALTYCSYSFGFYFSSVLVSVVNKITSTSVDSKGWL  539

Query  1671  GGNNVNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             G N++N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  540   GENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR  572



>ref|XP_010930188.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like isoform X1 [Elaeis 
guineensis]
Length=579

 Score =   411 bits (1056),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 232/562 (41%), Positives = 346/562 (62%), Gaps = 13/562 (2%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDW+G    K +HG +R+S FI  +    N+A +   + LV YL+G M++ ++ ++  VT
Sbjct  7     VDWKGNPVNKKRHGAVRSSYFIYFMVVMGNIAFVPNMLNLVNYLHGTMHMGISSSSTTVT  66

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF GA     ++ A L+D+YI RF+ +LI   ++FLG  LLA+QAH   L P  C+   +
Sbjct  67    NFIGAACGFALLGAFLSDSYITRFKTILIFGPVDFLGYALLALQAHLPSLHPSDCDMNGQ  126

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
                CE+V G N+A+L++ALYT A+G   V+AA+PS G DQFD+KD  E    SSFFNW  
Sbjct  127   QNNCEQVHGFNSALLYIALYTTALGEGCVRAALPSLGGDQFDDKDPVELQLKSSFFNWFT  186

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
              G+ +GG + LTL VW+  +KGWD GF  S +A+  G +    G+ FYR  + +G S +T
Sbjct  187   FGISLGGFIGLTLVVWIESNKGWDIGFGVSALAVLLGVLAVAGGVSFYRNQIPKG-SPLT  245

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD  1004
             +I+QVFVAA  NRKL LPE+  +L   S+D + +    E LPHT  ++FLDKA+I     
Sbjct  246   RIVQVFVAAFKNRKLVLPENVDQLQHNSEDMDII----EVLPHTKGFKFLDKASINHG--  299

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
              +   W  C VTQVE  KI+L ++P+ + TV+  L    L TF++QQGSTM+  + K   
Sbjct  300   -DTGTWS-CTVTQVEETKIILRMLPILISTVLGYLPTPVLLTFTVQQGSTMNTKLGK-IH  356

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I P++L  +P++F + ++ +YD+  VP  RR+TG   GIT L RV VG   S+L+   AA
Sbjct  357   ISPATLFVIPVIFQMVILVIYDQFIVPFARRITGYVGGITNLQRVGVGFAASALATCVAA  416

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             ++E KRK +  E  + +       +P+SVFWL++Q+F+ GI D+ ++VGLLEFF  +A +
Sbjct  417   LVERKRKNIVEEHGLEN---FETGVPMSVFWLALQFFLLGIVDVTSFVGLLEFFNGEASR  473

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLS  1724
              +KS+ +   W  + L     + LV +VN AT+      GWL G N+N++HL+ FY L++
Sbjct  474   GMKSIGTAIFWCVLGLASLLGTFLVDMVNKATRHGDTGRGWLEGANLNKSHLDWFYWLVT  533

Query  1725  GLSFVNFFVYLFVSKRYKYRQQ  1790
              L  V  F Y++ ++RY YR  
Sbjct  534   VLELVALFNYMYWARRYVYRHD  555



>ref|XP_009617493.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Nicotiana tomentosiformis]
Length=603

 Score =   412 bits (1059),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 251/576 (44%), Positives = 355/576 (62%), Gaps = 26/576 (5%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             +  VDWRGR +   KHGG++A+ F+LG+ G E M    +G  L+TY+   M+ +L+++AN
Sbjct  21    NSSVDWRGRPSNSIKHGGMKAAAFVLGLQGLEIMGIAAVGNNLITYVINEMHFSLSESAN  80

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  +IL+++   L+D+Y+  F  +LI A++E  G  LL++QAH  +LKPP CN 
Sbjct  81    IVTNFIGTVFILSLLGGYLSDSYLASFWTLLIFAFVELSGFILLSVQAHLPQLKPPKCNN  140

Query  456   L----DKAEK-CEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEM  620
             +    D  ++ C E  G  A I FVALY VA+GS  VK  + SHGADQF+ +  K+  ++
Sbjct  141   MLNTHDNGDQLCAEAKGFKALIFFVALYLVALGSGCVKPNMISHGADQFNHQ--KQSKQL  198

Query  621   SSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYV  800
             S +FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  FYR   
Sbjct  199   SRYFNAAYFAFSMGQLIALTLLVWVQTHSGMDVGFGVSAAAMALGLITLVAGTFFYRNKP  258

Query  801   IQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE----FLPHTDKYR  968
              QG S  T I QV VAA  NRK   P D+  L+     K      +      L HT+++R
Sbjct  259   PQG-SIFTPIAQVLVAAFLNRKHISPSDTRMLHGTHTIKNVNPTMSHDNIGILLHTNRFR  317

Query  969   FLDKAAIQT---SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSI  1139
             FLDKA I+    +  +E + WR+C VTQVE  KIL++++P+F CT+I    LAQLQTFS+
Sbjct  318   FLDKACIKVQDGNNTKEISRWRLCTVTQVEQVKILISVIPIFACTIIFNTILAQLQTFSV  377

Query  1140  QQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRV  1319
             QQGSTM+  +TK+F I P+SL  +P + LIF++PLYD  FVP  R+ TG  +GITPL R+
Sbjct  378   QQGSTMNTKLTKNFHIPPASLQSIPYILLIFIVPLYDTFFVPFARKFTGHDSGITPLQRI  437

Query  1320  AVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMF  1499
              +GL +++ SM +AA++E KR+      N            IS+FW++ Q+ IFGI++MF
Sbjct  438   GLGLFIATFSMVSAALMENKRRISVVNENK----------TISIFWITPQFLIFGISEMF  487

Query  1500  TYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGN  1679
             T VGL+EFFY Q+ K ++S  +   + S S G++ SS+LV +VN  T   +  GGWL  N
Sbjct  488   TAVGLIEFFYKQSLKGMQSFLTAITYCSYSFGFYLSSLLVSLVNKTTSN-SSHGGWLSDN  546

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
             N+N++ L+LFY LL+ LSF+NFF YLF +  Y   Q
Sbjct  547   NLNKDRLDLFYWLLAVLSFLNFFNYLFWATWYSKNQ  582



>gb|KHN11039.1| Putative peptide/nitrate transporter [Glycine soja]
Length=588

 Score =   411 bits (1056),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 241/567 (43%), Positives = 351/567 (62%), Gaps = 27/567 (5%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR +  + HGG RAS F+LG+   E MA   +G  L+TY+   M+ +L+ +AN VT
Sbjct  11    VDWRGRPSNPNVHGGTRASAFVLGLQACEIMAIAAVGNNLITYVINEMHFSLSKSANVVT  70

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPPPCN    
Sbjct  71    NFVGTIFLLALLGGYLSDSYLGSFWTILIFGFVELSGFILLSVQAHLPQLKPPPCNMFFD  130

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E C E  G  A I F+A+Y VA+GS  VK  + +HGADQF++++ K+  ++S++FN   
Sbjct  131   GEHCTEAKGFKALIFFLAIYLVALGSGCVKPNMIAHGADQFNQENPKQLKKLSTYFNAAY  190

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 VG  V+LT+ VW+  H G D GF  S   M  G I    G  +YR    QGS  I 
Sbjct  191   FAFSVGELVALTILVWVQTHSGMDAGFGVSAAVMTMGLISLICGTLYYRNKPPQGSIFIP  250

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQ----  992
              + QVFVAAI  RK   P +   L+    +            HT+K+RFLDKA I+    
Sbjct  251   -VAQVFVAAILKRKQICPSNPQMLHGSQSNVAR--------KHTNKFRFLDKACIRVQQG  301

Query  993   ---TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
                +S D + +PW +C V QVE AKILL+++P+F  T++    LAQLQTFS+QQGS+MD 
Sbjct  302   TGSSSNDTKESPWILCSVAQVEQAKILLSVIPIFASTIVFNTILAQLQTFSVQQGSSMDT  361

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
             ++TKSF + P+SL  +P + LI ++PLYD  FVP  R++TG  +GI+PL R+  GL L++
Sbjct  362   HLTKSFHVPPASLQSIPYILLIVVVPLYDSFFVPFARKITGHESGISPLQRIGFGLFLAT  421

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM +AA++E KR+  A   N            IS+FW++ Q+ IFG+++MFT VGL+EF
Sbjct  422   FSMISAALVEKKRRDAAVNLNE----------TISIFWITPQFLIFGLSEMFTAVGLIEF  471

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ K +++  +   + S S G++ SS+LV +VN  +   + +GGWL  N++N++ L+
Sbjct  472   FYKQSLKGMQTFFTAITYCSYSFGFYLSSLLVSMVNNISSS-SSTGGWLHDNDLNKDKLD  530

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYR  1784
              FY LL+ LSF+NF  YLF S+ Y Y+
Sbjct  531   FFYWLLAALSFLNFLNYLFWSRWYSYK  557



>ref|XP_010930189.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like isoform X2 [Elaeis 
guineensis]
Length=579

 Score =   410 bits (1054),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 233/562 (41%), Positives = 345/562 (61%), Gaps = 13/562 (2%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWR     K  HGG+R+S FI  +    N+A +   + LV YL+G M++ ++ ++  VT
Sbjct  7     VDWRVNPVNKKSHGGVRSSYFIYFMVVMGNIAFVPNMLNLVNYLHGTMHMGISSSSTTVT  66

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF GA     ++ A L+D+YI RF+ +LI   ++FLG  LLA+QAH   L P  C+   +
Sbjct  67    NFIGAACGFALLGAFLSDSYITRFKTILIFGPVDFLGYALLALQAHLPSLHPSDCDMNGQ  126

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
                CE+V G N+A+L++ALYT A+G   V+AA+PS G DQFD+KD  E    SSFFNW  
Sbjct  127   QNNCEQVHGFNSALLYIALYTTALGEGCVRAALPSLGGDQFDDKDPVELQLKSSFFNWFT  186

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
              G+ +GG + LTL VW+  +KGWD GF  S +A+  G +    G+ FYR  + +G S +T
Sbjct  187   FGISLGGFIGLTLVVWIESNKGWDIGFGVSALAVLLGVLAVAGGVSFYRNQIPKG-SPLT  245

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD  1004
             +I+QVFVAA  NRKL LPE+  +L   S+D + +    E LPHT  ++FLDKA+I     
Sbjct  246   RIVQVFVAAFKNRKLVLPENVDQLQHNSEDMDII----EVLPHTKGFKFLDKASINHG--  299

Query  1005  EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfq  1184
              +   W  C VTQVE  KI+L ++P+ + TV+  L    L TF++QQGSTM+  + K   
Sbjct  300   -DTGTWS-CTVTQVEETKIILRMLPILISTVLGYLPTPVLLTFTVQQGSTMNTKLGK-IH  356

Query  1185  ilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaa  1364
             I P++L  +P++F + ++ +YD+  VP  RR+TG   GIT L RV VG   S+L+   AA
Sbjct  357   ISPATLFVIPVIFQMVILVIYDQFIVPFARRITGYVGGITNLQRVGVGFAASALATCVAA  416

Query  1365  ilelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPK  1544
             ++E KRK +  E  + +       +P+SVFWL++Q+F+ GI D+ ++VGLLEFF  +A +
Sbjct  417   LVERKRKNIVEEHGLEN---FETGVPMSVFWLALQFFLLGIVDVTSFVGLLEFFNGEASR  473

Query  1545  ELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYALLS  1724
              +KS+ +   W  + L     + LV +VN AT+      GWL G N+N++HL+ FY L++
Sbjct  474   GMKSIGTAIFWCVLGLASLLGTFLVDMVNKATRHGDTGRGWLEGANLNKSHLDWFYWLVT  533

Query  1725  GLSFVNFFVYLFVSKRYKYRQQ  1790
              L  V  F Y++ ++RY YR  
Sbjct  534   VLELVALFNYMYWARRYVYRHD  555



>ref|XP_011003705.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Populus euphratica]
Length=612

 Score =   411 bits (1056),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 241/566 (43%), Positives = 348/566 (61%), Gaps = 18/566 (3%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRG+ +  +KHGG+RA+ F+LG+  FE MA   +G  L+TY+   M+  L+ AAN VT
Sbjct  22    VDWRGKPSNPNKHGGMRAAAFVLGLQAFEIMAIAAVGNNLITYVINEMHFPLSKAANTVT  81

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  +IL ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN L  
Sbjct  82    NFVGTIFILALLGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPQCNMLTD  141

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E C E  G  A I FVALY VA+GS  VK  + +HG DQF++ + K+  ++S++FN   
Sbjct  142   GENCVEAKGVKAFIFFVALYLVALGSGCVKPNMIAHGGDQFNQSNPKQSKKLSTYFNAAY  201

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G   +LTL VW+  H G D GF  S   M  G I    G  +YR    QG S +T
Sbjct  202   FAFSMGELFALTLIVWIQTHSGMDVGFGVSAAVMAMGLISLVSGNLYYRNKPPQG-SILT  260

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISK---DKEAVTICAE--FLPHTDKYRFLDKAA-  986
              I QVFVAAI  RK   P +   L+       D   V   A+   L HT ++RFLDKA  
Sbjct  261   PIAQVFVAAILKRKQICPSNPQLLHGSQNSVLDNGIVAPSADSGSLAHTQRFRFLDKACI  320

Query  987   -IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
              I+   + + +PWR+C VTQVE  KIL++ +P+F CT++    LAQLQTFS+QQG  MD 
Sbjct  321   KIEDGTNIKESPWRLCSVTQVEQVKILISAIPIFACTIVFNTILAQLQTFSVQQGGAMDT  380

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              + KSF I P+SL  +P + LI ++PLYD  FVP  R++TG  +GI+PL R+  GL  ++
Sbjct  381   QLAKSFHIPPASLQSIPYIILIIVVPLYDTFFVPLARKITGHESGISPLQRIGAGLFFAT  440

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM +AAI+E KR+  A + N +          +S+FW++ Q+ IFG+++M T VGL+EF
Sbjct  441   FSMVSAAIMEKKRRDAAVDSNKI----------LSIFWITPQFLIFGLSEMLTAVGLIEF  490

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ K +++  +   + S S G++ SS+LV +VN  T   + + GWL  N++N++ L+
Sbjct  491   FYKQSLKGMQAFLTAITYCSYSFGFYLSSLLVSLVNKITSSSSSNQGWLSDNDLNKDRLD  550

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKY  1781
             LFY +L+ LSF+NF  YLF ++ + Y
Sbjct  551   LFYWMLAVLSFLNFLSYLFWARWHSY  576



>ref|XP_010930190.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Elaeis guineensis]
Length=579

 Score =   410 bits (1053),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 231/566 (41%), Positives = 345/566 (61%), Gaps = 13/566 (2%)
 Frame = +3

Query  93    IDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAA  272
             I G VDWRG    K +HGG+R S FI  +    N+A +   + LV YL+G M++ ++ ++
Sbjct  3     IQGFVDWRGNPVNKKRHGGVRTSYFIYFMVVMGNIAHMANVLNLVKYLHGTMHMGISSSS  62

Query  273   NHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN  452
               VTNF GA    +++ A ++D++I RF+ +LI   + FLG  LLA+QAH   L P  C 
Sbjct  63    TTVTNFIGAACGFSLLGAFVSDSFITRFKTILIFGPVAFLGYALLALQAHLPSLHPSDCE  122

Query  453   PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFF  632
                + + CE+V G N+A+L +ALYT+A+G   V+AA+PS G DQFD+KD  E     SFF
Sbjct  123   INGQQKNCEQVHGFNSALLCIALYTIALGEGCVRAALPSLGGDQFDDKDPAESQLKVSFF  182

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             NW   G+ +GG + LTL VW+  +KGWD GF  S++ +  G +    G  FYR+ + +G 
Sbjct  183   NWFTFGISLGGFIGLTLVVWIENNKGWDIGFGVSSLTILLGLVAVASGASFYRIQITKG-  241

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQ  992
             S +T+I+QVFVAA  NRKL LPE+  +L   S+D + +    E LPHT  ++FLDKA+I 
Sbjct  242   SPLTRILQVFVAAFKNRKLVLPENLDQLQHNSEDMDGI----EGLPHTKGFKFLDKASIN  297

Query  993   TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNIT  1172
                  +   W  C VTQVE  KI+L ++PV + +V+  +    L TF++QQGSTM+  + 
Sbjct  298   HG---DTGTWS-CTVTQVEETKIVLQMLPVLISSVLGYISSPLLVTFTVQQGSTMNTKLG  353

Query  1173  KsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsm  1352
             K   I P++L  +P++F + ++ +YD+  VP  RR+TG   G+T L RV VG   S+L+ 
Sbjct  354   K-IHISPATLFVIPLIFQMVILVIYDQFIVPFARRITGYVGGVTILQRVGVGFAASALAT  412

Query  1353  aaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYS  1532
               AA++E KRK +  E  + D       +P+SVFWL +Q+F+ GI D+ ++VGLLEFF  
Sbjct  413   CVAALVERKRKNLVEEHGLED---FETGVPMSVFWLGVQFFLTGIVDVTSFVGLLEFFNG  469

Query  1533  QAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFY  1712
             +A + +KS+ +   W  + L     ++LV +VN AT+      GWL G N+N++HL+ FY
Sbjct  470   EASRGMKSIGTAIFWCVVGLASLLGTLLVDMVNKATRDGDGGRGWLEGTNLNKSHLDRFY  529

Query  1713  ALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              LL+ L       YL+ ++RY YR  
Sbjct  530   WLLTVLELAALLNYLYWARRYVYRHD  555



>ref|XP_003540130.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Glycine max]
Length=612

 Score =   411 bits (1056),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 241/567 (43%), Positives = 351/567 (62%), Gaps = 27/567 (5%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR +  + HGG RAS F+LG+   E MA   +G  L+TY+   M+ +L+ +AN VT
Sbjct  35    VDWRGRPSNPNVHGGTRASAFVLGLQACEIMAIAAVGNNLITYVINEMHFSLSKSANVVT  94

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPPPCN    
Sbjct  95    NFVGTIFLLALLGGYLSDSYLGSFWTILIFGFVELSGFILLSVQAHLPQLKPPPCNMFFD  154

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E C E  G  A I F+A+Y VA+GS  VK  + +HGADQF++++ K+  ++S++FN   
Sbjct  155   GEHCTEAKGFKALIFFLAIYLVALGSGCVKPNMIAHGADQFNQENPKQLKKLSTYFNAAY  214

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 VG  V+LT+ VW+  H G D GF  S   M  G I    G  +YR    QGS  I 
Sbjct  215   FAFSVGELVALTILVWVQTHSGMDAGFGVSAAVMTMGLISLICGTLYYRNKPPQGSIFIP  274

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQ----  992
              + QVFVAAI  RK   P +   L+    +            HT+K+RFLDKA I+    
Sbjct  275   -VAQVFVAAILKRKQICPSNPQMLHGSQSNVAR--------KHTNKFRFLDKACIRVQQG  325

Query  993   ---TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
                +S D + +PW +C V QVE AKILL+++P+F  T++    LAQLQTFS+QQGS+MD 
Sbjct  326   TGSSSNDTKESPWILCSVAQVEQAKILLSVIPIFASTIVFNTILAQLQTFSVQQGSSMDT  385

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
             ++TKSF + P+SL  +P + LI ++PLYD  FVP  R++TG  +GI+PL R+  GL L++
Sbjct  386   HLTKSFHVPPASLQSIPYILLIVVVPLYDSFFVPFARKITGHESGISPLQRIGFGLFLAT  445

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM +AA++E KR+  A   N            IS+FW++ Q+ IFG+++MFT VGL+EF
Sbjct  446   FSMISAALVEKKRRDAAVNLNE----------TISIFWITPQFLIFGLSEMFTAVGLIEF  495

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ K +++  +   + S S G++ SS+LV +VN  +   + +GGWL  N++N++ L+
Sbjct  496   FYKQSLKGMQTFFTAITYCSYSFGFYLSSLLVSMVNNISSS-SSTGGWLHDNDLNKDKLD  554

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYR  1784
              FY LL+ LSF+NF  YLF S+ Y Y+
Sbjct  555   FFYWLLAALSFLNFLNYLFWSRWYSYK  581



>ref|XP_006302056.1| hypothetical protein CARUB_v10020041mg [Capsella rubella]
 gb|EOA34954.1| hypothetical protein CARUB_v10020041mg [Capsella rubella]
Length=586

 Score =   410 bits (1053),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 250/569 (44%), Positives = 356/569 (63%), Gaps = 21/569 (4%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             +    +EL + + VDWRGR +   KHGG+RA++F+LG+  FE M    +G  L+TY+   
Sbjct  18    DEMNNWELAEEESVDWRGRPSNPTKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQAHM  137

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPP CNPL   + CEE   + A I F+ALY VA+GS  VK  + +HGADQF +   K
Sbjct  138   PQLKPPKCNPLID-QTCEE--AKKAMIFFMALYLVALGSGCVKPNMIAHGADQFSQSHPK  194

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  195   QSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDIGFGVSAAAMTLGLISLVSGTMY  254

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             +R    +  S  T I+QV VAAI  RKL  P D   ++ ++ D     + +  LPHT ++
Sbjct  255   FRNKRPR-RSIFTPIVQVVVAAILKRKLVSPSDP-RMFHVAND----VVPSSTLPHTPRF  308

Query  966   RFLDKAAIQT-SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
              FLDKA I+T   + + +PWR+C VTQVE  K L++LVP+F  T++    LAQLQTFS+Q
Sbjct  309   SFLDKACIKTQDTNTKESPWRLCTVTQVEQVKTLISLVPIFASTIVFNTILAQLQTFSVQ  368

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS+M+  ++ SF I P+SL  +P + LIFL+PLYD L VP  R+LTG  +GI PL R+ 
Sbjct  369   QGSSMNTRLSNSFHIPPASLQAIPYIMLIFLVPLYDSLLVPFARKLTGHNSGIPPLTRIG  428

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
             +GL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFGI++MFT
Sbjct  429   IGLFLSTFSMVSAAMLEKKR----RDSSVLDGN------ILSIFWITPQFLIFGISEMFT  478

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGL+EFFY Q+ K ++S      + S + G++ SSVLV VVN  T    +S GWLG N+
Sbjct  479   AVGLIEFFYKQSAKGMESFLMALTYCSYAFGFYFSSVLVSVVNKITSTSVDSKGWLGEND  538

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             +N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  539   LNKDRLDLFYWLLAVLSLLNFLSYLFWSR  567



>ref|XP_006385186.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP62983.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=613

 Score =   410 bits (1054),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 240/566 (42%), Positives = 347/566 (61%), Gaps = 18/566 (3%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRG+ +  +KHGG+RA+ F+LG+  FE MA   +G  L+TY+   M+  L+ AAN VT
Sbjct  22    VDWRGKPSNPNKHGGMRAAAFVLGLQAFEIMAIAAVGNNLITYVINEMHFPLSKAANTVT  81

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  +IL ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN L  
Sbjct  82    NFVGTIFILALLGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPQCNMLTD  141

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E C E  G  + I FVALY VA+GS  VK  + +HG DQF++ + K+  ++S++FN   
Sbjct  142   GENCVEAKGVKSLIFFVALYLVALGSGCVKPNMIAHGGDQFNQSNPKQSKKLSTYFNAAY  201

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G   +LTL VW+  H G D GF  S   M  G I    G  +YR    QG S  T
Sbjct  202   FAFSMGELFALTLLVWIQTHSGMDVGFGVSAAVMAMGLISLVSGNLYYRNKPPQG-SIFT  260

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISK---DKEAVTICAE--FLPHTDKYRFLDKAA-  986
              I QVFVAAI  RK   P +   L+       D   V   A+   L HT ++RFLDKA  
Sbjct  261   PIAQVFVAAILKRKQICPSNPQMLHGSQNSVLDNGIVAPSADSGSLAHTQRFRFLDKACI  320

Query  987   -IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
              I+   + + +PWR+C VTQVE  KIL++ +P+F CT++    LAQLQTFS+QQG  MD 
Sbjct  321   KIEDGTNIKESPWRLCSVTQVEQVKILISAIPIFACTIVFNTILAQLQTFSVQQGGAMDT  380

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              + KSF I P+SL  +P + LI ++PLYD  FVP  R++TG  +GI+PL R+  GL  ++
Sbjct  381   QLAKSFHIPPASLQSIPYIILIIVVPLYDTFFVPLARKITGHESGISPLQRIGAGLFFAT  440

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM +AAI+E KR+  A + N +          +S+FW++ Q+ IFG+++M T VGL+EF
Sbjct  441   FSMVSAAIMEKKRRDAAVDSNKI----------LSIFWITPQFLIFGLSEMLTAVGLIEF  490

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ K +++  +   + S S G++ SS+LV +VN  T   + + GWL  N++N++ L+
Sbjct  491   FYKQSLKGMQAFLTAITYCSYSFGFYLSSLLVSLVNKITSSSSSNQGWLSDNDLNKDRLD  550

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKY  1781
             LFY +L+ LSF+NF  YLF ++ + Y
Sbjct  551   LFYWMLAVLSFLNFLSYLFWARWHSY  576



>ref|XP_009624590.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Nicotiana tomentosiformis]
Length=597

 Score =   409 bits (1051),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 243/568 (43%), Positives = 354/568 (62%), Gaps = 20/568 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             +  +DWRG+ +   KHGG++A+ F+LG+ GFE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  15    ETTLDWRGKPSNSLKHGGMKAAAFVLGVQGFEIMAIAAVGNNLITYVINEMHFSLSKSAN  74

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN 
Sbjct  75    VVTNFIGTVFLLALLGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPNCNM  134

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR-KEGSEMSSFF  632
             +   E C E  G  A I F ALY VA+GS  VK  + +HGADQF+ +D  K+  ++S +F
Sbjct  135   VTDGEHCVEAKGFKALIFFTALYLVALGSGCVKPNMIAHGADQFNYQDNPKQSKQLSRYF  194

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N       +G  ++LT+ VW+  H G D GF  S  AM  G I    G   YR    QG 
Sbjct  195   NAAYFAFSMGELIALTVLVWVQTHSGMDLGFGISAAAMAMGLISLVGGTLLYRNKPPQG-  253

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEF--LPHTDKYRFLD  977
             S  T ++QVF+ A   RK   P D+  L   + I       TI  +   L HT+++RFLD
Sbjct  254   SIFTPMVQVFMTAFSKRKEVCPSDARVLHGSHSIKGPNSNATISDDMAILHHTNQFRFLD  313

Query  978   KAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             KA I  Q     + +PW++C V QVE  KIL++++P+F CT++    LAQLQTFS+QQGS
Sbjct  314   KACIKVQDGNSTKESPWKLCTVNQVEQVKILISVIPIFACTIVFNTILAQLQTFSVQQGS  373

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             +M+  +TKSF I P+SL  +P + LIFL+PLYD  FVP  R++TG  +G+TPL R+ +GL
Sbjct  374   SMNTKLTKSFHIPPASLQAIPYIMLIFLVPLYDTFFVPFARKITGHDSGVTPLQRIGLGL  433

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
              +++ SM +AA++E KR+  A   N            +S+FW++ Q+ IFG+++MFT VG
Sbjct  434   FVATFSMVSAALMEYKRRNAAVILNK----------TLSIFWITPQFLIFGVSEMFTAVG  483

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+ K ++S  +   + S S G++ SSVLV +VN  T   +  GGWL  NN+N+
Sbjct  484   LIEFFYKQSVKGMQSFLTAITYCSYSFGFYLSSVLVSLVNKITSN-SSHGGWLSDNNLNK  542

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             + L+LFY LL+ LSF+NFF YLF ++ Y
Sbjct  543   DRLDLFYWLLAVLSFLNFFNYLFWARWY  570



>ref|XP_007153917.1| hypothetical protein PHAVU_003G076000g [Phaseolus vulgaris]
 gb|ESW25911.1| hypothetical protein PHAVU_003G076000g [Phaseolus vulgaris]
Length=584

 Score =   409 bits (1050),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 246/559 (44%), Positives = 347/559 (62%), Gaps = 22/559 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             +DWRGR +   KHGG+  + FILG+  FE MA   +G  L+TY+   M+ +L+ AAN VT
Sbjct  23    LDWRGRPSDPAKHGGVLPAAFILGLQAFEIMAIAAVGNNLITYVTNDMHFSLSKAANVVT  82

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKP PCN L  
Sbjct  83    NFVGTIFLLALLGGYLSDSYLGSFWTMLIFGFLELSGFILLSVQAHVPQLKPAPCNVLTD  142

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E C E  G  A I FVALY VA+GS  VK  + ++G DQF++ + K+  ++S++FN   
Sbjct  143   GEHCAEAKGFKAVIFFVALYLVALGSGCVKPNMLAYGGDQFEQDNPKQSKKLSTYFNAAY  202

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 VG  VSLT+ VW+  H G D GF  S   M  G I    G  +YR    QG S +T
Sbjct  203   FAFSVGELVSLTILVWVQTHSGMDVGFGVSAAVMAMGLISLICGTLYYRNKPPQG-SILT  261

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI--QTS  998
              I QV VAAI  R L LP +   L+  S++   + +       +DK  FLDKA I  Q  
Sbjct  262   PIAQVLVAAISKRNLVLPSNPQMLHG-SQNNTGLLL-------SDKLGFLDKACIRVQEG  313

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
              + + + WR+C V QVE  KILL+++P+F CT++    LAQLQTFS+QQG  MD ++TKS
Sbjct  314   ENRKESAWRLCSVEQVEQVKILLSVIPIFSCTIVFNTILAQLQTFSVQQGRAMDSHLTKS  373

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
             F I P+SL  +P + LI L+PLYD  FVP  R++TG  +GI+PL R+  GL L++ SM A
Sbjct  374   FNIPPASLQSIPYILLIVLVPLYDTFFVPFARKITGHESGISPLRRIGFGLFLATFSMVA  433

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E KR+  A   N            +S+FW++ Q+ IFG+++MFT +GLLEFFY Q+
Sbjct  434   AAVMEKKRRDAAVNLNQT----------LSIFWITPQFLIFGLSEMFTAIGLLEFFYKQS  483

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYAL  1718
              K +++  +   + S S G++ S+VLV +VN  T   + +GGWL  NN+N++ L+LFY L
Sbjct  484   LKGMQAFLTAITYCSYSFGFYFSTVLVSLVNKITS-TSSTGGWLHYNNLNQDRLDLFYWL  542

Query  1719  LSGLSFVNFFVYLFVSKRY  1775
             L+ LSF+NF  YLF SKRY
Sbjct  543   LAVLSFLNFLNYLFWSKRY  561



>ref|NP_174610.2| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q56XQ6.1|PTR15_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 4.4; Short=AtNPF4.4; AltName: 
Full=Nitrate transporter 1.13 [Arabidopsis thaliana]
 dbj|BAD95216.1| nitrate transporter NTL1 [Arabidopsis thaliana]
 gb|AEE31595.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=601

 Score =   409 bits (1051),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 252/573 (44%), Positives = 357/573 (62%), Gaps = 21/573 (4%)
 Frame = +3

Query  63    LINSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             +I++ E+  L D  VD+RGR  R  KHGG RA++F+LG   FE MA   +G  L+TY+  
Sbjct  14    VIHTSEE-SLDDLCVDFRGRPCRPSKHGGTRAALFVLGFQAFEMMAIAAVGNNLITYVFN  72

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
              M+  L+ +AN VTNF G  ++L+++   L+D+Y+G FR +L+   IE  G  LL++QAH
Sbjct  73    EMHFPLSKSANLVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGVIEISGFILLSVQAH  132

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
               +L+PP CN       C E  G  AA L+ AL  VA+GS  +K  + SHGA+QF  KD 
Sbjct  133   LPELRPPECNMKSTTIHCVEANGYKAATLYTALCLVALGSGCLKPNIISHGANQFQRKDL  192

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             +   ++SSFFN       +G  ++LTL VW+  H G D GF  S   M  G I    G  
Sbjct  193   R---KLSSFFNAAYFAFSMGQLIALTLLVWVQTHSGMDVGFGVSAAVMAAGMISLVAGTS  249

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
             FYR     G S  T I QVFVAAI  RK   P +   +++ S D   V    + L H++K
Sbjct  250   FYRNKPPSG-SIFTPIAQVFVAAITKRKQICPSNPNMVHQPSTDLVRV----KPLLHSNK  304

Query  963   YRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             +RFLDKA I+T      +PWR+C + QV   KILL+++P+F CT+I    LAQLQTFS+Q
Sbjct  305   FRFLDKACIKTQGKAMESPWRLCTIEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQ  364

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS+M+ +ITK+FQI P+SL  +P + LIF +PLY+  FVP  R+LTG  +GI+PL R+ 
Sbjct  365   QGSSMNTHITKTFQIPPASLQAIPYIILIFFVPLYETFFVPLARKLTGNDSGISPLQRIG  424

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
              GL L++ SM AAA++E KR++   E+N++          +S+FW++ Q+ IFG+++MFT
Sbjct  425   TGLFLATFSMVAAALVEKKRRESFLEQNVM----------LSIFWIAPQFLIFGLSEMFT  474

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGG  1676
              VGL+EFFY Q+ + ++S  +   + S S G++ SSVLV  VN  T   G     GWLG 
Sbjct  475   AVGLVEFFYKQSSQSMQSFLTAMTYCSYSFGFYLSSVLVSTVNRVTSSNGSGTKEGWLGD  534

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             N++N++ L+ FY LL+ LSF+NFF YLF S+ Y
Sbjct  535   NDLNKDRLDHFYWLLASLSFINFFNYLFWSRWY  567



>ref|XP_009421158.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   409 bits (1050),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 244/569 (43%), Positives = 353/569 (62%), Gaps = 19/569 (3%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             L +  +DWRGR  + DKHGG+RA++F+LGI   E MA   +G  L+TY+   M+ +L+ +
Sbjct  15    LAEVSLDWRGRPCKHDKHGGMRAAVFVLGIQACEIMAIAAVGNNLITYVFNEMHFSLSMS  74

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTNF G  +IL+++   L+D+Y+G F  +L   ++E  G  LLA+QAH  +L+PPPC
Sbjct  75    ANVVTNFVGTIFILSLLGGFLSDSYLGSFWTMLTFGFVELSGFILLAVQAHLPQLRPPPC  134

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             N +   E+C E  G  AA+ F+ALY VA+GS  +K  + +HGADQF   D K+  ++S++
Sbjct  135   N-MMTGEQCVEAKGFKAAVFFLALYLVALGSGCLKPNMIAHGADQFGRDDPKQPKKLSTY  193

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN      CVG  ++LT+ VW+    G D GF  S  AM  G I    G+ FYR    QG
Sbjct  194   FNAAYFSFCVGELIALTVLVWVQTRSGMDVGFGVSAGAMAMGLISLISGVVFYRNKPPQG  253

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISK----DKEAVTICAEFLPHTDKYRFLD  977
              S  T I +VFVAAI  RK   P  + EL   S+    D    +     L HTDK+RFLD
Sbjct  254   -SIFTPIARVFVAAISKRKQVCPSTNSELIHQSQKHAGDHHQPSPGVNSLRHTDKFRFLD  312

Query  978   KAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             KA I  Q     + +PW++C  T+VE  K++L+++P+F CT+I    LAQLQTFS+QQGS
Sbjct  313   KACIKAQDGSSLKESPWKLCTATEVEQVKVVLSVIPIFACTIIFNTILAQLQTFSVQQGS  372

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             +MD  +  SF I P+S   +P + LI L+P+Y+  FVP +RR TG  +GITPL R+ VGL
Sbjct  373   SMDTRVGNSFTIPPASFQAIPYMMLIVLVPIYETGFVPLLRRFTGKESGITPLQRIGVGL  432

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
                + SM +AA++E KR++ A   +            +S+FW++ Q+ +FG+++MFT VG
Sbjct  433   FTVTFSMVSAALIEKKRREEAVGPHK----------HLSIFWIAPQFLVFGLSEMFTAVG  482

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+   ++S  +   + S S G+F SS+LV +VN  T   + SGGWL  N++N+
Sbjct  483   LIEFFYKQSAGGMQSFLTAMTYCSYSFGFFLSSLLVSLVNKITS-SSSSGGWLSDNDLNK  541

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             + L+LFY LL+ LS +NF  YLF ++ Y 
Sbjct  542   DRLDLFYWLLAALSLLNFVNYLFWARWYS  570



>ref|XP_006836895.1| hypothetical protein AMTR_s00099p00121400 [Amborella trichopoda]
 gb|ERM99748.1| hypothetical protein AMTR_s00099p00121400 [Amborella trichopoda]
Length=600

 Score =   409 bits (1050),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 243/580 (42%), Positives = 349/580 (60%), Gaps = 19/580 (3%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
             N + +   +   VDW+GR  R + HGG+ A+ F LG+  FE MA   +G  L+TY+   M
Sbjct  8     NVKGEKRYLGASVDWKGRPCRPN-HGGMTAAAFALGLQAFEIMAIAAVGNNLITYVFNEM  66

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             + +L+ +AN VTNF G  ++L+I+   LAD+Y+G F  +LI  ++E  G  LL++QAH  
Sbjct  67    HFSLSKSANIVTNFVGTIFLLSILGGFLADSYLGSFWTILIFGFVELSGFILLSVQAHLP  126

Query  429   KLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEK---D  599
             + KPP CN + + + C+E  G  A I F  LY VA+GS  VK  + +HG DQF E+   D
Sbjct  127   QFKPPSCNMITQPQSCQEAQGFQALIFFAGLYMVALGSGCVKPNMIAHGGDQFRERNTQD  186

Query  600   RKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGL  779
              K   ++S++FNW  L  C+G  V+LTL VW+    G D GF  S VAM  G +    G 
Sbjct  187   LKREKQLSTYFNWAYLSFCLGELVALTLLVWVQSKAGMDVGFGVSGVAMALGLVSVVSGA  246

Query  780   PFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTD  959
             PFYR    QG S  T I QVFVAAI  RK   P +   L+    D          L HTD
Sbjct  247   PFYRNKPPQG-SIFTPIAQVFVAAITKRKQICPSNPELLHGNRSDDRPGPNGGNLL-HTD  304

Query  960   KYRFLDKAAIQTS--WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTF  1133
             K+RFLDKA I+       E + W +C VTQVE  KI+L++ P+F CT+I    LAQLQTF
Sbjct  305   KFRFLDKACIKIEGHGSSEESSWGLCTVTQVEQVKIILSVTPIFACTIIFNTILAQLQTF  364

Query  1134  SIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLH  1313
             S+QQ S M+  ++  F++ P+SL  +P L L+F +PLY++  VP +RR+TG  +GI+PL 
Sbjct  365   SVQQASAMNRRVSNDFELPPASLQAIPYLLLVFFVPLYEKTLVPMVRRITGKESGISPLQ  424

Query  1314  RVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIAD  1493
             R+  GL  ++ SM  AA++E KR+++A E N +          +SV W++ Q+ IFG+++
Sbjct  425   RIGCGLFTATFSMVIAALVENKRRKIALESNQI----------LSVGWIAPQFLIFGLSE  474

Query  1494  MFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLG  1673
             MFT VGL+EFFY Q+   ++S  +   + S S G+F SS+LV +VN  +K  +   GW  
Sbjct  475   MFTAVGLIEFFYRQSIAGMQSFLTAMTYCSYSFGFFLSSLLVSLVNKLSKHGSHM-GWFS  533

Query  1674  GNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
              N++N++ L+LFY LL+ LS +N F YLF S+ Y Y   +
Sbjct  534   NNDLNKDRLDLFYWLLAALSIINVFNYLFWSRWYSYNPSV  573



>ref|XP_002888185.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64444.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=592

 Score =   408 bits (1049),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 251/573 (44%), Positives = 357/573 (62%), Gaps = 23/573 (4%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             N    +EL + + VDWRGR +  +KHGG+RA++F++G+  FE M    +G  L+TY+   
Sbjct  18    NEMNNWELAEEESVDWRGRPSNPNKHGGMRAALFVIGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  ++I  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFALLGGYLSDAFLGSFWTIIIFGFVELSGFILLSVQAHL  137

Query  426   AKLKPPPCNPL-DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
              +LKPP CNPL D+A  CEE  G  A I F+ALY VA+GS  VK  + +HGADQF +   
Sbjct  138   PQLKPPKCNPLIDQA--CEEAKGFKAMIFFMALYLVALGSGCVKPNMIAHGADQFSQSHP  195

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             K+   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  
Sbjct  196   KQSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMTMGLISLVSGTM  255

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEFLPH  953
             ++R    +  S  T I QV VAAI  RKL  P D   L   + ++ D     + +  LP+
Sbjct  256   YFRNKRPR-RSIFTPIAQVVVAAILKRKLVSPSDPRMLHGDHHVAND----VVPSSTLPY  310

Query  954   TDKYRFLDKAAIQ-TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQT  1130
             T ++RFLDKA I+    + + +PWR+C VTQVE  K L++LVP+F  T++    LAQLQT
Sbjct  311   TPRFRFLDKACIKIQDTNTKESPWRLCTVTQVEQVKTLISLVPIFASTIVFNTILAQLQT  370

Query  1131  FSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPL  1310
             FS+QQGS+M+  ++ SF I P+SL  +P + LIFL+PLYD   VP  R+LTG  +GI PL
Sbjct  371   FSVQQGSSMNNRLSNSFHIPPASLQAIPYMMLIFLVPLYDSFLVPFARKLTGHNSGIPPL  430

Query  1311  HRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIA  1490
              R+ +GL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFG++
Sbjct  431   TRIGIGLFLSTFSMVSAAMLEKKR----RDSSVLDG------RILSIFWITPQFLIFGVS  480

Query  1491  DMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWL  1670
             +MFT VGL+EFFY Q+ K ++S      + S S G++ SSVLV VVN  T    +S GWL
Sbjct  481   EMFTAVGLIEFFYKQSAKGMESFLMALTYCSYSFGFYFSSVLVSVVNKITSTSVDSKGWL  540

Query  1671  GGNNVNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             G N++N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  541   GENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR  573



>ref|XP_008670698.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Zea mays]
 tpg|DAA41871.1| TPA: hypothetical protein ZEAMMB73_744112 [Zea mays]
Length=623

 Score =   409 bits (1051),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 237/571 (42%), Positives = 346/571 (61%), Gaps = 22/571 (4%)
 Frame = +3

Query  102   KVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHV  281
              VDW+GR     KHGG++A++F+LGI  FE MA   +G  L+TY+ G M+  L+ AAN V
Sbjct  19    SVDWKGRPCDPLKHGGMKAAVFVLGIQAFEMMAVAAVGNNLITYVFGEMHFPLSQAANIV  78

Query  282   TNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLD  461
             TNF G  ++++++   L+D+Y+G F  +LI  ++E  G  LLA+QAH  +L+PPPC+ + 
Sbjct  79    TNFIGTVFLISLLGGFLSDSYLGSFWTMLIFGFVELSGFILLAVQAHLPQLRPPPCDMMA  138

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS-EMSSFFNW  638
               + CEE  G  A+I F ALY VA+GS  +K  + +HGADQF      + +  +SS+FN 
Sbjct  139   PGQACEEARGLKASIFFAALYLVALGSGCLKPNIIAHGADQFRRGSGSDAARRLSSYFNA  198

Query  639   LLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSA  818
               L  CVG  V+LT+ VW+    G D GF  S  AM  G +    G+ FYR    QG S 
Sbjct  199   AYLSFCVGELVALTVLVWVQTRSGMDVGFGVSAAAMAVGLLSLVAGVAFYRNKPPQG-SI  257

Query  819   ITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT-  995
              T I +VFVAA+  RK   P  +            +++    + H +K+RFLDKA ++  
Sbjct  258   FTPIAKVFVAAVSKRKQVCPSTASTQAVAGSTVHEMSVNTTDICHINKFRFLDKACMKAQ  317

Query  996   -----SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMD  1160
                  S   + +PW +C   +VE  K+LL +VP+F CT+I    LAQLQTFS+QQGS MD
Sbjct  318   DGPGGSSAGKKSPWIMCTPAEVEQVKLLLCVVPIFACTIIFNTILAQLQTFSVQQGSAMD  377

Query  1161  LNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGllls  1340
               +  SF + P+SL  +P + L+ L+P Y+  FVP+MRRLTG+PTGITPL R+ VGL   
Sbjct  378   TRLAASFHVPPASLQAIPYIMLVALVPAYEAAFVPAMRRLTGVPTGITPLQRIGVGLFAV  437

Query  1341  slsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLE  1520
             + SM AAA++E +R+  A      D   +L     S+ W++ Q+ +FG+++MFT VGL+E
Sbjct  438   TFSMVAAALVEARRRHAAAT----DGGRLL-----SILWIAPQFLVFGLSEMFTAVGLIE  488

Query  1521  FFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-----GGWLGGNNV  1685
             FFY Q+   +++  +   + S S G++ SSVLV +VN  T   + +     GGWL  N++
Sbjct  489   FFYRQSLAGMQAFLTSMTYCSYSFGFYLSSVLVSLVNRLTSSSSSTAGNGNGGWLANNDL  548

Query  1686  NRNHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             N++ L+LFY LL+ LS +NFF YLF ++ Y 
Sbjct  549   NKDRLDLFYCLLAALSMLNFFNYLFWARWYS  579



>ref|XP_009610133.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X2 [Nicotiana 
tomentosiformis]
Length=593

 Score =   408 bits (1048),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 241/565 (43%), Positives = 347/565 (61%), Gaps = 22/565 (4%)
 Frame = +3

Query  102   KVDWRGRTARKDK-HGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANH  278
             K+++   ++ K K  GG RAS FI G  G +N+  +   V++V YL+  M+ +L+ +AN 
Sbjct  6     KLEYNSVSSYKIKGKGGFRASSFIYGFVGLDNIGFVANMVSMVLYLSFKMHFDLSGSANT  65

Query  279   VTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL  458
             VTN  G+TY+L+I+   ++DTY+ RF  +LI    E L   L+ +Q  Y+ L+P  C   
Sbjct  66    VTNLLGSTYMLSIIGGFISDTYLSRFHTILIFGTAEILAWTLMTIQGRYSSLQPQVCG--  123

Query  459   DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNW  638
                 K   + G  A + + +L  +A+G+ GV+ A+P+ GADQFD+ D  E   +  +FNW
Sbjct  124   ----KSNCLEGGIALLFYGSLCLLALGTGGVRGALPALGADQFDQNDPNEAKALGRYFNW  179

Query  639   LLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSA  818
             LLL    G A+ +T+ VW+  +KGW  GF  S  A F G + F  G PFYR+ V    S 
Sbjct  180   LLLSSVSGSAIGVTVIVWVSTNKGWWIGFLISLGATFLGFLIFLFGKPFYRLQV-PAESP  238

Query  819   ITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTS  998
             +T+I+QV   AI NRKLQ PE+  ELYEI+  KE+ +   + + HTD++R+LDKAAI   
Sbjct  239   LTRILQVITVAIRNRKLQSPENPEELYEINV-KESDSSKPK-IAHTDQFRYLDKAAILPK  296

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                EP  W VC VT+VE  KIL  ++P+   T++M  CLAQLQTFS+QQG  M+ +    
Sbjct  297   -TVEPTQWTVCTVTKVEEVKILTRMMPIIASTILMNTCLAQLQTFSVQQGYRMNRHFGSF  355

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
                 PS      +     +   YD +FVP  R++T  P+GIT L RV VGL+LS +SM  
Sbjct  356   EIPAPSVPVIPLLFMCFLIPI-YDFVFVPFARKITNHPSGITQLQRVGVGLVLSIISMGI  414

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E+KRK  +  +N L+        PI VFWLS QY IFGIADMFT VG+LEFFY +A
Sbjct  415   AALVEIKRKHQSL-KNPLE--------PIHVFWLSFQYGIFGIADMFTLVGMLEFFYKEA  465

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYA  1715
             P+ ++S+S+ F W S+S GY+ SSV V ++N  TK  ++S  GWL G ++++N+L+LFY 
Sbjct  466   PEGMRSLSTSFTWISLSFGYYLSSVFVDIINSVTKRFSQSNKGWLAGQDLDQNNLQLFYW  525

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              L+ LS +NF  YL+ +  YKY+  
Sbjct  526   FLAILSCLNFINYLYWASWYKYKSD  550



>dbj|BAJ85519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   407 bits (1046),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 235/565 (42%), Positives = 348/565 (62%), Gaps = 12/565 (2%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
              G VDWRGR+    KHGG+RASIFI  +    N A I   + LVTYL G M++ +A+A+ 
Sbjct  5     SGLVDWRGRSVNPKKHGGVRASIFIHALVLLSNAANIANIMNLVTYLRGTMHMGVAEAST  64

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
               +NF  A  + +I AA LAD+YI RF  VLI   IE LG  LLA+QAH   L PPPC+P
Sbjct  65    TASNFFAALQMFSIPAAFLADSYIKRFYTVLIFGPIEILGYILLAVQAHVPSLHPPPCSP  124

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
                 + CE V+G N ++L + LY + +G    +A +P+ G DQFD  D  E  + +SFFN
Sbjct  125   -TAPQTCETVSGSNLSLLLLGLYLIPIGDGAARACLPALGGDQFDTADPVEQRQETSFFN  183

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             W    V  GG + L L VW+   +GWD GF    + +  G + +  G PFYR   + G S
Sbjct  184   WYTFAVSSGGFLGLVLLVWVENRRGWDIGFTLCALCVLLGMLIWMAGFPFYR-NQLPGGS  242

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
             AIT+I+QV V A   R +QLP+++ EL ++++D   V    E L  TD +R L+K+A++T
Sbjct  243   AITRILQVLVVAFKKRNVQLPDNASELKQLNQDDHNVL---EELQRTDGFRCLEKSAVET  299

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                 E   W +C VTQVE  KI+L +VP+FL +V+  + +  +  F++QQG+TMD  +  
Sbjct  300   G---ETGAWSLCSVTQVEETKIVLRMVPIFLSSVLGYIPVPLILNFTVQQGNTMDTKLGS  356

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
                I P++L  +P +F + ++ LYDR  VPS+RR+TG   G+T L R+ +G L ++++ A
Sbjct  357   -VHISPATLFVIPTVFQMVILVLYDRFIVPSLRRITGYVGGVTHLQRIGIGFLSATVATA  415

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
              AA++E KRK+VA E  +++A      +P+SVFWL++Q+F+ G+ D+ ++VGLLEFFYS+
Sbjct  416   VAALVEAKRKRVAEENGLMEAT---TGIPMSVFWLTVQFFLLGVVDVTSFVGLLEFFYSE  472

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYA  1715
             A   +KSV S   +  + +  +  S+L++V N  T+    +GGWL G N+N   L+ FY 
Sbjct  473   ASTGMKSVGSSIFYCILGVSAWLGSLLIQVANRVTRRADGTGGWLDGTNLNMGKLDNFYW  532

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             LL+ L  V+  VY F ++RY YR +
Sbjct  533   LLAVLELVSLVVYTFFARRYVYRNE  557



>ref|XP_004250721.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like isoform X1 [Solanum 
lycopersicum]
Length=593

 Score =   407 bits (1047),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 241/565 (43%), Positives = 347/565 (61%), Gaps = 21/565 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR  + +KHGG+ A+IF+L +  FE MA   +G  L+TY+   M+  L+ +AN VT
Sbjct  28    VDWRGRPCKPNKHGGMTAAIFVLCLQAFEMMAIAAVGNNLITYVFNEMHFPLSKSANIVT  87

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L++    L+D+Y+G F  + I  ++E  G  LLA+QAH  +L+PP C+ +  
Sbjct  88    NFIGTVFLLSLFGGFLSDSYLGSFWTMFIFGFVELSGFILLAVQAHVQQLRPPKCDMMLS  147

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
               KC +V G  A I FVALY VA+GS  +K  + SHGADQF ++D K   ++S++FN+  
Sbjct  148   NGKCLKVKGYKAMIFFVALYLVALGSGCLKPNIISHGADQFKKQDSK---KLSTYFNFAY  204

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                C G  ++LTL VW+    G D GF  S  +M FG I F  G   YR     G S  T
Sbjct  205   FAFCAGELLALTLVVWVQTRYGMDVGFGVSAASMVFGLIIFLSGTLVYR-NTPPGGSIFT  263

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQ--TS  998
              I QVFVAAI  RK   P +   L+      + +      L HTDK+RFLDKA I+    
Sbjct  264   PIAQVFVAAITKRKESCPSNLKMLH----GSQCIVPQDGTLIHTDKFRFLDKACIKIDNG  319

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                  +PWR+C V+QVE  KIL+++VP+F CT+I    LAQLQTFS+QQ + M+  +T +
Sbjct  320   RSTSESPWRLCTVSQVEQVKILISVVPIFACTIIFNTILAQLQTFSVQQATIMNTRLTHN  379

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
             F I P+SL  +P   LIFL+PLY+   VP +R+ TG  +GITPL RV +GL +++ SM  
Sbjct  380   FTIPPASLQSIPYFMLIFLVPLYEIALVPVIRKFTGNDSGITPLQRVGIGLFIATFSMVC  439

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E KR+  A  +N +          +S+FW+  Q+ I+G+++MFT VGL+EFFY Q+
Sbjct  440   AALVENKRRDYAMNQNRI----------LSIFWIVPQFIIYGLSEMFTAVGLIEFFYKQS  489

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYAL  1718
              + ++S  +   + S S G++ SS+LV +VN  T   ++ GGWL  N++N+N L+LFY L
Sbjct  490   LEGMQSFLTAMTYCSYSFGFYLSSILVSLVNRITS-TSDGGGWLNNNDLNKNRLDLFYWL  548

Query  1719  LSGLSFVNFFVYLFVSKRYKYRQQI  1793
             L+ LS VNF  Y+F S+ Y Y   +
Sbjct  549   LASLSLVNFINYVFCSRWYSYNPSL  573



>ref|XP_004231309.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Solanum lycopersicum]
Length=623

 Score =   408 bits (1049),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 246/556 (44%), Positives = 343/556 (62%), Gaps = 24/556 (4%)
 Frame = +3

Query  123   TARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGAT  302
             +++  + GG RA+ FI G+ G ENM  + + V+   Y + VM  +L+ +AN +TN  G+T
Sbjct  28    SSKVQRKGGFRATSFIFGLLGLENMGFVAVMVSFGLYFSFVMGFDLSGSANTLTNLMGST  87

Query  303   YILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEE  482
             ++L+I+   ++DTYI RF  VLI    E +   L+ +QAHY  L+P    P      C  
Sbjct  88    FLLSILGGFISDTYINRFHTVLIFGPFEIIAFALITIQAHYKSLQPICLEP-----NC--  140

Query  483   VAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVG  662
             ++G+ A   + +L   A+G   VK A+P+ GADQFD+KD KE   +  +FN+L+    +G
Sbjct  141   ISGKKAMFFYASLCCFALGGGAVKGALPALGADQFDQKDPKEAKALGRYFNFLMFSSVIG  200

Query  663   GAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVF  842
             GA  +T  V++   K W  GF  S V++  G IFF  G PF+R+    GS  +T+I QV 
Sbjct  201   GAFGVTFVVYVSTVKAWWKGFLISLVSVTLGFIFFAFGKPFFRLQQPAGS-PLTRIFQVI  259

Query  843   VAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPW  1022
             V AI+N KLQLPE+S ELYEIS +KE+ +  ++ L HT ++RFLDKAAI      EP PW
Sbjct  260   VVAINNGKLQLPENSEELYEIS-EKESDSSQSK-LAHTKQFRFLDKAAIHPK-TGEPAPW  316

Query  1023  RVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpssl  1202
              VC VTQVE  K+L  ++P+   T+IM  C+AQLQTFS+ QG  M+  I K     PS  
Sbjct  317   TVCTVTQVEEVKVLTRMLPIIASTIIMNTCMAQLQTFSVAQGYRMNRFINKFEVPAPSVP  376

Query  1203  pflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKR  1382
                 I   I +   YD +FVP  R++T  P+GIT L RV VGL+LS +SMA AA++E+KR
Sbjct  377   AIPLIFMCILIPI-YDMVFVPFARKITKHPSGITQLQRVGVGLVLSIVSMAVAALVEIKR  435

Query  1383  KQVARERNMLDAIPILQPL-PISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             K  + +           PL PI + WL  QY IFGIADMFT VGLLEFFY +AP  ++S+
Sbjct  436   KHHSLK----------DPLHPIHLAWLGFQYSIFGIADMFTLVGLLEFFYKEAPVGMRSL  485

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYALLSGLSF  1736
             S+ F W S+SLG+F SSVLV ++N  TK    S  GWL G ++++N+L LFY  L+ LS 
Sbjct  486   STSFTWISISLGFFLSSVLVDIINSVTKKRAPSKKGWLVGLDLDQNNLHLFYWFLAILSG  545

Query  1737  VNFFVYLFVSKRYKYR  1784
             +NF  YL+ +  YKY+
Sbjct  546   LNFLNYLYWASWYKYK  561



>ref|XP_009610132.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score =   407 bits (1047),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 241/565 (43%), Positives = 347/565 (61%), Gaps = 22/565 (4%)
 Frame = +3

Query  102   KVDWRGRTARKDK-HGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANH  278
             K+++   ++ K K  GG RAS FI G  G +N+  +   V++V YL+  M+ +L+ +AN 
Sbjct  9     KLEYNSVSSYKIKGKGGFRASSFIYGFVGLDNIGFVANMVSMVLYLSFKMHFDLSGSANT  68

Query  279   VTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL  458
             VTN  G+TY+L+I+   ++DTY+ RF  +LI    E L   L+ +Q  Y+ L+P  C   
Sbjct  69    VTNLLGSTYMLSIIGGFISDTYLSRFHTILIFGTAEILAWTLMTIQGRYSSLQPQVCG--  126

Query  459   DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNW  638
                 K   + G  A + + +L  +A+G+ GV+ A+P+ GADQFD+ D  E   +  +FNW
Sbjct  127   ----KSNCLEGGIALLFYGSLCLLALGTGGVRGALPALGADQFDQNDPNEAKALGRYFNW  182

Query  639   LLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSA  818
             LLL    G A+ +T+ VW+  +KGW  GF  S  A F G + F  G PFYR+ V    S 
Sbjct  183   LLLSSVSGSAIGVTVIVWVSTNKGWWIGFLISLGATFLGFLIFLFGKPFYRLQV-PAESP  241

Query  819   ITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTS  998
             +T+I+QV   AI NRKLQ PE+  ELYEI+  KE+ +   + + HTD++R+LDKAAI   
Sbjct  242   LTRILQVITVAIRNRKLQSPENPEELYEINV-KESDSSKPK-IAHTDQFRYLDKAAILPK  299

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                EP  W VC VT+VE  KIL  ++P+   T++M  CLAQLQTFS+QQG  M+ +    
Sbjct  300   -TVEPTQWTVCTVTKVEEVKILTRMMPIIASTILMNTCLAQLQTFSVQQGYRMNRHFGSF  358

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
                 PS      +     +   YD +FVP  R++T  P+GIT L RV VGL+LS +SM  
Sbjct  359   EIPAPSVPVIPLLFMCFLIPI-YDFVFVPFARKITNHPSGITQLQRVGVGLVLSIISMGI  417

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E+KRK  +  +N L+        PI VFWLS QY IFGIADMFT VG+LEFFY +A
Sbjct  418   AALVEIKRKHQSL-KNPLE--------PIHVFWLSFQYGIFGIADMFTLVGMLEFFYKEA  468

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYA  1715
             P+ ++S+S+ F W S+S GY+ SSV V ++N  TK  ++S  GWL G ++++N+L+LFY 
Sbjct  469   PEGMRSLSTSFTWISLSFGYYLSSVFVDIINSVTKRFSQSNKGWLAGQDLDQNNLQLFYW  528

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              L+ LS +NF  YL+ +  YKY+  
Sbjct  529   FLAILSCLNFINYLYWASWYKYKSD  553



>ref|XP_009113280.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 isoform X1 [Brassica 
rapa]
Length=591

 Score =   407 bits (1046),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 251/569 (44%), Positives = 348/569 (61%), Gaps = 16/569 (3%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             N    +EL + +  DWRGR +  +KHGG RA++F+LG+  FE M    +G  L+TY+   
Sbjct  18    NEMNNWELTEEESFDWRGRPSNPNKHGGTRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFGLLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQAHL  137

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPP CNPL     CEE  G  A   F+ALY VA+GS  VK  + +HGADQF +   K
Sbjct  138   PQLKPPKCNPLIDPSSCEEAKGFKATFFFMALYLVALGSGCVKPNMIAHGADQFSQSHPK  197

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  F
Sbjct  198   QSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMTIGLISLVSGTMF  257

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             +R    +  S  T I QV VAAI  RKL  P D   L+  +     V + +  LPHT + 
Sbjct  258   FRNKRPR-RSLFTPIAQVVVAAISKRKLVAPSDPIMLHGGNHASNDV-LPSSTLPHTPRL  315

Query  966   RFLDKAAIQT-SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             RFLDKA I+    + + +PW +C V+QVE  K L++LVP+F  T++    LAQLQTFS+Q
Sbjct  316   RFLDKACIKVQETNTKESPWTLCTVSQVEQVKTLISLVPIFASTIVFNTILAQLQTFSVQ  375

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS+M+  ++ SF I P+SL  +P + LIFL+PLYD LFVP  R+ TG  +GITPL R+ 
Sbjct  376   QGSSMNTRLSNSFHIPPASLQAIPYIMLIFLVPLYDSLFVPFARKFTGQDSGITPLTRIG  435

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
              GL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFGI++MFT
Sbjct  436   FGLFLSTFSMVSAALLEKKR----RDSSVLDG------RILSIFWITPQFLIFGISEMFT  485

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGL+EFFY Q+ K ++S      + S S G++ SSVLV +VN  T     S GWLG N+
Sbjct  486   AVGLIEFFYKQSAKGMESFLMALTYCSYSFGFYFSSVLVSIVNKITS--VNSKGWLGDND  543

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             +N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  544   LNKDRLDLFYWLLAVLSLLNFLSYLFWSR  572



>ref|XP_004141613.1| PREDICTED: probable peptide/nitrate transporter At1g33440-like 
[Cucumis sativus]
 ref|XP_004156241.1| PREDICTED: probable peptide/nitrate transporter At1g33440-like 
[Cucumis sativus]
 gb|KGN52605.1| hypothetical protein Csa_5G647280 [Cucumis sativus]
Length=577

 Score =   406 bits (1044),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 250/579 (43%), Positives = 355/579 (61%), Gaps = 37/579 (6%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             Q  +E  D  VDWRGR    ++HGG+ A+ F+LG+  FE MA   +G  L+TY+   M+ 
Sbjct  2     QRDHE--DICVDWRGRACNPNRHGGMGAAAFVLGLQAFEMMAIAAVGNNLITYVFSEMHF  59

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              L+ +AN VTNF G  + L+++   L+D+Y+G FR +LI  +IE  G  +L +QAHY  L
Sbjct  60    PLSKSANVVTNFVGTVFFLSLLGGFLSDSYLGSFRTMLIFGFIELAGFTVLTIQAHYPGL  119

Query  435   KPPPCN---PLDKA-EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
             +P PC     LD+  ++C E  G  A + F ALY VA+GS  +K  + SHGADQF ++D 
Sbjct  120   RPSPCEMGRKLDEEDDQCIEAKGYEALMFFSALYLVALGSGCLKPNIISHGADQFRKEDP  179

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             K+  ++S+FFN      C G  ++LTL VW+  H G D GF  ST AM    I    G  
Sbjct  180   KQFKKLSTFFNCAYFAFCTGELIALTLLVWVQTHSGMDLGFGVSTAAMLLALISLLSGTS  239

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
             FYR    +G S  T I QV VAA   R LQ+   + E+         V      L HTDK
Sbjct  240   FYRNNPPRG-SIFTPIAQVLVAAYRKRNLQMCPSNSEMVLNGTQNGIVK-----LIHTDK  293

Query  963   YRFLDKAAIQTSWD-----EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             +RFLDKA I++  +      E +PW++C V QVE  KI+L+++P+F CT+I    LAQLQ
Sbjct  294   FRFLDKACIKSEEERLGSIREESPWKLCTVKQVEQVKIILSVIPIFACTIIFNTILAQLQ  353

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFS+QQG++M+  +T SFQI P+SL  +P + LIFL+PLY+ +FVP  RRLT I +GI+P
Sbjct  354   TFSVQQGASMNTWLTNSFQIPPASLQAIPYIILIFLVPLYETVFVPLTRRLTSIDSGISP  413

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L RV  GL +++ SM +AA++E KR      RN   ++ IL        W++ Q+ IFG+
Sbjct  414   LQRVGTGLFVATFSMVSAALVEQKR------RNSSSSLSIL--------WIAPQFVIFGV  459

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             +++FT VGL+EFFY Q+ + ++S  +   + S S G++ SS+LV +VN        SGGW
Sbjct  460   SELFTAVGLIEFFYKQSVEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKI------SGGW  513

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             L  N++N + L+LFY LL+GLSFVNFF YLF + R+  +
Sbjct  514   LSHNDLNNDRLDLFYWLLAGLSFVNFFNYLFWANRFSQQ  552



>ref|XP_010099787.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB80405.1| putative peptide/nitrate transporter [Morus notabilis]
Length=619

 Score =   407 bits (1046),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 249/577 (43%), Positives = 356/577 (62%), Gaps = 26/577 (5%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VDWRG+ ++   HGG+RA+ F+LG+  FE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  22    DNTVDWRGKPSKPHTHGGMRAATFVLGLQCFEIMAIAAVGNNLITYVINEMHFSLSKSAN  81

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +L PP CN 
Sbjct  82    VVTNFVGTVFLLALLGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHMPQLMPPKCNT  141

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFD-EKDRKEGSEMSSFF  632
              +  + CEE  G  A I F+ALY VA+GS  VK  + +HGADQF+ ++   +  ++SS+F
Sbjct  142   TN-GDLCEEAKGFKALIFFLALYLVALGSGCVKPNMVAHGADQFNPDQSPNQSRKLSSYF  200

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N   L   +G  ++LT+ VW+  H G D GF  S  AM  G I    G  +YR    QG 
Sbjct  201   NAAYLAFSIGELIALTVLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLYYRNKPPQG-  259

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYE------ISKDKEAVTICAEFLPHTDKYRFL  974
             S  T I QVFVAAI  RK   P +   L        ++    A++     L HT K+RFL
Sbjct  260   SIFTPIAQVFVAAILKRKQVCPSNPQMLNGSQNNNFVNGTTAALSSDPGNLLHTQKFRFL  319

Query  975   DKAAIQTSWD--EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             DKA I+ S D   + +PW +C +TQVE AK LL+++P+F CT++    LAQLQTFS+QQG
Sbjct  320   DKACIRVSQDAGTKESPWTLCTITQVEQAKTLLSVIPIFACTIVFNTILAQLQTFSVQQG  379

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
             S MD ++TKSFQI P+SL  +P + LIFL+PLYD  FVP  RR TG  +GI+PL R+  G
Sbjct  380   SIMDTHLTKSFQIPPASLQSIPYIILIFLVPLYDTFFVPFARRFTGHISGISPLQRIGFG  439

Query  1329  lllsslsmaaaailelKRKQ--VARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
             L  ++ SM +AA++E KR+   +  +R             IS+FW++ Q+ IFG+++MFT
Sbjct  440   LFFATFSMVSAALMEKKRRDSFLNSDRT------------ISIFWITPQFLIFGLSEMFT  487

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              +GL+EFFY Q+ K +++  +   + S S G++ SSVLV +VN  T   +   GWL  NN
Sbjct  488   AIGLIEFFYKQSLKGMQAFLTAMTYCSYSFGFYFSSVLVSLVNKITSN-SNGSGWLSDNN  546

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             +N++ L+LFY LL+ LSF+NF  YLF S+ Y Y   I
Sbjct  547   LNKDRLDLFYWLLAVLSFLNFLNYLFWSRWYSYNPSI  583



>ref|XP_010478766.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 isoform X1 [Camelina 
sativa]
 ref|XP_010478767.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 isoform X2 [Camelina 
sativa]
Length=599

 Score =   406 bits (1044),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 250/562 (44%), Positives = 350/562 (62%), Gaps = 21/562 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VD RGR  R  KHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ +AN
Sbjct  23    DLCVDSRGRPCRPSKHGGTRAALFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKSAN  82

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G FR +L+   IE  G  LLA+QAH  +L+PP C+ 
Sbjct  83    LVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGIIEIFGFILLAVQAHLPELRPPECD-  141

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +     C E  G  A  L+ AL  VA+GS  +K  + SHGADQF  KD +   ++SSFFN
Sbjct  142   MKGTIHCLEANGYKAVTLYAALCLVALGSGCLKPNIISHGADQFQRKDLR---KLSSFFN  198

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LTL VW+  H G D GF  S   M  G I    G  FYR    +G S
Sbjct  199   AAYFAFSMGQLIALTLLVWVQTHSGMDVGFGVSAAVMAAGLISLVAGTNFYRNKASRG-S  257

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
               T I QVFVAAI  RK   P +   L++ S D   V    + L HT+K+RFLDKA I+T
Sbjct  258   IFTPIAQVFVAAITKRKQICPSNPNMLHQPSMDLVRV----KPLLHTNKFRFLDKACIKT  313

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                   +PWR+C   Q+   KILL+++P+F CT+I    LAQLQTFS+QQGS+M+ +ITK
Sbjct  314   QGKVMESPWRLCTTEQIHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMNTHITK  373

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             +FQI P+SL  +P + LIF +PLY+  FVP  R++TG  +GI+PL R+ VGL L++ SM 
Sbjct  374   TFQIPPASLQAIPYIILIFFVPLYETFFVPLARKVTGNDSGISPLQRIGVGLFLATFSMV  433

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             AAA++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  434   AAALVEKKRRESFLEQN----------VTLSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQ  483

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGNNVNRNHLELF  1709
             + K ++S  +   + S S G++ SSVLV  VN  T   G     GWLG N++N++ L+ F
Sbjct  484   SSKSMQSFLTALTYCSYSFGFYLSSVLVSAVNRVTSSNGSGTREGWLGDNDLNKDRLDHF  543

Query  1710  YALLSGLSFVNFFVYLFVSKRY  1775
             Y LL+ LSF+NFF Y+F S+ Y
Sbjct  544   YCLLASLSFINFFNYIFWSRWY  565



>gb|EYU35371.1| hypothetical protein MIMGU_mgv1a003103mg [Erythranthe guttata]
Length=608

 Score =   406 bits (1044),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 240/561 (43%), Positives = 340/561 (61%), Gaps = 22/561 (4%)
 Frame = +3

Query  126   ARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATY  305
             +R    GG  A+ FI  +   ENM  +   V+LV Y +  +  +L+ +AN +TN  G+T+
Sbjct  15    SRIKPRGGFTATSFIYALVALENMGFVANMVSLVLYFSYKLYFDLSTSANTLTNLMGSTF  74

Query  306   ILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEV  485
             +L+IV   ++DTY  RF+  +I   +E L L ++ +QA    L P PC       K   +
Sbjct  75    LLSIVGGFISDTYFNRFQTCVIFGTLEVLALAMMTIQARTDSLLPKPC-----GGKSSCL  129

Query  486   AGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGG  665
              G  A   + +L  +A+G  GVK A+   GADQFD KD KE   ++S+FNWLLL   VG 
Sbjct  130   EGGVAVYFYTSLCLMALGVGGVKGALAPLGADQFDPKDPKEAKGLASYFNWLLLSSVVGS  189

Query  666   AVSLTLFVWLIQHKG---WDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQ  836
             ++ +T+ VW+  +K    W  GF  + VA F G +F  +G PFYR+   +G S +++I Q
Sbjct  190   SIGVTVIVWVSTNKNNHNWWKGFLITAVATFVGYVFLVVGKPFYRLQAPKGDSPLSRIAQ  249

Query  837   VFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPN  1016
             V V A+ N +L  PE   ELYEI++     T     + HT+++R+LDKAAI    + +P+
Sbjct  250   VIVVAVKNSRLPHPESCSELYEINEKDSDST--GPKIVHTEQFRWLDKAAIVQP-NTDPS  306

Query  1017  PWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilps  1196
             PW+ C VTQVE  KIL  ++P+   T+I+  C+AQLQTFS+QQG  M+ ++        S
Sbjct  307   PWKSCTVTQVEEVKILTRMMPILASTIILNTCMAQLQTFSVQQGYRMEPHLGSFQVPAAS  366

Query  1197  slpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailel  1376
                   +  +I +   YDR+FVP +R+ T  P+GIT L RV VGL+LS+LSM+ AAI+E+
Sbjct  367   IPVIPLLFIIILVPI-YDRVFVPFIRKFTKNPSGITQLQRVGVGLVLSTLSMSVAAIVEV  425

Query  1377  KRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
             KRK  + E       P+    PIS+FWL+ QY IFGIADMFT VGLLEFFY +AP+ +KS
Sbjct  426   KRKNRSLEN------PVE---PISLFWLAFQYGIFGIADMFTLVGLLEFFYKEAPEGMKS  476

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLS  1733
             +S+ F W S S GYF SSV V  +N  TK +  SG GWL G +++RN+L LFY  L+ LS
Sbjct  477   LSTSFAWISQSFGYFLSSVFVDTINSVTKRVAPSGKGWLHGQDLDRNNLNLFYWFLAVLS  536

Query  1734  FVNFFVYLFVSKRYKYRQQIG  1796
              +NFF YL+ S  YKY+   G
Sbjct  537   GLNFFNYLYWSTWYKYKSGDG  557



>ref|XP_008378949.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Malus domestica]
Length=613

 Score =   406 bits (1044),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 254/580 (44%), Positives = 358/580 (62%), Gaps = 22/580 (4%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             I++ E  E  +  VDWRGR +   KHGG+RA+ F+LG+  FE M    +G  L+TY+   
Sbjct  13    IDTSEMAE--EMTVDWRGRPSNPTKHGGMRAAAFVLGLQSFEIMGIAAVGNNLITYVINE  70

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+ +L+++AN VTNF G  ++L +V   ++D+Y+G F  +LI  ++E  G  LL++QAH 
Sbjct  71    MHFSLSNSANVVTNFIGTVFLLXLVGGYVSDSYLGSFWTMLIFGFVELSGFILLSVQAHV  130

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPPPCN ++  E+C E  G  + I FVALY VA+GS  VK  + +HGADQF+  D K
Sbjct  131   PQLKPPPCN-VNNGEECVEAKGFKSLIFFVALYLVALGSGCVKPNMIAHGADQFNPDDPK  189

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +  ++S++FN       +G  V+LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  190   QSKKLSTYFNAAYFAFSMGELVALTLLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLY  249

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELY----EISKDKEAVTICAEFLPH  953
             YR    QG S +T I QVFVAAI  RK   P +   L+        D    +  A    H
Sbjct  250   YRNKRPQG-SILTPIAQVFVAAILKRKQVCPSNPQMLHGSQNNALNDNATFSSDAGSFLH  308

Query  954   TDKYRFLDKAA--IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             T+K+RFLDKA   IQ   + + +PWR+C VTQV+  KILL+++P+F  T+I    LAQLQ
Sbjct  309   TEKFRFLDKACIKIQDRTNSKESPWRLCTVTQVKQVKILLSVIPIFASTIIFNTILAQLQ  368

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFS+QQGS M+  +TKSF I P+SL  +P + L+ L+PLYD  FVP  R+ TG  +GI+P
Sbjct  369   TFSVQQGSMMNTKLTKSFHIPPASLQSIPYIILLILVPLYDTFFVPFARKFTGHDSGISP  428

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+  GL  ++ SM AAAI+E KR+  A   N +          IS+FW++ Q+ IFG+
Sbjct  429   LMRIGFGLFFATFSMIAAAIMEEKRRDAAIHSNQI----------ISIFWITPQFLIFGL  478

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKG--MTESG  1661
             ++M T VGL+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T        G
Sbjct  479   SEMLTAVGLIEFFYKQSLKGMQAFLTALTYCSYSFGFYLSSLLVSLVNKITTSSGGGVGG  538

Query  1662  GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             GWLG NN+N++ L+LFY LL+GLSF+NF  YLF S  Y +
Sbjct  539   GWLGDNNLNKDRLDLFYWLLAGLSFLNFLNYLFWSHWYSH  578



>ref|XP_010499893.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Camelina sativa]
Length=596

 Score =   405 bits (1042),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 248/560 (44%), Positives = 352/560 (63%), Gaps = 20/560 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VD RGR  R +KHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ +AN
Sbjct  23    DLSVDSRGRPCRPNKHGGTRAAVFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKSAN  82

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G FR +L+   IE  G  LLA+QAH  +L+PP C+ 
Sbjct  83    LVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGIIEIFGFILLAVQAHLPELRPPECD-  141

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +     C E  G  A  L+ AL  VA+GS  +K  + SHGADQF  KD +   ++SSFFN
Sbjct  142   MKGTIHCLEANGYKAVTLYAALCLVALGSGCLKPNIISHGADQFQRKDLR---KLSSFFN  198

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LTL VW+  H G D GF  S   M  G I   +G  FYR    +G S
Sbjct  199   AAYFAFSMGQLIALTLLVWVQTHSGMDVGFGVSAAVMAAGLISLVVGTNFYRNKPSRG-S  257

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
               T I QVFVAAI  RK   P ++  L++ S D     +  + L HT+K+RFLDKA I+T
Sbjct  258   IFTPIAQVFVAAITKRKQICPSNTNMLHQPSMD----LVRVKPLLHTNKFRFLDKACIKT  313

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                 + +PWR+C   QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+M+ +ITK
Sbjct  314   QGKVKESPWRLCTTEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMNTHITK  373

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             +FQI P+SL  +P + LIF +PLY+  FVP  R++TG  +GI+PL R+  GL L++ SM 
Sbjct  374   TFQIPPASLQAIPYIILIFFVPLYETFFVPLARKVTGNDSGISPLQRIGAGLFLATFSMV  433

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             AAA++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  434   AAALVEKKRRETFLEQN----------VTLSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQ  483

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYA  1715
             + + ++S  +   + S S G++ SSVLV  VN  T       GWLG N++N++ L+ FY 
Sbjct  484   SSQSMQSFLTALTYCSYSFGFYLSSVLVSAVNRVTSS-NGGEGWLGDNDLNKDRLDHFYW  542

Query  1716  LLSGLSFVNFFVYLFVSKRY  1775
             LL+ LSF+NFF YLF S+ Y
Sbjct  543   LLASLSFINFFNYLFWSRWY  562



>ref|XP_009401109.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   405 bits (1041),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 240/570 (42%), Positives = 354/570 (62%), Gaps = 22/570 (4%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             L +  +DWRG+  + +KHGG+RA+ F+LGI  FE MA   +G  L+TY+   M+  L+++
Sbjct  15    LTEVSLDWRGKPCKSNKHGGMRAACFVLGIQAFEIMAIAAVGNNLITYVFNEMHFPLSES  74

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTNF G  +IL++V   L+D+Y+G F  +LI  ++E  GL LL++QAH  +L+PPPC
Sbjct  75    ANIVTNFVGTIFILSLVGGFLSDSYLGSFWTMLIFGFVELSGLILLSVQAHLPQLRPPPC  134

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS-EMSS  626
             N +   E C E  G  A   F+ALY VA+GS  +K  + SHGADQF   D  + S ++S+
Sbjct  135   NMMS-GEHCMEAKGFKAVTFFLALYLVALGSGCLKPNMISHGADQFRNDDPDDQSRKLST  193

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             +FN      CVG  ++LT+ VW+    G D G   S  AM  G I    G PFYR    Q
Sbjct  194   YFNTAYFSFCVGELIALTVLVWVQMRSGMDVGLGVSAAAMAMGLISLVCGAPFYRNKPSQ  253

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKE----AVTICAEFLPHTDKYRFL  974
             G S  T I +VFVAA   RK      SG  +  +  K     + ++C   L H  K+RFL
Sbjct  254   G-SIFTPIARVFVAAFAKRKQVCLSSSGVPHTKNVPKHHGVSSQSVCN--LSHIHKFRFL  310

Query  975   DKAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQG  1148
             DKA I  Q   + + +PW++C   +VE  K++L+++P+F CT+I    LAQLQTFS++QG
Sbjct  311   DKACIKSQDGCNMKESPWKLCSKAEVEQVKVILSVIPIFACTIIFNTVLAQLQTFSVEQG  370

Query  1149  STMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVG  1328
             S+M+  +  SF++ P+SL  +P + L+ L+P+Y+  FVP  R+LTG  +GITPL R+ VG
Sbjct  371   SSMNTRLADSFRVPPASLQAIPYMVLVILVPIYETSFVPLARKLTGEDSGITPLQRIGVG  430

Query  1329  lllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYV  1508
             L  ++ SM AAA++E +R+++A     L          +S+FW++ Q+ IFG+++MFT V
Sbjct  431   LFTATFSMVAAAMIEKERREMAVGSGKL----------MSIFWIAPQFLIFGLSEMFTAV  480

Query  1509  GLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVN  1688
             GL+EFFY Q+   ++S  +   + S S G+F SS+LV +VN  T   + +GGWLG N++N
Sbjct  481   GLIEFFYKQSSGGMQSFLTAMTYCSYSFGFFLSSLLVSLVNKITSS-SSNGGWLGDNDLN  539

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             ++ L+LFY LL+ LS +NF  YLF +K Y 
Sbjct  540   KDRLDLFYWLLAALSLLNFLNYLFWAKWYS  569



>ref|XP_010248018.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X1 [Nelumbo 
nucifera]
Length=607

 Score =   405 bits (1042),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 243/560 (43%), Positives = 345/560 (62%), Gaps = 23/560 (4%)
 Frame = +3

Query  111   WRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNF  290
             +R         GG RA++FI      EN+  +        Y   VM+ +++ +AN +T+F
Sbjct  11    YRSLNPWSKGQGGFRAAMFIFVFTALENIGFVANMTGFYLYFYLVMHFDISGSANTLTSF  70

Query  291   AGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE  470
              G+TY+L++V   +ADTY+ R    LI   +E + + +L +QAHY K +P PC      +
Sbjct  71    MGSTYLLSLVGGFIADTYLSRLSTCLIFGLLEIVAMMILTVQAHYQKFQPEPC------D  124

Query  471   KCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLG  650
             K   V G  A + + +L  +A+G+ GVK A+P+ G DQF++KD KEG  ++SFFNWLLL 
Sbjct  125   KSPCVNGGKALMFYSSLCLLALGAGGVKGALPALGGDQFNQKDPKEGKALASFFNWLLLS  184

Query  651   VCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQI  830
               +G  + +T+  W+  +KGWD GF   T+  F G I  +LG PFY      G S + +I
Sbjct  185   STLGATIGVTVIQWVNTNKGWDLGFFICTILTFAGYIVLSLGKPFYHKRA-PGDSPLVRI  243

Query  831   IQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEE  1010
             IQV V AI NR   LP + G+LYEI+    A     E + HT+++RFLDKAAI       
Sbjct  244   IQVIVVAIRNRSSSLPVNPGQLYEINDKNIASD--EETISHTNQFRFLDKAAILRQ-GTN  300

Query  1011  PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqil  1190
             P PWRVC VTQVE  KIL+ ++P+   T+++  CLAQLQTFS+QQGS M+  + K F + 
Sbjct  301   PEPWRVCTVTQVEELKILMRMLPIIASTILLNTCLAQLQTFSVQQGSVMNRRLGK-FLVP  359

Query  1191  psslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaail  1370
               S+P +P++F+  LIP+Y  +FVP  RR+T  P+GIT L RV  GL+LS +SMA A ++
Sbjct  360   APSIPVIPLVFISILIPIYQFIFVPFARRITHRPSGITHLQRVGFGLVLSIISMAIAGVV  419

Query  1371  elKRK-QVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKE  1547
             E+KR+ QV ++             PIS+FWLS QY +FG ADMFT VGLLEF+Y +AP  
Sbjct  420   EVKRRDQVIKDPTK----------PISLFWLSFQYGVFGFADMFTLVGLLEFYYKEAPSG  469

Query  1548  LKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLS  1724
             ++S+S+ F W S S+GYF SSV V+++N  TK  T S  GWL G ++N+N+L LFY  L+
Sbjct  470   MRSLSTSFAWLSQSIGYFLSSVFVELINSITKRFTPSKQGWLEGIDLNKNNLNLFYWFLA  529

Query  1725  GLSFVNFFVYLFVSKRYKYR  1784
              LS +NF  Y F +  YK +
Sbjct  530   VLSCLNFANYCFWASWYKCK  549



>ref|XP_011095121.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 [Sesamum indicum]
Length=619

 Score =   405 bits (1042),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 245/569 (43%), Positives = 352/569 (62%), Gaps = 19/569 (3%)
 Frame = +3

Query  93    IDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAA  272
             +   VDWRGR  + + HGG+ A++FILG+  FE MA   +G  L+TY+   M+  L+ +A
Sbjct  18    LQTSVDWRGRPCKPNTHGGMTAALFILGLQAFEMMAIAGVGNNLITYVFNEMHFPLSKSA  77

Query  273   NHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCN  452
             N VTNF G  ++L++    L+D+Y+G F  +LI  ++E  G  LL++QAH A+L+PP C+
Sbjct  78    NTVTNFVGTVFLLSLFGGFLSDSYLGSFWTMLIFGFVELSGFVLLSIQAHVAELRPPKCS  137

Query  453   PLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFF  632
                    CEE  G  A I + ALY VA+GS  +K  + SHGADQF + D K+  ++S+FF
Sbjct  138   MGSPRGGCEEAKGYKAWIFYGALYLVALGSGCLKPNIISHGADQFPKHDSKQSKKLSTFF  197

Query  633   NWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGS  812
             N      C G  ++LTL VW+  H G D GF  S  AM  G I    G   YR    +G 
Sbjct  198   NSAYFAFCTGELLALTLLVWVQTHSGMDVGFGVSAAAMAVGLICLISGSLIYRNSPPRG-  256

Query  813   SAITQIIQVFVAAIHNRKLQLPEDSGELYE---ISKDKEAVTICAEF-LPHTDKYRFLDK  980
             S  T I QVFVAAI  RK   P +S  L+    +     + TI     L HT+K+RFLDK
Sbjct  257   SIFTPIAQVFVAAISKRKQICPSNSEMLHRSEMLDPQNPSRTISNNVTLIHTEKFRFLDK  316

Query  981   AAIQTS---WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             A I+T     +   + WR+C V+QVE  KIL+++VP+F CT+I     AQLQTFS+QQG+
Sbjct  317   ACIKTENGGNEMRESSWRLCSVSQVEQVKILVSVVPIFACTIIFNTISAQLQTFSVQQGT  376

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             +M+ N+T +F+I P+SL  +P + LIF++PLY+  FVP  RR+TG  +GITPL RV +GL
Sbjct  377   SMNTNLTPNFRIPPASLQSIPYMMLIFVVPLYETAFVPLARRITGNDSGITPLQRVGIGL  436

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
              +++ SM +AAI+E KR+  A + N            +S+ W++ Q+ IFG+++MFT VG
Sbjct  437   FIATFSMVSAAIIEHKRRNSALKLNER----------LSILWIAPQFLIFGVSEMFTAVG  486

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+ + + S  +   + S S G++ SS+LV +VN  T   +  GGWL  N++N+
Sbjct  487   LIEFFYKQSIQGMPSFLTAMTYCSYSFGFYLSSLLVSLVNKVTSS-SWGGGWLSENDLNK  545

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             + L+LFY LL+ LS +NFF YLF S+ Y 
Sbjct  546   DRLDLFYWLLAALSLINFFNYLFWSRWYS  574



>ref|XP_009795124.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Nicotiana sylvestris]
Length=627

 Score =   405 bits (1042),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 253/567 (45%), Positives = 342/567 (60%), Gaps = 26/567 (5%)
 Frame = +3

Query  96    DGK-VDWRGRTARKDK-HGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             +GK  ++   T+ K K  GG RA+ FI G+ G ENM  I + V+   Y + VM  +L  +
Sbjct  3     EGKSTEYNSMTSSKTKGKGGFRATTFIYGLLGLENMGFIAIMVSFGLYFSFVMGFDLTGS  62

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN +TN  G+T++L+I+   ++DTYI R+  VLI    E L   L+ +QAHY  L+P   
Sbjct  63    ANTLTNLMGSTFLLSILGGFISDTYINRYHTVLIFGPFEILAFALITIQAHYKSLQPECV  122

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
              P      C  ++G  A   + +L   A+GS GV+ A+P+ GADQFD+KD KE   +  +
Sbjct  123   VP-----NC--ISGWKAVFFYASLCCFALGSGGVRGALPALGADQFDQKDPKEAKALGRY  175

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN +LL   +GGA  +T  V++   K W  GF  S VA   G +FF  G PF R+    G
Sbjct  176   FNLVLLSSVIGGAFGVTFVVYVSTVKAWWKGFLISLVATSLGFVFFAFGKPFLRLQRPAG  235

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
             S  +T+I QV V AI NR LQ+PE+  ELYEI+ DKE+ +   + L HT ++RFLDKAAI
Sbjct  236   S-PLTRIFQVIVVAIENRNLQIPENIDELYEIN-DKESDS-SQQKLAHTKQFRFLDKAAI  292

Query  990   QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNI  1169
                   E  PW VC VTQVE  K+L  ++P+   T+IM  C+AQLQTFS+ QG  M+  I
Sbjct  293   LPK-TVEATPWTVCTVTQVEEVKVLTRMLPIIASTIIMNTCMAQLQTFSVAQGYRMNRFI  351

Query  1170  TKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssls  1349
              K     PS      I   I +   YD  FVP  R++T  P+GIT L RV VGL+LS +S
Sbjct  352   KKFEVPAPSVPAIPLIFMCILIPI-YDMFFVPFARKITKHPSGITQLQRVGVGLVLSIVS  410

Query  1350  maaaailelKRKQVARERNMLDAIPILQPL-PISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             MA AA++E+KRK  + +           PL PI + WL  QY IFGIADMFT VGLLEFF
Sbjct  411   MAVAALVEIKRKHHSLK----------NPLKPIHLAWLGFQYAIFGIADMFTLVGLLEFF  460

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLE  1703
             Y +AP  ++S+S+ F W S+SLGYF SSVLV+++N  TK    S  GWL G ++++N+L 
Sbjct  461   YKEAPAGMRSLSTSFTWISISLGYFLSSVLVEIINSVTKRRAPSKKGWLVGLDLDQNNLH  520

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             LFY  L+ LS +NF  YLF +  YKY+
Sbjct  521   LFYWFLAILSGLNFLNYLFWASWYKYK  547



>ref|XP_006307047.1| hypothetical protein CARUB_v10008635mg [Capsella rubella]
 gb|EOA39945.1| hypothetical protein CARUB_v10008635mg [Capsella rubella]
Length=600

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 250/562 (44%), Positives = 351/562 (62%), Gaps = 21/562 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VD RGR  R  KHGG+RA++F+LG+  FE MA   +G  L+TY+   M+  L+ +AN
Sbjct  24    DLCVDSRGRPCRLSKHGGMRAALFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKSAN  83

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G FR +L+   IE  G  LLA+QAH  +L+PP CN 
Sbjct  84    LVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGIIEIFGFILLAVQAHLPELRPPQCN-  142

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +     C E  G  A  L+ AL  VA+GS  +K  + SHGADQF  KD +   ++SSFFN
Sbjct  143   MKGTTHCLEANGYKAVTLYAALCLVALGSGCLKPNIISHGADQFQRKDLR---KLSSFFN  199

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LTL VW+  H G D GF  S   M  G I    G  FYR    +G S
Sbjct  200   AAYFAFSMGQLIALTLLVWVQTHSGMDVGFGVSAAVMAAGLISLVAGTNFYRNTPSRG-S  258

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
               T I QVFVAAI  RK   P +   L++ S D   V    + L HT+K+RFLDKA ++T
Sbjct  259   IFTPIAQVFVAAITKRKQICPSNPNMLHQPSMDLVRV----KPLLHTNKFRFLDKACVKT  314

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                   +PWR+C + QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+M+ +ITK
Sbjct  315   QGKVIESPWRLCTIEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMNTHITK  374

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             +FQI P+SL  +P + LIF +PLY+  FVP  R++TG  +GI+PL R+  GL L++ SM 
Sbjct  375   TFQIPPASLQAIPYIILIFFVPLYETFFVPLARKVTGNDSGISPLQRIGTGLFLATFSMV  434

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             AAA++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  435   AAALVEKKRRESFLEQN----------VTLSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQ  484

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGNNVNRNHLELF  1709
             + + ++S  +   + S S G++ SSVLV  VN  T   G     GWLG N++N++ L+ F
Sbjct  485   SSQSMQSFLTAMTYCSYSFGFYLSSVLVSAVNRVTSSNGSGTKEGWLGDNDLNKDRLDHF  544

Query  1710  YALLSGLSFVNFFVYLFVSKRY  1775
             Y LL+ LSF+NFF YLF S+ Y
Sbjct  545   YWLLASLSFINFFNYLFWSRWY  566



>ref|XP_006840235.1| hypothetical protein AMTR_s00089p00178270 [Amborella trichopoda]
 gb|ERN01910.1| hypothetical protein AMTR_s00089p00178270 [Amborella trichopoda]
Length=561

 Score =   403 bits (1035),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 238/564 (42%), Positives = 346/564 (61%), Gaps = 11/564 (2%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             DG +D +G    K KHGG RAS     +    N+A I   +  VTYL+  M  +LA A+ 
Sbjct  4     DGLIDRKGNPINKQKHGGPRASFLTHFLVLAVNIAMIPNILNTVTYLHETMYFDLAQAST  63

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              +TNF G T +  ++   L+D+YI RF  +LI   +EFLG G+LA+QAH+  L+PP C+ 
Sbjct  64    TMTNFLGVTSLFALLGGFLSDSYIKRFTMILIFGPLEFLGYGMLAIQAHFGSLRPPQCDI  123

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
              ++   C  V G  AA+L++ALYTVA+G   ++A +PS G DQFDE D +E  + SSFFN
Sbjct  124   GNEKSNCSPVQGGKAAMLYIALYTVALGEGCLRANIPSFGGDQFDENDIEESKQRSSFFN  183

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             W    + +GGA+ L L + L   KGWD+GFAA ++ +  G +    G P YR     G S
Sbjct  184   WYTFSISLGGAIGLVLIISLESSKGWDYGFAACSLVILVGWLVLVSGFPLYRHQSPSG-S  242

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
              + +I+QV V A+ NRKL LPE++ EL      ++ V +  E L HT+ ++FLDKA+I T
Sbjct  243   PLARIMQVTVVALKNRKLDLPENAEELNHGETKEDMVGV--EVLSHTNDFKFLDKASILT  300

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
             S   + +P   C VTQVE  KI+  LVP+ L ++I  + +  L T ++QQG+TM+  + +
Sbjct  301   SKKGKLSP---CSVTQVEETKIIFRLVPIALSSIICYVPVTLLLTLTVQQGNTMNKKVGR  357

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
                I P+SL F+PI F + ++ LYDR  +P  RRL    +GIT L RV +G   +++SM 
Sbjct  358   -IHISPASLFFIPITFQMLILFLYDRFIMPFGRRLIKDGSGITSLKRVGLGYFTTTISMC  416

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
              AA++E KRKQVA E  M++A      +P+SV WL  Q+F+ GI D  ++VGLLEFF S+
Sbjct  417   LAAMIEKKRKQVAIEHGMVEAT---TGIPMSVLWLGFQFFVLGIFDATSFVGLLEFFNSE  473

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYA  1715
               K +KS+ +   W  + LG    S LV +VN  T+  ++  GWLGGNN+N+NHL+ FY 
Sbjct  474   VSKGMKSLGTAIFWCILGLGSLLGSFLVHLVNQFTR-HSQGEGWLGGNNLNKNHLDRFYW  532

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQ  1787
             LL+ + F++F  YL+ + +Y  RQ
Sbjct  533   LLALIGFISFINYLWWALQYSSRQ  556



>ref|XP_006385089.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP62886.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=611

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 236/566 (42%), Positives = 345/566 (61%), Gaps = 18/566 (3%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRG+ +  +KHGG+RA+ F+LG+  FE MA   +G  L+TY+   M+ +L+ +AN VT
Sbjct  24    VDWRGKPSNPNKHGGMRAAAFVLGLQAFEIMAIAAVGNNLITYVINEMHFSLSKSANIVT  83

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  +IL ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN L  
Sbjct  84    NFVGTIFILALLGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPQCNMLTG  143

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E C E  G    I FVALY VA+GS  VK  + +HG DQF+  + K+  ++S++FN   
Sbjct  144   GENCIEAKGFKTLIFFVALYMVALGSGCVKPNMIAHGGDQFNRSNPKQSKKLSTYFNAAY  203

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G   +LTL VW+  + G D GF  S   M  G I    G  +YR    QG S  T
Sbjct  204   FAFSMGELFALTLLVWVQTNSGMDVGFGVSAAVMAMGLISLVSGTLYYRNKAPQG-SIFT  262

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEF-----LPHTDKYRFLDKAAI  989
              I QVFVAA+  RK   P +   L+       +  +         L HT ++RFLDKA I
Sbjct  263   PIAQVFVAAMFKRKQTYPANPQMLHGSQNSVPSNGLVDPSSDPCRLVHTQRFRFLDKACI  322

Query  990   QTS--WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
             +     + + +PWR+C VTQVE  KIL++ +P+F CT++    LAQLQTFS+QQGS MD 
Sbjct  323   KVEDGSNRKESPWRLCSVTQVEQVKILISAIPIFACTIVFNTILAQLQTFSVQQGSAMDT  382

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              +TKSF I P+SL  +P + LIF++PLY+  FVP  R++TG  +GI+PL R+  GL   +
Sbjct  383   QLTKSFHIPPASLQSIPYIILIFVVPLYETFFVPFARKITGHESGISPLQRIGAGLFFVT  442

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM +AAI+E KR+  A + N +          +S+FW++ Q+ IFG+++M T VGL+EF
Sbjct  443   FSMVSAAIMEKKRRDAAVDSNKI----------LSIFWITPQFLIFGLSEMLTAVGLIEF  492

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ K +++  +   + S S G++ SS+LV +VN  T   + + GWL  N++N++ L+
Sbjct  493   FYKQSLKGMQAFLTAITYCSYSFGFYLSSLLVSLVNKVTSSSSTNKGWLSDNDLNKDRLD  552

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKY  1781
             LFY +L+ L F+NF  YLF ++ Y Y
Sbjct  553   LFYWMLAVLGFLNFLNYLFWARWYSY  578



>ref|XP_009103101.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Brassica rapa]
Length=594

 Score =   404 bits (1038),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 253/574 (44%), Positives = 352/574 (61%), Gaps = 24/574 (4%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             IN++E  E  +  VDWRGR +   KHGG+RA++F+LG+  FE M    +G  L+TY+   
Sbjct  20    INNRELAE--EESVDWRGRPSNPSKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I +++   L+D ++G F  +LI  ++E  G  LL++QAH 
Sbjct  78    MHFPLSKAANSVTNFVGTIFIFSLLGGYLSDAFLGSFWTILIFGFVELSGFILLSVQAHL  137

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR-  602
             ++LKPP CNPL     CEE  G  A I F ALY VA+GS  VK  + +HGADQF  +   
Sbjct  138   SQLKPPKCNPLINQSSCEEAKGFKAIIFFTALYLVALGSGCVKPNMIAHGADQFSHQSHP  197

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             K+   +SS+FN       +G  ++L+L VW+  H G D GF  S  AM  G I    G  
Sbjct  198   KQSKRLSSYFNAAYFAFSIGELIALSLLVWIQTHSGMDVGFGVSAAAMTMGLISLVSGTM  257

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL---YEISKDKEAVTICAEFLPH  953
             ++R    +  S  T I QV VAAI  RKL  P D   L   + +  D     + +  LP+
Sbjct  258   YFRNKRPR-RSIFTPIAQVVVAAILKRKLASPADPKMLNGGHRVPND----VVDSSTLPY  312

Query  954   TDKYRFLDKAA--IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             T + RFLDKA   IQ +  +E +PWR+C V QVE  K L++LVPVF  T++    LAQLQ
Sbjct  313   TPRLRFLDKACTKIQDTNTKE-SPWRLCTVNQVEQVKTLISLVPVFASTIVFNTILAQLQ  371

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFS+QQGS+M+  ++ SF I P+SL  +P + LIFL+PLYD LFVP  R+LTG  +GI P
Sbjct  372   TFSVQQGSSMNTRLSNSFHIPPASLQAIPYIMLIFLVPLYDSLFVPFARKLTGHSSGIPP  431

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+ VGL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFGI
Sbjct  432   LTRIGVGLFLSTFSMVSAALLEKKR----RDSSVLDG------RILSIFWITPQFLIFGI  481

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGW  1667
             ++MFT VGL+EFFY Q    ++S      + S S G++ SS+LV +VN  T    +S GW
Sbjct  482   SEMFTAVGLIEFFYKQTIMGMESFLMSLTYCSYSFGFYFSSLLVSIVNKITSTSADSKGW  541

Query  1668  LGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             L  N++N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  542   LRENDLNKDRLDLFYWLLAVLSLLNFISYLFWSR  575



>ref|XP_010065237.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 [Eucalyptus grandis]
 gb|KCW62580.1| hypothetical protein EUGRSUZ_G00075 [Eucalyptus grandis]
Length=608

 Score =   403 bits (1035),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 247/563 (44%), Positives = 347/563 (62%), Gaps = 21/563 (4%)
 Frame = +3

Query  108   DWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTN  287
             DWRGR +   KHGG+RA+ F+LG+  FE MA   +G  L+TY+   M+ +L+ +AN VTN
Sbjct  23    DWRGRPSNPRKHGGMRAATFVLGLQTFEIMAIAAVGNNLITYVINEMHYSLSKSANIVTN  82

Query  288   FAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKA  467
             F G  +IL ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP C+ +   
Sbjct  83    FVGTIFILALLGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLKPPKCDMIHSP  142

Query  468   EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLL  647
               C+E  G  A I FVALY VA+GS  VK  + +HGADQF   D  +  ++SS+FN    
Sbjct  143   SDCDEAKGFKAFIFFVALYLVALGSGCVKPNMIAHGADQFKRDDPSQSKKLSSYFNAAYF  202

Query  648   GVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQ  827
                VG  V+LT+ VW+  H G D GF  S   M  G I    G  +YR    QG S +T 
Sbjct  203   AFSVGELVALTVLVWVQTHSGMDVGFGVSAAVMAMGLISLVSGTLYYRNKRPQG-SILTP  261

Query  828   IIQVFVAAIHNRKLQLPEDSGELYEISKD-KEAVTICAEFLPH------TDKYRFLDKAA  986
             + QV VAAI  R   LP +   L+       ++    +   PH      T+++RFLDKA 
Sbjct  262   LAQVIVAAIAKRNQVLPSNPQLLHGSQNSVNDSNNDGSSSSPHGGHLFRTERFRFLDKAC  321

Query  987   IQTSWD--EEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMD  1160
             I+T  +     +PWR+C V+QVE  KILL+++PVF CT+I    LAQLQTFS+QQGS+M+
Sbjct  322   IKTQEEGKSRESPWRLCTVSQVEQVKILLSIIPVFACTIIFNTILAQLQTFSVQQGSSMN  381

Query  1161  LNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGllls  1340
              ++T+SF I P+SL  +P L LIF++PLYD LFVP  RR TG  +GI+PL R+  GL L+
Sbjct  382   NHLTRSFHIPPASLQAIPYLMLIFVVPLYDTLFVPFARRFTGRDSGISPLQRIGFGLFLA  441

Query  1341  slsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLE  1520
             + SM AAA++E KR+  A     +          IS+FWL+ Q+ IFG+++M T VGL+E
Sbjct  442   TFSMIAAALMERKRRDEAVGNGKI----------ISIFWLTPQFLIFGLSEMLTAVGLIE  491

Query  1521  FFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHL  1700
             FFY Q+   L++  +   + S S G++ SS+LV +VN  T     +GGWLG N++N + L
Sbjct  492   FFYKQSSNGLQAFLTAITYCSYSFGFYFSSLLVSLVNKVTAS-NGNGGWLGQNDLNNDRL  550

Query  1701  ELFYALLSGLSFVNFFVYLFVSK  1769
             +LFY LL+ LSF+NF  YLF S+
Sbjct  551   DLFYWLLAILSFLNFLNYLFWSR  573



>ref|XP_011028408.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 [Populus euphratica]
Length=669

 Score =   405 bits (1040),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 237/566 (42%), Positives = 346/566 (61%), Gaps = 18/566 (3%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRG+ +  +KHGG+RA+ F+LG+ GFE MA   +G  L+TY+   M+ +L+ +AN VT
Sbjct  82    VDWRGKPSNPNKHGGMRAAAFVLGLQGFEIMAIAAVGNNLITYVINEMHFSLSKSANIVT  141

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  +IL ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN L  
Sbjct  142   NFVGTIFILALLGGYLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPQCNMLTG  201

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E C E  G    I FVALY VA+GS  VK  + +HG DQF++ + K+  ++S++FN   
Sbjct  202   GENCIEAKGFKTLIFFVALYMVALGSGCVKPNMIAHGGDQFNQSNPKQSKKLSTYFNAAY  261

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G   +LTL VW+  + G D GF  S   M  G I    G  +YR    QG S  T
Sbjct  262   FAFSMGELFALTLLVWVQTNSGMDVGFGVSAAVMAMGLISLVSGTLYYRNKAPQG-SIFT  320

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEF-----LPHTDKYRFLDKAAI  989
              I QVFVAA+  RK   P +   L+       +  +         L HT ++RFLDKA I
Sbjct  321   PIAQVFVAAMFKRKHICPANPQMLHGSQNSVPSNGLVDPSSDPCRLVHTQRFRFLDKACI  380

Query  990   QTS--WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
             +     + +  PWR+C VTQVE  KIL++ +P+F CT++    LAQLQTFS+QQGS MD 
Sbjct  381   KVEDGINRKEGPWRLCSVTQVEQVKILISAIPIFACTIVFNTILAQLQTFSVQQGSAMDT  440

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              +TKSF I P+SL  +P + LIF++PLY+  FVP  R++TG  +GI+PL R+  GL   +
Sbjct  441   QLTKSFHIPPASLQSIPYIILIFVVPLYETFFVPFARKITGHESGISPLQRIGAGLFFVT  500

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM +AAI+E KR+  A + N +          +S+FW++ Q+ IFG+++M T VGL+EF
Sbjct  501   FSMVSAAIMEKKRRDSAVDSNKI----------LSIFWITPQFLIFGLSEMLTAVGLIEF  550

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+ K +++  +   + S S G++ SS+LV +VN  T   + + GWL  N++N++ L+
Sbjct  551   FYKQSLKGMQAFLTAITYCSYSFGFYLSSLLVSLVNKVTSSSSTNKGWLSDNDLNKDRLD  610

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKY  1781
             LFY +L+ L F+NF  YLF ++ Y Y
Sbjct  611   LFYWMLAVLGFLNFLNYLFWARWYSY  636



>ref|XP_006358567.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Solanum tuberosum]
Length=611

 Score =   403 bits (1035),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 246/549 (45%), Positives = 338/549 (62%), Gaps = 24/549 (4%)
 Frame = +3

Query  144   GGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVA  323
             GG RA+ FI G+ G ENM  + + V+   Y + VM  +L+ +AN +TN  G+T++L+I+ 
Sbjct  21    GGFRATSFIFGLLGLENMGFVAVMVSFGLYFSFVMGFDLSGSANTLTNLMGSTFLLSILG  80

Query  324   AVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAA  503
               ++DTYI RF  VLI    E +   L+ +QAHY  L+P    P      C  ++G+ A 
Sbjct  81    GFISDTYINRFHTVLIFGPFEIIAFALITIQAHYKSLQPVCLEP-----NC--ISGKKAI  133

Query  504   ILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTL  683
               + +L   A+G  GVK A+P+ GADQFD+KD KE   +  +FN L+    +GGA  +T 
Sbjct  134   FFYASLCCFALGGGGVKGALPALGADQFDQKDPKEAKALGRYFNLLMFSSVIGGAFGVTF  193

Query  684   FVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNR  863
              V++     W  GF  S V++  G IFF LG PF+R+    GS  +T+I QV V AI+N 
Sbjct  194   VVYVSTVNAWWKGFLISLVSVTLGFIFFALGKPFFRLQQPAGS-PLTRIFQVIVVAINNG  252

Query  864   KLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQ  1043
             KLQLPE+S ELYEIS +KE+ +   + L HT ++RFLDKAAI      EP  W VC VTQ
Sbjct  253   KLQLPENSEELYEIS-EKESDSSQPK-LAHTKQFRFLDKAAIHPK-TGEPTAWTVCTVTQ  309

Query  1044  VENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilf  1223
             VE  K+L  ++P+   T+IM  C+AQLQTFS+ QG  M+  I K     PS      I+ 
Sbjct  310   VEEVKVLTRMLPIIASTIIMNTCMAQLQTFSVAQGYRMNRFIKKFEVPAPSVPAIPLIIM  369

Query  1224  lifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARER  1403
              I +   YD +FVP  R++T  P+GIT L RV VGL+LS +SMA AA++E+KRK  + + 
Sbjct  370   CILIPI-YDMVFVPFARKITKHPSGITQLQRVGVGLVLSIVSMAVAALVEIKRKHHSLK-  427

Query  1404  NMLDAIPILQPL-PISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWS  1580
                       PL PI + WL  QY IFGIADMFT VGLLEFFY +AP  ++S+S+ F W 
Sbjct  428   ---------DPLHPIHLAWLGFQYSIFGIADMFTLVGLLEFFYKEAPVGMRSLSTSFTWI  478

Query  1581  SMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYALLSGLSFVNFFVYL  1757
             S+SLG+F SSVLV ++N  TK    S  GWL G ++++N+L LFY  L+ LS +NF  YL
Sbjct  479   SISLGFFLSSVLVDIINSVTKKRAPSKKGWLVGLDLDQNNLHLFYWFLAILSGLNFLNYL  538

Query  1758  FVSKRYKYR  1784
             + +  YKY+
Sbjct  539   YWASWYKYK  547



>ref|XP_009355381.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Pyrus x bretschneideri]
Length=613

 Score =   403 bits (1035),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 251/580 (43%), Positives = 358/580 (62%), Gaps = 22/580 (4%)
 Frame = +3

Query  66    INSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             I++ E  E  +  VDWRGR +   KHGG+RA+ F+LG+  FE M    +G  L+TY+   
Sbjct  13    IDTSEMAE--EMTVDWRGRPSNPTKHGGMRAAAFVLGLQSFEIMGIAAVGNNLITYVINE  70

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+ +L+++AN VTNF G  ++L +V   ++D+Y+G F  +LI  ++E  G  LL++QAH 
Sbjct  71    MHFSLSNSANVVTNFIGTVFLLALVGGYVSDSYLGSFWTMLIFGFVELSGFILLSVQAHV  130

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPPPCN ++  E+C    G  + I FVALY VA+GS  +K  + +HGADQF+  D K
Sbjct  131   PQLKPPPCN-VNNGEECVVAKGFKSLIFFVALYLVALGSGCMKPNMIAHGADQFNPDDPK  189

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +  ++S++FN       +G  V+LTL VW+  H G D GF  S  AM  G I    G  +
Sbjct  190   QSKKLSTYFNAAYFAFSMGELVALTLLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLY  249

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELY----EISKDKEAVTICAEFLPH  953
             YR    QG S +T I QVFVAAI  RK   P +   L+        D    +  A    H
Sbjct  250   YRNKRPQG-SILTPIAQVFVAAILKRKQVCPSNPQMLHGSQNNAPNDNATFSSDAGSFLH  308

Query  954   TDKYRFLDKAA--IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQ  1127
             ++K+RFLDKA+  IQ   + + +PWR+C VTQV+  KILL+++P+F  T+I    LAQLQ
Sbjct  309   SEKFRFLDKASIKIQDRTNSKESPWRLCTVTQVKQVKILLSVIPIFASTIIFNTILAQLQ  368

Query  1128  TFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITP  1307
             TFS+QQGS M+  +TKSF I P+SL  +P + L+ L+PLYD  FVP  R+ TG  +GI+P
Sbjct  369   TFSVQQGSMMNTKLTKSFHIPPASLQSIPYIILLILVPLYDTFFVPFARKFTGHDSGISP  428

Query  1308  LHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGI  1487
             L R+  GL  ++ SM AAAI+E KR+  A   N +          IS+FW++ Q+ IFG+
Sbjct  429   LMRIGFGLFSATFSMIAAAIMEKKRRDAAIHSNQI----------ISIFWITPQFLIFGL  478

Query  1488  ADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKG--MTESG  1661
             ++M T VGL+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T        G
Sbjct  479   SEMLTAVGLIEFFYKQSLKGMQAFLTALTYCSYSFGFYLSSLLVSLVNKITTSSGGGVGG  538

Query  1662  GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKY  1781
             GWLG NN+N++ L+LFY LL+GLSF+NF  YLF S  Y +
Sbjct  539   GWLGDNNLNKDRLDLFYWLLAGLSFLNFLNYLFWSHWYSH  578



>ref|XP_009600843.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Nicotiana tomentosiformis]
Length=654

 Score =   404 bits (1038),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 251/567 (44%), Positives = 340/567 (60%), Gaps = 26/567 (5%)
 Frame = +3

Query  96    DGK-VDWRGRTARKDK-HGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             +GK  D+    + K K  GG RA+ FI G+FG ENM  I + V+   Y + VM  +L  +
Sbjct  48    EGKSADYNSVISSKTKGKGGFRATTFIYGLFGLENMGFIAIMVSFGLYFSFVMGFDLTGS  107

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN +TN  G+T++L+I+   ++DTYI R+  VLI    E L   L+ +QAHY  L+P   
Sbjct  108   ANTLTNLMGSTFLLSILGGFISDTYINRYHTVLIFGPFEILAFALITIQAHYKSLQPECV  167

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
              P      C  ++G  A   + +L   A+GS GV+ A+P+ GADQFD+KD KE   +  +
Sbjct  168   VP-----NC--ISGWKAVFFYASLCCFALGSGGVRGALPALGADQFDQKDPKEAKALGRY  220

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN +LL   +GGA  +T  V++   K W  GF  S V    G IFF  G PF R+    G
Sbjct  221   FNLVLLSSVIGGAFGVTFVVYVSTTKAWWKGFLISLVGTALGFIFFAFGKPFLRLQRPAG  280

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
             S  +T+I QV V  I NR LQ+PE+S ELYEI+ +KE+ +   + L HT ++RFLDKAA 
Sbjct  281   S-PLTRIFQVIVVTIKNRNLQIPENSDELYEIN-EKESDS-SQQKLAHTKQFRFLDKAAT  337

Query  990   QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNI  1169
                   E  PW VC VTQ+E  K+L  ++P+   T+IM  C+AQLQTFS+ QG  M+  I
Sbjct  338   LPK-TVEATPWTVCTVTQIEEVKVLTRMLPIIASTIIMNTCMAQLQTFSVAQGYRMNRFI  396

Query  1170  TKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssls  1349
              K     PS      I   I +   YD  FVP  R++T  P+GIT L RV VGL+LS +S
Sbjct  397   KKFEVPAPSVPAIPLIFMCILIPI-YDMFFVPLARKITKHPSGITQLQRVGVGLVLSIVS  455

Query  1350  maaaailelKRKQVARERNMLDAIPILQPL-PISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             MA AA++E+KRK  + +           PL PI + WL  QY IFGIADMFT VGLLEFF
Sbjct  456   MAVAALVEIKRKHHSLQ----------NPLKPIHLAWLGFQYAIFGIADMFTLVGLLEFF  505

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLE  1703
             Y +AP  ++S+S+ F W S+SLGYF SSVLV+++N  TK    S  GWL G ++++N+L 
Sbjct  506   YKEAPAGMRSLSTSFTWISISLGYFLSSVLVEIINSVTKRRAPSKKGWLVGLDLDQNNLH  565

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             LFY  L+ LS +NF  YLF +  YKY+
Sbjct  566   LFYWFLAILSGLNFLNYLFWASWYKYK  592



>ref|XP_010542589.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542597.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 isoform X2 [Tarenaya 
hassleriana]
Length=593

 Score =   401 bits (1031),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 247/564 (44%), Positives = 350/564 (62%), Gaps = 24/564 (4%)
 Frame = +3

Query  87    ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLAD  266
             E  D  VD+RGR     KHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ 
Sbjct  18    ESDDLCVDFRGRPCIPRKHGGARAALFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSK  77

Query  267   AANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPP  446
             +AN VTNF G  ++L+++   L+D+Y+G FR VL+   +E  G  LL++QAH  +L+P  
Sbjct  78    SANIVTNFIGTVFLLSLLGGFLSDSYLGSFRTVLVFGSVEISGFILLSVQAHLPQLRPRD  137

Query  447   CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             C+ +     C E  G  A IL+ ALY +A+GS  +K  + SHGA+QF ++D +   ++SS
Sbjct  138   CD-MKSTRHCPEAKGYEAVILYTALYLIALGSGCLKPNIISHGANQFLKEDSR---KLSS  193

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             FFN      C+G  ++LTL VW+  H G D GF  S   M  G I    G PFYR     
Sbjct  194   FFNGAYFAFCMGELLALTLLVWVQTHSGMDVGFGVSAAVMAAGMICLVSGTPFYRNKPPN  253

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA  986
             G S  T I QVFVAA+  RK   P +   L++ S D+         L HTDK+RFLDKA 
Sbjct  254   G-SIFTPISQVFVAAVTKRKQSFPSNMETLHQSSSDR------VRPLLHTDKFRFLDKAC  306

Query  987   IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLN  1166
             I+       + WR+C V QVE  KILL++VP+F CT++    LAQLQTFS+QQGS M+ +
Sbjct  307   IKMQDKGSESQWRLCTVEQVEQVKILLSVVPIFACTIVFNTILAQLQTFSVQQGSIMNTH  366

Query  1167  ITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllssl  1346
             ITK F+I P+SL  +P + LIF++PLY+  FVP  R+LTG  +GI+PL R+  GL L++ 
Sbjct  367   ITKRFEIPPASLQSIPYIILIFVVPLYETFFVPIARKLTGKDSGISPLQRIGAGLFLATF  426

Query  1347  smaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFF  1526
             SM AAA++E KR++ +                +S+FW++ Q+ IFG+++MFT VGL+EFF
Sbjct  427   SMVAAALIEAKRRKSSFHHGE----------TLSIFWIAPQFLIFGLSEMFTAVGLVEFF  476

Query  1527  YSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT-KGMTESGGWLGGNNVNRNHLE  1703
             Y Q+ + ++S  +   + S S G++ SS+LV +VN  T KG    GGWL  N++N++ L+
Sbjct  477   YKQSSQRMQSFLTAMTYCSYSFGFYLSSILVSLVNHVTSKG--SGGGWLSDNDLNKDRLD  534

Query  1704  LFYALLSGLSFVNFFVYLFVSKRY  1775
             LFY LL+ LSF NFF YLF S+ Y
Sbjct  535   LFYWLLAALSFFNFFHYLFWSRWY  558



>ref|XP_010094918.1| Nitrate transporter 1.2 [Morus notabilis]
 gb|EXB57561.1| Nitrate transporter 1.2 [Morus notabilis]
Length=624

 Score =   402 bits (1032),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 243/560 (43%), Positives = 341/560 (61%), Gaps = 21/560 (4%)
 Frame = +3

Query  114   RGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFA  293
             R   A   K GG  A  FI  +  FENM  +   V+ V Y   +M      AAN +TNF 
Sbjct  43    RINEALSPKKGGFNACKFIFVLAAFENMGFVANMVSFVVYFMSIMFFKYHTAANTLTNFM  102

Query  294   GATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEK  473
             G T++L+++   ++DTY+ RF   LI   +E + L L+ +QA    L+P  C       K
Sbjct  103   GTTFLLSLLGGFISDTYLSRFTTCLIFGSLEIVALVLMTIQAATHSLQPEFC------VK  156

Query  474   CEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGV  653
                + G    + + +LY +A+GS GV+ A+P+ GADQFD KD KE   +++FFNW LL V
Sbjct  157   SSCIQGGVKVMFYFSLYLLALGSGGVRGALPALGADQFDRKDPKEAKALATFFNWFLLSV  216

Query  654   CVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQII  833
              +G +V +T  V+      W  GF  ST+A F G +   LG P+YR+   +  S I +II
Sbjct  217   TLGASVGVTAIVYYSTTVSWYKGFIVSTIAAFLGFVVLALGKPYYRLQTPE--SPILKII  274

Query  834   QVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEP  1013
             QV   A  NR L LPED  ELYEIS DK+ V    + + HT+++R LDKAAI    + EP
Sbjct  275   QVIYVASKNRGLSLPEDPRELYEIS-DKDPVA-AEDKIAHTNEFRLLDKAAILPQ-NTEP  331

Query  1014  NPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilp  1193
              PW+VC VTQVE  K+L  ++P+   T++M  C+AQLQTFS+QQG+T+      S +I  
Sbjct  332   LPWKVCTVTQVEEVKVLTRMLPILASTILMNTCMAQLQTFSVQQGATVMDRKLGSMEIPA  391

Query  1194  sslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaaile  1373
              S+P +P+LF+  LI +Y+ LFVP  R++T  P+GIT L RV VGL+LS+LSMA A ++E
Sbjct  392   PSVPIIPLLFMSVLIVIYEYLFVPFARKITKHPSGITQLQRVGVGLVLSALSMAVAGLVE  451

Query  1374  lKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELK  1553
              KR ++A E           P  IS+ WLS QY IFGIADMFT VGLLEFFY +AP  ++
Sbjct  452   HKRLKLAHES---------PPKTISIMWLSFQYGIFGIADMFTLVGLLEFFYKEAPAGMR  502

Query  1554  SVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYALLSGL  1730
             S+S+ F W ++S GYF S++ V ++N  TK +T S  GWL G  +N ++L LFY  L+ L
Sbjct  503   SLSTSFTWLTLSFGYFLSTIFVDIINAVTKRVTPSKKGWLSGQTINDSNLHLFYWFLAIL  562

Query  1731  SFVNFFVYLFVSKRYKYRQQ  1790
             S +NF +Y++ +  YKY+ +
Sbjct  563   SCLNFLLYVWSAMCYKYKSE  582



>ref|XP_009113281.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 isoform X2 [Brassica 
rapa]
Length=587

 Score =   400 bits (1028),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 250/569 (44%), Positives = 346/569 (61%), Gaps = 20/569 (4%)
 Frame = +3

Query  69    NSQEKYELIDGK-VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGV  245
             N    +EL + +  DWRGR +  +KHGG RA++F+LG+  FE M    +G  L+TY+   
Sbjct  18    NEMNNWELTEEESFDWRGRPSNPNKHGGTRAALFVLGLQAFEIMGIAAVGNNLITYVINE  77

Query  246   MNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHY  425
             M+  L+ AAN VTNF G  +I  ++   L+D ++G F  +LI  +    G  LL++QAH 
Sbjct  78    MHFPLSKAANIVTNFVGTIFIFGLLGGYLSDAFLGSFWTILIFGF----GFILLSVQAHL  133

Query  426   AKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRK  605
              +LKPP CNPL     CEE  G  A   F+ALY VA+GS  VK  + +HGADQF +   K
Sbjct  134   PQLKPPKCNPLIDPSSCEEAKGFKATFFFMALYLVALGSGCVKPNMIAHGADQFSQSHPK  193

Query  606   EGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPF  785
             +   +SS+FN       +G  ++LTL VW+  H G D GF  S  AM  G I    G  F
Sbjct  194   QSKRLSSYFNAAYFAFSMGELIALTLLVWVQTHSGMDVGFGVSAAAMTIGLISLVSGTMF  253

Query  786   YRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKY  965
             +R    +  S  T I QV VAAI  RKL  P D   L+  +     V + +  LPHT + 
Sbjct  254   FRNKRPR-RSLFTPIAQVVVAAISKRKLVAPSDPIMLHGGNHASNDV-LPSSTLPHTPRL  311

Query  966   RFLDKAAIQT-SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             RFLDKA I+    + + +PW +C V+QVE  K L++LVP+F  T++    LAQLQTFS+Q
Sbjct  312   RFLDKACIKVQETNTKESPWTLCTVSQVEQVKTLISLVPIFASTIVFNTILAQLQTFSVQ  371

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS+M+  ++ SF I P+SL  +P + LIFL+PLYD LFVP  R+ TG  +GITPL R+ 
Sbjct  372   QGSSMNTRLSNSFHIPPASLQAIPYIMLIFLVPLYDSLFVPFARKFTGQDSGITPLTRIG  431

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
              GL LS+ SM +AA+LE KR    R+ ++LD         +S+FW++ Q+ IFGI++MFT
Sbjct  432   FGLFLSTFSMVSAALLEKKR----RDSSVLDG------RILSIFWITPQFLIFGISEMFT  481

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNN  1682
              VGL+EFFY Q+ K ++S      + S S G++ SSVLV +VN  T     S GWLG N+
Sbjct  482   AVGLIEFFYKQSAKGMESFLMALTYCSYSFGFYFSSVLVSIVNKITS--VNSKGWLGDND  539

Query  1683  VNRNHLELFYALLSGLSFVNFFVYLFVSK  1769
             +N++ L+LFY LL+ LS +NF  YLF S+
Sbjct  540   LNKDRLDLFYWLLAVLSLLNFLSYLFWSR  568



>ref|XP_010063728.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Eucalyptus grandis]
Length=613

 Score =   401 bits (1030),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 243/568 (43%), Positives = 354/568 (62%), Gaps = 19/568 (3%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR  R ++HGG+ A+IF+LG+  FE MA   +G  L+TY+   M+  L+ +AN VT
Sbjct  29    VDWRGRPCRANRHGGMTAAIFVLGLQAFEMMAIAGVGNNLITYVFSDMHFPLSKSANIVT  88

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLD-  461
             NF G  ++L+++   L+D+Y+G F  +L+  ++E  G  LL++QAH   LKPP CN  D 
Sbjct  89    NFVGTIFLLSLLGGFLSDSYLGSFWTMLVFGFVELAGFILLSIQAHLQSLKPPKCNMTDA  148

Query  462   KAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWL  641
             +   CEE +G  A I +V+L  VA+GS  +K  + SHGADQF  +D ++   +S++FN  
Sbjct  149   QGSHCEEASGYRALIFYVSLCLVALGSGCLKPNIISHGADQFRREDSRQSRRLSTYFNAA  208

Query  642   LLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAI  821
                 C G  V+LT+ VW+    G D GF  S  AM  G +    G+ FY+     G S  
Sbjct  209   YFAFCTGELVALTVLVWVQTDSGMDVGFGVSAAAMVVGLVSLISGILFYKNTPPHG-SIF  267

Query  822   TQIIQVFVAAIHNRKLQLPEDSGELY--EISKDKEAVTICAEF--LPHTDKYRFLDKAA-  986
             T I QVFVAAI  RK   P ++  L+  +I++  + V   AE   L HT+K+RFLDKA  
Sbjct  268   TPIAQVFVAAITKRKQICPSNTDMLHGNKINESNDQVASAAESSNLRHTEKFRFLDKACI  327

Query  987   -IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
              IQ    +  +PWR+C V QVE  KI+++++P+F CT+I    LAQLQTFS+ QG +MD 
Sbjct  328   KIQDGARDSESPWRLCTVRQVEQVKIIISVIPIFACTIIFNTILAQLQTFSVLQGRSMDT  387

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              I   F + P+SL  +P L LI ++PLY+ LFVP  RRLTG  +GI+PL RV +GL ++S
Sbjct  388   RIKDHFHVPPASLQAIPYLMLIVVVPLYETLFVPITRRLTGRDSGISPLQRVGIGLFIAS  447

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM +AA++E KR+  A + +            +S+FW++ Q+ IFG+++MFT VGL+EF
Sbjct  448   FSMVSAALVEKKRRDSALQHHE----------TLSIFWIAPQFLIFGLSEMFTAVGLIEF  497

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHL  1700
             FY Q+ + ++S  +   + S S G++ SS+LV +VN  T   + S GGWL  N++N++ L
Sbjct  498   FYKQSVEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITSTSSSSVGGWLSDNDLNKDRL  557

Query  1701  ELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             +LFY LL+ LSF+NF  YLF S  Y  +
Sbjct  558   DLFYWLLAALSFINFLNYLFCSLWYSNK  585



>ref|XP_011092258.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3 [Sesamum indicum]
Length=608

 Score =   400 bits (1029),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 247/582 (42%), Positives = 356/582 (61%), Gaps = 23/582 (4%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
             N  E+       VDWRGR +  +KHGG+RA++F+LG+ GFE M    +G  L++Y+   M
Sbjct  13    NKGERVYEETSTVDWRGRPSNPNKHGGMRAAVFVLGLQGFEIMGIAAVGNNLISYVINEM  72

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             + +L+ +AN VTNF G  +IL +    L+D+Y+  F  +LI A++E  G  LL++QAH  
Sbjct  73    HFSLSKSANTVTNFIGTLFILALFGGYLSDSYLSSFSTILIFAFLELSGFILLSVQAHLP  132

Query  429   KLKPPPCNPLDKA--EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
             +LKPP CN L  +  E+C E  G  A I FVALY VA+GS  VK  + +HGADQF     
Sbjct  133   QLKPPKCNMLSDSGDEQCVEAKGMQALIFFVALYLVALGSGCVKPNLIAHGADQFSPNQS  192

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             K   ++S++FN       +G  V+LTL V++  H G D GF  S  AM  G I F  G  
Sbjct  193   K---KLSTYFNSAYFAFSMGELVALTLLVYVQTHSGMDVGFGVSAAAMAMGLISFISGAF  249

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPED---SGELYEISKDKEAVTICAEFLPH  953
              Y+    QG S ++ I QVFVAA   RK   P D   S  +Y    + +     +   PH
Sbjct  250   LYKNKPPQG-SILSPIAQVFVAATLKRKHVCPSDLVMSHGIYHKEPNCDKPISSSFGNPH  308

Query  954   -TDKYRFLDKAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
              T+++RFL+KA I  Q    ++ +PWR+C V+QVE  KIL++++P+F  T++    LAQL
Sbjct  309   PTERFRFLNKACIKLQDGNIQKESPWRLCSVSQVEQVKILISIIPIFASTIVFNTILAQL  368

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFS+QQGS+M+  +T++F+I P+SL  +P + LIF++PLYD  FVP  R++TG  +GIT
Sbjct  369   QTFSVQQGSSMNTKLTETFRIPPASLQAIPYIMLIFIVPLYDTFFVPFARKITGHDSGIT  428

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
             PL R+  GL L++ SM +AA++E KR+  A   N+           +S+FW++ Q+ IFG
Sbjct  429   PLQRIGTGLFLATFSMISAALMEKKRRNAAVNENVT----------LSIFWITPQFLIFG  478

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGG  1664
             I++MFT VGL+EFFY Q  K ++S  +   + S S G+F SSVLV +VN AT   +   G
Sbjct  479   ISEMFTAVGLVEFFYKQPLKGMQSFLTAITYCSYSFGFFLSSVLVTLVNKATSD-SSGAG  537

Query  1665  WLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             WL  NN+N++ ++ FY LL+ LSF+NF  YLF +  Y    Q
Sbjct  538   WLSNNNLNKDKVDHFYWLLAVLSFINFLNYLFWATWYSNINQ  579



>ref|XP_002512591.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF50043.1| nitrate transporter, putative [Ricinus communis]
Length=640

 Score =   401 bits (1031),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 245/563 (44%), Positives = 347/563 (62%), Gaps = 21/563 (4%)
 Frame = +3

Query  99    GKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANH  278
              K +      R++  GG RA +F+  +   +NM  I   V+LV Y   VM  ++ ++AN 
Sbjct  4     SKAEDNSLNKREEGKGGFRACMFVFVLVALDNMGFIANMVSLVLYFLKVMYFDIPNSANT  63

Query  279   VTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL  458
             +TN  G+ ++LT++   ++DT++ +   VL+ A IE L + L+ +QAH   L PP C   
Sbjct  64    LTNLMGSIFLLTLLGGFISDTFLNKLYTVLLFAVIEILAMVLMTIQAHAKSLHPPYCG--  121

Query  459   DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNW  638
                 KC  V G+    L+ +L  +A+GS GV+ A+PS GADQF++ D +E  +++++FNW
Sbjct  122   --KPKC--VEGKIEFTLYASLALLALGSGGVRGALPSLGADQFNQNDPEEAKDLATYFNW  177

Query  639   LLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSA  818
             + L   +G AV +T  VW+  +  W  GF  ST+A F G I    G  +Y +    G S 
Sbjct  178   MTLSTVLGAAVGVTGIVWVSVNDAWYKGFMISTIAAFVGFIVLACGKRYYHLKE-PGESP  236

Query  819   ITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTS  998
             + +I+QVFV AI NRKL LPE+  ELYEIS D+E +    E + HTD++RFLD+AAI   
Sbjct  237   LIRIVQVFVVAIKNRKLSLPENPEELYEIS-DEERI-YSDEKIAHTDQFRFLDRAAILPK  294

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
              D    PW+VC VTQVE  KIL  ++P+   T+IM  CLAQLQTFS++QG  M+  I K 
Sbjct  295   -DLTAAPWQVCTVTQVEEVKILTRMMPILFSTIIMNTCLAQLQTFSVEQGYIMNRFIGKF  353

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
                 PS      +  +I +   Y+  FVP  R+++G P+GIT L RV +GL+LS++SMA 
Sbjct  354   EVPAPSVPIIPLVFMVILIPM-YEFFFVPFARKISGHPSGITQLQRVGIGLVLSAISMAV  412

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             A I+E+KR+  A +             PISVFWLS QY IFGIADMFT VGLLEFFY +A
Sbjct  413   AGIVEVKRRDQAHKD---------LAHPISVFWLSFQYGIFGIADMFTLVGLLEFFYKEA  463

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYA  1715
             P  +KS+S+ F W S+S GYF S+VLV ++N  TK +T S  GWL G+++N N+L LFY 
Sbjct  464   PSGMKSLSTSFTWLSLSFGYFLSTVLVNLINAITKRVTPSKQGWLHGDDINSNNLNLFYW  523

Query  1716  LLSGLSFVNFFVYLFVSKRYKYR  1784
              L+ LS +NF VYL ++  YKY+
Sbjct  524   FLAILSCINFGVYLCMASWYKYK  546



>ref|XP_009366884.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4 [Pyrus x bretschneideri]
Length=615

 Score =   400 bits (1028),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 242/580 (42%), Positives = 353/580 (61%), Gaps = 32/580 (6%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VDWRGR  +   HGG+RA++F+LG+ GFE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  18    DMSVDWRGRPCKPTNHGGMRAAVFVLGLQGFEMMAIAGVGNNLITYVLTEMHFSLSKSAN  77

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G F  ++I  ++E  G  LL +QAH  +L+PP CN 
Sbjct  78    IVTNFIGTVFLLSLLGGYLSDSYLGSFWTMIIFGFVELSGFILLCVQAHLPQLRPPSCNN  137

Query  456   L-----DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEM  620
             +      + E C E  G  A I F A+Y VA+GS  +K  + SHGADQF   D K+  ++
Sbjct  138   IMSSHEHEEELCPEAKGYKALIFFAAIYLVALGSGCLKPNIISHGADQFRRDDSKQSKKL  197

Query  621   SSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYV  800
             SS+FN      C G  ++LT+ VW+  H G D GF  S  AM  G    T G   YR   
Sbjct  198   SSYFNCAYFAFCTGELIALTVLVWVQTHSGMDVGFGVSAAAMAMGLFCLTFGTSLYRNKP  257

Query  801   IQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE-FLP---------  950
              +G S  T I QVFVAA   RK   P ++  L+    ++ +V +    F+P         
Sbjct  258   PRG-SIFTPIAQVFVAAFTKRKQICPSNTEMLH---GNRNSVPMSNHLFVPMSPNVTTLL  313

Query  951   HTDKYRFLDKAAIQTSWDEE--PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
             HT+K+RFLDKA I+     +   + WR+C V QVE  KI+ ++VP+F CT+I    LAQL
Sbjct  314   HTEKFRFLDKACIKIEDGSQRIESSWRLCTVAQVEQVKIIFSVVPIFACTIIFNTILAQL  373

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFS+QQGS+M+  I K F++ P+SL  +P + LIFL+PLY+ +FVP+ R++TG  +GI+
Sbjct  374   QTFSVQQGSSMNTRIAKGFKVPPASLQAIPYIMLIFLVPLYEIVFVPATRKVTGRDSGIS  433

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
             PL RV  GL +++ SM +AA++E KR+  A   N            +S+FW++ Q+ IFG
Sbjct  434   PLQRVGTGLFIATFSMVSAALIEKKRRNAALYSNQ----------ALSIFWIAPQFLIFG  483

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGG  1664
             +++MFT VGL+EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T   + +GG
Sbjct  484   LSEMFTAVGLIEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKVTS-TSSNGG  542

Query  1665  WLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             WL  N++NR+ L+ FY LL+ LS  NFF YLF S  Y Y 
Sbjct  543   WLSDNDLNRDRLDRFYWLLAALSLANFFNYLFWSNWYSYN  582



>ref|XP_004169231.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide/nitrate transporter 
At1g59740-like, partial [Cucumis sativus]
Length=618

 Score =   400 bits (1028),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 252/544 (46%), Positives = 353/544 (65%), Gaps = 25/544 (5%)
 Frame = +3

Query  177   IFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRF  356
             +  FE+M  +    +LV Y   VM+ +L  AAN +TNF G+ ++L+++   L+DTYI R 
Sbjct  1     LLTFESMGFVANMTSLVQYFLFVMHFDLQTAANTLTNFMGSAFLLSLLGGFLSDTYINRL  60

Query  357   RAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAM  536
                LI  ++E + L L+ +QA+   L P P  P D    C  V GR A + + +LY +A+
Sbjct  61    NTCLIFGFLEVIALILITVQAYSHDLLPSPLCPKD----C--VKGRIAFVFYTSLYLLAI  114

Query  537   GSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWD  716
             GS GV+ A+P+ GADQF++KD KE   + +FFN++LL V +G AV +TL VW+  +K W 
Sbjct  115   GSGGVRGALPALGADQFNQKDPKEAKALGTFFNYMLLSVVIGAAVGVTLIVWVAVNKAWY  174

Query  717   WGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGEL  896
             WGF  S +A   G I F +G PFYR+ V  G S + ++IQV V AI NR+L+LP+   EL
Sbjct  175   WGFFISALAALVGFIIFAIGKPFYRIQV-PGQSPLLRVIQVIVVAIKNRRLRLPDTPNEL  233

Query  897   YEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLV  1076
             YEIS DK  +      + HT++ RFLDKAAI    D EP PW VC VTQVE  KI+  +V
Sbjct  234   YEIS-DKLHMDSNHYKIVHTNQLRFLDKAAIVPK-DIEPQPWNVCSVTQVEEVKIITRMV  291

Query  1077  PVFLCTVIMTLCLAQLQTFSIQQGST--MDLNITKsfqilpsslpflpilflifliplYD  1250
             P+F+ T+IM  CLAQLQTFS++QG+T  MD  +   FQ    S+P +P++F+ FLIPLY+
Sbjct  292   PIFVSTIIMNTCLAQLQTFSVEQGNTRIMDKXLGH-FQFPAPSIPVIPLVFMAFLIPLYE  350

Query  1251  RLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPIL  1430
               FVP  R++T  P+GIT L RV VGL+LS+++M  A ++E+KR+  A E       P  
Sbjct  351   FFFVPFARKITHHPSGITQLQRVGVGLVLSAIAMTVAGLVEVKRRHQATEH------PDK  404

Query  1431  QPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSS  1610
             Q   IS+FWL+ QY IFG+ADMFT VGLLEFFY +AP  ++S+S+ F + S++LGY+ SS
Sbjct  405   Q---ISLFWLAFQYGIFGVADMFTLVGLLEFFYKEAPVGMRSLSTSFTFLSLALGYYLSS  461

Query  1611  VLVKVVNGATKGMTES-GGWLGG---NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             + V VVN  TK +T S  GW+ G    ++N N+L LFY  L+ LS +NFF YL+ +  YK
Sbjct  462   IFVNVVNKVTKNITPSKKGWVEGLIPEDLNHNNLNLFYWFLAILSVLNFFHYLYWASWYK  521

Query  1779  YRQQ  1790
             Y+ +
Sbjct  522   YKTE  525



>ref|XP_010910278.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Elaeis guineensis]
Length=579

 Score =   399 bits (1024),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 234/581 (40%), Positives = 360/581 (62%), Gaps = 24/581 (4%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
             N +E+  L +  +DWRGRT + +KHGG++A+ F+LG+   E MA   +G  L+TY+   M
Sbjct  7     NMKEESLLAEVSLDWRGRTCKPNKHGGMKAAAFVLGLLALEIMAIAAVGNNLITYVFNEM  66

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             +  L+ +AN VTNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LL++QAH  
Sbjct  67    HFPLSKSANIVTNFIGTIFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLP  126

Query  429   KLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKE  608
             +L+PPPC+   + + C E  G  A + F++LY VA+GS  +K  + SHGADQF + D  +
Sbjct  127   QLRPPPCSMTSEGDHCSEAKGFKATVFFISLYLVALGSGCLKPNMISHGADQFRKDDPDQ  186

Query  609   GSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFY  788
               ++S++FN      C+G  ++LT+ +W+    G   GF  S   M  G      G+  Y
Sbjct  187   SKKLSTYFNTAYFSFCIGELIALTVIIWVQTQSGMAVGFGVSAATMVMGLTSLICGMFCY  246

Query  789   RVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEA---------VTICAE  941
             R    +G S +T I +V VAAI  RK   P ++ EL   S +  +         ++  A 
Sbjct  247   RNKPPKG-SILTPIARVLVAAITKRKQVCPSNT-ELLRRSINNASDHLMIPGLEISSNAT  304

Query  942   FLPHTDKYRFLDKAAIQTS--WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCL  1115
              + HT+K+RFLDKA IQ     D   +PW++C + QVE  KI+ +L+P+F CT+I    L
Sbjct  305   NVIHTEKFRFLDKACIQIQDGSDRMESPWKLCTMAQVEQVKIIFSLIPIFACTIIFNTVL  364

Query  1116  AQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPT  1295
             AQLQTFS+QQGS+MD  +T++F I P+SL  +P L LI L+P+Y+ +FVP  R++T   +
Sbjct  365   AQLQTFSVQQGSSMDTRLTETFHIPPASLQSIPYLILIILVPIYEMVFVPLARKVTSRDS  424

Query  1296  GITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYF  1475
             GI+PL R+ +GL + + SM +AA++E KR+++A   N            +S+FW++ Q+ 
Sbjct  425   GISPLQRIGIGLFMVTFSMVSAALVENKRRELAVGSNK----------QLSIFWIAPQFL  474

Query  1476  IFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTE  1655
             IFG+++MFT VGL+EFFY Q+   ++S  +   + S S G+F SS+LV +VN  T G + 
Sbjct  475   IFGLSEMFTAVGLIEFFYKQSLAGMQSFLTAMTYCSYSFGFFLSSLLVSLVNKVTSGPSG  534

Query  1656  SGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             S GWL  NN+N++ L+LFY LL+ LSF+NFF YL+ S+ Y 
Sbjct  535   S-GWLSDNNLNKDRLDLFYWLLAALSFLNFFNYLYWSRWYS  574



>ref|XP_009403716.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=589

 Score =   399 bits (1025),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 235/565 (42%), Positives = 347/565 (61%), Gaps = 23/565 (4%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             L +  +DWRG   + +KHGG+RA++F+LGI  FE MA   +G  L+TY+   M+ +L+++
Sbjct  15    LTEVSLDWRGNPCKPNKHGGMRAAVFVLGIQAFEIMAIAAVGNNLITYVFNEMHFSLSES  74

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTNF G  +IL+++   L+D+Y+G F  +LI   +E  G  LL++QAH  +L+PPPC
Sbjct  75    ANIVTNFVGTIFILSLLGGFLSDSYLGSFWTMLIFGSVELSGFILLSVQAHLPQLRPPPC  134

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             + + +A  C E  G  A + F+ALY VA+GS  +K  + SHGADQF E D  +  ++S++
Sbjct  135   DMMSEAH-CMEAKGFKATMFFLALYLVALGSGCLKPNMISHGADQFREDDPNQSKKLSTY  193

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN      CVG  ++LT+ VW+    G D GF  S  AM  G I    G+  YR    QG
Sbjct  194   FNIAYFSFCVGELIALTVLVWVQTRSGMDVGFGVSAAAMAMGLISLVSGVLLYRNRPSQG  253

Query  810   SSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAI  989
              S    I +VFVAA   RK   P   G+L          +     L H +K+RFL+KA +
Sbjct  254   -SIFNPIARVFVAAFSKRKQVCPSIVGDLVP--------SPSVHNLMHINKFRFLNKACM  304

Query  990   QTSWDE--EPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDL  1163
             ++      + + WR+C   +VE  K++L+++P+F CT+I    LAQLQTFS+QQGS+M+ 
Sbjct  305   KSHDGSAMKESRWRLCTPAEVEQVKVILSVIPIFACTIIFNTILAQLQTFSVQQGSSMNA  364

Query  1164  NITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllss  1343
              +  SF++ P+SL  +P + LI L+P+Y+   VP  RRLTG   GI+PL R+ VGL   +
Sbjct  365   QLADSFKVPPASLQAIPYMMLIVLVPIYETCVVPLARRLTGKDPGISPLQRIGVGLFTVT  424

Query  1344  lsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEF  1523
              SM AAA++E KR++ A   N L          +S+FW++ Q+ IFG+++MFT VGL+EF
Sbjct  425   FSMVAAAMIERKRRETAIGSNEL----------LSIFWIAPQFLIFGLSEMFTAVGLIEF  474

Query  1524  FYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLE  1703
             FY Q+   ++S S+   + S S G+F SS+LV  VN  T   + +GGWL  N++N++ L+
Sbjct  475   FYKQSSAGMQSFSTAMTYCSYSFGFFLSSLLVSSVNKITSN-SSNGGWLSDNDLNKDRLD  533

Query  1704  LFYALLSGLSFVNFFVYLFVSKRYK  1778
             LFY LL+ LS +NFF YLF +K Y 
Sbjct  534   LFYWLLAALSLLNFFHYLFWAKWYS  558



>ref|XP_009403715.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=594

 Score =   399 bits (1024),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 236/569 (41%), Positives = 348/569 (61%), Gaps = 26/569 (5%)
 Frame = +3

Query  90    LIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADA  269
             L +  +DWRG   + +KHGG+RA++F+LGI  FE MA   +G  L+TY+   M+ +L+++
Sbjct  15    LTEVSLDWRGNPCKPNKHGGMRAAVFVLGIQAFEIMAIAAVGNNLITYVFNEMHFSLSES  74

Query  270   ANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPC  449
             AN VTNF G  +IL+++   L+D+Y+G F  +LI   +E  G  LL++QAH  +L+PPPC
Sbjct  75    ANIVTNFVGTIFILSLLGGFLSDSYLGSFWTMLIFGSVELSGFILLSVQAHLPQLRPPPC  134

Query  450   NPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSF  629
             + + +A  C E  G  A + F+ALY VA+GS  +K  + SHGADQF E D  +  ++S++
Sbjct  135   DMMSEAH-CMEAKGFKATMFFLALYLVALGSGCLKPNMISHGADQFREDDPNQSKKLSTY  193

Query  630   FNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQG  809
             FN      CVG  ++LT+ VW+    G D GF  S  AM  G I    G+  YR    QG
Sbjct  194   FNIAYFSFCVGELIALTVLVWVQTRSGMDVGFGVSAAAMAMGLISLVSGVLLYRNRPSQG  253

Query  810   S----SAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLD  977
             S     A    +QVFVAA   RK   P   G+L          +     L H +K+RFL+
Sbjct  254   SIFNPIARNVFLQVFVAAFSKRKQVCPSIVGDLVP--------SPSVHNLMHINKFRFLN  305

Query  978   KAAIQTSWDE--EPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             KA +++      + + WR+C   +VE  K++L+++P+F CT+I    LAQLQTFS+QQGS
Sbjct  306   KACMKSHDGSAMKESRWRLCTPAEVEQVKVILSVIPIFACTIIFNTILAQLQTFSVQQGS  365

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             +M+  +  SF++ P+SL  +P + LI L+P+Y+   VP  RRLTG   GI+PL R+ VGL
Sbjct  366   SMNAQLADSFKVPPASLQAIPYMMLIVLVPIYETCVVPLARRLTGKDPGISPLQRIGVGL  425

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
                + SM AAA++E KR++ A   N L          +S+FW++ Q+ IFG+++MFT VG
Sbjct  426   FTVTFSMVAAAMIERKRRETAIGSNEL----------LSIFWIAPQFLIFGLSEMFTAVG  475

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+   ++S S+   + S S G+F SS+LV  VN  T   + +GGWL  N++N+
Sbjct  476   LIEFFYKQSSAGMQSFSTAMTYCSYSFGFFLSSLLVSSVNKITSN-SSNGGWLSDNDLNK  534

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             + L+LFY LL+ LS +NFF YLF +K Y 
Sbjct  535   DRLDLFYWLLAALSLLNFFHYLFWAKWYS  563



>ref|XP_010066966.1| PREDICTED: protein NRT1/ PTR FAMILY 4.6-like [Eucalyptus grandis]
Length=593

 Score =   399 bits (1024),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 250/589 (42%), Positives = 349/589 (59%), Gaps = 41/589 (7%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             DG VDWR R A   +HGG+ A++F+L     EN+A +     LV Y+   M+V+ + AAN
Sbjct  16    DGYVDWRSRPAIAGRHGGMLAALFVLVAEVLENLAYLANASNLVMYMAEYMHVSPSRAAN  75

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L ++   L+D +   +R  LISA IEFLGL +LA+QA  A LKP PCN 
Sbjct  76    DVTNFMGTAFLLALLGGFLSDAFFTAYRIYLISAAIEFLGLVILAVQAKSASLKPLPCNQ  135

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
              D    CEEV+GR AA+LF  LY VA+G  G+K ++PSHGA+QFD+   +   + S+FFN
Sbjct  136   ADPTAVCEEVSGRKAAMLFAGLYLVALGVGGIKGSLPSHGAEQFDDTTPQGRKQRSTFFN  195

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             + +  +  GG +++TL +W+  +KGW WGF  ST+A+F     F  G   YR  +  GS 
Sbjct  196   YFVFCLSCGGLIAVTLVIWVEDNKGWQWGFGISTLAIFLSIPIFLAGTAIYRNKIPSGSP  255

Query  816   AITQIIQVFVAAIHN--------------------RKLQLPEDSGELYEI-----SKDKE  920
              +T I +V VAA  N                       Q  +   E +E       K KE
Sbjct  256   -LTTIFKVLVAATLNPCKSRNTSNAIASMNTSPADATTQTAQRKQEAFEAGAEDDQKSKE  314

Query  921   AVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVI  1100
             A       LP      FL++A               C V QVE+ K++L L+PVF CT+I
Sbjct  315   AT------LPSNGSLSFLNRAVTSKPIHRSLE----CSVQQVEDVKVVLKLLPVFACTII  364

Query  1101  MTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRL  1280
             +  CLAQL TFS+QQ STMD  +    ++ P+SLP  PILF++ L P+YD   +P  RR 
Sbjct  365   LNCCLAQLSTFSVQQASTMDTKLGS-LKVPPASLPIFPILFIMILAPVYDHFIIPFARRA  423

Query  1281  TGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWL  1460
             T   TGIT L R+ +GL LS L+MA AA++E+KRK+VA +  +L A P   PLPI+ FW+
Sbjct  424   TKTETGITHLQRIGIGLALSVLAMAVAALVEIKRKRVATDSGLL-ASP--DPLPITFFWI  480

Query  1461  SIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT  1640
             ++QY   G AD+FT  GLLEFF+S+AP  ++S+++   W+S+++GY+ S+V+V +VN AT
Sbjct  481   ALQYLFLGSADLFTLAGLLEFFFSEAPASMRSLATSLSWASLAMGYYLSTVIVSIVNSAT  540

Query  1641  KGMTESGGWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQ  1787
              G +    WL G ++N  HLE FY L+  LS +NF  YLF + RYKYR 
Sbjct  541   -GHSGHRPWLKGESLNGYHLERFYWLMCVLSGLNFVNYLFWASRYKYRS  588



>ref|XP_011092687.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like, partial [Sesamum 
indicum]
Length=582

 Score =   398 bits (1022),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 245/555 (44%), Positives = 343/555 (62%), Gaps = 26/555 (5%)
 Frame = +3

Query  141   HGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIV  320
              GG+RA+ FI G+   ENM  +   V+LV Y +  M  +L++AAN +TN  G+T++LT+V
Sbjct  3     RGGLRATSFIYGLVALENMGFVANMVSLVLYFSYKMYFDLSNAANTLTNLMGSTFLLTVV  62

Query  321   AAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNA  500
                ++DT+I RF+  +I    E L L ++ +QAH   L P PC        C E  G  A
Sbjct  63    GGFISDTFINRFQTCVIFGTFEVLALSMMTIQAHNDSLLPKPCG----KPSCME--GGVA  116

Query  501   AILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLT  680
                + +L  +A+G  GVK ++P+ GADQFD  D KE   ++S+FNWLLL   +G +V +T
Sbjct  117   VYFYTSLCLLALGVGGVKGSLPALGADQFDANDPKEAKGLASYFNWLLLSTVIGSSVGVT  176

Query  681   LFVWLIQHKG---WDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
             + VW+  +K    W  GF  + V    G +   LG PFYR+ V + S  I +I QV   A
Sbjct  177   VVVWVATNKNNHNWWKGFLITAVGASLGYVLLLLGKPFYRLKVPKDSPLI-RIAQVIAVA  235

Query  852   IHNRKLQLPEDSGELYEIS-KDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRV  1028
             + NR L LPE   ELYEI+ KD E+    A  + HT+++R LDKAAI    + EP+PW+V
Sbjct  236   VRNRGLSLPESPSELYEINEKDSEST---ASRIAHTEQFRCLDKAAILPP-NTEPSPWKV  291

Query  1029  CRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpf  1208
             C VTQVE  K+L  ++P+   T+IM  C+AQLQTFS+QQG  MD ++        S    
Sbjct  292   CTVTQVEEVKVLARMLPIIASTIIMNTCMAQLQTFSVQQGYRMDPHLGSFRVPSASIPVI  351

Query  1209  lpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQ  1388
               +  +I +   YDRLFVP +R+ T  P+G+T L RV VGL+LS+LSM+ AA++E+KR  
Sbjct  352   PLLFMIILIPI-YDRLFVPFIRKFTKHPSGVTQLQRVGVGLVLSALSMSIAALVEVKR--  408

Query  1389  VARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSC  1568
               R R++ + +      PIS+FWL+ QY IFGIADMFT VGLLEFFY +AP+ +KS+S+ 
Sbjct  409   --RNRSLKNPL-----RPISLFWLAFQYGIFGIADMFTLVGLLEFFYKEAPEGMKSLSTS  461

Query  1569  FLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYALLSGLSFVNF  1745
             F W S+S GYF SSV V  +N  TK +  S  GWL G +++RN+L LFY  L+ LS +NF
Sbjct  462   FTWISLSFGYFLSSVFVDCINSVTKRIAPSRQGWLHGQDLDRNNLNLFYWFLAILSGLNF  521

Query  1746  FVYLFVSKRYKYRQQ  1790
             F YL+ +  YKY+  
Sbjct  522   FNYLYWATWYKYKNN  536



>ref|XP_009416965.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Musa acuminata 
subsp. malaccensis]
Length=596

 Score =   398 bits (1023),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 232/564 (41%), Positives = 340/564 (60%), Gaps = 21/564 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDW+G+  + +KHGG+RA++F+L I  FE MA   +G  L+TY+   M+  L+ +AN VT
Sbjct  20    VDWKGKPCKPNKHGGMRAAVFVLAIQAFEIMAIAAVGNNLITYVFNDMHFPLSKSANIVT  79

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L++    L+D+Y+G F  +L+  ++E  G  LL++QAH  +L+PPPCN + K
Sbjct  80    NFIGTVFLLSLFGGFLSDSYLGSFWTMLVFGFVELSGFILLSVQAHLPQLRPPPCNMISK  139

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E+C E  G  A I F+ALY VA+GS  +K  + SHGADQF ++D     ++S++FN   
Sbjct  140   EEQCMEAKGFKATIFFLALYLVALGSGCLKPNMISHGADQFRKEDPCHSKKLSTYFNTAY  199

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                CVG  ++LT+ VW+    G D GF  S  AM  G      G  FYR    QG S  T
Sbjct  200   FSFCVGELIALTVLVWVQTRSGMDVGFGVSAGAMAMGLAILISGAFFYRNKPPQG-SIFT  258

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWD  1004
              I +VFVAA   RK   P +       S D E  +     LP T+K RFLDKA I+    
Sbjct  259   PIARVFVAAFTKRKQVCPSN-------SSDVEPSSSYVGNLPRTNKLRFLDKACIEARDG  311

Query  1005  E--EPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                + + WR+C   +VE  KI+++++P+F CT+I    LAQLQTFS+QQGS M+  +  S
Sbjct  312   SGMKESSWRLCTAAEVEQVKIIISVIPIFACTIIFNTILAQLQTFSVQQGSAMNTRLATS  371

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
             F + P+SL  +P + LI L+P+Y+  FVP  R+LTG  +GITPL R+ VGL   + SM A
Sbjct  372   FHVPPASLQAIPYIMLIVLVPVYETCFVPLARKLTGTSSGITPLQRIGVGLFAVTFSMVA  431

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E KR++   +   L          +S+FW++ Q+ IFG+++MFT VGL+EFFY Q+
Sbjct  432   AAVIERKRRETYVDSGEL----------LSIFWIAPQFLIFGVSEMFTAVGLIEFFYKQS  481

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYAL  1718
                ++S  +   + S S G++ SS+LV +VN  T   +   GWL  N++N++ L+LFY L
Sbjct  482   LAGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITSSSSRD-GWLSDNDLNKDRLDLFYWL  540

Query  1719  LSGLSFVNFFVYLFVSKRYKYRQQ  1790
             ++ LS +NF  YL  S+ Y   Q 
Sbjct  541   MAALSLLNFLSYLLCSRWYCSSQS  564



>gb|AAG51210.1|AC051630_7 nitrate transporter NTL1, putative; 54085-51470 [Arabidopsis 
thaliana]
Length=596

 Score =   398 bits (1023),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 249/573 (43%), Positives = 353/573 (62%), Gaps = 26/573 (5%)
 Frame = +3

Query  63    LINSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNG  242
             +I++ E+  L D  VD+RGR  R  KHGG RA++F+LG   FE MA   +G  L+TY+  
Sbjct  14    VIHTSEE-SLDDLCVDFRGRPCRPSKHGGTRAALFVLGFQAFEMMAIAAVGNNLITYVFN  72

Query  243   VMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAH  422
              M+  L+ +AN VTNF G  ++L+++   L+D+Y+G FR +L+   IE     +   QAH
Sbjct  73    EMHFPLSKSANLVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGVIE-----ISVFQAH  127

Query  423   YAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR  602
               +L+PP CN       C E  G  AA L+ AL  VA+GS  +K  + SHGA+QF  KD 
Sbjct  128   LPELRPPECNMKSTTIHCVEANGYKAATLYTALCLVALGSGCLKPNIISHGANQFQRKDL  187

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             ++   +SSFFN       +G  ++LTL VW+  H G D GF  S   M  G I    G  
Sbjct  188   RK---LSSFFNAAYFAFSMGQLIALTLLVWVQTHSGMDVGFGVSAAVMAAGMISLVAGTS  244

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
             FYR     GS   T I QVFVAAI  RK   P +   +++ S D   V    + L H++K
Sbjct  245   FYRNKPPSGS-IFTPIAQVFVAAITKRKQICPSNPNMVHQPSTDLVRV----KPLLHSNK  299

Query  963   YRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQ  1142
             +RFLDKA I+T      +PWR+C + QV   KILL+++P+F CT+I    LAQLQTFS+Q
Sbjct  300   FRFLDKACIKTQGKAMESPWRLCTIEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQ  359

Query  1143  QGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVA  1322
             QGS+M+ +ITK+FQI P+SL  +P + LIF +PLY+  FVP  R+LTG  +GI+PL R+ 
Sbjct  360   QGSSMNTHITKTFQIPPASLQAIPYIILIFFVPLYETFFVPLARKLTGNDSGISPLQRIG  419

Query  1323  VGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFT  1502
              GL L++ SM AAA++E KR++   E+N++          +S+FW++ Q+ IFG+++MFT
Sbjct  420   TGLFLATFSMVAAALVEKKRRESFLEQNVM----------LSIFWIAPQFLIFGLSEMFT  469

Query  1503  YVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGG  1676
              VGL+EFFY Q+ + ++S  +   + S S G++ SSVLV  VN  T   G     GWLG 
Sbjct  470   AVGLVEFFYKQSSQSMQSFLTAMTYCSYSFGFYLSSVLVSTVNRVTSSNGSGTKEGWLGD  529

Query  1677  NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             N++N++ L+ FY LL+ LSF+NFF YLF S+ Y
Sbjct  530   NDLNKDRLDHFYWLLASLSFINFFNYLFWSRWY  562



>ref|XP_007023125.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY25747.1| Major facilitator superfamily protein [Theobroma cacao]
Length=653

 Score =   400 bits (1027),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 242/573 (42%), Positives = 343/573 (60%), Gaps = 36/573 (6%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             +  VDWRGR +  +KHGG+RA+ F+LG+  FE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  57    ESTVDWRGRPSNPNKHGGMRAAAFVLGLQAFEIMAIAAVGNNLITYVINEMHFSLSKSAN  116

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN 
Sbjct  117   IVTNFVGTIFLLALLGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLKPPKCNM  176

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +   E C E  G  A I FVALY VA+GS  VK  + +HGADQF++ +  +  ++S++FN
Sbjct  177   VIDGEHCVEAKGFKALIFFVALYLVALGSGCVKPNMIAHGADQFNQTNPSQSKKLSTYFN  236

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LT+ VW+  H G D GF  S  AM    I    G  +YR    QG S
Sbjct  237   AAYFAFSMGELIALTILVWIQTHAGMDVGFGVSAAAMAMALISVVSGTLYYRNKPPQG-S  295

Query  816   AITQIIQVFVAAIHNRKL----------------QLPEDSGELYEISKDKEAVTICAEFL  947
               T I QVFVAAI  RK                  +P  S     +  +   V       
Sbjct  296   IFTPIAQVFVAAILKRKQICRPISNPQMLNGKQNSVPNRSASASHLHSESGNVL------  349

Query  948   PHTDKYRFLDKAAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQ  1121
              HT ++RFLDKA I  Q   + + + WR+C V QVE  KILL+++P+F CT++    LAQ
Sbjct  350   -HTQRFRFLDKACIKVQDGSNTKESRWRLCSVAQVEQVKILLSVIPIFACTIVFNTILAQ  408

Query  1122  LQTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGI  1301
             LQTFS+QQGS MD  +TKSF I P+SL  +P + LIF++PLYD  FVP  R+ TG  +GI
Sbjct  409   LQTFSVQQGSAMDTQLTKSFHIPPASLQSIPYIMLIFIVPLYDEFFVPFARKFTGNESGI  468

Query  1302  TPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIF  1481
             +PL R+  GL L++ SM AAA++E KR+  A     +          IS+FW++ Q+ IF
Sbjct  469   SPLLRIGSGLFLATFSMIAAAVMEKKRRDAAVGSGEI----------ISIFWITPQFLIF  518

Query  1482  GIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG  1661
             GI++M T VGL+EFFY Q+ K +++  +   + S S G++ SSVLV +VN  T   +  G
Sbjct  519   GISEMLTAVGLIEFFYKQSLKGMQAFFTAITYCSYSFGFYLSSVLVSLVNKITSSGSSRG  578

Query  1662  GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLF  1760
             GWL  N++N++ L+LFY LL+ LSF+NF  YLF
Sbjct  579   GWLSDNDLNKDRLDLFYWLLAVLSFLNFLNYLF  611



>ref|XP_008373309.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Malus domestica]
Length=614

 Score =   398 bits (1023),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 243/580 (42%), Positives = 353/580 (61%), Gaps = 32/580 (6%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VDWRGR  +   HGG+RA++F+LG+ GFE MA   +G  L+TY+   M+ +L+ +AN
Sbjct  18    DMSVDWRGRPCKPTNHGGMRAAVFVLGLQGFEMMAIAGVGNNLITYVLSEMHFSLSKSAN  77

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G F  ++I  ++E  G  LL +QAH  +L+P  CN 
Sbjct  78    IVTNFIGTVFLLSLLGGYLSDSYLGSFWTMIIFGFVELSGFILLCVQAHLPQLRPLSCNN  137

Query  456   L-----DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEM  620
             +        E C E  G  A I F A+Y VA+GS  +K  + SHGADQF   D K+  ++
Sbjct  138   IMSSHEHDEELCPEAKGYKALIFFAAIYLVALGSGCLKPNIISHGADQFRRVDSKQSKKL  197

Query  621   SSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYV  800
             SS+FN      C G  ++LT+ VW+  + G D GF  S  AM  G    T G P YR   
Sbjct  198   SSYFNCAYFAFCTGELIALTVLVWVQTNSGMDVGFGVSAAAMAMGLFCLTFGTPLYRNKP  257

Query  801   IQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAE-FLP---------  950
              +G S  T I QVFVAA   RK   P ++  L+    ++ +V      F+P         
Sbjct  258   PRG-SIFTPIAQVFVAAFTKRKQICPSNTEMLH---GNRNSVPTSNHLFVPMSPNVTTLL  313

Query  951   HTDKYRFLDKAAIQTSWDEE--PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
             HT+K+RFLDKA I+     +   + WR+C V QVE  KI+ ++VP+F CT+I    LAQL
Sbjct  314   HTEKFRFLDKACIKIEDGSQRIESSWRLCTVAQVEQVKIIFSIVPIFACTIIFNTILAQL  373

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFS+QQGS+M+  ITK F++ P+SL  +P + LIFL+PLY+ +FVP+ R++TG  +GI+
Sbjct  374   QTFSVQQGSSMNTKITKGFKVPPASLQAIPYIMLIFLVPLYEIVFVPAARKVTGRDSGIS  433

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
             PL RV  GL +++ SM +AA++E KR+  A   N            +S+FW++ Q+ IFG
Sbjct  434   PLQRVGAGLFIATFSMVSAALIEQKRRNAALYSNQ----------ALSIFWIAPQFLIFG  483

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGG  1664
             +++MFT VGL+EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T   + +GG
Sbjct  484   LSEMFTAVGLIEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKVTS-TSSNGG  542

Query  1665  WLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYR  1784
             WL  N++NR+ L+ FY LL+ LS VNFF YLF S  Y Y 
Sbjct  543   WLSDNDLNRDRLDRFYWLLAALSLVNFFNYLFWSNWYSYN  582



>ref|XP_009602084.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Nicotiana tomentosiformis]
Length=609

 Score =   398 bits (1022),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 246/575 (43%), Positives = 352/575 (61%), Gaps = 20/575 (3%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
                VDWRGR  + +KHGG+ A+IF+L +  FE M    +G  L+TY+   M+  L+ +AN
Sbjct  26    QNSVDWRGRPCKPNKHGGMTAAIFVLCLQAFEMMGIAAVGNNLITYVFNEMHFPLSKSAN  85

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L++    L+D+Y+G F  +LI  ++E  G  LLA+QAH  +L+PP C+ 
Sbjct  86    IVTNFIGTVFLLSLFGGFLSDSYLGSFWTMLIFGFVELSGFILLAVQAHVPQLRPPKCDM  145

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +    +C E  G  A I FVALY VA+GS  +K  + S GADQF + D K+  ++S++FN
Sbjct  146   MLSKGQCMEAKGYKAMIFFVALYLVALGSGSLKPNIISQGADQFKKDDSKQSKKLSTYFN  205

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             +     C G  V+LTL VW+  H G D GF  S  AM  G I    G   YR    +G S
Sbjct  206   FAYFAFCTGELVALTLVVWVQTHYGMDVGFGVSAAAMALGLISLLCGTLVYRNTPPRG-S  264

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYE-----ISKDKEAVTICAEFLPHTDKYRFLDK  980
               T I QVFVAAI  RK   P +   L+        +    ++     L HTDK+RFLDK
Sbjct  265   IFTPIAQVFVAAITKRKQICPSNLEMLHGSHCIVAQQSLSGMSSKGSTLIHTDKFRFLDK  324

Query  981   AAIQT---SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             A I+    S     +PWR+C V+QVE  KIL+++VP+F CT+I    LAQLQTFS+QQG+
Sbjct  325   ACIKIQDGSSSTSESPWRLCTVSQVEQVKILISVVPIFACTIIFNTILAQLQTFSVQQGT  384

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
             TM+  +T +F+I P+SL  +P + LIFL+PLY+  FVP  R+ TG  +GITPL RV +GL
Sbjct  385   TMNTRLTHNFKIPPASLQAIPYIMLIFLVPLYEIAFVPMTRKFTGKDSGITPLQRVGIGL  444

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
              +++ SM  AA++E KR+  A  +N            +S+FW++ Q+ IFG+++MFT VG
Sbjct  445   FIATFSMVCAALVENKRRNYALNQNRT----------LSIFWIAPQFLIFGLSEMFTAVG  494

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT-KGMTESGGWLGGNNVN  1688
             L+EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T    + SGGWL  N++N
Sbjct  495   LIEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITSSSSSGSGGWLNDNDLN  554

Query  1689  RNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             ++ L+LFY LL+ LS VNFF Y+F S+ Y Y   +
Sbjct  555   KDRLDLFYWLLAALSLVNFFNYIFCSRWYSYNPSL  589



>ref|XP_002893770.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH70029.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=599

 Score =   397 bits (1021),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 245/562 (44%), Positives = 347/562 (62%), Gaps = 21/562 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VD+RGR +R  KHGG RA++F+LG   FE MA   +G  L+TY+   M+  L+ +AN
Sbjct  23    DICVDFRGRPSRPSKHGGTRAALFVLGFQAFEMMAIAAVGNNLITYVFNEMHFPLSKSAN  82

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G FR +L    IE  G  LL++QAH  +L+PP CN 
Sbjct  83    LVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLFFGVIEISGFILLSVQAHLPELRPPECN-  141

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +     C E  G  A  L+ AL  VA+GS  +K  + SHGA+QF  KD +   ++SSFFN
Sbjct  142   MKSTIHCVEANGYKAVTLYAALCLVALGSGCLKPNIISHGANQFQRKDLR---KLSSFFN  198

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LTL VW+  H G D GF  S   M  G I    G  FYR    +G S
Sbjct  199   AAYFAFSMGQLIALTLLVWVQTHSGMDVGFGVSAAVMAAGMISLVAGTNFYRNKPPRG-S  257

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
               T I QVFVAAI  RK   P +   L++ S D     +  + L H++K++FLDKA I+T
Sbjct  258   IFTPIAQVFVAAITKRKQICPSNPNMLHQPSTD----LVRVKPLLHSNKFKFLDKACIKT  313

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                   +PWR+C + QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+M+ +ITK
Sbjct  314   QGKAMESPWRLCTIEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMNTHITK  373

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             +FQI P+SL  +P + LIF +PLY+  FVP  R+  G  +GI+PL R+  GL L++ SM 
Sbjct  374   TFQIPPASLQAIPYIILIFFVPLYETFFVPLARKFAGNDSGISPLQRIGTGLFLATFSMV  433

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             AAA++E KR++   E+N            +S+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  434   AAALVEKKRRESFLEQNAT----------LSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQ  483

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT--KGMTESGGWLGGNNVNRNHLELF  1709
             + + ++S  +   + S S G++ SSVLV  VN  T   G     GWLG N++N++ L+ F
Sbjct  484   SSQSMQSFLTAMTYCSYSFGFYLSSVLVSTVNRVTSSNGSGTKEGWLGDNDLNKDRLDHF  543

Query  1710  YALLSGLSFVNFFVYLFVSKRY  1775
             Y LL+ LSF+NFF YLF S+ Y
Sbjct  544   YWLLASLSFINFFNYLFWSRWY  565



>ref|XP_010248019.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   397 bits (1019),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 238/543 (44%), Positives = 338/543 (62%), Gaps = 23/543 (4%)
 Frame = +3

Query  162   IFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADT  341
             +FI      EN+  +        Y   VM+ +++ +AN +T+F G+TY+L++V   +ADT
Sbjct  1     MFIFVFTALENIGFVANMTGFYLYFYLVMHFDISGSANTLTSFMGSTYLLSLVGGFIADT  60

Query  342   YIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVAL  521
             Y+ R    LI   +E + + +L +QAHY K +P PC      +K   V G  A + + +L
Sbjct  61    YLSRLSTCLIFGLLEIVAMMILTVQAHYQKFQPEPC------DKSPCVNGGKALMFYSSL  114

Query  522   YTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQ  701
               +A+G+ GVK A+P+ G DQF++KD KEG  ++SFFNWLLL   +G  + +T+  W+  
Sbjct  115   CLLALGAGGVKGALPALGGDQFNQKDPKEGKALASFFNWLLLSSTLGATIGVTVIQWVNT  174

Query  702   HKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPE  881
             +KGWD GF   T+  F G I  +LG PFY      G S + +IIQV V AI NR   LP 
Sbjct  175   NKGWDLGFFICTILTFAGYIVLSLGKPFYHKRA-PGDSPLVRIIQVIVVAIRNRSSSLPV  233

Query  882   DSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKI  1061
             + G+LYEI+    A     E + HT+++RFLDKAAI       P PWRVC VTQVE  KI
Sbjct  234   NPGQLYEINDKNIASD--EETISHTNQFRFLDKAAILRQ-GTNPEPWRVCTVTQVEELKI  290

Query  1062  LLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilfliflip  1241
             L+ ++P+   T+++  CLAQLQTFS+QQGS M+  + K F +   S+P +P++F+  LIP
Sbjct  291   LMRMLPIIASTILLNTCLAQLQTFSVQQGSVMNRRLGK-FLVPAPSIPVIPLVFISILIP  349

Query  1242  lYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRK-QVARERNMLDA  1418
             +Y  +FVP  RR+T  P+GIT L RV  GL+LS +SMA A ++E+KR+ QV ++      
Sbjct  350   IYQFIFVPFARRITHRPSGITHLQRVGFGLVLSIISMAIAGVVEVKRRDQVIKDPTK---  406

Query  1419  IPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGY  1598
                    PIS+FWLS QY +FG ADMFT VGLLEF+Y +AP  ++S+S+ F W S S+GY
Sbjct  407   -------PISLFWLSFQYGVFGFADMFTLVGLLEFYYKEAPSGMRSLSTSFAWLSQSIGY  459

Query  1599  FTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             F SSV V+++N  TK  T S  GWL G ++N+N+L LFY  L+ LS +NF  Y F +  Y
Sbjct  460   FLSSVFVELINSITKRFTPSKQGWLEGIDLNKNNLNLFYWFLAVLSCLNFANYCFWASWY  519

Query  1776  KYR  1784
             K +
Sbjct  520   KCK  522



>ref|XP_004133734.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Cucumis sativus]
 gb|KGN56280.1| hypothetical protein Csa_3G112250 [Cucumis sativus]
Length=613

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 248/565 (44%), Positives = 352/565 (62%), Gaps = 24/565 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VDWRGR +    HGG+RA++F+LG+  FE MA   +G  L+TYL   M+ +L+ +AN
Sbjct  23    DVSVDWRGRPSNPTSHGGMRAAVFVLGMQTFEIMAIAAVGNNLITYLINEMHFSLSKSAN  82

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L ++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN 
Sbjct  83    IVTNFVGTVFLLALLGGFLSDSYLGSFWTLLIFGFVELSGFILLSVQAHVPQLKPPQCNM  142

Query  456   L----DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSE-M  620
             L    +   +C E  G  A I FVALY VA+GS  VK  + +HGADQF        S+ +
Sbjct  143   LLIKNNNEHECVEAKGVKALIFFVALYLVAIGSGCVKPNLIAHGADQFSTSQNPSHSKSL  202

Query  621   SSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYV  800
             S +FN   L   +G  ++LTL VW+  H G D GF  S   M FG I    G+ +Y+   
Sbjct  203   SKYFNTAYLAFSIGELIALTLIVWIQTHSGMDVGFGVSAAVMAFGLIILVAGIFYYKNKP  262

Query  801   IQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPH--TDKYRFL  974
              QG   I  I+QVFVAA+  RK   P +S  ++     K A++  +    H  T K+RFL
Sbjct  263   PQGPIFIP-ILQVFVAALLKRKQVCPSNSHTIHH----KVALSSQSHSPNHIPTQKFRFL  317

Query  975   DKAAIQTSWDE-EPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGS  1151
             DKA I++   E + +PWR+C   QVE  KIL++LVP+F CT+I    LAQLQTFS+QQGS
Sbjct  318   DKACIKSQDGETKESPWRLCTPNQVEQVKILVSLVPIFACTIIFNTILAQLQTFSVQQGS  377

Query  1152  TMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGl  1331
              M+  +TKSF I P+SL  +P + L+F++PLYD  FVP  R+ TG  +GI+PL R+  GL
Sbjct  378   LMNTQLTKSFHIPPASLQSIPYIMLLFIVPLYDTFFVPFARKFTGHTSGISPLKRIGFGL  437

Query  1332  llsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVG  1511
              LS+ SM AAA++E +R+ +A   N +          IS+FW++ Q+ IFG+++MFT VG
Sbjct  438   FLSTFSMVAAALMEKRRRDLAVNSNEM----------ISIFWITPQFLIFGLSEMFTAVG  487

Query  1512  LLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNR  1691
             L+EFFY Q+ K +++  +   + S S G++ SS+LV +VN  T   + +GGWL  NN+N+
Sbjct  488   LIEFFYKQSVKGMQAFLTAMTYCSYSFGFYLSSLLVSLVNKITSS-SSNGGWLHENNLNK  546

Query  1692  NHLELFYALLSGLSFVNFFVYLFVS  1766
             + L+LFY LL+ LS +NFF YLF S
Sbjct  547   DRLDLFYWLLAALSLLNFFNYLFWS  571



>ref|XP_002268504.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Vitis vinifera]
Length=607

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 240/555 (43%), Positives = 346/555 (62%), Gaps = 22/555 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR +  +KHGG+RA+ F+LG+  FE M    +G  L+TY+   M+  L+ +AN VT
Sbjct  29    VDWRGRPSNPEKHGGMRAASFVLGLQAFEIMGIAAVGNNLITYVINEMHFPLSTSANIVT  88

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L ++   ++D+Y+G F  +LI  ++E  G  LL++QAH  +LKPP CN +  
Sbjct  89    NFIGTVFLLALLGGCISDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLKPPQCNMVTD  148

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
              E+C E  G  A I ++ALY VA+GS  VK  + +HGADQF+    K+   +SS+FN   
Sbjct  149   GERCVEAKGFKAFIFYLALYLVALGSGCVKPNMVAHGADQFNRDSPKQSKSLSSYFNAAY  208

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                 +G  ++LT+ VW+  H G D GF  S  AM  G I    G   YR    QG S +T
Sbjct  209   FAFSIGELIALTVLVWVQTHSGMDVGFGVSAAAMAMGLISLVSGTLLYRNKPPQG-SILT  267

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA--IQTS  998
              I QVFVAAI  RK + P     L+  S++   V   A     T K++FLDKA   IQ  
Sbjct  268   PIAQVFVAAILKRKQRCPPSPHMLHG-SQNNVLVGSVA-----TSKFKFLDKACIKIQDG  321

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
              + + +PWR+C V QV+  KILL+++P+F CT++    LAQ+QTFS+QQGS+M+  +TK+
Sbjct  322   NNVKESPWRLCTVAQVQQVKILLSVIPIFACTIVFNTILAQMQTFSVQQGSSMNTQLTKN  381

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
             F I P+SL  +P + LIFL+PLYD  FVP  RR TG  +GI+PL R+  GL +++ SM A
Sbjct  382   FHIPPASLQAIPYIILIFLVPLYDAFFVPFARRFTGNVSGISPLQRIGFGLFVATFSMVA  441

Query  1359  aailelKRKQVA-RERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             AAI+E KR+  A  E+ +L           S+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  442   AAIMEDKRRNAAVNEKKIL-----------SIFWITPQFLIFGLSEMFTAVGLIEFFYKQ  490

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNHLELFYA  1715
             +   +++  +   + S S G++ SSVLV +VN  T   + S GWL  +++N++ L+LFY 
Sbjct  491   SSTGMQAFLTAITYFSYSFGFYFSSVLVSLVNKITSS-SSSDGWLKDDDLNKDRLDLFYW  549

Query  1716  LLSGLSFVNFFVYLF  1760
             LL+ LSF+NF  YLF
Sbjct  550   LLAVLSFINFLNYLF  564



>ref|XP_009757633.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like [Nicotiana sylvestris]
Length=608

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 244/574 (43%), Positives = 348/574 (61%), Gaps = 19/574 (3%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
                VDWRGR  + +KHGG+ A+IF+L +  FE M    +G  L+TY+   M+  L+ +AN
Sbjct  26    QASVDWRGRPCKPNKHGGMTAAIFVLCLQAFEMMGIAAVGNNLITYVFNEMHFPLSKSAN  85

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L++    L+D+Y+G F  +LI  ++E  G  LLA+QAH  +L+PP C+ 
Sbjct  86    IVTNFIGTVFLLSLFGGFLSDSYLGSFLTMLIFGFVELSGFILLAVQAHVPQLRPPKCDM  145

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +    +C E  G  A I FVALY VA+GS  +K  + S GADQF + D K+  ++S++FN
Sbjct  146   MLSKGQCMEAKGYKAMIFFVALYLVALGSGSLKPNIISQGADQFKKDDSKQSKKLSTYFN  205

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
             +     C G  V+LTL VW+  H G D GF  S  AM  G I    G   YR    +G S
Sbjct  206   FAYFAFCTGELVALTLLVWVQTHYGMDVGFGVSAAAMALGLISLLCGTVLYRNTPPRG-S  264

Query  816   AITQIIQVFVAAIHNRKLQLPED-----SGELYEISKDKEAVTICAEFLPHTDKYRFLDK  980
               T I QVFVAAI  RK   P +       +     ++   +      L HTDK+RFLDK
Sbjct  265   IFTPIAQVFVAAITKRKQICPSNLEMLHGSQFIAPQQNLSGMASKGSTLIHTDKFRFLDK  324

Query  981   AAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
             A I  Q       +PWR+C V+QVE  KIL+++VP+F CT+I    LAQLQTFS+QQG+T
Sbjct  325   ACIKKQDGSSTSESPWRLCTVSQVEQVKILISVVPIFACTIIFNTILAQLQTFSVQQGTT  384

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             M+  +  +F+I P+SL  +P + LIFL+PLY+  FVP  R+ TG  +GITPL RV +GL 
Sbjct  385   MNTRLAHNFKIPPASLQAIPYIMLIFLVPLYEIAFVPMTRKFTGKDSGITPLQRVGIGLF  444

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
             +++ SM  AA++E KR+  A  +N            +S+FW++ Q+ IFG+++MFT VGL
Sbjct  445   IATFSMVCAALVENKRRNYALNQNRT----------LSIFWIAPQFLIFGLSEMFTAVGL  494

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGAT-KGMTESGGWLGGNNVNR  1691
             +EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T    + SGGWL  N++N+
Sbjct  495   IEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITSSSSSGSGGWLNDNDLNK  554

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             + L+LFY LL+ LS VNF  YLF S+ Y Y   +
Sbjct  555   DRLDLFYWLLAALSLVNFINYLFCSRWYSYNPSL  588



>ref|XP_009415000.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like [Musa acuminata 
subsp. malaccensis]
Length=600

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 227/568 (40%), Positives = 346/568 (61%), Gaps = 16/568 (3%)
 Frame = +3

Query  87    ELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLAD  266
              +I+  VDWRG+  R +KHGG+RA+ F+L I  FE MA   +G  L+TY+   M+  L++
Sbjct  13    SMIEVSVDWRGKPCRPNKHGGMRAAAFVLAIQAFEIMAIAAVGNNLITYVFNEMHFPLSN  72

Query  267   AANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPP  446
             +AN VTNF G  ++++++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +L+PPP
Sbjct  73    SANVVTNFIGTVFLVSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLRPPP  132

Query  447   CNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSS  626
             CN + + E C E  G  A + F+ALY VA+GS  +K  + SHGADQF   D  +  ++S+
Sbjct  133   CNMISEEEHCTEATGFKATVFFLALYLVAVGSGCLKPNMISHGADQFRNHDPDQSRKLST  192

Query  627   FFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQ  806
             +FN      C G  V+LT+ VW+    G D GF  S  AM         G  FYR     
Sbjct  193   YFNAAYFSFCAGELVALTVLVWVQTRSGMDVGFGVSAGAMAMVLAILICGAFFYRNRPPH  252

Query  807   GSSAITQIIQVFVAAIHNRKLQLPEDSGELYEIS--KDKEAVTICAEFLPHTDKYRFLDK  980
             G S    + +VFVAA   RK   P  +  + + S       + +    L +T  +RFLDK
Sbjct  253   G-SIFMPLARVFVAAFTKRKQVCPSINPRVLQRSHFNSPHHLDVDDGGLRYTTMFRFLDK  311

Query  981   AAI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
             A +  Q   DE+ +PWR+C   +VE  K++L+++P+F CT+I    LAQLQT S+QQGS 
Sbjct  312   ACVRAQDGSDEKESPWRLCTAAEVEQVKVILSVIPIFACTIIFNTVLAQLQTLSVQQGSA  371

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             M+  +T SF + P+SL  +P + L+ L+P+Y+  FVP  R+LTG  +GITPL R+ +GL 
Sbjct  372   MNTQLTSSFHVPPASLQSIPYIVLLVLVPVYETTFVPLARKLTGNSSGITPLQRIGIGLF  431

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
               ++SM +AA++E KR++ A + + L          +S+FW++ Q+ IFG+++MFT VGL
Sbjct  432   TVAVSMVSAAVVEKKRRETAVDSDKL----------LSIFWIAPQFLIFGLSEMFTAVGL  481

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRN  1694
             +EFFY Q+   ++S  +   + S S G++ SS+LV +VN  T  ++ S GWL  N++N++
Sbjct  482   IEFFYKQSVAGMQSFLTAMTYCSYSFGFYLSSLLVSMVNKITS-LSSSRGWLSDNDLNKD  540

Query  1695  HLELFYALLSGLSFVNFFVYLFVSKRYK  1778
              L+LFY LL+ LS +NFF YL+  + Y 
Sbjct  541   RLDLFYWLLAALSLLNFFNYLYWCRWYS  568



>gb|KGN61036.1| hypothetical protein Csa_2G035360 [Cucumis sativus]
Length=612

 Score =   397 bits (1019),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 249/530 (47%), Positives = 348/530 (66%), Gaps = 25/530 (5%)
 Frame = +3

Query  219   TLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGL  398
             +LV Y   VM+ +L  AAN +TNF G+ ++L+++   L+DTYI R    LI  ++E + L
Sbjct  9     SLVQYFLFVMHFDLQTAANTLTNFMGSAFLLSLLGGFLSDTYINRLNTCLIFGFLEVIAL  68

Query  399   GLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGA  578
              L+ +QA+   L P P  P D    C  V GR A + + +LY +A+GS GV+ A+P+ GA
Sbjct  69    ILITVQAYSHDLLPSPLCPKD----C--VKGRIAFVFYTSLYLLAIGSGGVRGALPALGA  122

Query  579   DQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGG  758
             DQF++KD KE   + +FFN++LL V +G AV +TL VW+  +K W WGF  S +A   G 
Sbjct  123   DQFNQKDPKEAKALGTFFNYMLLSVVIGAAVGVTLIVWVAVNKAWYWGFFISALAALVGF  182

Query  759   IFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICA  938
             I F +G PFYR+ V  G S + ++IQV V AI NR+L+LP+   ELYEIS DK  +    
Sbjct  183   IIFAIGKPFYRIQV-PGQSPLLRVIQVIVVAIKNRRLRLPDTPNELYEIS-DKLHMDSNH  240

Query  939   EFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLA  1118
               + HT++ RFLDKAAI    D EP PW VC VTQVE  KI+  +VP+F+ T+IM  CLA
Sbjct  241   YKIVHTNQLRFLDKAAIVPK-DIEPQPWNVCSVTQVEEVKIITRMVPIFVSTIIMNTCLA  299

Query  1119  QLQTFSIQQGST--MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIP  1292
             QLQTFS++QG+T  MD ++   FQ    S+P +P++F+ FLIPLY+  FVP  R++T  P
Sbjct  300   QLQTFSVEQGNTRIMDKSLGH-FQFPAPSIPVIPLVFMAFLIPLYEFFFVPFARKITHHP  358

Query  1293  TGITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQY  1472
             +GIT L RV VGL+LS+++M  A ++E+KR+  A E       P  Q   IS+FWL+ QY
Sbjct  359   SGITQLQRVGVGLVLSAIAMTVAGLVEVKRRHQATEH------PDKQ---ISLFWLAFQY  409

Query  1473  FIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMT  1652
              IFG+ADMFT VGLLEFFY +AP  ++S+S+ F + S++LGY+ SS+ V VVN  TK +T
Sbjct  410   GIFGVADMFTLVGLLEFFYKEAPVGMRSLSTSFTFLSLALGYYLSSIFVNVVNKVTKNIT  469

Query  1653  ES-GGWLGG---NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              S  GW+ G    ++N N+L LFY  L+ LS +NFF YL+ +  YKY+ +
Sbjct  470   PSKKGWVEGLIPEDLNHNNLNLFYWFLAILSVLNFFHYLYWASWYKYKTE  519



>ref|XP_004979024.1| PREDICTED: probable peptide/nitrate transporter At1g33440-like 
[Setaria italica]
Length=605

 Score =   396 bits (1018),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 237/569 (42%), Positives = 342/569 (60%), Gaps = 20/569 (4%)
 Frame = +3

Query  102   KVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHV  281
              VDWRGR     KHGG++A++F+LGI  FE MA   +G  L+TY+ G M+  L+ AAN V
Sbjct  20    SVDWRGRPCDHRKHGGMKAAVFVLGIQAFEMMAIAAVGNNLITYVFGEMHYPLSQAANIV  79

Query  282   TNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPL-  458
             TNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LLA+QAH  +L+PPPC+ + 
Sbjct  80    TNFIGTVFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLAVQAHLPQLRPPPCDMMA  139

Query  459   -DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
                A  CEE  G  A I F ALY VA+GS  +K  + +HGADQF      +   +S++FN
Sbjct  140   AAAAAACEEAGGVKAGIFFAALYLVAVGSGCLKPNIIAHGADQFRRGSGGDARRLSTYFN  199

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                   CVG  V+LT+ VW+    G D GF  S  AM  G +    G+ FYR    QG S
Sbjct  200   AAYFSFCVGELVALTVLVWVQTRSGMDVGFGVSAAAMAVGLVSLVAGVAFYRNKPPQG-S  258

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQ-  992
               T I +VFVAA+  RK   P  +      S     +++    + H +K+RFLDKA ++ 
Sbjct  259   IFTPIAKVFVAAVTKRKQVCPSTATVQANASITAHEMSVNTTSIRHINKFRFLDKACVKA  318

Query  993   ------TSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
                    S   + +PWR+C   +VE  K+LL +VP+F CT++    LAQLQTFS+QQGS 
Sbjct  319   QDGPGGASSAGKESPWRLCTPAEVEQVKVLLCVVPIFACTIVFNTILAQLQTFSVQQGSA  378

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             MD  +  SF + P+SL  +P   L+ L+P Y+  FVP++RRLTG+ TGITPL R+ VGL 
Sbjct  379   MDTRLAASFHVPPASLQAIPYAMLVALVPAYEAAFVPAVRRLTGVATGITPLQRIGVGLF  438

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
               + SM AAA++E +R   A + +            +S+FW++ Q+ +FG+++MFT VGL
Sbjct  439   AVTFSMVAAALVEARRLHAAADGD---------GHLLSIFWIAPQFLVFGLSEMFTAVGL  489

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATK-GMTESGGWLGGNNVNR  1691
             +EFFY Q+   +++  +   + S S G++ SSVLV +VN  T       GGWL  N++N+
Sbjct  490   IEFFYKQSLAGMQAFLTSMTYCSYSFGFYLSSVLVSLVNRVTSTSAAGDGGWLANNDLNK  549

Query  1692  NHLELFYALLSGLSFVNFFVYLFVSKRYK  1778
             + L+LFY LL+GLS +NFF YLF ++ Y 
Sbjct  550   DRLDLFYWLLAGLSILNFFNYLFWARWYS  578



>gb|KHN26211.1| Putative peptide/nitrate transporter [Glycine soja]
Length=601

 Score =   396 bits (1017),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 239/558 (43%), Positives = 340/558 (61%), Gaps = 24/558 (4%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
             +  +++  GG RAS+FI  +   +NM  +   V+LV Y  GVM+ +L+++AN +TNF G+
Sbjct  4     KEVKEELKGGFRASMFIFVLSALDNMGFVANMVSLVLYFYGVMHFDLSNSANTLTNFMGS  63

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCE  479
             T++L++V   ++DTY  R    L+   +E L L +L +QA    L P  C       K  
Sbjct  64    TFLLSLVGGFISDTYFNRLTTCLLFGSLEVLALVMLTVQAALDHLHPDFCG------KSS  117

Query  480   EVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCV  659
              V G  A + + +LY +A+G  GV+ ++ + GADQF EK+ +E   ++S+FNWLLL   +
Sbjct  118   CVKGGIAVMFYSSLYLLALGMGGVRGSLTAFGADQFGEKNPQEAKALASYFNWLLLSSTL  177

Query  660   GGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQV  839
             G  + +T  VW+   K W WGF   TVA   G +   LG PFYR+    G S I++I QV
Sbjct  178   GSIIGVTGVVWVSTQKAWHWGFIIITVASSIGFLTLALGKPFYRIKT-PGQSPISRIAQV  236

Query  840   FVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNP  1019
              V A  NRKL LPE + ELYE+ ++        E + HT++ RFLD+A+I    + E  P
Sbjct  237   IVVAFKNRKLPLPESNEELYEVYEEA-----TLEKIAHTNQMRFLDRASILQE-NIESQP  290

Query  1020  WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpss  1199
             W+VC VTQVE  KIL  ++P+   T+IM  CLAQLQTFS+QQG+ M+L +       PS 
Sbjct  291   WKVCTVTQVEEVKILTRMLPILASTIIMNTCLAQLQTFSVQQGNVMNLKLGSFTVPAPSI  350

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
                  +   I +   Y+  FVP  R++T  P+G+T L RV VGL+LSS+SM  A I+E+K
Sbjct  351   PVIPLLFMSILIPL-YEFFFVPFARKITHHPSGVTQLQRVGVGLVLSSISMTIAGIIEVK  409

Query  1380  RKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             R+   R+             PIS+FWLS QY IFGIADMFT VGLLEFFY +AP  +KS+
Sbjct  410   RRDQGRKD---------PSRPISLFWLSFQYAIFGIADMFTLVGLLEFFYREAPVTMKSL  460

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSF  1736
             S+ F + SMSLGYF S++ V V+N  TK +T S  GWL G ++N+N+L LFY  L+ LS 
Sbjct  461   STSFTYLSMSLGYFLSTIFVDVINAVTKRVTPSKQGWLHGLDLNQNNLNLFYWFLAILSC  520

Query  1737  VNFFVYLFVSKRYKYRQQ  1790
             +NFF +L+ +  YKY+ +
Sbjct  521   LNFFNFLYWASWYKYKAE  538



>ref|XP_006359595.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like 
[Solanum tuberosum]
Length=583

 Score =   395 bits (1015),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 233/557 (42%), Positives = 335/557 (60%), Gaps = 31/557 (6%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
             R  +    GG RAS FI G  G +N+  +   V++V YL+  M+ +L+ +AN VTN  G+
Sbjct  13    RNCKMKGKGGFRASSFIYGFVGLDNIGFVANMVSMVLYLSFKMHFDLSGSANTVTNLLGS  72

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCE  479
             TY+L+I+   ++DTY+ RF  ++I    E L   L+ +QA Y+ L+P          K  
Sbjct  73    TYLLSIIGGFISDTYLNRFNTIIIFGTAEILAWALMTIQARYSFLQP----------KAN  122

Query  480   EVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCV  659
              + G  A + +V++  +A+G+ GV+ A+P+ GADQFDE + K    +  +FNWLLL    
Sbjct  123   SLEGGIAVLFYVSVCLLALGTGGVRGALPALGADQFDENNSK--GAVGKYFNWLLLSSVS  180

Query  660   GGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQV  839
             G A+ +T+ VW+  +KGW  GF  S    F G I F  G PFY++ +   +  +T+I+QV
Sbjct  181   GSAIGVTIIVWISTNKGWWMGFLISFATTFLGFIIFVFGKPFYQLQLPAQTPPLTRILQV  240

Query  840   FVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNP  1019
              VAAI NRKLQLP++  +LYE   D     I      HT+++R LDKAA+      E   
Sbjct  241   IVAAIRNRKLQLPDNPQQLYEKDSDSSDPKIA-----HTNQFRCLDKAAVVPK-SVEITE  294

Query  1020  WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpss  1199
             WRVC V++VE  KI+  ++P+   T+IM  CLAQLQTFS+QQG  M+ +        PS 
Sbjct  295   WRVCTVSKVEEVKIVTRMLPIIGSTIIMNTCLAQLQTFSVQQGYRMNRHFGSFEVPAPSV  354

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
                  +   I +   YD LFVP  R++T  P+GIT L RV VGL+LS +SM  AA++E+K
Sbjct  355   PVIPLLFMCILIPI-YDLLFVPFARKITNHPSGITQLQRVGVGLVLSIISMGIAALVEIK  413

Query  1380  RKQVARERNMLDAIPILQPL-PISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKS  1556
             RK  + +           PL PI VFWLS QY IFGIADMFT VG+LEFFY +AP  ++S
Sbjct  414   RKNQSLK----------NPLQPIHVFWLSFQYAIFGIADMFTLVGMLEFFYKEAPIGMRS  463

Query  1557  VSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYALLSGLS  1733
             +S+ F W S+S GYF SS  V ++N  TK ++ S  GWL G ++++N+L+LFY  L+ LS
Sbjct  464   LSTSFTWISLSFGYFLSSAFVDIINSVTKRVSSSKKGWLDGQDLDQNNLQLFYWFLAILS  523

Query  1734  FVNFFVYLFVSKRYKYR  1784
              +NF  Y++ +  YKY+
Sbjct  524   CLNFINYIYWACWYKYK  540



>ref|XP_003577653.2| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Brachypodium distachyon]
Length=644

 Score =   397 bits (1021),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 234/577 (41%), Positives = 345/577 (60%), Gaps = 15/577 (3%)
 Frame = +3

Query  75    QEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNV  254
             +E+     G VDWRGR     KHGG+RASIFI  +    N A I   + LVTYL G M++
Sbjct  53    KEEMGSSSGLVDWRGRPINSKKHGGVRASIFIHALVLLSNAANIANIMNLVTYLRGTMHM  112

Query  255   NLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKL  434
              +A+A+   +NF  A  + +I AA LAD+YI R  AVLI   IE LG  LLA+QAH   L
Sbjct  113   GVAEASTTASNFFAALQMFSIPAAFLADSYIKRVYAVLIFGPIEILGYILLAVQAHIPML  172

Query  435   KPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGS  614
              PPPC+       CE V G N ++L + LY + +G    +A +P+ G DQFD  D  E  
Sbjct  173   HPPPCSQTGATATCEPVHGSNLSLLLLGLYLIPIGDGAARACLPALGGDQFDTADPAEQR  232

Query  615   EMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRV  794
             + +SFFNW    V  GG + L L VW+   +GWD GFA   + +  G + +  G PFYR 
Sbjct  233   QETSFFNWYTFAVSSGGFLGLVLIVWVQNRQGWDIGFALCALCVLLGMLIWIAGFPFYR-  291

Query  795   YVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFL  974
               + G SAIT+++QV V A   R ++LP+D+ EL ++++D     +  E L  T  ++ L
Sbjct  292   NQLPGGSAITRMLQVLVVAFKKRNVELPKDTSELKQMNQDDSNNGL--EKLERTVGFQCL  349

Query  975   DKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGST  1154
             +K+AI T    E  PW +C VTQVE  KI+L +VP+FL  ++  + +  +  F++QQG+T
Sbjct  350   EKSAIDTG---ETGPWSLCTVTQVEETKIVLRMVPIFLSAILGYIPVPLILNFTVQQGNT  406

Query  1155  MDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGll  1334
             MD  +  +  I P++L  +P +F + ++ LYDR  VP +RR+TG   G+T L R+ +G L
Sbjct  407   MDTKL-GAIHISPATLFLIPTVFQMVILVLYDRFIVPFLRRITGYVGGVTHLQRIGIGFL  465

Query  1335  lsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGL  1514
              ++L+   AA++E KRK+VA E  ++DA      +PISVFWL++Q+F+ G+ D+ ++VGL
Sbjct  466   SATLATGVAALVETKRKRVAEENGLMDAA---TGIPISVFWLTVQFFLLGVVDVTSFVGL  522

Query  1515  LEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATK-----GMTESGGWLGGN  1679
             LEFFYS+A   +KSV S   +  + +  +  S+L++V N  T+         + GWL G 
Sbjct  523   LEFFYSEASTGMKSVGSSIFYCILGVSAWLGSLLIQVTNQVTRRGGSGAAAAATGWLDGT  582

Query  1680  NVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
             N+N   L+ FY LL+ L  V FF+Y+F + RY+YR  
Sbjct  583   NLNMGKLDRFYWLLAVLELVAFFIYMFFAWRYEYRNN  619



>ref|XP_008453012.1| PREDICTED: protein NRT1/ PTR FAMILY 4.5-like [Cucumis melo]
Length=608

 Score =   396 bits (1017),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 247/530 (47%), Positives = 350/530 (66%), Gaps = 25/530 (5%)
 Frame = +3

Query  219   TLVTYLNGVMNVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGL  398
             +LV Y   VM+ +L  AAN +TNF G+ ++L+++   L+DTYI R    LI  ++E + L
Sbjct  3     SLVQYFLFVMHFDLETAANTLTNFMGSAFLLSLLGGFLSDTYINRLTTCLIFGFLEVIAL  62

Query  399   GLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGA  578
              L+ +QA+   L P P  P D    C  V GR A + + +LY +A+GS GV+ A+P+ GA
Sbjct  63    ILITVQAYSHDLLPSPLCPKD----C--VKGRIAFVFYTSLYLLAIGSGGVRGALPALGA  116

Query  579   DQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGG  758
             DQF++KD KE   + +FFN++LL V +G AV +T+ VW+  +K W WGF  S +A   G 
Sbjct  117   DQFNQKDPKEAKALGTFFNYMLLSVVLGAAVGVTVIVWVAVNKAWYWGFFISALAALVGF  176

Query  759   IFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICA  938
             I F +G PFYR+ V  G S I ++IQV V AI NR+L+LP+   ELYEIS DK  +    
Sbjct  177   IIFAIGKPFYRIQV-PGQSPILRVIQVIVVAIKNRRLRLPDTPNELYEIS-DKVYMDSIH  234

Query  939   EFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLA  1118
               + HT++ RFLDKAAI    D EP PW VC VTQVE  KI+  +VP+F+ T+IM  CLA
Sbjct  235   YKIVHTNQLRFLDKAAIVPK-DIEPQPWNVCSVTQVEEVKIITRMVPIFISTIIMNTCLA  293

Query  1119  QLQTFSIQQGSTMDLNIT-KsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPT  1295
             QLQTFS++QG+T+ ++ +   FQ    S+P +P++F+ FLIPLY+ +FVP  R++T  P+
Sbjct  294   QLQTFSVEQGNTIIMDKSLGHFQFPAPSIPVIPLVFMAFLIPLYEFVFVPFARKITHHPS  353

Query  1296  GITPLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQP-LPISVFWLSIQY  1472
             GIT L RV VGL+LS+++MA A ++E+KR+  A          I  P  PIS+FWL+ QY
Sbjct  354   GITQLQRVGVGLVLSAIAMAVAGLVEVKRRHQA----------IKHPDEPISLFWLAFQY  403

Query  1473  FIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMT  1652
              IFGIADMFT VGLLEFFY +AP  ++S+S+ F + S++LGY+ SS+ V +VN  T+ +T
Sbjct  404   GIFGIADMFTLVGLLEFFYKEAPVGMRSLSTSFTFLSLALGYYLSSIFVNIVNKVTRNIT  463

Query  1653  ESG-GWLGG---NNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQ  1790
              S  GW+ G    ++N N+L LFY  L+ LS +NFF YL+ +  YKY+ +
Sbjct  464   PSKRGWVEGLIPEDLNHNNLNLFYWFLAILSVLNFFHYLYWASWYKYKTE  513



>ref|XP_006605772.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Glycine max]
Length=601

 Score =   396 bits (1017),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 239/558 (43%), Positives = 340/558 (61%), Gaps = 24/558 (4%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
             +  +++  GG RAS+FI  +   +NM  +   V+LV Y  GVM+ +L+++AN +TNF G+
Sbjct  4     KEVKEELKGGFRASMFIFVLSALDNMGFVANMVSLVLYFYGVMHFDLSNSANTLTNFMGS  63

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCE  479
             T++L++V   ++DTY  R    L+   +E L L +L +QA    L P  C       K  
Sbjct  64    TFLLSLVGGFISDTYFNRLTTCLLFGSLEVLALVMLTVQAALDHLHPDFCG------KSS  117

Query  480   EVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCV  659
              V G  A + + +LY +A+G  GV+ ++ + GADQF EK+ +E   ++S+FNWLLL   +
Sbjct  118   CVKGGIAVMFYSSLYLLALGMGGVRGSLTAFGADQFGEKNPQEAKALASYFNWLLLSSTL  177

Query  660   GGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQV  839
             G  + +T  VW+   K W WGF   TVA   G +   LG PFYR+    G S I++I QV
Sbjct  178   GSIIGVTGVVWVSTQKAWHWGFIIITVASSIGFLTLALGKPFYRIKT-PGQSPISRIAQV  236

Query  840   FVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNP  1019
              V A  NRKL LPE + ELYE+ ++        E + HT++ RFLD+A+I    + E  P
Sbjct  237   IVVAFKNRKLPLPESNEELYEVYEEA-----TLEKIAHTNQMRFLDRASILQE-NIESRP  290

Query  1020  WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpss  1199
             W+VC VTQVE  KIL  ++P+   T+IM  CLAQLQTFS+QQG+ M+L +       PS 
Sbjct  291   WKVCTVTQVEEVKILTRMLPILASTIIMNTCLAQLQTFSVQQGNVMNLKLGSFTVPAPSI  350

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
                  +   I +   Y+  FVP  R++T  P+G+T L RV VGL+LSS+SM  A I+E+K
Sbjct  351   PVIPLLFMSILIPL-YEFFFVPFARKITHHPSGVTQLQRVGVGLVLSSISMTIAGIIEVK  409

Query  1380  RKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             R+   R+             PIS+FWLS QY IFGIADMFT VGLLEFFY +AP  +KS+
Sbjct  410   RRDQGRKD---------PSRPISLFWLSFQYAIFGIADMFTLVGLLEFFYREAPVTMKSL  460

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSF  1736
             S+ F + SMSLGYF S++ V V+N  TK +T S  GWL G ++N+N+L LFY  L+ LS 
Sbjct  461   STSFTYLSMSLGYFLSTIFVDVINAVTKRVTPSKQGWLHGLDLNQNNLNLFYWFLAILSC  520

Query  1737  VNFFVYLFVSKRYKYRQQ  1790
             +NFF +L+ +  YKY+ +
Sbjct  521   LNFFNFLYWASWYKYKAE  538



>emb|CDP15160.1| unnamed protein product [Coffea canephora]
Length=614

 Score =   396 bits (1018),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 236/550 (43%), Positives = 338/550 (61%), Gaps = 20/550 (4%)
 Frame = +3

Query  144   GGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTIVA  323
             GG RA+ F+  +   ENM  +   V+ V Y    M   ++ AAN VTN  G+TY+L+I  
Sbjct  14    GGFRAASFVYALVSLENMGFVANMVSFVLYFQLQMYFKVSAAANTVTNLMGSTYLLSIFG  73

Query  324   AVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRNAA  503
               ++DTYI RF+  LI    E   L L+ +QA Y  L+P PC       K   +AGR A 
Sbjct  74    GFISDTYINRFKTCLIFGVFELAALLLMTVQARYKDLQPSPCG------KSSCLAGRVAV  127

Query  504   ILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSLTL  683
             + + +L  VAMG+ GV+ A+P+ GADQF++KD KE   ++++FN+LLL   +G  + +T+
Sbjct  128   MFYASLSLVAMGTGGVRGALPALGADQFNQKDPKESKALATYFNFLLLSSTLGATIGVTI  187

Query  684   FVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIHNR  863
              VW+  ++ W  GF  S +A   G IF  LG PFYR+  + G S + ++IQV V AI NR
Sbjct  188   IVWVATNRHWWPGFLISLLATLVGFIFLVLGKPFYRLQ-LPGDSPLLRVIQVIVVAIKNR  246

Query  864   KLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQ  1043
              LQ P    ELYE  +DKE+     + + HT+++R+LDKAAI    + +P PW VC VTQ
Sbjct  247   SLQHPSSPEELYE-PEDKESSISTDQKIQHTEQFRWLDKAAILRDSNTKPAPWTVCTVTQ  305

Query  1044  VENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpilf  1223
             VE  K+L  ++P+   T+I+  C+AQLQTFS+ QG  M+  +  SF++   S+P +P++F
Sbjct  306   VEEVKVLTRMLPIIASTIILNTCMAQLQTFSVTQGYYMN-RVLGSFEVPAPSVPVIPLVF  364

Query  1224  lifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVARER  1403
             +  LIP+Y+  FVP  R++T  P+G+T L RV VGL+LS +SM  A  +E+KRK      
Sbjct  365   ISILIPIYEFFFVPFARKITNHPSGVTQLQRVGVGLVLSVVSMTVAGFVEVKRKNHDLTY  424

Query  1404  NMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLWSS  1583
                         P+ V WLS QY IFGIADMFT VGLLEFFY +AP  ++S+S+ F W +
Sbjct  425   GK----------PVHVVWLSFQYGIFGIADMFTLVGLLEFFYKEAPVGMRSLSTSFTWLT  474

Query  1584  MSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLF  1760
              S GYF SS+ V ++N  T+  T S  GWL G  ++ NHL+ F+  L+ LS +NFF YL+
Sbjct  475   QSFGYFLSSIFVDIINSVTRRTTHSKRGWLDGKLLDENHLDYFFWFLAILSLLNFFNYLY  534

Query  1761  VSKRYKYRQQ  1790
              +  YKY+Q+
Sbjct  535   WASWYKYKQE  544



>ref|XP_006371371.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP49168.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=600

 Score =   395 bits (1016),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 247/573 (43%), Positives = 356/573 (62%), Gaps = 19/573 (3%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             +  VDWRGR   K KHGG+ A++F+LG+  FE M    +G  L+TY+   M+  L+ +AN
Sbjct  14    ETSVDWRGRIC-KSKHGGMAAAVFVLGLQAFEMMGIAAVGNNLITYVFNDMHFPLSKSAN  72

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +L+PP C+ 
Sbjct  73    IVTNFVGTVFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLRPPSCDM  132

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +     C E  G  A I F+ALY VA+GS  +K  + SHGADQF ++D K+  ++S++FN
Sbjct  133   VSDGVDCVEAKGYKALIFFLALYLVALGSGCLKPNIISHGADQFKKEDPKQSKKLSTYFN  192

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                   C+G  ++LT+ VW+  H G D GF  S  AM  G I    G   YR    +G S
Sbjct  193   VAYFAFCIGELIALTVLVWVQTHSGMDVGFGVSAAAMAVGLICLISGSFSYRNKPPKG-S  251

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELY----EISKDKEAVTICAEFLPHTDKYRFLDKA  983
               T   QVFVAAI  RK   P ++  L+     +S    A +  A  L HT+K+RFLDKA
Sbjct  252   IFTPFAQVFVAAITKRKQICPSNAQMLHGCHNNVSSHVPATSTDASNLLHTEKFRFLDKA  311

Query  984   AI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTM  1157
              I  Q   +   + WR+C V QVE  KIL++++P+F CT+I    LAQLQTFS+QQGS M
Sbjct  312   CIRVQDGSEASESTWRLCTVAQVEQVKILISVIPIFSCTIIFNTILAQLQTFSVQQGSAM  371

Query  1158  DLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlll  1337
             +  ITKSF+I P+SL  +P + LIF++PLY+  FVP  RR+TG  +GITPL RV VGL +
Sbjct  372   NTRITKSFKIPPASLQSIPYIMLIFVVPLYETAFVPFARRITGKDSGITPLQRVGVGLFI  431

Query  1338  sslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLL  1517
             ++ SM +AA++E KR+  A +              +S+FW++ Q+ IFG+++MFT VGL+
Sbjct  432   ATFSMVSAAVIERKRRTSALDYQE----------TLSIFWIAPQFLIFGLSEMFTAVGLI  481

Query  1518  EFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNH  1697
             EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T   + SGGWL  N++N++ 
Sbjct  482   EFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITS-SSSSGGWLSDNDLNKDK  540

Query  1698  LELFYALLSGLSFVNFFVYLFVSKRYKYRQQIG  1796
             L+LFY LL+ LS +NFF YLF SK Y Y   + 
Sbjct  541   LDLFYWLLAVLSLINFFNYLFWSKWYSYNPSLS  573



>ref|XP_006423955.1| hypothetical protein CICLE_v10028084mg [Citrus clementina]
 ref|XP_006480334.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Citrus sinensis]
 gb|ESR37195.1| hypothetical protein CICLE_v10028084mg [Citrus clementina]
Length=582

 Score =   395 bits (1014),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 230/558 (41%), Positives = 329/558 (59%), Gaps = 20/558 (4%)
 Frame = +3

Query  120   RTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGA  299
             + A   + GG RA  F+  +   ENM  I  G+++V Y    M+ ++A A+N +TNF G+
Sbjct  4     KVAGIKQKGGFRACTFVFVLSALENMGFIANGISMVLYFKNEMHFDIAGASNTLTNFFGS  63

Query  300   TYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCE  479
             T++L +V   ++DTY+ RF   L+   +E L L +L +QA+   L PP C       K  
Sbjct  64    TFLLCLVGGFISDTYLSRFATCLVFGTLEVLSLVMLTIQAYSKSLHPPDCG------KSS  117

Query  480   EVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCV  659
              + G  AA  + +LY  ++G  G +  +P+ GA QFDE D K    ++S+FN+ L    +
Sbjct  118   CLKGAIAAYFYGSLYLYSLGCGGNRGTLPALGAGQFDENDPKGAKALASYFNFYLFATTL  177

Query  660   GGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQV  839
                + +T  V++   +GW  GF  S+VA   G I   +G PFYR+    G S + ++ QV
Sbjct  178   AAMIGVTAIVYVFIDQGWWLGFLISSVATLIGLIALAIGKPFYRIQQ-PGESPLVRVAQV  236

Query  840   FVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNP  1019
              V AI NRKL LP++  ELYEI+K +   T   E +PHT+++R LDKAAI         P
Sbjct  237   IVVAIKNRKLSLPDNPEELYEINKIERVGT--EERIPHTNQFRCLDKAAIVPKDSTAAAP  294

Query  1020  WRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpss  1199
             WRVC VTQVE  KIL  ++P+   T+IM  CLAQLQT S+ QG+ MD  +       PS 
Sbjct  295   WRVCTVTQVEEVKILARMMPILASTIIMNTCLAQLQTLSVTQGAYMDPRLGSIKVPTPSI  354

Query  1200  lpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelK  1379
                  +   I +   Y+ LFVP  R++TG P GIT L RV VGL+LS +SM  A  +E+K
Sbjct  355   PVLPLLFMAILIPI-YEFLFVPFARKITGHPAGITQLQRVGVGLVLSVISMTIAGFVEVK  413

Query  1380  RKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSV  1559
             R      RN  +  P   P  IS+FWLS QY IFGIADMFT+VGLLEFFY +AP  ++++
Sbjct  414   R------RNAFNQSP---PKQISLFWLSFQYCIFGIADMFTFVGLLEFFYKEAPAGMRTL  464

Query  1560  SSCFLWSSMSLGYFTSSVLVKVVNGATKGMTES-GGWLGGNNVNRNHLELFYALLSGLSF  1736
             S+ F + S+S G F SS  V+++N  TK +T S  GWL G ++N+N+  LFY  L+ +S 
Sbjct  465   STSFTFLSLSFGNFLSSAFVEIINAVTKRITPSRQGWLHGKDINKNNANLFYWFLAIVSV  524

Query  1737  VNFFVYLFVSKRYKYRQQ  1790
             +NF +YL+ +  YKY+Q+
Sbjct  525   LNFVLYLYSAIWYKYKQE  542



>ref|XP_006362722.1| PREDICTED: probable peptide/nitrate transporter At1g33440-like 
[Solanum tuberosum]
Length=595

 Score =   395 bits (1015),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 238/566 (42%), Positives = 343/566 (61%), Gaps = 21/566 (4%)
 Frame = +3

Query  105   VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVT  284
             VDWRGR  + +KHGG+ A+IF+L +  FE MA   +G  L+TY+   M+  L+ +AN VT
Sbjct  28    VDWRGRPCKPNKHGGMTAAIFVLCLQAFEMMAIAAVGNNLITYVFNEMHFPLSKSANIVT  87

Query  285   NFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDK  464
             NF G  ++L++    L+D+Y+G F  + I  ++E  G  LLA+QAH  +L+PP C+ +  
Sbjct  88    NFIGTVFLLSLFGGFLSDSYLGSFSTMFIFGFVELSGFILLAVQAHVPQLRPPKCDMMLS  147

Query  465   AEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLL  644
               KC +V G  A I FVALY VA+GS  +K  + SHGADQF + D K   ++S++FN+  
Sbjct  148   KGKCLKVKGYKAMIFFVALYLVALGSGCLKPNIISHGADQFKKNDSK---KLSTYFNFAY  204

Query  645   LGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAIT  824
                C G  ++LTL VW+  H G D GF  S  AM  G I F  G   Y +    G S   
Sbjct  205   FAFCAGELLALTLVVWIQTHYGMDVGFGVSAAAMVVGLIIFLSGTLVY-MNTPPGGSIFI  263

Query  825   QIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAA--IQTS  998
              I QVFVAAI  RK   P +   L+      + +      L HTDK+RFLDKA   I+  
Sbjct  264   PIAQVFVAAITKRKQICPSNLKMLH----GSQCIVPQDGTLIHTDKFRFLDKACIKIENG  319

Query  999   WDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKs  1178
                  +PWR+C V+QVE  KIL+++VP+F CT+I    LAQLQTFS+QQG+ M+  +T +
Sbjct  320   RSTSESPWRLCTVSQVEQVKILISVVPIFACTIIFNTILAQLQTFSVQQGTVMNTRLTDN  379

Query  1179  fqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaa  1358
             F I P+SL  +P   LI L+PLY+   VP +R+  G  +GITPL RV +GL +++ SM  
Sbjct  380   FTIPPASLQSIPYFMLIILVPLYEIALVPMIRKFMGNDSGITPLQRVGIGLFIATFSMVC  439

Query  1359  aailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQA  1538
             AA++E KR+  +  +N +          +S+FW+  Q+ I+G+++MFT VGL+EFFY Q+
Sbjct  440   AALVENKRRDYSLNQNRI----------LSIFWIVPQFIIYGLSEMFTAVGLIEFFYKQS  489

Query  1539  PKELKSVSSCFLWSSMSLGYFTSSVLVKVVNG-ATKGMTESGGWLGGNNVNRNHLELFYA  1715
              + ++S  +   + S S G++ SS+LV +VN   +   +  GGWL  N++N+N L+LFY 
Sbjct  490   LEGMQSFLTAMTYCSYSFGFYLSSILVSLVNRITSTSSSGGGGWLNDNDLNKNRLDLFYW  549

Query  1716  LLSGLSFVNFFVYLFVSKRYKYRQQI  1793
             LL+ LS VNF  Y+F SK Y Y   +
Sbjct  550   LLAALSLVNFINYVFCSKWYSYNPSL  575



>ref|XP_006480388.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Citrus sinensis]
Length=624

 Score =   396 bits (1017),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 236/559 (42%), Positives = 334/559 (60%), Gaps = 20/559 (4%)
 Frame = +3

Query  111   WRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNF  290
             +  + A   + GG RA  FI  +   ENM  I   +++V Y    M+ NLA A+N +TN 
Sbjct  9     YEDKVATIKQKGGFRACGFIFVLSSLENMGFIANAISMVLYFKNEMHFNLAGASNTLTNL  68

Query  291   AGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAE  470
              G+T++L +V   ++DT++ RF   LI   +E L L ++ +QA+  KL PP C       
Sbjct  69    MGSTFLLCLVGGFISDTFLSRFATCLIFGTLEVLALVMITVQAYSEKLHPPDCG------  122

Query  471   KCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLG  650
             K   V G  AA  + +L   A+GS GV+ A+P+ GA QFDEKD K    ++S+FN+ LL 
Sbjct  123   KSSCVKGGIAAYFYASLCLYALGSGGVRGALPALGAGQFDEKDPKGAKALASYFNYFLLT  182

Query  651   VCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQI  830
               +   + +T  V++   K W  GF  S++  F G I   +G PFYR     G S + ++
Sbjct  183   TTLAAVIGVTAIVYVSTEKAWWGGFLISSIVTFIGFIALVIGKPFYRNQQ-PGESPLVRV  241

Query  831   IQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEE  1010
              QV V AI NRKL LPE+  ELYEI++ +   T   E +PHT+++R LDKAAI      E
Sbjct  242   SQVVVVAIKNRKLSLPENPEELYEINEKERVGT--EERIPHTNQFRCLDKAAIVPKDSTE  299

Query  1011  PNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqil  1190
               PWRVC +TQVE  KIL  ++P+   T++M  CLAQLQTFS+ QG+ MD  +       
Sbjct  300   AAPWRVCTLTQVEEVKILTRMMPILASTILMNTCLAQLQTFSVTQGAYMDPQLGSIKVPT  359

Query  1191  psslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaail  1370
             PS      +   I L   Y+ LFVP  +++TG P+GIT L RV VGL+LS++SM  A  +
Sbjct  360   PSIPVIPLLFMSILLPV-YELLFVPFAQKITGHPSGITQLQRVGVGLVLSAVSMTIAGFV  418

Query  1371  elKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKEL  1550
             E++R      RN  + +P   P  IS+FWLS QY IFGIADMFT VGLLEFFY +AP  +
Sbjct  419   EVQR------RNAFNQMP---PKQISLFWLSFQYCIFGIADMFTLVGLLEFFYKEAPAGM  469

Query  1551  KSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSG  1727
             +++S+ F + S+S G F SSV V ++N  TK +T S  GWL G ++N+N++ LFY  L+ 
Sbjct  470   RTLSTSFTFLSLSFGNFLSSVFVDIINAVTKRITPSKQGWLHGTDINKNNVNLFYWFLAI  529

Query  1728  LSFVNFFVYLFVSKRYKYR  1784
             LS +NF +YL+ +  YKY+
Sbjct  530   LSVLNFVLYLYAAAWYKYK  548



>ref|XP_004300018.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Fragaria vesca subsp. vesca]
Length=639

 Score =   396 bits (1017),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 247/578 (43%), Positives = 352/578 (61%), Gaps = 26/578 (4%)
 Frame = +3

Query  87    ELIDGK-----VDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMN  251
             EL+ G+     VDWRGR +   KHGG++A+ F+LG+  FE MA   +G  L+TY+   M+
Sbjct  35    ELMGGEEVVVTVDWRGRPSNAAKHGGMKAASFLLGLQSFEIMAIAAVGNNLITYVINEMH  94

Query  252   VNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAK  431
              +L+ +AN VTNF G  ++L +V   L+D+Y+G F  +LI  ++E  G  LL++QAH  +
Sbjct  95    FSLSKSANIVTNFIGTVFLLALVGGYLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQ  154

Query  432   LKPPPCNPLDKA--EKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDR-  602
             LKPPPCN       + CEE  G  A I F ALY VA+GS  VK  + +HGADQF+  D  
Sbjct  155   LKPPPCNNSTAVGEDYCEEAKGFKALIFFAALYLVALGSGCVKPNMIAHGADQFNPADNP  214

Query  603   KEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLP  782
             K+  ++S++FN       VG  ++LTL VW+  H G D GF  S   M  G I    G  
Sbjct  215   KQSKKLSTYFNAAYFAFSVGELIALTLLVWVQTHSGMDVGFGVSAAVMAMGLICLVSGTL  274

Query  783   FYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDK  962
             +YR    Q  S  T I QVFVAAI  RK   P +   L+    +  A +   +   H+ K
Sbjct  275   YYRNKPPQ-RSIFTPIAQVFVAAILKRKQVCPSNPHLLHGSQNNDNAFSSDIDPFNHSQK  333

Query  963   YRFLDKAA--IQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFS  1136
             +RFLDKA   I+   + + +PWR+C VTQV   K+LL+++P+F  T++    LAQLQTFS
Sbjct  334   FRFLDKACIKIEDGSNTKESPWRLCTVTQVNQVKVLLSVIPIFASTIVFNTILAQLQTFS  393

Query  1137  IQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHR  1316
             +QQGS MD  +TKSF I P+SL  +P + LIFL+PLYD  FVP  R+LTG  +GI+PL R
Sbjct  394   VQQGSAMDTQLTKSFHIPPASLQSIPYIILIFLVPLYDAFFVPFTRKLTGNESGISPLQR  453

Query  1317  VAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADM  1496
             +  GL  ++ SM +AA++E KR++ A   N            +S+FW++ Q+ IFG+++M
Sbjct  454   IGAGLFFATFSMISAAVMEQKRREAAVTSNK----------TLSIFWITPQFLIFGLSEM  503

Query  1497  FTYVGLLEFFYSQAPK-ELKSVSSCFLWSSMSLGYFTSSVLVKVVNG----ATKGMTESG  1661
              T VGL+EFFY Q+ K  +++  +   + S S G++ SS+LV +VN     ++      G
Sbjct  504   LTAVGLIEFFYKQSLKGRMQAFLTAVTYCSYSFGFYLSSLLVSLVNKITSSSSSSTGSHG  563

Query  1662  GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRY  1775
             GWL  N++N++ L+LFY LL+GLSF+NF  YLF SK Y
Sbjct  564   GWLSDNDLNKDRLDLFYWLLAGLSFLNFLNYLFWSKWY  601



>ref|XP_004304920.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like 
[Fragaria vesca subsp. vesca]
Length=633

 Score =   395 bits (1016),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 250/554 (45%), Positives = 347/554 (63%), Gaps = 17/554 (3%)
 Frame = +3

Query  132   KDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYIL  311
             + K GG  ASIFI  +   +NM  +   V++V Y  G M+ NLA AAN +TNF G  ++L
Sbjct  50    EKKRGGFTASIFIFVLLALDNMGFVANMVSMVLYFLGPMHFNLATAANTLTNFMGTNFLL  109

Query  312   TIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAG  491
             +++   ++DTY+ R+   LI   I+ +GL ++ +QA+   L+P  C  LDK   C E  G
Sbjct  110   SLLGGFISDTYLSRYTTCLIFGSIQIVGLSMMTIQAYSKALQPKFCG-LDKPS-CME--G  165

Query  492   RNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAV  671
                   +V+LY  A+GS GVK A+P+ G DQF  KD  E  ++++FFN  LL   +G  +
Sbjct  166   GIGFYFYVSLYLWALGSGGVKGALPALGGDQFGHKD--EAKKLATFFNLFLLSSTLGATI  223

Query  672   SLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAA  851
              +T+ VW+   K W WGF  ST+    G I   LG PFYR+ V +  S + ++ QV V A
Sbjct  224   GVTVVVWVSTTKAWYWGFFISTMGSLIGFIVLALGRPFYRLQVPR-ESPLIRVFQVIVLA  282

Query  852   IHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVC  1031
             I NR L LP  S ELYEIS+ + A T   E + HT+++ FLDKAAI    D +  PW+VC
Sbjct  283   IKNRSLSLPGSSAELYEISEKESAFT--NEKISHTEQFSFLDKAAILGK-DTKAEPWKVC  339

Query  1032  RVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpfl  1211
              VTQVE  K+L  ++P+ L T+IM  CLAQLQTFS+QQG+        +F++   S+P +
Sbjct  340   TVTQVEEVKVLTRMLPILLSTIIMNTCLAQLQTFSVQQGNRSMNRKLGNFEVPAPSIPVI  399

Query  1212  pilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQV  1391
             P++F+  LIPLY+  FVP  R++TG P GIT L RV +GL+LS++SMA A I+E+KR   
Sbjct  400   PLIFMCVLIPLYEYFFVPFARKITGHPAGITQLQRVGIGLVLSAVSMAVAGIVEVKR---  456

Query  1392  ARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCF  1571
                RN   A   L P  IS+FWLS QY IFGIADMFT VGLLEFFY +AP  +KS+S+ F
Sbjct  457   ---RNYALAHSPLAPGGISLFWLSFQYAIFGIADMFTLVGLLEFFYREAPAGMKSLSTSF  513

Query  1572  LWSSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFF  1748
              W S+S GYF SS+ V ++N  T  +  S  GWL G ++N+N++ LFY  L+ LS +NF 
Sbjct  514   TWLSLSFGYFLSSIFVSIINAVTAKIAPSKLGWLHGIDINQNNVNLFYFFLAILSCLNFA  573

Query  1749  VYLFVSKRYKYRQQ  1790
              YL+ +  YKY+ +
Sbjct  574   NYLYWASWYKYKPE  587



>ref|XP_011007486.1| PREDICTED: protein NRT1/ PTR FAMILY 4.3-like isoform X1 [Populus 
euphratica]
Length=609

 Score =   394 bits (1013),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 248/573 (43%), Positives = 354/573 (62%), Gaps = 19/573 (3%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             +  VDWRGRT  K KHGG+ A++F+LG+  FE M    +G  L+TY    M+  L+ +AN
Sbjct  23    ETSVDWRGRTC-KSKHGGMAAAVFVLGLQAFEMMGIAAVGNNLITYALNDMHFPLSKSAN  81

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G F  +LI  ++E  G  LL++QAH  +L+PP C+ 
Sbjct  82    IVTNFVGTVFLLSLLGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLPQLRPPSCDM  141

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +     C E  G  A I F+ALY VA+GS  +K  + SHGADQF ++D K+  ++S++FN
Sbjct  142   VSDGVDCVEAKGYKALIFFLALYLVALGSGCLKPNIISHGADQFKKEDPKQSKKLSTYFN  201

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                   C+G  ++LT+ VW+  H G D GF  S  AM  G I    G   YR    +G S
Sbjct  202   VAYFAFCIGELIALTVLVWVQTHSGMDVGFGVSAAAMAVGLICLISGSFSYRNKPPKG-S  260

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKD----KEAVTICAEFLPHTDKYRFLDKA  983
               T   QVFVAAI  RK   P +   L+    +      A +  A  L HT+K+RFLDKA
Sbjct  261   IFTPFAQVFVAAITKRKQISPSNVQMLHGCHNNLLSHVPATSTDASNLLHTEKFRFLDKA  320

Query  984   AI--QTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTM  1157
              I  Q   DE  + WR+C V QVE  KIL++++P+F CT+I    LAQLQTFS+QQGS M
Sbjct  321   CIRVQDGSDESESTWRLCTVAQVEQVKILISVIPIFSCTIIFNTILAQLQTFSVQQGSAM  380

Query  1158  DLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlll  1337
             +  ITKSF+I P+SL  +P + LIF++PLY+  FVP  RR+TG  +GITPL RV  GL +
Sbjct  381   NTRITKSFKIPPASLQSIPYIMLIFVVPLYETAFVPFARRITGKDSGITPLQRVGAGLFI  440

Query  1338  sslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLL  1517
             ++ SM +AA++E KR+  A +              +S+FW++ Q+ IFG+++MFT VGL+
Sbjct  441   ATFSMVSAAVIERKRRTSALDYQE----------TLSIFWIAPQFLIFGLSEMFTAVGLI  490

Query  1518  EFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESGGWLGGNNVNRNH  1697
             EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T   + SGGWL  N++N++ 
Sbjct  491   EFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITS-SSSSGGWLSDNDLNKDK  549

Query  1698  LELFYALLSGLSFVNFFVYLFVSKRYKYRQQIG  1796
             L+LFY LL+ LS +NFF YLF SK Y Y   + 
Sbjct  550   LDLFYWLLAVLSLINFFNYLFWSKWYSYNPSLS  582



>ref|XP_010461172.1| PREDICTED: protein NRT1/ PTR FAMILY 4.4-like isoform X1 [Camelina 
sativa]
Length=643

 Score =   395 bits (1014),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 249/563 (44%), Positives = 348/563 (62%), Gaps = 23/563 (4%)
 Frame = +3

Query  96    DGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAAN  275
             D  VD RGR  R  KHGG RA++F+LG+  FE MA   +G  L+TY+   M+  L+ +AN
Sbjct  67    DLCVDSRGRPCRPSKHGGTRAALFVLGLQAFEMMAIAAVGNNLITYVFNEMHFPLSKSAN  126

Query  276   HVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNP  455
              VTNF G  ++L+++   L+D+Y+G FR +L+   IE  G  LLA+QAH  +L+PP C+ 
Sbjct  127   LVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGIIEIFGFILLAVQAHLPELRPPECD-  185

Query  456   LDKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFN  635
             +     C E  G  A  L+ AL  VA+GS  +K  + SHGADQF  KD +   ++SSFFN
Sbjct  186   MKGTIHCLEANGYKAVTLYAALCLVALGSGCLKPNIISHGADQFQRKDLR---KLSSFFN  242

Query  636   WLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSS  815
                    +G  ++LTL VW+  + G D GF  S   M  G I    G  FYR     G S
Sbjct  243   AAYFAFSMGQLIALTLLVWVQTYSGMDVGFGVSAAVMAAGLISLVAGTNFYRNKPSCG-S  301

Query  816   AITQIIQVFVAAIHNRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQT  995
               T I QVFVAAI  RK   P +   L++ S D   V    + L HT+K+RFLDKA I+T
Sbjct  302   IFTPIAQVFVAAITKRKQICPSNPNMLHQPSMDLVRV----KPLLHTNKFRFLDKACIKT  357

Query  996   SWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITK  1175
                   +PWR+C   QV   KILL+++P+F CT+I    LAQLQTFS+QQGS+M+ +ITK
Sbjct  358   QGKVMESPWRLCTTEQVHQVKILLSVIPIFACTIIFNTILAQLQTFSVQQGSSMNTHITK  417

Query  1176  sfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsma  1355
             +FQI P+SL  +P + LIF +PLY+  FVP  R++ G  +GI+PL R+  GL L++ SM 
Sbjct  418   TFQIPPASLQAIPYIILIFFVPLYETFFVPLARKVMGNDSGISPLQRIGAGLFLATFSMV  477

Query  1356  aaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQ  1535
             AAA++E KR++   E+N          + +S+FW++ Q+ IFG+++MFT VGL+EFFY Q
Sbjct  478   AAALVEKKRRESFLEQN----------VTLSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQ  527

Query  1536  APKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG---GWLGGNNVNRNHLEL  1706
             + + ++S  +   + S S G++ SSVLV  VN  T     SG   GWLG N++N++ L+ 
Sbjct  528   SSQSMQSFLTALTYCSYSFGFYLSSVLVSAVNRVTSS-NRSGTREGWLGDNDLNKDRLDH  586

Query  1707  FYALLSGLSFVNFFVYLFVSKRY  1775
             FY LL+ LSF+NFF YLF S+ Y
Sbjct  587   FYWLLASLSFINFFNYLFWSRWY  609



>ref|XP_006441808.1| hypothetical protein CICLE_v10019334mg [Citrus clementina]
 gb|ESR55048.1| hypothetical protein CICLE_v10019334mg [Citrus clementina]
Length=614

 Score =   394 bits (1011),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 246/585 (42%), Positives = 361/585 (62%), Gaps = 23/585 (4%)
 Frame = +3

Query  69    NSQEKYELIDGKVDWRGRTARKDKHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVM  248
             +S    ++ +  VDWRGR  + +KHGG+ A++F+LG+  FE  A   +G  L+TY+   M
Sbjct  13    DSMLSLDVDETAVDWRGRPCKANKHGGMTAAVFVLGLQAFEMTAIAAVGNNLITYVFNEM  72

Query  249   NVNLADAANHVTNFAGATYILTIVAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYA  428
             +  L+ +AN VTNF G  ++L++    L+D+Y+G F  +LI  ++E  G  LL++QAH  
Sbjct  73    HFPLSKSANIVTNFIGTVFLLSLFGGFLSDSYLGSFWTMLIFGFVELSGFILLSVQAHLP  132

Query  429   KLKPPPCNPL---DKAEKCEEVAGRNAAILFVALYTVAMGSAGVKAAVPSHGADQFDEKD  599
             +L+P PCN L   D  + C+E  G  A IL++ALY VA+GS  +K  + SHGADQF    
Sbjct  133   QLRPSPCNMLTDTDGTQNCQEAKGYKALILYLALYLVALGSGCLKPNIISHGADQF---K  189

Query  600   RKEGSEMSSFFNWLLLGVCVGGAVSLTLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGL  779
             ++E  ++S++FN      C+G  ++LTL VW+  H G D GF  S  AM  G I    G+
Sbjct  190   KQESKKLSTYFNVAYFAFCMGQLIALTLLVWVQTHSGMDIGFGVSAAAMAVGLISLIFGI  249

Query  780   PFYRVYVIQGSSAITQIIQVFVAAIHNRKLQLPEDS----GELYEISKDKE-AVTICAEF  944
               YR    +G S  T I QVFVAAI  RK   P ++    G    I+ ++  A +     
Sbjct  250   FVYRNKSPRG-SIFTPIAQVFVAAITKRKQICPSNTYILHGSQTNIATNRVLATSPNNRN  308

Query  945   LPHTDKYRFLDKAAIQTSWDEEPNPWRVCRVTQVENAKILLNLVPVFLCTVIMTLCLAQL  1124
             L HT+K+RFLDKA I+       +PW++C VTQVE  KI++++VP+F CT+I    LAQL
Sbjct  309   LLHTEKFRFLDKACIKVQDGANESPWKLCTVTQVEQVKIIMSVVPIFACTIIFNTILAQL  368

Query  1125  QTFSIQQGSTMDLNITKsfqilpsslpflpilflifliplYDRLFVPSMRRLTGIPTGIT  1304
             QTFS+QQGS MD  IT  FQI P+SL  +P + LIF++PLY+ +FVP   + T   +GI+
Sbjct  369   QTFSVQQGSAMDNKITNRFQIPPASLQAIPYILLIFVVPLYEIVFVPVASKFTKKDSGIS  428

Query  1305  PLHRVAVGlllsslsmaaaailelKRKQVARERNMLDAIPILQPLPISVFWLSIQYFIFG  1484
             PL RV VGL +++ SM AAA++E KR+  A   N +          +S+FW++ Q+ IFG
Sbjct  429   PLQRVGVGLFVATFSMVAAALIEKKRRTAALNSNQI----------LSIFWIAPQFLIFG  478

Query  1485  IADMFTYVGLLEFFYSQAPKELKSVSSCFLWSSMSLGYFTSSVLVKVVNGATKGMTESG-  1661
             +++MFT VGL+EFFY Q+ + ++S  +   + S S G++ SS+LV +VN  T   + S  
Sbjct  479   LSEMFTAVGLIEFFYKQSLEGMQSFLTAMTYCSYSFGFYLSSLLVSLVNKITSRTSSSAH  538

Query  1662  GWLGGNNVNRNHLELFYALLSGLSFVNFFVYLFVSKRYKYRQQIG  1796
             GWL  N++N++ L+LFY LL+ LS +NFF YLF S+ Y Y   + 
Sbjct  539   GWLSDNDLNKDRLDLFYWLLAALSLINFFNYLFWSRWYSYNPSLS  583



>ref|XP_006423956.1| hypothetical protein CICLE_v10030352mg, partial [Citrus clementina]
 gb|ESR37196.1| hypothetical protein CICLE_v10030352mg, partial [Citrus clementina]
Length=566

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 228/552 (41%), Positives = 324/552 (59%), Gaps = 20/552 (4%)
 Frame = +3

Query  138   KHGGIRASIFILGIFGFENMATIVLGVTLVTYLNGVMNVNLADAANHVTNFAGATYILTI  317
             + GG RA  F+      ENM  I  G+++V Y    M+ +LA A+N +TNF G+T++L +
Sbjct  10    QKGGFRACTFVFVFSALENMGFIANGISMVLYFKNEMHFDLAGASNTLTNFFGSTFLLCL  69

Query  318   VAAVLADTYIGRFRAVLISAWIEFLGLGLLAMQAHYAKLKPPPCNPLDKAEKCEEVAGRN  497
             V   ++DT++ RF   LI   +E L L +L +QA+   L PP C       K   + G  
Sbjct  70    VGGFISDTFLSRFATCLIFGTLEVLALVMLTIQAYSKNLHPPDCG------KSSCLKGAI  123

Query  498   AAILFVALYTVAMGSAGVKAAVPSHGADQFDEKDRKEGSEMSSFFNWLLLGVCVGGAVSL  677
             AA  + +LY  + G  G +  +P+ GA QFDE D K    ++S+FN+ LL   V   V +
Sbjct  124   AAYFYGSLYLYSFGCGGNRGTLPAFGAGQFDENDPKGAKALASYFNFYLLATTVAAVVGV  183

Query  678   TLFVWLIQHKGWDWGFAASTVAMFFGGIFFTLGLPFYRVYVIQGSSAITQIIQVFVAAIH  857
             T  V++   K W  GF  S+VA F G I    G   YR+    G S + ++ QV V AI 
Sbjct  184   TGIVYVFTEKSWWLGFLVSSVANFIGLIALAAGKCLYRIQQ-PGESPLVRVAQVLVVAIK  242

Query  858   NRKLQLPEDSGELYEISKDKEAVTICAEFLPHTDKYRFLDKAAIQTSWDEEPNPWRVCRV  1037
             NRKL LP++  ELYEI++ + A T   E +PH +++R LDKAAI         PWRVC V
Sbjct  243   NRKLSLPDNPEELYEINEKERASTW--ERIPHANQFRCLDKAAIMPKDSAVAAPWRVCTV  300

Query  1038  TQVENAKILLNLVPVFLCTVIMTLCLAQLQTFSIQQGSTMDLNITKsfqilpsslpflpi  1217
             TQVE  KIL  ++P+   T++M  CLAQLQTFSI QG+ MD ++        S      +
Sbjct  301   TQVEEVKILTRMMPILASTILMNTCLAQLQTFSITQGAAMDPHLGSIKVPTSSIPVIPLL  360

Query  1218  lflifliplYDRLFVPSMRRLTGIPTGITPLHRVAVGlllsslsmaaaailelKRKQVAR  1397
                I L   Y+  FVP  R++TG P+GIT L RV +GL+LS++SM  A ++E+ R     
Sbjct  361   FMSILLPL-YEFFFVPFARKITGHPSGITQLQRVGIGLVLSAVSMTVAGLVEVIR-----  414

Query  1398  ERNMLDAIPILQPLPISVFWLSIQYFIFGIADMFTYVGLLEFFYSQAPKELKSVSSCFLW  1577
              RN  +  P   P  IS+FWLS QY IFGIADMFT++GLLEFFY +AP  +K+++S F +
Sbjct  415   -RNAFNETP---PKQISLFWLSFQYCIFGIADMFTFIGLLEFFYKEAPAGMKTLASSFTY  470

Query  1578  SSMSLGYFTSSVLVKVVNGATKGMTESG-GWLGGNNVNRNHLELFYALLSGLSFVNFFVY  1754
              S+S GYF SS  V ++N  TK +T S  GWL G ++N+N++ LFY  L+ +S +N  +Y
Sbjct  471   LSLSFGYFLSSAFVDIINAVTKRITPSKQGWLHGKDINKNNVNLFYWFLAIVSVLNLVLY  530

Query  1755  LFVSKRYKYRQQ  1790
             L+ +  YKY+ +
Sbjct  531   LYAAAWYKYKPE  542



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6150696075558