BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1187_g1_i1 len=1835 path=[1:0-1544 1546:1545-1834]

Length=1835
                                                                      Score     E

ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    337   4e-105   
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    334   4e-104   
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    332   4e-103   
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    328   1e-101   
emb|CDP00619.1|  unnamed protein product                                323   6e-100   
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    320   6e-99    
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    319   5e-98    
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    314   2e-96    Vitis vinifera
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    313   3e-96    
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    310   7e-95    
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    305   1e-93    
ref|XP_002531628.1|  conserved hypothetical protein                     306   4e-93    Ricinus communis
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    302   9e-92    
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     300   3e-91    
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    298   1e-90    
ref|XP_002311458.2|  zinc finger family protein                         297   6e-90    Populus trichocarpa [western balsam poplar]
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like          294   6e-89    
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein              292   3e-88    
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    290   2e-87    
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    290   3e-87    
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    288   2e-86    
gb|AFX73409.1|  constans-like protein 5                                 286   4e-86    
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    286   1e-85    
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    285   3e-85    
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                     282   5e-85    
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    284   9e-85    
ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...    283   1e-84    
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6                283   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    282   3e-84    
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     282   4e-84    
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    282   5e-84    
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg                281   8e-84    
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                    280   1e-83    
gb|KEH44219.1|  zinc finger constans-like protein                       280   1e-83    
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    280   2e-83    
gb|KDP29405.1|  hypothetical protein JCGZ_18326                         280   3e-83    
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    278   6e-83    
ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    277   3e-82    
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg             276   9e-82    
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    273   1e-80    
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    273   1e-80    
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    270   5e-79    
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    268   9e-79    
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg             259   2e-75    
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    256   2e-74    
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg                254   4e-74    
ref|XP_006829901.1|  hypothetical protein AMTR_s00073p00061640          253   5e-74    
gb|EPS73837.1|  hypothetical protein M569_00919                         254   6e-74    
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    255   7e-74    
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g             253   1e-73    
emb|CDO98435.1|  unnamed protein product                                253   2e-73    
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg             252   3e-73    
ref|XP_007036519.1|  Transcription factor, putative                     243   9e-70    
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    242   2e-69    Vitis vinifera
gb|AHI45077.1|  COL domain class transcription factor                   243   2e-69    
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    242   2e-69    
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                    241   3e-69    
emb|CAN73757.1|  hypothetical protein VITISV_026326                     243   3e-69    Vitis vinifera
ref|XP_002533412.1|  transcription factor, putative                     241   1e-68    Ricinus communis
ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    238   9e-68    
dbj|BAK01505.1|  predicted protein                                      238   2e-67    
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg             237   2e-67    
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829             237   2e-67    
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    238   2e-67    
ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    236   3e-67    
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    233   1e-65    
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    231   3e-65    
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    231   3e-65    
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    229   9e-65    
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    230   9e-65    
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    229   1e-64    
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    229   1e-64    
gb|AAG50803.1|AC079281_5  zinc finger protein, putative                 229   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                  229   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    229   2e-64    
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    228   6e-64    
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein              227   1e-63    
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    226   2e-63    
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16               225   9e-63    Zea mays [maize]
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                    224   2e-62    
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg             222   5e-62    
gb|EAZ00428.1|  hypothetical protein OsI_22452                          222   2e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g             221   2e-61    
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg             218   1e-60    
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    219   2e-60    
ref|NP_001140584.1|  uncharacterized protein LOC100272654               219   2e-60    Zea mays [maize]
gb|EAZ36554.1|  hypothetical protein OsJ_20892                          217   8e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    215   2e-59    
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    213   1e-58    
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                  213   1e-58    
ref|NP_001057333.2|  Os06g0264200                                       214   4e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480          213   5e-58    Sorghum bicolor [broomcorn]
dbj|BAJ87752.1|  predicted protein                                      212   2e-57    
gb|AFK37106.1|  unknown                                                 206   3e-56    
dbj|BAK04456.1|  predicted protein                                      203   4e-55    
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    203   5e-55    
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    204   1e-54    
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    200   4e-54    
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    201   9e-54    
ref|XP_009381104.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    199   2e-53    
dbj|BAD15937.1|  zinc finger protein-like                               194   4e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    192   1e-50    
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    192   2e-50    
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    186   9e-49    
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920          186   3e-48    Sorghum bicolor [broomcorn]
gb|AHI45078.1|  COL domain class transcription factor                   182   4e-47    
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    182   5e-47    
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    179   4e-46    
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg             178   9e-46    
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16               179   1e-45    
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    177   2e-45    
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16               172   1e-43    
gb|AGM20692.1|  COL6-2                                                  167   6e-42    
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    161   7e-40    
gb|KDP20116.1|  hypothetical protein JCGZ_05885                         158   9e-39    
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g             157   1e-38    
gb|KHN05568.1|  Zinc finger protein CONSTANS-LIKE 16                    150   1e-37    
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     154   2e-37    
ref|XP_003637430.1|  Zinc finger protein CONSTANS-like protein          146   3e-37    
ref|XP_008393304.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    151   3e-37    
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    153   4e-37    
gb|EMT27110.1|  hypothetical protein F775_43077                         147   6e-36    
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   8e-36    
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    149   9e-36    
ref|XP_006656860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    144   6e-35    
ref|XP_010546462.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   7e-35    
ref|XP_010543105.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   1e-34    
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    143   8e-34    
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    141   3e-33    
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   6e-33    
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g             139   8e-33    
dbj|BAH19571.1|  AT1G68520                                              136   1e-32    Arabidopsis thaliana [mouse-ear cress]
emb|CDY03851.1|  BnaC07g10760D                                          137   5e-32    
dbj|BAJ89584.1|  predicted protein                                      137   7e-32    
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   8e-32    
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   8e-32    
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                   137   9e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888669.1|  zinc finger (B-box type) family protein            137   9e-32    
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...    137   9e-32    Arabidopsis thaliana [mouse-ear cress]
gb|AAM61001.1|  putative B-box zinc finger protein                      137   1e-31    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   2e-31    
emb|CDY44890.1|  BnaA02g13920D                                          135   2e-31    
gb|AAM13173.1|  unknown protein                                         135   2e-31    Arabidopsis thaliana [mouse-ear cress]
emb|CDX81527.1|  BnaC02g18310D                                          135   3e-31    
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   4e-31    
gb|AEF12203.1|  CONSTANS-like zinc finger protein                       135   4e-31    
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   5e-31    
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   5e-31    
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg                134   6e-31    
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg             135   7e-31    
emb|CDY24402.1|  BnaCnng04690D                                          132   2e-30    
ref|XP_004135402.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    132   3e-30    
gb|KGN52081.1|  hypothetical protein Csa_5G609670                       132   3e-30    
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     131   6e-30    
emb|CDY65591.1|  BnaC05g50730D                                          130   8e-30    
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     130   2e-29    
emb|CDY67920.1|  BnaAnng25560D                                          129   3e-29    
gb|EEC73943.1|  hypothetical protein OsI_08813                          128   3e-29    Oryza sativa Indica Group [Indian rice]
gb|AEF12205.1|  CONSTANS-like zinc finger protein                       129   4e-29    
ref|NP_001048022.1|  Os02g0731700                                       127   6e-29    Oryza sativa Japonica Group [Japonica rice]
gb|KHN32039.1|  Zinc finger protein CONSTANS-LIKE 16                    129   1e-28    
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    128   1e-28    
gb|EMS53816.1|  Zinc finger protein CONSTANS-LIKE 16                    125   1e-28    
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   1e-28    
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   2e-28    
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g             126   3e-28    
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   4e-28    
gb|ACX42573.1|  CONSTANS-like zinc finger protein                       125   8e-28    Glycine max [soybeans]
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   1e-27    
ref|NP_001149548.1|  CCT motif family protein                           125   1e-27    Zea mays [maize]
gb|AEF12200.1|  CONSTANS-like zinc finger protein                       124   2e-27    
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   3e-27    
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   3e-27    
emb|CDY36106.1|  BnaA08g19420D                                          122   6e-27    
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    122   7e-27    
emb|CDY51133.1|  BnaA07g37160D                                          122   7e-27    
ref|XP_006649016.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   9e-27    
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     122   1e-26    
ref|NP_001239992.1|  uncharacterized protein LOC100802113               121   1e-26    
emb|CDX77359.1|  BnaC08g04040D                                          116   2e-26    
gb|ADK63396.1|  B-box type zinc finger protein                          119   2e-26    
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   7e-26    
gb|EEE59794.1|  hypothetical protein OsJ_12314                          115   1e-25    Oryza sativa Japonica Group [Japonica rice]
gb|ACF84125.1|  unknown                                                 115   1e-25    Zea mays [maize]
emb|CDY53119.1|  BnaCnng24470D                                          118   2e-25    
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                     117   3e-25    
gb|AGI62036.1|  CONSTANS-like 12                                        117   4e-25    
ref|NP_001051053.1|  Os03g0711100                                       117   4e-25    Oryza sativa Japonica Group [Japonica rice]
gb|ABF98510.1|  CCT motif family protein, expressed                     115   1e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420          116   1e-24    Sorghum bicolor [broomcorn]
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    115   2e-24    
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     115   2e-24    
ref|XP_004164163.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   3e-24    
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg             114   4e-24    
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   4e-24    
ref|XP_004138344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    112   5e-24    
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   6e-24    
emb|CDY07383.1|  BnaA07g24620D                                          110   1e-23    
emb|CDY04230.1|  BnaC06g25850D                                          110   1e-23    
gb|KGN63817.1|  hypothetical protein Csa_1G023050                       112   1e-23    
gb|EPS70096.1|  hypothetical protein M569_04666                         103   7e-23    
gb|AFX97569.1|  K                                                       106   9e-23    
ref|XP_004155029.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    106   1e-22    
gb|ACL53155.1|  unknown                                                 104   2e-22    Zea mays [maize]
gb|EEE59793.1|  hypothetical protein OsJ_12313                          105   2e-22    Oryza sativa Japonica Group [Japonica rice]
gb|AFX97570.1|  K                                                       105   2e-22    
gb|AFK49208.1|  unknown                                                 105   3e-22    
ref|XP_008665284.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   4e-22    
ref|XP_002887511.1|  zinc finger (B-box type) family protein            108   4e-22    
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000             109   4e-22    
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834             108   6e-22    
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                   105   4e-21    Arabidopsis thaliana [mouse-ear cress]
gb|AGI62031.1|  CONSTANS-like 7                                         103   6e-21    
ref|XP_009409258.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    104   8e-21    
dbj|BAE98863.1|  hypothetical protein                                   102   1e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769011.1|  predicted protein                                  102   1e-19    
emb|CDY09849.1|  BnaC09g43120D                                        99.4    3e-19    
ref|XP_010519196.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    100   4e-19    
emb|CDX85600.1|  BnaA02g02130D                                        98.6    4e-19    
ref|XP_001771896.1|  predicted protein                                  100   4e-19    
emb|CDX69586.1|  BnaA10g19350D                                        98.6    5e-19    
ref|XP_009121672.1|  PREDICTED: uncharacterized protein LOC103846490  98.6    5e-19    
ref|XP_010483220.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  99.8    6e-19    
ref|XP_010451861.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  99.8    8e-19    
ref|XP_010443395.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  99.4    1e-18    
ref|XP_006286526.1|  hypothetical protein CARUB_v10001375mg           97.4    1e-18    
gb|KFK25676.1|  hypothetical protein AALP_AA8G144900                  97.4    1e-18    
emb|CDX91067.1|  BnaC02g05300D                                        96.7    2e-18    
ref|XP_002864503.1|  hypothetical protein ARALYDRAFT_495815           97.8    2e-18    
ref|XP_006399947.1|  hypothetical protein EUTSA_v10014044mg           96.7    2e-18    
ref|XP_006280489.1|  hypothetical protein CARUB_v10026429mg           97.8    2e-18    
gb|EMS59726.1|  Zinc finger protein CONSTANS-LIKE 6                   93.6    2e-18    
ref|XP_008797174.1|  PREDICTED: uncharacterized protein LOC103712429  95.1    3e-18    
ref|XP_007140857.1|  hypothetical protein PHAVU_008G147400g           96.3    3e-18    
ref|NP_568852.2|  chloroplast import apparatus 2 protein              97.8    3e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873661.1|  hypothetical protein ARALYDRAFT_488277           96.3    3e-18    
gb|AAM63153.1|  unknown                                               95.5    4e-18    Arabidopsis thaliana [mouse-ear cress]
gb|KHN16247.1|  Zinc finger protein CONSTANS-LIKE 16                  90.9    4e-18    
ref|NP_568300.1|  CCT motif family protein                            95.5    5e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125969.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.4    5e-18    
ref|XP_010492239.1|  PREDICTED: uncharacterized protein LOC104769672  95.1    8e-18    
ref|XP_009120241.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  95.9    8e-18    
emb|CDY38274.1|  BnaA10g11220D                                        95.5    9e-18    
ref|XP_010938521.1|  PREDICTED: uncharacterized protein LOC105057575  93.2    9e-18    
ref|XP_010248760.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   94.7    1e-17    
ref|XP_010453557.1|  PREDICTED: uncharacterized protein LOC104735456  94.7    1e-17    
gb|KDP46366.1|  hypothetical protein JCGZ_10206                       94.4    1e-17    
ref|XP_010539413.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  95.9    1e-17    
ref|XP_010420071.1|  PREDICTED: uncharacterized protein LOC104705709  94.4    1e-17    
ref|XP_001765504.1|  predicted protein                                95.9    2e-17    
gb|KHG21982.1|  Zinc finger CONSTANS-LIKE 7 -like protein             93.2    3e-17    
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.7    3e-17    
ref|XP_009420122.1|  PREDICTED: uncharacterized protein LOC103999941  92.8    3e-17    
emb|CDY52734.1|  BnaC09g53340D                                        93.6    3e-17    
ref|XP_006401232.1|  hypothetical protein EUTSA_v10013517mg           94.0    4e-17    
ref|XP_008799931.1|  PREDICTED: uncharacterized protein LOC103714457  91.7    5e-17    
gb|KFK27272.1|  hypothetical protein AALP_AA8G360600                  93.6    6e-17    
emb|CDY47926.1|  BnaA02g08300D                                        92.4    8e-17    
emb|CDX78575.1|  BnaA03g04870D                                        91.3    9e-17    
gb|EPS70097.1|  hypothetical protein M569_04667                       86.3    1e-16    
ref|XP_009354295.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    1e-16    
ref|XP_009593986.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    1e-16    
ref|XP_003553886.1|  PREDICTED: uncharacterized protein LOC100811815  91.7    1e-16    
ref|XP_008354841.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    1e-16    
ref|XP_004296491.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    1e-16    
gb|EMT01944.1|  hypothetical protein F775_21198                       91.3    1e-16    
emb|CDX70561.1|  BnaC03g06450D                                        88.2    1e-16    
ref|XP_002867585.1|  hypothetical protein ARALYDRAFT_354188           92.0    1e-16    
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           90.9    1e-16    
emb|CDY42238.1|  BnaC02g11770D                                        91.7    1e-16    
ref|XP_009383142.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.9    2e-16    
ref|XP_009126853.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.7    2e-16    
ref|XP_010932278.1|  PREDICTED: uncharacterized protein LOC105052987  89.7    2e-16    
ref|XP_008230480.1|  PREDICTED: uncharacterized protein LOC103329755  90.1    2e-16    
emb|CBI15893.3|  unnamed protein product                              85.5    3e-16    
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  89.7    3e-16    
ref|XP_006283882.1|  hypothetical protein CARUB_v10004999mg           90.5    4e-16    
ref|NP_567737.1|  CIA2-like transcription factor                      90.5    4e-16    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216840.1|  hypothetical protein PRUPE_ppa022528mg           89.4    4e-16    
gb|KDP41094.1|  hypothetical protein JCGZ_03224                       90.5    5e-16    
ref|XP_010685899.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   87.8    6e-16    
ref|XP_010479339.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    6e-16    
ref|XP_010479340.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    7e-16    
ref|XP_009349161.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    7e-16    
ref|XP_011094103.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    7e-16    
ref|XP_006447220.1|  hypothetical protein CICLE_v10015864mg           89.0    7e-16    
ref|XP_009590839.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.0    7e-16    
ref|XP_010448341.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    7e-16    
ref|XP_002274679.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   87.4    7e-16    
ref|XP_009131400.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    8e-16    
ref|XP_004142772.1|  PREDICTED: uncharacterized protein LOC101217596  88.6    8e-16    
ref|XP_004156700.1|  PREDICTED: uncharacterized LOC101217596          88.6    8e-16    
gb|KDP45740.1|  hypothetical protein JCGZ_17347                       87.8    8e-16    
ref|XP_009801175.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    9e-16    
ref|XP_003547688.2|  PREDICTED: DNA topoisomerase 1-like isoform X1   88.6    1e-15    
gb|KDO45660.1|  hypothetical protein CISIN_1g017778mg                 88.6    1e-15    
ref|XP_004294775.1|  PREDICTED: uncharacterized protein LOC101310098  87.4    1e-15    
ref|XP_001752335.1|  predicted protein                                82.8    1e-15    
ref|XP_010273555.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.0    1e-15    
ref|XP_008384739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.7    2e-15    
ref|XP_007225066.1|  hypothetical protein PRUPE_ppa018578mg           89.4    2e-15    
ref|XP_008223874.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.4    2e-15    
ref|XP_004507897.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.6    2e-15    
ref|XP_002268929.1|  PREDICTED: uncharacterized protein LOC100254358  87.4    2e-15    
ref|XP_008458850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   87.8    2e-15    
emb|CBI17712.3|  unnamed protein product                              87.4    2e-15    
ref|XP_009369559.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    2e-15    
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    2e-15    
ref|XP_006425148.1|  hypothetical protein CICLE_v10029146mg           86.3    3e-15    
ref|XP_006453246.1|  hypothetical protein CICLE_v10008308mg           88.6    3e-15    
ref|XP_004231827.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  87.0    3e-15    
ref|XP_006362450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.6    3e-15    
gb|EMS51379.1|  Zinc finger protein CONSTANS-LIKE 6                   86.3    3e-15    
ref|XP_010111554.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           88.2    3e-15    
emb|CAN75558.1|  hypothetical protein VITISV_028190                   86.7    3e-15    
ref|XP_010433566.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    3e-15    
ref|XP_009359939.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    4e-15    
ref|XP_007206389.1|  hypothetical protein PRUPE_ppa018053mg           85.9    4e-15    
ref|XP_004242804.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    4e-15    
ref|XP_010438814.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    4e-15    
ref|XP_009354286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    4e-15    
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757           86.7    4e-15    
ref|XP_011003377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   85.1    4e-15    
gb|EYU38741.1|  hypothetical protein MIMGU_mgv1a008071mg              87.4    4e-15    
ref|XP_008354834.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    4e-15    
ref|XP_002298500.1|  CONSTANS-like family protein                     85.1    4e-15    
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    4e-15    
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    4e-15    
ref|XP_009340847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    5e-15    
ref|XP_004499509.1|  PREDICTED: uncharacterized protein LOC101500...  86.3    5e-15    
ref|XP_002268213.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.0    5e-15    
emb|CAN72725.1|  hypothetical protein VITISV_015092                   87.0    5e-15    
ref|XP_003615824.1|  Zinc finger protein CONSTANS-like protein        84.7    6e-15    
emb|CDX89377.1|  BnaA01g15160D                                        86.7    6e-15    
ref|XP_010690879.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    7e-15    
ref|XP_007031686.1|  CCT motif family protein, putative               86.3    7e-15    
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg           85.9    7e-15    
emb|CDX94392.1|  BnaC01g17920D                                        86.7    8e-15    
ref|XP_011097346.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    8e-15    
emb|CBI40095.3|  unnamed protein product                              86.7    8e-15    
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg           85.5    8e-15    
ref|XP_008233500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   84.7    9e-15    
ref|XP_010927568.1|  PREDICTED: uncharacterized protein LOC105049568  84.3    9e-15    
emb|CDP15779.1|  unnamed protein product                              87.0    9e-15    
ref|XP_010524282.1|  PREDICTED: uncharacterized protein LOC104802388  85.9    1e-14    
ref|XP_008799492.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  86.7    1e-14    
ref|XP_010046933.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    1e-14    
ref|XP_002892377.1|  predicted protein                                83.6    1e-14    
gb|EYU18216.1|  hypothetical protein MIMGU_mgv1a007342mg              86.3    1e-14    
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   85.1    1e-14    
dbj|BAC42037.1|  putative B-box zinc finger protein                   84.7    1e-14    
ref|XP_006599067.1|  PREDICTED: DNA topoisomerase 1-like isoform X2   85.5    1e-14    
ref|XP_011010948.1|  PREDICTED: uncharacterized protein LOC105115687  84.7    1e-14    
gb|KHN40106.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                84.0    1e-14    
emb|CAB87776.1|  putative protein                                     85.1    1e-14    
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                 84.7    1e-14    
ref|XP_008388630.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    1e-14    
ref|XP_003544900.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.0    2e-14    
emb|CDP09243.1|  unnamed protein product                              81.6    2e-14    
ref|XP_007016977.1|  CCT motif family protein isoform 2               83.6    2e-14    
gb|AAF69700.1|AC016041_5  F27J15.10                                   84.3    2e-14    
ref|XP_006574444.1|  PREDICTED: uncharacterized protein LOC100803...  83.2    2e-14    
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8              84.3    2e-14    
ref|XP_010111661.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           84.7    2e-14    
ref|XP_001759088.1|  predicted protein                                86.3    2e-14    
ref|XP_001769217.1|  predicted protein                                86.3    2e-14    
ref|XP_009139739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    3e-14    
emb|CDY06672.1|  BnaA10g04510D                                        82.4    3e-14    
ref|XP_006413244.1|  hypothetical protein EUTSA_v10025322mg           85.1    3e-14    
ref|XP_004490653.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    3e-14    
ref|XP_009119001.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    3e-14    
ref|NP_563778.1|  CCT motif family protein                            82.0    4e-14    
ref|XP_006417850.1|  hypothetical protein EUTSA_v10008808mg           82.0    4e-14    
ref|XP_010457868.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    4e-14    
ref|XP_010929359.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  84.7    5e-14    
emb|CDY66177.1|  BnaC08g46470D                                        81.6    5e-14    
ref|XP_001754240.1|  predicted protein                                78.2    5e-14    
ref|XP_010487064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    5e-14    
ref|XP_006488582.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.4    5e-14    
ref|NP_851201.1|  chloroplast import apparatus 2 protein              84.3    5e-14    
ref|XP_004305701.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    5e-14    
ref|XP_008677196.1|  PREDICTED: LOC100281423 isoform X1               84.7    5e-14    
ref|XP_006338638.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.8    6e-14    
ref|NP_001147813.1|  LOC100281423                                     84.3    7e-14    
ref|XP_002324691.2|  hypothetical protein POPTR_0018s13890g           84.3    8e-14    
ref|XP_008645243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    8e-14    
ref|XP_007142158.1|  hypothetical protein PHAVU_008G257300g           81.3    8e-14    
ref|XP_011017668.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.0    9e-14    
ref|XP_009110963.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.9    9e-14    
ref|XP_003549301.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.2    1e-13    
ref|XP_003622266.1|  CONSTANS-like zinc finger protein                82.4    1e-13    
ref|XP_010927244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.2    1e-13    
ref|XP_002993117.1|  hypothetical protein SELMODRAFT_136568           77.4    1e-13    
ref|XP_007014423.1|  Chloroplast import apparatus 2, putative iso...  82.8    1e-13    
ref|XP_001769056.1|  predicted protein                                77.0    1e-13    
ref|NP_001169082.1|  uncharacterized protein LOC100382924             83.2    2e-13    
ref|XP_009403041.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.8    2e-13    
gb|KFK43009.1|  hypothetical protein AALP_AA1G067400                  80.1    2e-13    
ref|XP_006850881.1|  hypothetical protein AMTR_s00025p00156240        83.2    2e-13    
ref|XP_002308112.2|  hypothetical protein POPTR_0006s07490g           83.2    2e-13    
ref|XP_009120242.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.8    2e-13    
ref|XP_009371730.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   82.0    2e-13    
ref|XP_001751672.1|  predicted protein                                83.2    2e-13    
ref|XP_002520096.1|  hypothetical protein RCOM_1709850                76.6    2e-13    
ref|XP_011024893.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    2e-13    
ref|XP_010029065.1|  PREDICTED: uncharacterized protein LOC104419187  81.6    2e-13    
ref|XP_009370323.1|  PREDICTED: uncharacterized protein LOC103959692  81.6    2e-13    
ref|XP_008363941.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    3e-13    
ref|XP_002964550.1|  hypothetical protein SELMODRAFT_38981            76.3    3e-13    
ref|XP_010557193.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   79.3    3e-13    
ref|XP_008379178.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   80.9    4e-13    
gb|KHM99279.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                78.6    4e-13    
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           79.7    5e-13    
emb|CDY10244.1|  BnaC05g04870D                                        78.6    5e-13    
ref|XP_001776067.1|  predicted protein                                75.5    5e-13    
gb|KGN61175.1|  hypothetical protein Csa_2G061540                     81.3    5e-13    
gb|ABF00989.1|  putative stress resistance-related protein            81.6    6e-13    
ref|XP_003543009.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.9    6e-13    
ref|XP_008451201.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.3    7e-13    
ref|XP_009126854.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.5    8e-13    
ref|XP_006401233.1|  hypothetical protein EUTSA_v10013517mg           80.9    9e-13    
ref|XP_011020038.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.9    9e-13    
ref|XP_009137564.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.1    1e-12    
ref|XP_002451540.1|  hypothetical protein SORBIDRAFT_04g003470        80.5    1e-12    
ref|XP_010690870.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.5    1e-12    
emb|CDX92740.1|  BnaC07g39980D                                        80.1    1e-12    
ref|NP_849445.1|  CIA2-like transcription factor                      80.1    1e-12    
ref|XP_007154713.1|  hypothetical protein PHAVU_003G141200g           79.7    1e-12    
ref|XP_006646882.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.1    2e-12    
ref|XP_010264549.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   77.8    2e-12    
ref|XP_008811451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    2e-12    
ref|XP_011098790.1|  PREDICTED: uncharacterized protein LOC105177...  78.2    2e-12    
gb|KHN46121.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                76.6    3e-12    
ref|XP_009410222.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    3e-12    
emb|CDY42769.1|  BnaA03g47700D                                        76.6    3e-12    
ref|XP_010927243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.2    5e-12    
ref|XP_002526951.1|  hypothetical protein RCOM_0531220                76.6    5e-12    
gb|KHN27582.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                75.5    7e-12    
emb|CAB39664.1|  putative protein                                     77.4    8e-12    
gb|KDO45661.1|  hypothetical protein CISIN_1g017778mg                 76.6    1e-11    
emb|CDP16632.1|  unnamed protein product                              76.6    1e-11    
dbj|BAJ92256.1|  predicted protein                                    77.0    1e-11    
ref|XP_002518229.1|  CIL, putative                                    76.6    2e-11    
ref|XP_004499508.1|  PREDICTED: uncharacterized protein LOC101500...  75.5    2e-11    
gb|KDO67019.1|  hypothetical protein CISIN_1g025320mg                 73.6    4e-11    
ref|XP_006425147.1|  hypothetical protein CICLE_v10029146mg           73.6    4e-11    
gb|KDO61917.1|  hypothetical protein CISIN_1g0135002mg                75.5    4e-11    
ref|XP_006453244.1|  hypothetical protein CICLE_v10008308mg           75.5    4e-11    
gb|KDO61918.1|  hypothetical protein CISIN_1g0135002mg                75.5    4e-11    
ref|XP_006453248.1|  hypothetical protein CICLE_v10008308mg           75.1    5e-11    
gb|EYU34766.1|  hypothetical protein MIMGU_mgv1a008504mg              74.3    7e-11    
dbj|BAK01784.1|  predicted protein                                    73.6    7e-11    
ref|XP_008811450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  74.7    8e-11    
ref|XP_010487055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  72.0    9e-11    
ref|XP_006362451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  74.3    9e-11    
ref|XP_011097348.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  73.2    1e-10    
ref|XP_006596439.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.4    1e-10    
ref|XP_010323337.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.9    1e-10    
ref|XP_009410221.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.9    1e-10    
ref|XP_010236261.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.9    1e-10    
gb|EMT29986.1|  hypothetical protein F775_13638                       72.0    2e-10    
ref|XP_007016976.1|  CCT motif family protein isoform 1               71.6    2e-10    
ref|XP_010099464.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           71.2    2e-10    
ref|XP_004304686.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  72.4    3e-10    
ref|XP_004951711.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  71.6    5e-10    
ref|XP_001758440.1|  predicted protein                                72.0    7e-10    
dbj|BAJ85986.1|  predicted protein                                    70.1    7e-10    
ref|XP_004490652.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.1    7e-10    
ref|XP_007142159.1|  hypothetical protein PHAVU_008G257300g           68.9    9e-10    
gb|EPS64862.1|  hypothetical protein M569_09916                       66.2    1e-09    
gb|EMT06010.1|  hypothetical protein F775_08552                       70.5    2e-09    
ref|XP_006305953.1|  hypothetical protein CARUB_v10011200mg           67.8    2e-09    
ref|XP_007014424.1|  Chloroplast import apparatus 2, putative iso...  69.7    2e-09    
dbj|BAD36814.1|  zinc finger protein-like                             66.2    3e-09    
ref|XP_007154800.1|  hypothetical protein PHAVU_003G149000g           69.3    3e-09    
ref|NP_001045888.1|  Os02g0148000                                     69.7    3e-09    
gb|EEC84137.1|  hypothetical protein OsI_30489                        65.9    3e-09    
gb|ACZ67162.1|  GATA-4/5/6 transcription factor                       65.9    3e-09    
gb|ABG57263.1|  CONSTANS-like 1                                       68.6    4e-09    
gb|KHG01643.1|  chloroplast import apparatus 2 -like protein          69.3    4e-09    
ref|XP_008804437.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  68.9    4e-09    
ref|XP_004149511.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.9    6e-09    
ref|XP_007154712.1|  hypothetical protein PHAVU_003G141200g           68.6    6e-09    
ref|XP_010048577.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.6    6e-09    
dbj|BAJ53164.1|  JHL10I11.10                                          68.2    6e-09    
gb|ADO61394.1|  CONSTANS-like 1                                       65.5    7e-09    
gb|ADO61370.1|  CONSTANS-like 1                                       65.5    7e-09    
gb|ADO61323.1|  CONSTANS-like 1                                       65.5    7e-09    
gb|ADO61376.1|  CONSTANS-like 1                                       65.5    8e-09    
gb|ADO61359.1|  CONSTANS-like 1                                       65.5    8e-09    
gb|ADO61358.1|  CONSTANS-like 1                                       65.5    8e-09    
gb|ADO61362.1|  CONSTANS-like 1                                       65.5    8e-09    
gb|ADO61292.1|  CONSTANS-like 1                                       65.5    8e-09    
gb|ADO61364.1|  CONSTANS-like 1                                       65.1    8e-09    
gb|ADO61280.1|  CONSTANS-like 1                                       65.1    8e-09    
gb|ADO61298.1|  CONSTANS-like 1                                       65.1    8e-09    
gb|ADO61340.1|  CONSTANS-like 1                                       65.1    8e-09    
gb|ADO61318.1|  CONSTANS-like 1                                       65.1    8e-09    
gb|ACZ67160.1|  GATA-4/5/6 transcription factor                       64.7    8e-09    
gb|ADO61312.1|  CONSTANS-like 1                                       65.1    9e-09    



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   337 bits (863),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 227/491 (46%), Positives = 267/491 (54%), Gaps = 97/491 (20%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT---  462
             AM GK     RACD CI KRARWYC ADDAFLCQ CDSSVHSANPLARRH RV+LKT   
Sbjct  10    AMGGK---TTRACDNCIRKRARWYCPADDAFLCQNCDSSVHSANPLARRHERVRLKTSPL  66

Query  463   --------LSNIEP------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHD-------  579
                       N+E       PSWHRGFTRK RTPR  +GR  + +++     +       
Sbjct  67    KESSPDENFPNLESPVSVSLPSWHRGFTRKARTPR--NGRKVSKSTEEEEEEEEEEEEEV  124

Query  580   VVKTPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAA  759
             ++K P+HL    VPE+ SDEN    DE E+Q LLYRVPIFDP VA++CT+    D     
Sbjct  125   ILKNPIHL----VPEILSDENSL--DENEEQ-LLYRVPIFDPFVAELCTSATRNDQIENV  177

Query  760   AAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEE  939
                 ++              D  +            EMELAEFAADVESLLGKGL+DE  
Sbjct  178   QTATETDPEFKLESKEMHKHDICNDDLNTFHGMLPSEMELAEFAADVESLLGKGLEDE--  235

Query  940   SSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAAN  1119
              SFDMEGLG LGG N EE      M  + +                     +D++ M   
Sbjct  236   -SFDMEGLGLLGGCNKEENSMECSMVSNEK------------------VKIEDEVVMDTT  276

Query  1120  ANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMR--------------NK  1257
                H    +    DT E K DYD    SP N   E+    + M+               K
Sbjct  277   TTSHDIDING---DTFEFKIDYD----SPININGEDEVGEVVMKINGEDGVVGDGNYNEK  329

Query  1258  STILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVG  1437
               ILLNLDYE+V+ AW+DQR PW  G+RPE++S+  WPDC+       GTIH        
Sbjct  330   KKILLNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCM----GNCGTIHP-------  378

Query  1438  DMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  1617
               GI  G   + D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK
Sbjct  379   -YGIMNGHTTMIDR---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  434

Query  1618  RA----NFPLL  1638
             R+    N+PLL
Sbjct  435   RSNLVPNYPLL  445



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score =   334 bits (857),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 228/480 (48%), Positives = 267/480 (56%), Gaps = 86/480 (18%)
 Frame = +1

Query  289   GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT--  462
              AM GK     RACD CI KRARWYC ADDAFLCQ CD+SVHSANPLARRH RV+LKT  
Sbjct  9     SAMGGK---TTRACDNCIKKRARWYCPADDAFLCQNCDASVHSANPLARRHERVRLKTSS  65

Query  463   ----------------------LSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHH  576
                                   +S++  PSWHRGFTRK RTPR  HGR     SK     
Sbjct  66    LKQPSSSSSSDDYFPDLESPLSISSVSVPSWHRGFTRKVRTPR--HGR---KASKSAGDG  120

Query  577   DVV-KTPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLN-----I  738
             DV+ + P+HL    VPE+ SDEN SHD+ +E+Q LLYRVPI DP VA + ++       +
Sbjct  121   DVIQRNPIHL----VPEILSDEN-SHDENEEEQ-LLYRVPILDPFVAQLYSSATRNNHEM  174

Query  739   TDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGK  918
              + +A AAA   S+          ++ D  +            EMELAEFAADVESLLGK
Sbjct  175   VESNATAAADADSEFKLESKEMMLQD-DICNVDLNRFHEMLPSEMELAEFAADVESLLGK  233

Query  919   GLDDEEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadd  1098
             GLDDE   SFDMEGLG LG  N EE      ME+S      ++  E+             
Sbjct  234   GLDDE---SFDMEGLGLLGVCNKEENS----MEYS------MISHEKVKIEDEGEIEVVR  280

Query  1099  dIFMAANANHHYTSSS---SLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTIL  1269
                 A   +H Y  +     +  DT E KFD D    SP N   E+   +    NK  IL
Sbjct  281   KTISATTHDHQYNHTHHDIDINEDTFEFKFDCD----SPMNIIGEDEVIMKD-ENKKKIL  335

Query  1270  LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGI  1449
             LNLDYE V+ AW+DQR PW  G+RPE++S+  WP C+              Y     MGI
Sbjct  336   LNLDYEGVLTAWADQRSPWTNGERPELDSNDSWPHCM------------GNY-----MGI  378

Query  1450  TFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                   I D    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR NF
Sbjct  379   MNENVTIVDR---GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF  435



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score =   332 bits (850),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 227/485 (47%), Positives = 265/485 (55%), Gaps = 84/485 (17%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-  468
             AM GK     RACD CI KRARWYC ADDAFLCQ CDSSVHSANPLARRH RV+LKT S 
Sbjct  10    AMGGK---TVRACDNCIRKRARWYCPADDAFLCQNCDSSVHSANPLARRHERVRLKTSSL  66

Query  469   ----------NIEPPS----------WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVK  588
                       N+E P           WHRGFTRK RTPR+   + + +  +      ++K
Sbjct  67    KESSPDENFPNLESPVSVSVSVSVPSWHRGFTRKARTPRNGR-KVSKSTEEEEEEEVILK  125

Query  589   TPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAF  768
              P+HL    VPE+ SDEN    DE E+QLL YRVPIFDP VA++ T+    D        
Sbjct  126   NPIHL----VPEILSDENSL--DENEEQLL-YRVPIFDPFVAELYTSATRNDRMENVQTA  178

Query  769   NQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSF  948
               S+           + +  +            EMELAEFAADVE+LLGKGLDDE   SF
Sbjct  179   ADSEFKPESKETLQHDDNICNGDLNRFHGMLPSEMELAEFAADVENLLGKGLDDE---SF  235

Query  949   DMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANH  1128
             DMEGLG LGG N EE      M            V   +      E   D++ M     +
Sbjct  236   DMEGLGLLGGCNKEENSMECSM------------VSIHEKVKIEDEGEGDEVVMDTTTTN  283

Query  1129  HYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMR-----------NKSTILLN  1275
             H    +    DT E KFDYD    SP N    +    + M+            K  ILLN
Sbjct  284   HDIDING---DTFEFKFDYD----SPMNINGGDEVGEVVMKINGEDGDGNYNEKKKILLN  336

Query  1276  LDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITF  1455
             LDYE+V+ AW+DQR PW  G+RPE++S+  WPDC+       GTIH          GI  
Sbjct  337   LDYESVLTAWADQRSPWTNGERPELDSNDCWPDCM----GNCGTIHP--------YGIMN  384

Query  1456  GQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA----  1623
             G   I D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR+    
Sbjct  385   GHTTIID---RGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNLVP  441

Query  1624  NFPLL  1638
             N+PLL
Sbjct  442   NYPLL  446



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 266/471 (56%), Gaps = 75/471 (16%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
             +ARACD C+ KRARWYC ADDAFLCQ+CDSSVHSANPLARRH RV+LKT S         
Sbjct  16    SARACDNCVKKRARWYCTADDAFLCQSCDSSVHSANPLARRHERVRLKTASTKSSDDESR  75

Query  469   ---NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE  639
                 +  PSWH+GFTRK RTPR    ++N  +S  +V    +  PLHL    VPE+CS++
Sbjct  76    SGLQVSVPSWHQGFTRKARTPRQK--KHNRLSSDELVSG--ISNPLHL----VPEVCSED  127

Query  640   NYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNW  819
             N SH++ +E   LLYRVPIFDP VA++  + N +  +AA +  N  +     G       
Sbjct  128   N-SHEENEEQ--LLYRVPIFDPSVAELRNSANSS--EAANSIQNGGETTHVSGPELKPAL  182

Query  820   DGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEK  999
             +  S   +        EM+LAEFAADVESLLGKGL++E   SFDMEGLG L  +   +E 
Sbjct  183   NDFSQEMSHLQGFLPSEMDLAEFAADVESLLGKGLENE---SFDMEGLGLLDCDGKVKES  239

Query  1000  ASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSS-SSLCFDTLELK  1176
                 +   R   +                       +   ANH   +    +  +T EL 
Sbjct  240   RECSLGSGRVKVEDEE--------------------IGEVANHRIDAEFIDMGSETFELN  279

Query  1177  FDYDN------DYYSPNNekeeegeellkMRNK----STILLNLDYEAVILAWSDQRCPW  1326
             FDYD+      +Y    N +        +  NK      I L LDYE V+ AW DQ+ PW
Sbjct  280   FDYDSPITGEEEYIKAENVEPITPNNFDQDSNKVHDSKRIFLRLDYEGVLSAWDDQKSPW  339

Query  1327  ITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
              TG+RP+++S   WPDC+       GT+H       G+MG+  G A    D   GREARV
Sbjct  340   TTGERPDLDSAGCWPDCMGT----CGTVHV-----YGEMGMMIGHAVAVGD--GGREARV  388

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLLDQ  1644
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN     F LL++
Sbjct  389   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANLVAPAFSLLNK  439



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   323 bits (829),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 220/474 (46%), Positives = 267/474 (56%), Gaps = 77/474 (16%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-  468
             AM GK    ARACD CI KRARWYCAADDAFLCQ CD+SVHSANPLARRH RV+LKT S 
Sbjct  10    AMGGK---TARACDNCIRKRARWYCAADDAFLCQNCDASVHSANPLARRHERVRLKTSSL  66

Query  469   --------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
                      I  PSWHRGFT+K RTPR      + ++ +P       ++PLHL    VPE
Sbjct  67    KPSKELSLEISVPSWHRGFTKKARTPRSGKHAKSKSDQEP------ARSPLHL----VPE  116

Query  625   MCSDE-NYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggggh  801
             +CSDE   SH+D +E   LLYRVPIFDP VA++ T+ N    +AA    N  + A   G 
Sbjct  117   ICSDEIETSHEDNEEQ--LLYRVPIFDPFVAELRTSENSN--EAATNMGNDGEAADAVGV  172

Query  802   ghhKN--WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLG  975
                K   +D   +           EMELAEFAADVESLLGKGLDDE   SFD+EGLG   
Sbjct  173   DESKGTVYDC-GNHINQFHGPLPSEMELAEFAADVESLLGKGLDDE---SFDIEGLGL--  226

Query  976   GNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLC  1155
              ++ +E          R                   +  + ++ M  N        S   
Sbjct  227   -SDCKEADLVDNNSLGR-------------GRVKVEDEGEAEVAMGNNQIDGEIDMSRGD  272

Query  1156  FDTLELKFDYDNDYYSPNNekeeegeellkMRN----------------KSTILLNLDYE  1287
              +  EL FDYD+       + +   E  + +++                   ILL+LDYE
Sbjct  273   HEPFELSFDYDSPMTCEEEDNKAGVERAIALKDHLKSEDCKVEDAGINTNKKILLSLDYE  332

Query  1288  AVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAA  1467
              VI AW+DQR PW TG+RPE++S+  WPDC+       GTIH    +  G++G+ FG  A
Sbjct  333   GVISAWADQRSPWTTGERPELDSNDCWPDCLGT----CGTIH----NLYGEVGM-FGHPA  383

Query  1468  IADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             + D    GREARVSRYREKRRTRLF KKIRYEVRKLNAEKRPRMKGRFVKRA F
Sbjct  384   MMDG---GREARVSRYREKRRTRLFCKKIRYEVRKLNAEKRPRMKGRFVKRATF  434



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score =   320 bits (821),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 219/477 (46%), Positives = 255/477 (53%), Gaps = 90/477 (19%)
 Frame = +1

Query  289   GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS  468
              AM GK     RACD CI KRARWYC ADDAFLCQ CD+SVHSANPLARRH RV+LKT S
Sbjct  9     SAMGGK---TTRACDNCIKKRARWYCPADDAFLCQNCDASVHSANPLARRHERVRLKTSS  65

Query  469   ----------------NIEPPS-------------WHRGFTRKPRTPRHAHGRYNNNNSK  561
                             ++E P              WHRGFTRK RTPR   GR     SK
Sbjct  66    LKQTSSPSSSSDDYFPDLESPLSISSVSVSVSVPSWHRGFTRKARTPRQ--GR---KASK  120

Query  562   PVVHHDVV-KTPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNI  738
                  DV+ K P+HL    VPE+ SDEN    DE E++ LLYRVPI DP V  +      
Sbjct  121   SAGDGDVIRKNPIHL----VPEILSDENSL--DENEEEQLLYRVPILDPFVGHL------  168

Query  739   TDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGK  918
               Y ++ A  +                D  +            EMELAEFAADVESLLGK
Sbjct  169   --YSSSTAPTDADSEFKLESKEMTLQDDICNVDLNRFHEMLPSEMELAEFAADVESLLGK  226

Query  919   GLDDEEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadd  1098
             GLDDE   SFDMEGLG LG  N EE   ++M+   +   +   ++E              
Sbjct  227   GLDDE---SFDMEGLGLLGVCNKEE---NSMISHEKVKIEDEGEMEVVTKTTSPTTHNHQ  280

Query  1099  dIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNL  1278
                     NH +     +  DT E KFDYD+      +++    +      NK  ILLNL
Sbjct  281   Y-------NHTHDHDIDINEDTFEFKFDYDSSINIIGDDEVVTND-----ENKKKILLNL  328

Query  1279  DYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFG  1458
             DYE V+ AW+DQRCPW  G+RPE++S+  WPDC+              Y     MGI   
Sbjct  329   DYEGVLKAWADQRCPWTNGERPELDSNESWPDCM------------GNY-----MGIMNE  371

Query  1459  QAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                I D    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF
Sbjct  372   NVTIVD---RGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  425



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score =   319 bits (817),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 213/463 (46%), Positives = 262/463 (57%), Gaps = 64/463 (14%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
             +ARACD C+ KRARWYCAADDAFLCQ+CDSSVHSANPLARRH RV+LKT S         
Sbjct  21    SARACDNCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRLKTASISSFDDGSK  80

Query  469   ---NIEPPSWHRGFTRKPRTPRHAH-GRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD  636
                 I  PSWH+GFTRK RTPR    G+  NN+  P+   + +  PLHL    VPE+CS+
Sbjct  81    AGLQISVPSWHQGFTRKARTPRQKKPGKLINNSEDPI---NRISHPLHL----VPEICSE  133

Query  637   ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
             E      E+ ++ LLYRVPIFDP VA++CT+ N  +        N  +   G GH     
Sbjct  134   EQSH---EENEEQLLYRVPIFDPFVAELCTSANSPEVLTTTFQINDEENKRGFGHESKAA  190

Query  817   WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
              +G S            +M+LAEFAADVESLLGKGL+DE   SF ME LG    +   +E
Sbjct  191   ANGFSQEMNHLQGFLPSDMDLAEFAADVESLLGKGLEDE---SFHMEELGLFDCDEKGKE  247

Query  997   --KASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLE  1170
                 S ++   R                   +    ++    + NHH      +  +T E
Sbjct  248   LHDCSNLLPSGR---------------VKVEDEDVAELMAMGHENHHLDVEFDMGRETFE  292

Query  1171  LKFDY-------DNDYYSPNNeke--eegeellkMRNKSTILLNLDYEAVILAWSDQRCP  1323
             LKFDY       + D  + N E+       +  KM + S   L LDYE V+ AW D++ P
Sbjct  293   LKFDYGSPVACEEEDIKAQNEERIGWNSCFQECKMGDSSKTFLRLDYEGVLSAWDDKKSP  352

Query  1324  WITGQRPEMNSHHGWPD-CIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREA  1500
             W TG+RP ++S   WPD C+      SG +H       G+MG   G AA   D   GREA
Sbjct  353   WTTGERPNLDSCDCWPDHCLGT----SGAMHV-----YGEMGRMSGHAAAMADG--GREA  401

Query  1501  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR+NF
Sbjct  402   RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNF  444



>ref|XP_002282578.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
 emb|CBI27020.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 215/465 (46%), Positives = 259/465 (56%), Gaps = 71/465 (15%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRAR+YCAADDAFLCQACD SVHSANPLARRH RV+LKT S   P      
Sbjct  16    ARACDSCIRKRARFYCAADDAFLCQACDMSVHSANPLARRHERVRLKTASLKLPGADSLE  75

Query  481   ---PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVP-VPEMCSDENYS  648
                PSWH+GFTRK RTPRH          KP  H       L  + +P VPE+ +DE  S
Sbjct  76    NSMPSWHQGFTRKARTPRHG---------KPAAHPAFKSDELTRNPLPFVPEIGADET-S  125

Query  649   HDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGK  828
             +DD +E   LLYRVPIFDP VA++C + N    +A     N ++ A   G        G+
Sbjct  126   YDDNEEQ--LLYRVPIFDPFVAELCASTNSN--EAVTTVANDTETADVTGSETKALVAGR  181

Query  829   SStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKAST  1008
                          +M+LAEFAADVESLLGKGLD+E   SF MEGLG +  +  E+E    
Sbjct  182   GHDVDSLHGFLPSDMDLAEFAADVESLLGKGLDNE---SFGMEGLGLI--DCKEKESVEY  236

Query  1009  MMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYD  1188
              +   R   +    +                  MA  A+    +   +  +  EL FDY 
Sbjct  237   SLHSGRVKLEEEEDIGG---------------VMACQAD----AEIDMTREPFELNFDYG  277

Query  1189  NDYYSPNNekeeegeellkMRN-------KSTILLNLDYEAVILAWSDQRCPWITGQRPE  1347
             +   +   E+E+     + M N       K+ ILL LDYEA+I AW+ Q  PW  G RPE
Sbjct  278   SP-ATCEEEEEKVAVGAMDMNNKVDDPKKKNKILLRLDYEAIITAWASQGSPWTNGHRPE  336

Query  1348  MNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKR  1527
             ++    WPDC+    CG    H   Y   G MG    QAA+ D    GREARVSRYREKR
Sbjct  337   LDPDDCWPDCLGT--CGIQVHH--PYGEFGGMGEQ--QAAMGDG---GREARVSRYREKR  387

Query  1528  RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN------FPLLDQ  1644
             RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+      FPLL++
Sbjct  388   RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFGGPAAFPLLNK  432



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score =   313 bits (803),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 216/487 (44%), Positives = 260/487 (53%), Gaps = 98/487 (20%)
 Frame = +1

Query  256   LGIEIKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLAR  435
             +  E K+  A GA        ARACD CI KRARWYCAADDAFLCQ+CDSSVHSANPLAR
Sbjct  1     MSSEKKLANAVGA------KTARACDNCIRKRARWYCAADDAFLCQSCDSSVHSANPLAR  54

Query  436   RHARVQLKT---LSNIEPPS-----------------WHRGFTRKPRTPRHA--HGRYNN  549
             RH RV+LKT    S+ E P+                 WHRGFTRK RTPRH   H +   
Sbjct  55    RHERVRLKTSSIKSSDEFPNLGSTVSGSGSGSESVPSWHRGFTRKARTPRHGNKHAKRVK  114

Query  550   NNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTT  729
             +  +     + +K P+ L    VPE+ SDEN SHD+ +E+Q LLYRVPIFDP V D    
Sbjct  115   STEEEEEDEEEMKNPIQLV---VPEILSDEN-SHDENEEEQ-LLYRVPIFDPFVEDGSNY  169

Query  730   LNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESL  909
              N   Y +    FNQ                      T        EMELA+FAADVE L
Sbjct  170   GN--KYSSNKVDFNQ-------------------DMNTFQGLLAPSEMELADFAADVECL  208

Query  910   LGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapacea  1089
             LGKGLDDEE  ++ MEGLGFL  ++ +  K     E                        
Sbjct  209   LGKGLDDEESFNY-MEGLGFLEKHDEKLVKVEDEGEMG----------------------  245

Query  1090  adddIFMAANANHHYTSSSSLCFD----TLELKFDYDNDYYS---PNNekeeegeellkM  1248
                 + M +  NH         FD    T ELKFDYD+   S    + + E         
Sbjct  246   ---FVNMVSTNNHDINQVDYSDFDMVGETFELKFDYDSQVMSNLDEDKKVEFGEINYDSG  302

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             +N + I+LNLDYE+V+ +W+D+R PW  G+RPE++ +  WP C+       G IH+    
Sbjct  303   KNNNKIMLNLDYESVLKSWADKRSPWTMGERPEVDFNDCWPVCM----GNCGKIHS----  354

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
               GD+GI         D   GREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  355   -YGDIGIVNRHGGGGVD--EGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  411

Query  1609  FVKRANF  1629
             FVKR NF
Sbjct  412   FVKRTNF  418



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score =   310 bits (793),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 220/493 (45%), Positives = 264/493 (54%), Gaps = 110/493 (22%)
 Frame = +1

Query  256   LGIEIKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLAR  435
             +  E K+  A GA        ARACD CI KRARWYCAADDAFLCQ+CDSSVHSANPLAR
Sbjct  1     MSSEKKLANAMGA------KTARACDNCIRKRARWYCAADDAFLCQSCDSSVHSANPLAR  54

Query  436   RHARVQLKTLS--------NIE----------------PPSWHRGFTRKPRTPRHAHGRY  543
             RH RV+LKT S        N+E                 PSWH GFTRK RTP     RY
Sbjct  55    RHERVRLKTSSFKSSDDFPNLESTVSGLGSGSGSGSDSIPSWHCGFTRKARTP-----RY  109

Query  544   NNNNSKPV------VHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDP  705
              N ++K V         + +K P+ L    VPE+ SDEN SHD+ +E+Q LLYRVPIFDP
Sbjct  110   GNKHAKRVKSTEEEEEEEEMKNPIQLV---VPEILSDEN-SHDENEEEQ-LLYRVPIFDP  164

Query  706   VVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAE  885
              +AD     N  +Y +    FNQ                      T        EMELAE
Sbjct  165   FMADGSNYGN--EYSSNKVDFNQ-------------------DMNTFQGLLAPSEMELAE  203

Query  886   FAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeed  1065
             FAADV SLLGKGLDDEE  ++ MEGLGFL  ++ +  K     E                
Sbjct  204   FAADVVSLLGKGLDDEESFNY-MEGLGFLEKHDEKLVKVEDEGEVG--------------  248

Query  1066  apapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYD----NDYYSPNNekeeege  1233
                         + M +  N    S   +  +T ELKFDYD    N+    N + E    
Sbjct  249   -----------FVNMISTNNQVDYSEFDMVGETFELKFDYDSQVINNLDEDNKKVEFLEI  297

Query  1234  ellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIH  1413
                  +N + I+LNLDYE+V+ +W D+R PW TG RPE++ +  WP C+       G IH
Sbjct  298   NYDSGKNNNKIMLNLDYESVLKSWGDKRFPWTTGVRPEVDFNDCWPVCM----GNCGKIH  353

Query  1414  AAAYDGVGDMGITFGQ-AAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1590
             +      GD+ I  G    + D+   GREARV RY+EKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  354   S-----YGDIAIMNGHGGGVVDE---GREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKR  405

Query  1591  PRMKGRFVKRANF  1629
             PRMKGRFVKR NF
Sbjct  406   PRMKGRFVKRTNF  418



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 206/464 (44%), Positives = 252/464 (54%), Gaps = 93/464 (20%)
 Frame = +1

Query  265   EIKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHA  444
             E KI    GA        ARACD CI KRARWYCAADDAFLCQ+CDSSVHSANPLARRH 
Sbjct  5     EKKIANVVGA------KTARACDSCIRKRARWYCAADDAFLCQSCDSSVHSANPLARRHE  58

Query  445   RVQLKTLS---------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL  597
             RV+LKT S         ++  PSWHRGFTRK RTPR      N  NS+       VK P+
Sbjct  59    RVRLKTSSLKSSDEFSNSVSVPSWHRGFTRKARTPR------NGKNSRK------VKNPI  106

Query  598   HLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQS  777
              L    VPE+ SDEN   D+E++   LLYRVPI DP VAD          DA    +++ 
Sbjct  107   QLV---VPEILSDENSQDDNEEQ---LLYRVPILDPFVAD----------DAIGNEYSKD  150

Query  778   KCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDME  957
             +        H   ++G              EMELAEFAADVESLLG+ LDDEE  ++   
Sbjct  151   QMKNDFNDDHMSKFNG--------MLNIPSEMELAEFAADVESLLGRRLDDEESFNYMEL  202

Query  958   GLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYT  1137
             GLGFL                  +H+  +     ++      E   + +   ++ N    
Sbjct  203   GLGFL-----------------EKHDDSMGCSLVDEKIKVENEGEMEVVIDRSSYNQVDY  245

Query  1138  SSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQR  1317
             S      DT +LK D D+   +   + + +          + ILLNLDY  V+ AW+DQR
Sbjct  246   S------DTFDLKLDCDSPIITLEEDDKGDT-------KNNKILLNLDYGGVLNAWADQR  292

Query  1318  CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGRE  1497
              PW TG+RPE++ +  WP C+    CG   ++       GDMG   G     D+   GRE
Sbjct  293   SPWTTGERPEVDFNDCWPVCMGN--CGKNHLY-------GDMGTMTGHGPTVDE---GRE  340

Query  1498  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             ARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR NF
Sbjct  341   ARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF  384



>ref|XP_002531628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30756.1| conserved hypothetical protein [Ricinus communis]
Length=468

 Score =   306 bits (784),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 207/478 (43%), Positives = 252/478 (53%), Gaps = 63/478 (13%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT---  462
             A+ GK    ARACD C+ KRARWYCAADDAFLCQ+CDSSVHSANPLARRH RV+LK    
Sbjct  10    AVAGK---TARACDSCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRLKISSL  66

Query  463   ---------LSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVP  615
                       S I  PSWH+GFTRK RTPR+ HG      +KP++    ++      I  
Sbjct  67    KSLDIISKGSSVITVPSWHQGFTRKARTPRNGHG------NKPLLSLLKIEEKSRNPIPL  120

Query  616   VPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDY--DAAAAAFNQSKCAg  789
             VPE+ SD+  SH+D  E++ LLYRVPIFDP VA++CT   I++       A F      G
Sbjct  121   VPEVGSDDQISHEDNNEEEQLLYRVPIFDPFVAELCTPTTISNEADQTTTAPFTAGGGNG  180

Query  790   ggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                       +G  S  +        E +LA+FAADVESLLG+GL++E   SF ME LG 
Sbjct  181   NDTDQTVAGANGIESKASYLHGFLPSETDLADFAADVESLLGRGLENE---SFGMEDLGL  237

Query  970   LGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSS  1149
             +   + +EEK   M E          +           E  + +   A    H  T    
Sbjct  238   V---DCKEEKQFKMQE---------REFSLASGQVIKLEEEEKEEEEAVRECHIDTEIDM  285

Query  1150  LCFDTLELKFDYDN---------------DYYSPNNekeeegeellkMRNKSTILLNLDY  1284
                   EL FDYD+               D  S N E ++        + K  ILL+LDY
Sbjct  286   AKEPPFELSFDYDSATCGEEDEKVATPQRDIKSNNGEYKDNTRSKNDNKKKRKILLSLDY  345

Query  1285  EAVILAWSDQ-RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQ  1461
             EAVI AW+ Q   PW  G R +++    W DC+       GT  A  +   GD     G 
Sbjct  346   EAVITAWATQGTSPWTDGTRRDVDPDECWQDCM-------GTCGAEFHHPYGDTNGLGGV  398

Query  1462  AAIADDVWV--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                 +      GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA F
Sbjct  399   GGGGNPAMAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRATF  456



>ref|XP_010265147.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nelumbo 
nucifera]
Length=439

 Score =   302 bits (773),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 206/457 (45%), Positives = 246/457 (54%), Gaps = 63/457 (14%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD C+ KRARWYCAADDAFLCQ CD+SVHSANPLARRH RV+LKT S  +P      
Sbjct  16    ARACDSCLRKRARWYCAADDAFLCQGCDASVHSANPLARRHGRVRLKTAS-FKPNDDSLV  74

Query  481   ----PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYS  648
                 P+WH+GFTRK RTPRH         SK   H + +  PL L    VPEM S+E  +
Sbjct  75    ENYVPAWHQGFTRKARTPRHGK-PTALQQSKSTDHEEPIPNPLPL----VPEMGSEE--A  127

Query  649   HDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGK  828
               DE E+QLL YRVPIFDP VA++CT     +   A+   N S  A  G        +G 
Sbjct  128   SPDENEEQLL-YRVPIFDPFVAELCTPATSNE---ASMTANDSSTAAVGTETKAFLHEGH  183

Query  829   --SStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKA  1002
               +      P     +M+L EFAADVE+LLGKGLD   E SF MEGLG L  +  +EEK 
Sbjct  184   DVTGDMDNLPGFLPSDMDLVEFAADVETLLGKGLD---EDSFGMEGLGLL--DCKDEEKT  238

Query  1003  STMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFD  1182
                    R                     A  +  +     H       +  +TL+L FD
Sbjct  239   DCCFGSGR------------VKVEEEEVEAAVECHVEVELEH------DMARETLDLNFD  280

Query  1183  YDNDYYSPNNekeeegeellkM---------RNKSTILLNLDYEAVILAWSDQRCPWITG  1335
             YD+   + +  +E+       M                L LDYEA+I AW+++  PW TG
Sbjct  281   YDSPTTAEDEVEEKMVTGATMMVTNGGCKAEETTRKTSLKLDYEAIISAWANKGLPWTTG  340

Query  1336  QRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRY  1515
              RP  N    WPDC+    C    +H   Y   G+MG   G     D    GREARVSRY
Sbjct  341   DRPLFNPDDCWPDCMGT--CPMTEVH--HYHPYGEMGGVGGHVTAGDG---GREARVSRY  393

Query  1516  REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+
Sbjct  394   REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS  430



>ref|XP_011022115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Populus euphratica]
Length=440

 Score =   300 bits (769),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 209/460 (45%), Positives = 251/460 (55%), Gaps = 61/460 (13%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------N  471
             ARACD CI KRARWYCAADDAFLCQACDSSVHSANPLARRH RV+LKT S          
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRLKTASLKSLDLCSKE  75

Query  472   IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
                PSWH GFTRK RTPRH          KPV    + +T  ++ I  VPE+ SDE  SH
Sbjct  76    NSVPSWHGGFTRKARTPRHG---------KPVSQSKIAETIRNIPIPLVPEVGSDE-ISH  125

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDG--  825
             +D +E+  LLYRVPIFDP VAD+C +  I++   A       +          K   G  
Sbjct  126   EDNEEEH-LLYRVPIFDPSVADLCASTTISNEAPAGGNGCTDQRVADSNGVESKILIGAI  184

Query  826   KSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKAS  1005
             +       P     + +LAEFAAD+ESLLG+GL++E   SF ME LG +   + +EEK  
Sbjct  185   ERRDVESLPGFLPSDTDLAEFAADMESLLGRGLENE---SFGMEELGLM---DCKEEKEF  238

Query  1006  TMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDY  1185
              +  F   + KV V+ EE                 A    H    + +      EL FD+
Sbjct  239   EVKGFPLWNGKVKVEDEENAGVERK----------AVRKCHAGIETGTAKEPIFELSFDF  288

Query  1186  DNDYYSPNNekeeegeellkMRN-----------KSTILLNLDYEAVILAWSDQRCPWIT  1332
              N   +   E E+ G E   ++N           K  ILL+LDYEAV+ AW+ Q  PW  
Sbjct  289   -NSPATCGEEDEKVGIEEGDLKNTRGEYEDDDGAKRKILLSLDYEAVMTAWASQGSPWTN  347

Query  1333  GQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFG-QAAIADDVWVGREARVS  1509
             G RP+ +    WPDC+       G   A  +   GDM    G   A+ D    GREARVS
Sbjct  348   GNRPDFDPDECWPDCM-------GICGAQLHHPYGDMISGLGAHPAMMDG---GREARVS  397

Query  1510  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR   
Sbjct  398   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTL  437



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 211/456 (46%), Positives = 250/456 (55%), Gaps = 94/456 (21%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS--------N  471
              ARACD CI KRARWYCAADDAFLCQ CDSSVHSANPLARRH RV+LKT S        +
Sbjct  16    TARACDSCIRKRARWYCAADDAFLCQTCDSSVHSANPLARRHERVRLKTASLKSSDSENS  75

Query  472   IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
                PSWHRGFTRK RTPR       N+ S        +K P+ L    VPE+ SDEN   
Sbjct  76    ASVPSWHRGFTRKARTPRIGK----NSGS--------IKNPIQLI---VPEISSDEN--S  118

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKS  831
              DE E+Q LLYRVPI DP VAD  +       D   + FN        G  +  +     
Sbjct  119   QDENEEQ-LLYRVPIPDPFVADEYSK------DQMKSDFNDDHMNKFHGMLNIPS-----  166

Query  832   StttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTM  1011
                         EMELAEFAADVESLLGKGLDDEE  ++   GLGFL      E+   +M
Sbjct  167   ------------EMELAEFAADVESLLGKGLDDEESFNYMELGLGFL------EKHDDSM  208

Query  1012  MEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDN  1191
               F              D         + ++ M  N N++    S    DT +LKFD D+
Sbjct  209   GCF------------LVDEKIKVENEGEMEVVM-DNTNYNQVDYS----DTFDLKFDCDS  251

Query  1192  DYYSPNNekeeegeellkM----------RNKSTILLNLDYEAVILAWSDQRCPWITGQR  1341
                +   + + E  E++               + ILLNLDY  V+ AW+DQR PW TG+R
Sbjct  252   PVITLEEDDKGEAGEIIMQDSTNDGLIGDSKNNKILLNLDYGGVLNAWADQRSPWTTGER  311

Query  1342  PEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYRE  1521
             P+++S+  WP C+       G IHA      GDM I  G   + D+   GREARV RY+E
Sbjct  312   PQVDSNDCWPVCM----GNCGQIHA-----YGDMEIMTGHGPMIDE---GREARVLRYKE  359

Query  1522  KRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             KRRTRLFSKKIRYEVRKLNAE RPRMKGRFVKR NF
Sbjct  360   KRRTRLFSKKIRYEVRKLNAEMRPRMKGRFVKRTNF  395



>ref|XP_002311458.2| zinc finger family protein [Populus trichocarpa]
 gb|ABK95116.1| unknown [Populus trichocarpa]
 gb|EEE88825.2| zinc finger family protein [Populus trichocarpa]
Length=444

 Score =   297 bits (761),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 211/483 (44%), Positives = 259/483 (54%), Gaps = 72/483 (15%)
 Frame = +1

Query  268   IKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHAR  447
             I I+ +  A+ GK    ARACD CI KRARWYCAADDAFLCQACDSSVHSANPLARRH R
Sbjct  2     ICIKSSANAVGGK---TARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHER  58

Query  448   VQLKTLS---------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLH  600
             V+LKT S             PSWH GFTRK RTPRH          KPV    + +T  +
Sbjct  59    VRLKTASLKSLDLCSKENSVPSWHGGFTRKARTPRHG---------KPVSQSKIAETIRN  109

Query  601   LSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSK  780
             + I  VPE+ SDE  SH+D +E+  LLYRVPIFDP VAD+C +  I++ +A A       
Sbjct  110   IPIPLVPEVGSDE-ISHEDNEEEH-LLYRVPIFDPFVADLCASTTISN-EAGAIVPAGGN  166

Query  781   CAgggghghhKNWDGK-------SStttmpptttememeLAEFAADVESLLGKGLDDEEE  939
                          + K              P     +M+LAEFAAD+ESLLG+GL++E  
Sbjct  167   DGTDQRVADSNGVESKILIGAIERRDVESLPGFLPSDMDLAEFAADMESLLGRGLENE--  224

Query  940   SSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAAN  1119
              SF ME LG +   + +EEK   +  F              +      +  +  +   A 
Sbjct  225   -SFGMEELGLM---DCKEEKEFEVKGFP-----------LWNGKVKVEDEENASVERKAV  269

Query  1120  ANHHYTSSSSLCFDTL-ELKFDYDNDYYSPNNekeeegeellkMRN-----------KST  1263
                +    + +  D + EL FDY N   +   E E+ G E   ++N           K  
Sbjct  270   RKCYAGIETDMAKDPIFELSFDY-NSSATCGEEDEKVGIEEGDLKNTRGEYEDDDGAKRK  328

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM  1443
             ILL+LDYEAV+ AW+ Q  PW  G RP+ +    WPDC+       G   A  +   GDM
Sbjct  329   ILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCM-------GICGAQLHHPYGDM  381

Query  1444  GITFG-QAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
                 G   A+ D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  382   ISGLGAHPAMVDG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  438

Query  1621  ANF  1629
                
Sbjct  439   TTL  441



>ref|NP_001278940.1| zinc finger protein CONSTANS-LIKE 16-like [Glycine max]
 gb|AEF12204.1| CONSTANS-like zinc finger protein [Glycine max]
Length=419

 Score =   294 bits (752),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 246/471 (52%), Gaps = 97/471 (21%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----------  468
             ARACD CI KRARWYCAADDAFLCQACDSSVHSANPLARRH RV+LKT S          
Sbjct  17    ARACDSCITKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRLKTASYKSTDEQQQQ  76

Query  469   -NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
                +PP+WH   T+KPRTPRH     NNN             P HL    VPE  S+E  
Sbjct  77    QQQQPPTWH---TKKPRTPRHGKHSRNNN-------------PFHL----VPEEGSEEAN  116

Query  646   SHDDEKEDQLLLYRVPIFDPVVADICTT------LNITDYDAAAAAFNQSKCAgggghgh  807
             SHD+ +E   LLYRVPIFDP VA++C T      +  TD    AAA  + K         
Sbjct  117   SHDENEEQ--LLYRVPIFDPFVAELCGTNSSPSPVTSTDQGVVAAAEVEYK------GFQ  168

Query  808   hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNV  987
                +   SS           + ELAEFAADVESLLG+GL++E      ME LG +     
Sbjct  169   SNGFCSNSSEMENLHGMLPSDAELAEFAADVESLLGRGLENE---CVGMEELGLVDAKEE  225

Query  988   EEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTL  1167
             E    S  ++   +                     + ++ M    +            + 
Sbjct  226   ECSVGSGKVKMEDQE---------------ESPLVEMEMDMVVGRDDQ----------SF  260

Query  1168  ELKFDYDN-------DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPW  1326
             EL FDY+        D    N    ++  +    +NK  I L LDYEAVI+AW+ Q+ PW
Sbjct  261   ELSFDYETCEEVKVCDLGLGNELGAKKENDDEVKKNK--ISLQLDYEAVIIAWASQKSPW  318

Query  1327  ITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
              T  +P ++    W  C+       G+   A +   G+MG  FG   +  D   GREARV
Sbjct  319   TTADKPNLDPDECWKQCM-------GSCETAYHHPCGEMG-GFGIHPVIID--GGREARV  368

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLLDQ  1644
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+     FPLL++
Sbjct  369   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAPPTFPLLNK  419



>gb|KHG17662.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=417

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 199/469 (42%), Positives = 256/469 (55%), Gaps = 90/469 (19%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE--------  477
             RACD CI KRARWYCAADDAFLCQACDSSVHSANPLARRH RV+LKT S           
Sbjct  11    RACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHKRVRLKTASVKSSGDELPLE  70

Query  478   --PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
                P+W RGFTRK RT R   G          +H  ++K   +   V VPE+  DE ++ 
Sbjct  71    SFSPTWDRGFTRKARTRRPVKGS---------IHRKLLKAKNNPVPV-VPEVGIDELFNE  120

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKS  831
             ++E+E   LLYRVPIFDP VA++CT+   T+   +A        A        ++ DG  
Sbjct  121   ENEEEQ--LLYRVPIFDPFVAELCTSTTSTEAAVSAVGNEAETTATESKAFLGQDVDGSH  178

Query  832   StttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTM  1011
                         EM+LAEFAADVESLLGKGL++E   SF M  LG  G  + +      +
Sbjct  179   G-------LFPSEMDLAEFAADVESLLGKGLENE---SFTMVELGLTGSKDKD------L  222

Query  1012  MEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDN  1191
              E+S  + +                                +    +  +  EL F+YD+
Sbjct  223   REYSYGNGQ-------------------------VKIEDEESFEGGMGREPFELSFNYDS  257

Query  1192  ------------DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITG  1335
                         +  +  ++++ E +E    + K   LL+LDYEAVI AW+ Q  PW +G
Sbjct  258   PPSCGGVDELVKEEVAMKSKEDGECQESTAKKKKRKTLLSLDYEAVITAWATQGSPWTSG  317

Query  1336  QRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRY  1515
              +P+++    WPDC M+ G   GT    +Y G+  +G+   Q A+ D    GREARVSRY
Sbjct  318   GKPDLDPDECWPDC-MRNG---GTEVQQSYSGL--IGMGGQQQAMGDG---GREARVSRY  368

Query  1516  REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN------FPLLDQ  1644
             REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+      FPLL++
Sbjct  369   REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFLAGPAFPLLNK  417



>ref|XP_010667660.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 203/477 (43%), Positives = 246/477 (52%), Gaps = 97/477 (20%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-  468
             A+ GK    ARACD CI KRARWYC ADDAFLCQ CDSSVHSAN LARRH RV+LKT S 
Sbjct  10    AVSGK---TARACDCCIRKRARWYCPADDAFLCQTCDSSVHSANQLARRHERVRLKTASL  66

Query  469   -------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM  627
                      + PSWHRG TRKPRTPR  HG++ +   +        + PLH   V VPE+
Sbjct  67    RRSDDHQQTDIPSWHRGLTRKPRTPR--HGKHQSKTEE--------RNPLH---VIVPEL  113

Query  628   -CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNIT-DYDAAAAAFNQSKCAggggh  801
                D + S D E E++ LLYRVPI+DP +AD    + +    D A   FN SK +     
Sbjct  114   GMEDSSSSQDGETEEEHLLYRVPIYDPFIADDIRPMELEGGLDTAKCMFNNSKSSP----  169

Query  802   ghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGG-  978
                   DG              +++L EFAADVE+LLGKGLDDE   S+ +E LG LG  
Sbjct  170   ------DG----------YLPSDIDLEEFAADVETLLGKGLDDE---SYGIEELGLLGCS  210

Query  979   -NNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLC  1155
              NN E      +++                          D+  M         S+S + 
Sbjct  211   INNNEIHDIEKIIKEE--------------------GELGDEGEMIRRCEIEADSNSLVI  250

Query  1156  FDTLELKFDYDNDYY-------------------SPNNekeeegeellkMRNKSTILLNL  1278
              +  E  FDYD+ Y+                   S  NE  +   +      +  ILL L
Sbjct  251   KEPFEFSFDYDDHYFGTMCEDDVEDQKKVIMIEQSMGNELSKIEGDDETENKRRKILLRL  310

Query  1279  DYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFG  1458
             DYEA+  AW+    PWI GQRP++NS   WP C+    CG    H       GD  +   
Sbjct  311   DYEAISDAWASHGSPWINGQRPQINSDDCWPHCMAT--CGLEGRHPI----FGDHQMGGM  364

Query  1459  QAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                       GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR++F
Sbjct  365   GGNRGIGD-GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  420



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score =   290 bits (741),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 203/463 (44%), Positives = 242/463 (52%), Gaps = 77/463 (17%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT---  462
             AM GK     RACD CI KRARWYC ADDAFLCQ CD+SV       ++ +     +   
Sbjct  10    AMGGK---TTRACDNCIKKRARWYCPADDAFLCQNCDASVRLKTSSLKQTSSPSSSSDDY  66

Query  463   LSNIEPPS-------------WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVV-KTPLH  600
               ++E P              WHRGFTRK RTPR   GR     SK     DV+ K P+H
Sbjct  67    FPDLESPLSISSVSVSVSVPSWHRGFTRKARTPRQ--GR---KASKSAGDGDVIRKNPIH  121

Query  601   LSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSK  780
             L    VPE+ SDEN    DE E++ LLYRVPI DP V  +        Y ++ A  +   
Sbjct  122   L----VPEILSDENSL--DENEEEQLLYRVPILDPFVGHL--------YSSSTAPTDADS  167

Query  781   CAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEG  960
                          D  +            EMELAEFAADVESLLGKGLDDE   SFDMEG
Sbjct  168   EFKLESKEMTLQDDICNVDLNRFHEMLPSEMELAEFAADVESLLGKGLDDE---SFDMEG  224

Query  961   LGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTS  1140
             LG LG  N EE   ++M+   +   +   ++E                      NH +  
Sbjct  225   LGLLGVCNKEE---NSMISHEKVKIEDEGEMEVVTKTTSPTTHNHQY-------NHTHDH  274

Query  1141  SSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRC  1320
                +  DT E KFDYD+      +++    +      NK  ILLNLDYE V+ AW+DQRC
Sbjct  275   DIDINEDTFEFKFDYDSSINIIGDDEVVTND-----ENKKKILLNLDYEGVLKAWADQRC  329

Query  1321  PWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREA  1500
             PW  G+RPE++S+  WPDC+              Y     MGI      I D    GREA
Sbjct  330   PWTNGERPELDSNESWPDCM------------GNY-----MGIMNENVTIVD---RGREA  369

Query  1501  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             RV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF
Sbjct  370   RVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  412



>ref|XP_011007910.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Populus euphratica]
Length=445

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 248/465 (53%), Gaps = 66/465 (14%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV+LK+ S+         
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCQACDSSVHSANLLARRHERVRLKSASHKSSGAGSQE  75

Query  481   ---PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
                PSWH GFTRK RTPRH          KPV    + KT  ++ I  VPE+ SDE    
Sbjct  76    NSMPSWHGGFTRKARTPRHG---------KPVSQSKIEKTKRNIPIPLVPEVGSDEISLE  126

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAA---AAFNQSKCAgggghghhKNWD  822
             D+E+E   LLYRVPIFDP  A++CT+  +++   A       +  + A        K   
Sbjct  127   DNEEEH--LLYRVPIFDPFAAELCTSTTVSNEAGAVVPDGGTDTDQRAADSSGTESKVLL  184

Query  823   GKSStttmppttt--ememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
             G S    +         +M+LAEFAAD+ESLLG+GL++E   SF ME LG +      E 
Sbjct  185   GGSEGKDVESLHGFLPSDMDLAEFAADMESLLGRGLENE---SFGMEELGLMDCKEENEL  241

Query  997   KASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELK  1176
                       + +    +    +        AD +I +A +                EL 
Sbjct  242   GVKGYPLGKGKVKVEEEEDAGMEEKDVRECHADIEIDIAKDP-------------PFELS  288

Query  1177  FDYDN-------------DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQR  1317
             FDYD+             +     N   E  ++    + + T+L +LDY+AV+ AW+ Q 
Sbjct  289   FDYDSPATCDEEDEKVGIEEGDLKNSDGEYEDDGGAKKKRRTLL-SLDYDAVMTAWASQG  347

Query  1318  CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM-GITFGQAAIADDVWVGR  1494
              PW  G RP+ ++   WPDC+       G   A  +   GD+ G+    AA+ D    GR
Sbjct  348   SPWTNGYRPDFDADECWPDCM-------GICGAQLHQPYGDVSGLAAHPAALVDG---GR  397

Query  1495  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  F
Sbjct  398   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  442



>gb|AFX73409.1| constans-like protein 5 [Gossypium hirsutum]
Length=423

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 199/469 (42%), Positives = 252/469 (54%), Gaps = 90/469 (19%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE--------  477
             RACD CI  RARWYCAADDAFLCQACDSSVHSANPLARRH RV+LKT S           
Sbjct  17    RACDSCIRGRARWYCAADDAFLCQACDSSVHSANPLARRHKRVRLKTASVKSSGDELPLE  76

Query  478   --PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
                PSW RGFTRK RT R   G          +H   +K   +   V VPE+  DE ++ 
Sbjct  77    SFSPSWDRGFTRKARTRRPVKGS---------IHRKPLKAKNNPVPV-VPEVGIDEIFNE  126

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKS  831
             ++E+E   LLYRVPIFDP VA++CT+   T+   +A        A        ++ DG  
Sbjct  127   ENEEEQ--LLYRVPIFDPFVAELCTSTTSTEAAVSAVGNEAETTATESKAFMGQDVDGSH  184

Query  832   StttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTM  1011
                         EM+LAEFAADVESLLGKGL++E   SF M  LG  G       K   +
Sbjct  185   G-------LFPSEMDLAEFAADVESLLGKGLENE---SFTMVELGLTG------SKDKDL  228

Query  1012  MEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDN  1191
              E+S  + +                                +    +  +  E  F+YD+
Sbjct  229   REYSYGNGQ-------------------------VKIEDEESFEDGMGREPFEFSFNYDS  263

Query  1192  ------------DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITG  1335
                         +  +  ++++ E +E    + K   LL+LDYEAVI AW+ Q  PW +G
Sbjct  264   PPSCGGVDELVKEEVAMKSKEDGECQENTAKKKKRKTLLSLDYEAVITAWATQGSPWTSG  323

Query  1336  QRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRY  1515
              +P+++    WPDC M+ G   GT    +Y G+  +G+   Q A+ D    GREARVSRY
Sbjct  324   GKPDLDPDECWPDC-MRNG---GTEVQQSYSGL--IGMGGQQQAMGDG---GREARVSRY  374

Query  1516  REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN------FPLLDQ  1644
             REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+      FPLL++
Sbjct  375   REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFLAGPAFPLLNK  423



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score =   286 bits (732),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 204/471 (43%), Positives = 259/471 (55%), Gaps = 57/471 (12%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  A+ GK    ARACD C+ KRARWYCAADDAFLCQ CDSSVHSANPLARRH RV+LKT
Sbjct  7     AANAVGGK---TARACDSCLRKRARWYCAADDAFLCQGCDSSVHSANPLARRHERVRLKT  63

Query  463   LSNIEP------------PSWHRGFTRKPRTPRHAHGRYNNNNSKP-VVHHDVVKTPLHL  603
              S I+P            P+WH+GFTRK RTPRH          KP  +    V+ P+ L
Sbjct  64    AS-IKPMLNDGFLVENSAPAWHQGFTRKARTPRHV---------KPAALQPPKVEEPILL  113

Query  604   SIVP-VPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICT--TLN---ITDYDAAAA-  762
             + +P VPEM  +E+   D+E++   LLYRVPIFDP VA++CT  T N   +T  DA  A 
Sbjct  114   NPLPLVPEMGGEESSPDDNEEQ---LLYRVPIFDPFVAELCTPATFNEPAMTTNDATTAE  170

Query  763   -AFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEE  939
                ++ K     GH    +  G++      P     +M++AEFAADVE+LLG+GLDD+  
Sbjct  171   DMGSERKALLPDGHDFDNDLTGETD---KLPVFLLSDMDIAEFAADVETLLGRGLDDD--  225

Query  940   SSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAAN  1119
              SF ME LG L  +  EEE         R   +V                      +  N
Sbjct  226   -SFGMEDLGLL--DCKEEENMEHCFRSGRVKVEVEEVEAVVGCQQVEPGLGMTRESLDLN  282

Query  1120  ANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVIL  1299
              N    +++       +   +  N     N      G +  KM +K ++ L L+YE VI 
Sbjct  283   FNSDSPTTAEEEEVEEKAVKEAANSNVVTN---MNSGYKGDKMSSKISLRLRLNYEGVIC  339

Query  1300  AWSDQRCPWITGQRPEMNSHHG-WPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIAD  1476
             AW+ +  PW TG+RP+ N     WPDC+     G+  +    +   G+MG   G   + +
Sbjct  340   AWASKGSPWTTGERPQFNPDDDCWPDCM-----GTYPMEVYHHHPYGEMGGVGGHVTMGN  394

Query  1477  DVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                 GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR + 
Sbjct  395   G---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSL  442



>ref|XP_004497095.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=445

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 200/473 (42%), Positives = 246/473 (52%), Gaps = 73/473 (15%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP-----  480
              ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV+LKT S         
Sbjct  13    TARACDNCITKRARWYCAADDAFLCQACDSSVHSANSLARRHERVRLKTASYKSTGSGSG  72

Query  481   --------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVK----TPLHLSIVPVPE  624
                     PSWH GFT+K RTPRH   +Y+ + +               P HL    VPE
Sbjct  73    SGEFINCGPSWHHGFTKKARTPRHGK-QYSASTTLQTTKSSSPGRKNYNPFHL----VPE  127

Query  625   MCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghg  804
             M  DE  S   E  +  LLYRVPIFDP V ++CT+   ++    A     +  +      
Sbjct  128   MGFDEVNSISHEDNEAQLLYRVPIFDPFVVELCTSPR-SEGGPGAVVVTSAFASDVNTSE  186

Query  805   hhKNWDGKSStttmppttte-memeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGN  981
             +     G S+            ++ELAEFAADVESLLG+GL++E      ME LG +   
Sbjct  187   NKVQLGGDSNYEMENFHGILPSDIELAEFAADVESLLGRGLENE---CIGMEELGLVDTK  243

Query  982   NVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFD  1161
                  +    +E    HE VV++                  +     N      SS    
Sbjct  244   REVYSEGKVKVEDEESHEVVVLEG-----------------YKIEGDNIEMGKESS----  282

Query  1162  TLELKFDYDNDYYSPNNekee---------egeellkMRNKSTILLNLDYEAVILAWSDQ  1314
               EL FDYD+   +    KE+         E  E    + K  I L LDY+AVI+AW  +
Sbjct  283   -FELNFDYDDSNETSEEVKEKVELEIGKCGEQNENNNNKGKRKISLQLDYDAVIIAWDGR  341

Query  1315  RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGR  1494
             +CPW TG +P +++   WPDC     CG+  ++       G++G       +AD    GR
Sbjct  342   KCPWTTGDKPNLDADETWPDCTGS--CGTEVLYP-----YGELGGYECHPVMADG---GR  391

Query  1495  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLL  1638
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+     FPLL
Sbjct  392   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPLL  444



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score =   282 bits (722),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 199/456 (44%), Positives = 245/456 (54%), Gaps = 106/456 (23%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
             +ARACD C+ KRARWYCAADDAFLCQ+CDSSVHSAN LARRH RV+LKT S         
Sbjct  5     SARACDNCVRKRARWYCAADDAFLCQSCDSSVHSANTLARRHERVRLKTASINSRTFDDD  64

Query  469   -----NIEPPSWHRGFTRKPRTPRH-AHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                  ++  P+W +GFTRKPRTPRH  HG+  N              PLHL    VPEMC
Sbjct  65    DEMKISVSVPTWDQGFTRKPRTPRHKKHGKLLN--------------PLHL----VPEMC  106

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S+E +SH++  E Q LLYRVP+FDP    +    N  D + +    ++SK A        
Sbjct  107   SEE-HSHEENDEVQ-LLYRVPVFDPFEVAVNPIRN-DDAENSNPFGSESKAAT-------  156

Query  811   KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVE  990
                   S    M       E++LAEFAADVESLLGKGL+DE   SF ME LG +  ++ E
Sbjct  157   ------SIYYKMDEGVLPSELDLAEFAADVESLLGKGLEDE---SFYMEELGLVDCHDYE  207

Query  991   EEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLE  1170
             +E     +   R                   +  D++I    + N              E
Sbjct  208   KESKDCCLMSGR-----------------MVKVEDEEIGDVEDKNQ-----------VFE  239

Query  1171  LKFDY-----DNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITG  1335
             L FD      + + Y P N  E + +      +  +  L LDYE V+ +W D++ PW TG
Sbjct  240   LNFDLTCEEMEEEEYKPRNILEMKQD------DFRSNFLKLDYEGVMSSWDDRKSPWTTG  293

Query  1336  QRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRY  1515
             +RPE NS   WPD ++     SG + A      G M +  G A        GREARV RY
Sbjct  294   ERPEFNSADCWPDSLVS---ASGAMQA-----YGGMAMVSGDAR-------GREARVMRY  338

Query  1516  REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  1623
             REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA
Sbjct  339   REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  374



>ref|XP_011007901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=447

 Score =   284 bits (726),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 247/465 (53%), Gaps = 64/465 (14%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV+LK+ S+         
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCQACDSSVHSANLLARRHERVRLKSASHKSSGAGSQE  75

Query  481   ---PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
                PSWH GFTRK RTPRH          KPV    + KT  ++ I  VPE+ SDE    
Sbjct  76    NSMPSWHGGFTRKARTPRHG---------KPVSQSKIEKTKRNIPIPLVPEVGSDEISLE  126

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAA---AAFNQSKCAgggghghhKNWD  822
             D+E+E   LLYRVPIFDP  A++CT+  +++   A       +  + A        K   
Sbjct  127   DNEEEH--LLYRVPIFDPFAAELCTSTTVSNEAGAVVPDGGTDTDQRAADSSGTESKVLL  184

Query  823   GKSStttmppttt--ememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
             G S    +         +M+LAEFAAD+ESLLG+GL++E   SF ME LG +      E 
Sbjct  185   GGSEGKDVESLHGFLPSDMDLAEFAADMESLLGRGLENE---SFGMEELGLMDCKEENEL  241

Query  997   KASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELK  1176
                       + +    +    +        AD +I +A +                EL 
Sbjct  242   GVKGYPLGKGKVKVEEEEDAGMEEKDVRECHADIEIDIAKDP-------------PFELS  288

Query  1177  FDYDN-------------DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQR  1317
             FDYD+             +     N   E  ++    + + T+L +LDY+AV+ AW+ Q 
Sbjct  289   FDYDSPATCDEEDEKVGIEEGDLKNSDGEYEDDGGAKKKRRTLL-SLDYDAVMTAWASQG  347

Query  1318  CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM-GITFGQAAIADDVWVGR  1494
              PW  G RP+ ++   WPD      CG     A  +   GD+ G+    AA+ D    GR
Sbjct  348   SPWTNGYRPDFDADECWPDPDCMGICG-----AQLHQPYGDVSGLAAHPAALVDG---GR  399

Query  1495  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  F
Sbjct  400   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score =   283 bits (724),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 211/478 (44%), Positives = 260/478 (54%), Gaps = 74/478 (15%)
 Frame = +1

Query  268   IKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHAR  447
             I  +    A+ GK    ARACD CI KRARWYCAADDAFLCQACDSSVHSANPLARRH R
Sbjct  2     ISTKNVANAVGGK---TARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHER  58

Query  448   VQLKTLS--------NIE--PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL  597
             V+LKT S         +E   PSWH+GFTRK RT R      +          +    PL
Sbjct  59    VRLKTASLQSSGHEAPLESFAPSWHKGFTRKARTRRPTKASIHQKLKAEHTKRNSNPFPL  118

Query  598   HLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQS  777
                   VPE+ +DE  S+++ +E+Q LLYRVPIFDP+VA +CT+   ++  A +A  N  
Sbjct  119   ------VPEIGADE-ISYEENEEEQ-LLYRVPIFDPLVAKLCTS-TTSNEAAVSAVGNDV  169

Query  778   KCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDME  957
             + A                           EM+LAEFAADVESLLGKGL++E   SF ME
Sbjct  170   ETADAAVSESKAFLACNGQDADGSHGLFPSEMDLAEFAADVESLLGKGLENE---SFGME  226

Query  958   GLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYT  1137
              LG      +++ K     + S  + KV ++ EE               F A  A  H  
Sbjct  227   DLG------LKDSKEKYFRDCSLGNGKVKIEDEES--------------FEAVGAC-HVD  265

Query  1138  SSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKS--------------TILLN  1275
             S   +  +  +L F  D    SP N  EE+     ++  KS               ILL+
Sbjct  266   SEIDMAREPFKLNFSCD----SPGNCGEEDELVKEEVTVKSYEEYEEDTAKKKKRKILLS  321

Query  1276  LDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITF  1455
             L+YE+VI AW+ Q  PW +G RP+ +    WPDC+   G G   +H    D +G MG   
Sbjct  322   LNYESVITAWASQGSPWTSGGRPDFDPDECWPDCM---GTGGTEVHHTYSDLIG-MG---  374

Query  1456  GQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                A+ D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+F
Sbjct  375   AHQALGDG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  429



>ref|XP_002315940.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
 gb|EEF02111.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
Length=447

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 200/466 (43%), Positives = 247/466 (53%), Gaps = 66/466 (14%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------N  471
             ARACD CI KRA WYCAADDAFLCQACDSSVHSAN LARRH RV+LK+ S          
Sbjct  16    ARACDSCIKKRASWYCAADDAFLCQACDSSVHSANLLARRHERVRLKSASLKSSDAGSKE  75

Query  472   IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
                PSWH GFTRK RTPRH          KPV    + +T  ++ I  VPE+ SDE    
Sbjct  76    NSMPSWHGGFTRKARTPRHG---------KPVSRSKIEETTRNIPIPLVPEVGSDEISLE  126

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAA---AAAFNQSKCAgggghghhKNWD  822
             D+E+E   LLYRVPIFDP  A++CT+  +++   A   A   +  + A        K   
Sbjct  127   DNEEEH--LLYRVPIFDPFAAELCTSTTVSNEAGAVVPAGGTDTDQRAADSSGTESKVLL  184

Query  823   GKSStttmppttt--ememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
             G S    +         +M+LAEFAAD+ESLLG+GL++E   SF ME LG          
Sbjct  185   GGSEGKDVESLHGFLPSDMDLAEFAADMESLLGRGLENE---SFGMEELG----------  231

Query  997   KASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFD-TLEL  1173
                 +M+    +E  V      +      E  D  +   A    H      +  D   EL
Sbjct  232   ----LMDCKEENELGVKGYPLGNGKVKVEEEEDAGMEEKAVRECHADIEIDIAKDPPFEL  287

Query  1174  KFDYDN-------------DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQ  1314
              FDYD+             +     N   E  ++    + + T+ L+LDYEAV+ AW+ Q
Sbjct  288   SFDYDSPATCVEEDEKVGIEEGDLKNSDGEYEDDGGAKKKRRTL-LSLDYEAVMTAWASQ  346

Query  1315  RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM-GITFGQAAIADDVWVG  1491
               PW  G RP+ ++   WPD      CG+   H       GD+ G+    AA+ D    G
Sbjct  347   GSPWTNGYRPDFDADECWPDADCMGICGAQLHHP-----YGDVSGLGAHPAALVDG---G  398

Query  1492  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  F
Sbjct  399   REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_008243227.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=451

 Score =   282 bits (722),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 199/465 (43%), Positives = 244/465 (52%), Gaps = 67/465 (14%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV LKT S+++P      
Sbjct  16    ARACDSCIRKRARWYCAADDAFLCQACDSSVHSANQLARRHERVLLKTASSLKPTDKDDQ  75

Query  481   ---------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
                      PSWHRGF RK RTPR    +    +                    VPE+ +
Sbjct  76    VSVSDNPAAPSWHRGFRRKARTPRQGKHKCQEGSRN--------------RFPQVPEVGA  121

Query  634   DENYSHDDEKED--QLLLYRVPIFDPVVADICTTLNITDYDAAAAA----FNQSKCAggg  795
             D++ S+D+E E+  Q LLYRVP+FDP VA++CT     + +  A A     N    +   
Sbjct  122   DDSNSYDEENEEDQQQLLYRVPVFDPFVAEMCTATTSANSNEEAVANYELANTGDVSKVS  181

Query  796   ghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLG  975
                 + N +G              +M+LAEFAADV+SLLGKGL+D+E   F MEGLG + 
Sbjct  182   SSSPNYNHNGHDG------FLLPSDMDLAEFAADVDSLLGKGLEDDE--CFGMEGLGLM-  232

Query  976   GNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANA----NHHYTSS  1143
               + +E +++  ++     E+                    +I M           Y  S
Sbjct  233   --DSKENESNCRVKLEDEEEEDEEGGTGGVNFMGCELGETPEIDMMREPFVLNFEDYDDS  290

Query  1144  SSLCF---DTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQ  1314
                C    D L +    DN Y   + + EE      K   K  I L LDYEAVI AW   
Sbjct  291   PQSCGEQDDKLGVGM-MDNTYSGDHQQHEEVHAGASKSSKKKEIFLRLDYEAVITAWDGS  349

Query  1315  RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGR  1494
               PW +G RP+ NS    PDC+       G      +   GD+   +   AIAD    GR
Sbjct  350   --PWTSGGRPDFNS-ECLPDCM-------GVCGTELHFPYGDLNGLWVHPAIADG---GR  396

Query  1495  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+F
Sbjct  397   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  441



>ref|XP_008339676.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=453

 Score =   282 bits (722),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 197/461 (43%), Positives = 248/461 (54%), Gaps = 57/461 (12%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLC+ACDS+VHSAN LARRH RV LKT S+++P      
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCEACDSAVHSANDLARRHERVLLKTASSLKPSNKDDR  75

Query  481   ----------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                       PSWHRGFTRKPRTPR           K + HH   K  +      VPE+ 
Sbjct  76    TXAVSKTSXAPSWHRGFTRKPRTPR---------GGKSMTHHGKSKEGIRNLFPQVPEVG  126

Query  631   SDENYSHDDEK-EDQLLLYRVPIFDPVVADICTTLNITDYDAAA--AAFNQSKCA-----  786
              D+N S+D+E  EDQ LLYRVPIFDP VA++C+    +  DA A   A N S  +     
Sbjct  127   GDDNNSYDEENDEDQQLLYRVPIFDPSVAELCSNSGNSSEDAVANYEASNLSTVSDHVGS  186

Query  787   gggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
                      N++G                 LAEFAADV+SLLG+GL+D++   F MEGLG
Sbjct  187   QSKAVSSLPNFNGHDGFLLPSDMD------LAEFAADVDSLLGRGLNDDQ--CFGMEGLG  238

Query  967   FLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSS  1146
              L     +E K    +E     + +            +      + F+  N   +  S +
Sbjct  239   -LRDCKEKESKGRVKLEEDDDQDGIDGVDFMGCQLGESENDMMREPFV-LNFEDYDDSPA  296

Query  1147  SLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPW  1326
             S      ++    D++    +  +E + +     + + TI L LDYEAVI AW     PW
Sbjct  297   SCGEQDDKMIVGIDSNCTEDHEHEEADEDATDNXKKRKTI-LRLDYEAVITAWDGS--PW  353

Query  1327  ITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
              +G RP+ +S    PD +    CG G  +       GD+       A+ D    GREARV
Sbjct  354   TSGDRPDFDSEF-LPDYMGV--CGPGLHYP-----YGDLNGIGVHPAMVDG---GREARV  402

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR++F
Sbjct  403   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_008352923.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=453

 Score =   282 bits (721),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 197/461 (43%), Positives = 248/461 (54%), Gaps = 57/461 (12%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLC+ACDS+VHSAN LARRH RV LKT S+++P      
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCEACDSAVHSANDLARRHERVLLKTASSLKPSNKDDR  75

Query  481   ----------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                       PSWHRGFTRKPRTPR           K + HH   K  +      VPE+ 
Sbjct  76    TXAVSKTSXAPSWHRGFTRKPRTPR---------GGKSMTHHGKSKEGIRNLFPQVPEVG  126

Query  631   SDENYSHDDEK-EDQLLLYRVPIFDPVVADICTTLNITDYDAAA--AAFNQSKCA-----  786
              D+N S+D+E  EDQ LLYRVPIFDP VA++C+    +  DA A   A N S  +     
Sbjct  127   GDDNNSYDEENDEDQQLLYRVPIFDPSVAELCSNSGNSSEDAVANYEASNLSTVSDHVGS  186

Query  787   gggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
                      N++G                 LAEFAADV+SLLG+GL+D++   F MEGLG
Sbjct  187   QSKAVSSLPNFNGHDGFLLPSDMD------LAEFAADVDSLLGRGLNDDQ--CFGMEGLG  238

Query  967   FLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSS  1146
              L     +E K    +E     + +            +      + F+  N   +  S +
Sbjct  239   -LRDCKEKESKGRVKLEEDDDQDGIDGVDFMGCQLGESENDMMREPFV-LNFEDYDDSPA  296

Query  1147  SLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPW  1326
             S      ++    D++    +  +E + +     + + TI L LDYEAVI AW     PW
Sbjct  297   SCGEQDDKMIVGIDSNCTEDHEHEEADEDATDNRKKRKTI-LRLDYEAVITAWDGS--PW  353

Query  1327  ITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
              +G RP+ +S    PD +    CG G  +       GD+       A+ D    GREARV
Sbjct  354   TSGDRPDFDSEF-LPDYMGV--CGPGLHYP-----YGDLNGIGVHPAMVDG---GREARV  402

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR++F
Sbjct  403   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Erythranthe guttata]
Length=460

 Score =   281 bits (720),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 199/479 (42%), Positives = 251/479 (52%), Gaps = 85/479 (18%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
             + RACD C+ KRARWYCAADDAFLCQ+CDSSVHSANPLARRH RV+LKT S         
Sbjct  16    SVRACDNCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRLKTTSFKSSLDGSS  75

Query  469   ------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                    I PP+WH+GFTRK RTPR    + N+N  +    H             VPE+C
Sbjct  76    DQLPQIQIPPPTWHQGFTRKARTPRQK--KNNSNKQRSSFGH------------LVPEIC  121

Query  631   SDENYSHDDEKEDQL---LLYRVPIFDPVVADICTTLNITDYDAAAAA---FNQSKCAgg  792
             S+ + S+++E+E++    LLYRVPIFDP VA++CT  N  + +         N ++    
Sbjct  122   SEADNSNEEEEEEENEEQLLYRVPIFDPFVAELCTPFNNNNNNNNNNNNNIHNGTETCES  181

Query  793   gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
              G     +  G              EM+LAEFAADVESLLGKGL+DE   SFDMEGLG L
Sbjct  182   KGELVISD-GGFGEEMNHLQGFLPSEMDLAEFAADVESLLGKGLEDE---SFDMEGLGLL  237

Query  973   GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSL  1152
               ++ E EK       S R +      E                      N  +     +
Sbjct  238   DCDD-EREKLKWANLVSERVKVEDDDEECN--------------------NGEFI---DI  273

Query  1153  CFDTLELKFDYDNDYYSPNN---------------ekeeegeellkMRNKSTILLNLDYE  1287
               +T EL FDY++     +                      +   KM +   I L LDY+
Sbjct  274   GRETFELNFDYNSPITGEDEEEEEEDNKIENVEPIAMNNFEDSNSKMFDSKKIFLRLDYD  333

Query  1288  AVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTI-----HAAAYDGVGDMGIT  1452
              V+ +W +++ PW TG+RP+++S   WPDC     CG   +     H      +   G  
Sbjct  334   GVLSSWDERKSPWTTGERPDLDSDECWPDC--SGTCGKMHVYGNHHHDMGMMMMMMGGGG  391

Query  1453  FGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                 A+   V  GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF
Sbjct  392   THSGAVVASVDGGRQARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  450



>gb|KHN11420.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=417

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 199/481 (41%), Positives = 248/481 (52%), Gaps = 98/481 (20%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  A+ GK    ARACD CI KRARWYCAADDAFLCQACDSSVH ANPLARRH RV+LKT
Sbjct  8     AANAVGGK---TARACDGCITKRARWYCAADDAFLCQACDSSVHLANPLARRHERVRLKT  64

Query  463   LS------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
              S        +PP+WH   T+KPRTPRH     NNN             P HL    VPE
Sbjct  65    ASYKSTDERRQPPTWH---TKKPRTPRHGKHSRNNN-------------PFHL----VPE  104

Query  625   MCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTT----LNITDYDAAAAAFNQSKCAgg  792
               S+E  SHD+ +E   L+YRVPI DP VA++C T     ++T  D    A   +     
Sbjct  105   EGSEEANSHDENEEQ--LVYRVPIVDPFVAELCGTNSSPSSVTSTDQGVVAAAAASAEVE  162

Query  793   gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
                    ++   S+           + ELAEFAADVES LG+GL   E     ME LG +
Sbjct  163   YKGIQSNDFCSNSNEIENLHGMLPSDAELAEFAADVESFLGRGL---ENKCVGMEELGLV  219

Query  973   -----------GGNNVEEEKASTM-MEFSRRHekvvvkveeedapapaceaadddIFMAA  1116
                        G   VEEE++  M M+  R                              
Sbjct  220   DTKEEECSVGSGKVKVEEEESPLMEMDMGR-----------------------------D  250

Query  1117  NANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVI  1296
             + +   +     C +  E+K    +D    N   E +  +  +++ K  + L LDYEA+I
Sbjct  251   DQSFELSFDYETCEEVKEMKV---SDLELGNELGEMKENDDDEVKRKK-VSLQLDYEAII  306

Query  1297  LAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIAD  1476
             +AW+ Q+ PW T  +  ++    W  C+    CG+   H   Y  +G  GI    + I D
Sbjct  307   IAWASQKSPWTTADKQNLDPDECWHQCMG--SCGTAFHH--PYGELGGFGI---HSVIVD  359

Query  1477  DVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLLD  1641
                 GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+     FPLL+
Sbjct  360   G---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAPPTFPLLN  416

Query  1642  Q  1644
             +
Sbjct  417   K  417



>gb|KEH44219.1| zinc finger constans-like protein [Medicago truncatula]
Length=436

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 201/471 (43%), Positives = 252/471 (54%), Gaps = 81/471 (17%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
              ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV+LKT S         
Sbjct  16    TARACDSCITKRARWYCAADDAFLCQACDSSVHSANSLARRHERVRLKTASYKSINGDEF  75

Query  469   -NIEPPSWHRGFTRKPRTPRHA-HGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDEN  642
              N  P S   GFT+K RTPR   H   ++++S+P  +++ +  P HL    VPE+  DE 
Sbjct  76    FNCGPFS---GFTKKARTPRQGKHKSKSSSSSEPARNNNNI--PFHL----VPELGFDEV  126

Query  643   YSHDDEKEDQLLLYRVPIFDPVVADICT-------TLNITDYDAAAAAF----NQSKCAg  789
              S+  E+ +  LLYRVPIFDP +AD+CT       T         A+AF      ++   
Sbjct  127   NSNSIEENEAQLLYRVPIFDPSIADLCTSPPSVCSTEGGLGVVVVASAFAPDVKNNESES  186

Query  790   ggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                 G   N++ +S            ++ELAEFAADVESLLG+GL++E      ME LG 
Sbjct  187   RVQLGSDNNYEMES-----FHGLLPSDIELAEFAADVESLLGRGLENE---CIGMEELGL  238

Query  970   LGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSS  1149
             +   + E EK     +                           ++    N       SS 
Sbjct  239   IDTKHEESEKWKCGGKVKEE------------------GEECYEVVEGDNMMEIGKESS-  279

Query  1150  LCFDTLELKFDYDNDYYSPNNekeeegeellk---MRNKSTILLNLDYEAVILAWSDQRC  1320
                   EL FDYD+ + +    KE+ GE+       + K  I L LDY+AVI+AW  Q+C
Sbjct  280   -----FELNFDYDDSHETCEEVKEKCGEQNENNDYNKGKRKISLQLDYDAVIIAWDSQKC  334

Query  1321  PWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREA  1500
             PW  G +P +++   WPDC+       GT     +   G+ G       + D    GREA
Sbjct  335   PWTNGDKPILDADENWPDCM-------GTFGTEVHYAYGEFGGYGCHPVMVDG---GREA  384

Query  1501  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLL  1638
             RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+     FPLL
Sbjct  385   RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPLL  435



>ref|XP_009356747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=453

 Score =   280 bits (716),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 195/455 (43%), Positives = 247/455 (54%), Gaps = 45/455 (10%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLC+ACDS VHSAN LARRH RV LKT S+++P      
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCEACDSDVHSANQLARRHERVLLKTASSLKPSNKDDR  75

Query  481   ----------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                       PSWHRGFTRKPRTPR           K + HH   K  +      VPE+ 
Sbjct  76    TTAVSKTSAAPSWHRGFTRKPRTPR---------GGKSMTHHGKSKEGIRNLFPQVPEVG  126

Query  631   SDENYSHDDE-KEDQLLLYRVPIFDPVVADICTTLNITDYDAAAA-AFNQSKCAgggghg  804
              D+N S+D+E +EDQ LLYRVPIFDP VA++C+    +  DAAA    N           
Sbjct  127   GDDNNSYDEENEEDQQLLYRVPIFDPSVAELCSNSGNSSEDAAANYEANNLSTVSDNVGS  186

Query  805   hhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNN  984
               K      +           +M+LAEFAADV+SLLG+GL+D++     MEGLG L    
Sbjct  187   QSKAVSSLPNCNGHDGFLLPSDMDLAEFAADVDSLLGRGLNDDQ--CIGMEGLG-LRDCK  243

Query  985   VEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDT  1164
              +E K    +E     + +            +      + F+  N   +  S +S     
Sbjct  244   EKESKGRVKLEEDDDQDGIDGVDFMGCQLGESEIDMMKEPFV-LNFEDYDDSPASCGEQD  302

Query  1165  LELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRP  1344
              ++    D++    +  +E + + +   + + TI L LDYEAVI AW     PW +G RP
Sbjct  303   DKMIVGIDSNCTEDHEHEEADEDAIDNSKKRKTI-LRLDYEAVITAWDGS--PWTSGDRP  359

Query  1345  EMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREK  1524
             + +S    PD +    CG G  +       GD+       A+ D    GREARVSRYREK
Sbjct  360   DFDSEC-LPDYMGV--CGPGLHYP-----YGDLNGIGVHPAMVDG---GREARVSRYREK  408

Query  1525  RRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             RRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR++F
Sbjct  409   RRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>gb|KDP29405.1| hypothetical protein JCGZ_18326 [Jatropha curcas]
Length=438

 Score =   280 bits (715),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 206/450 (46%), Positives = 256/450 (57%), Gaps = 48/450 (11%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----NIEP-  480
              ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV+LKT S    N+   
Sbjct  15    TARACDSCIRKRARWYCAADDAFLCQACDSSVHSANSLARRHERVRLKTASLKSLNLFSK  74

Query  481   ------PSWHRGFTRKPRTPRHAHG-RYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE  639
                   PSWH+GFTRK RTPRH     + + N + + +H          I  VPE+ SDE
Sbjct  75    ESTSCVPSWHQGFTRKARTPRHGKSVNFISKNEEKIRNH----------IPFVPELGSDE  124

Query  640   NYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNW  819
               + ++E +++ LLYRVPIFDP VA++C      + +   A        G          
Sbjct  125   --TSNEENDEEQLLYRVPIFDPFVAELCAPTVSNEAETIIADRTVGDVNGVESKTPSLGC  182

Query  820   DGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEK  999
             D   S           +M+LAEF+ADVESLLG+GL++E   SF ME LG +   + +EE+
Sbjct  183   DVGQS--LHGCGIMPSDMDLAEFSADVESLLGRGLENE---SFGMEELGLM---DCKEEE  234

Query  1000  ASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKF  1179
              S      +   +   + EEED           +I MA      +    S  +D+     
Sbjct  235   YS----LGKVKVEEEKEEEEEDDDDVRECQVHTEIDMAREPPFEF----SFDYDSTTCGD  286

Query  1180  DYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSH  1359
             D +      N E E + +E L  + K  ILL LDYEAVI AW+ Q  PWITG +P++N  
Sbjct  287   DDEKVELKKNGELEGDDDEKLNKKKKRKILLRLDYEAVITAWASQGSPWITGNQPDINPD  346

Query  1360  HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRL  1539
               W DC+     G+  +H +  D  G +GI   Q A+ D    GREARVSRYREKRRTRL
Sbjct  347   DCWLDCMGIY--GAEVLHHSYGDHNGGIGI---QPAMTDG---GREARVSRYREKRRTRL  398

Query  1540  FSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             FSKKIRYEVRKLNAEKRPRMKGRFVKRANF
Sbjct  399   FSKKIRYEVRKLNAEKRPRMKGRFVKRANF  428



>ref|XP_003555902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Glycine 
max]
Length=418

 Score =   278 bits (711),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 202/482 (42%), Positives = 250/482 (52%), Gaps = 99/482 (21%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  A+ GK    ARACD CI KRARWYCAADDAFLCQACDSSVH ANPLARRH RV+LKT
Sbjct  8     AANAVGGK---TARACDGCITKRARWYCAADDAFLCQACDSSVHLANPLARRHERVRLKT  64

Query  463   LS------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
              S        +PP+WH   T+KPRTPRH     NNN             P HL    VPE
Sbjct  65    ASYKSTDERRQPPTWH---TKKPRTPRHGKHSRNNN-------------PFHL----VPE  104

Query  625   MCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTT----LNITDYDAAAAAFNQSKCAgg  792
               S+E  SHD+ +E   L+YRVPI DP VA++C T     ++T  D    A   +  A  
Sbjct  105   EGSEEANSHDENEEQ--LVYRVPIVDPFVAELCGTNSSPSSVTSTDQGVVAAAAAASAEV  162

Query  793   gghghhKN-WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                G   N +   S+           + ELAEFAADVES LG+GL   E     ME LG 
Sbjct  163   EYKGIQSNDFCSNSNEIENLHGMLPSDAELAEFAADVESFLGRGL---ENKCVGMEELGL  219

Query  970   L-----------GGNNVEEEKASTM-MEFSRRHekvvvkveeedapapaceaadddIFMA  1113
             +           G   VEEE++  M M+  R                             
Sbjct  220   VDTKEEECSVGSGKVKVEEEESPLMEMDMGR-----------------------------  250

Query  1114  ANANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAV  1293
              + +   +     C +  E+K    +D    N   E +  +  +++ K  + L LDYEA+
Sbjct  251   DDQSFELSFDYETCEEVKEMKV---SDLELGNELGEMKENDDDEVKRKK-VSLQLDYEAI  306

Query  1294  ILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIA  1473
             I+AW+ Q+ PW T  +  ++    W  C+    CG+   H   Y  +G  GI    + I 
Sbjct  307   IIAWASQKSPWTTADKQNLDPDECWHQCMG--SCGTAFHH--PYGELGGFGI---HSVIV  359

Query  1474  DDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLL  1638
             D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+     FPLL
Sbjct  360   DG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAPPTFPLL  416

Query  1639  DQ  1644
             ++
Sbjct  417   NK  418



>ref|XP_006468698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO76999.1| hypothetical protein CISIN_1g012558mg [Citrus sinensis]
Length=461

 Score =   277 bits (709),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 204/464 (44%), Positives = 247/464 (53%), Gaps = 59/464 (13%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----------  468
             ARACD CI KRARWYCAADDAFLCQACD+SVHSANPLARRH RV+LKT S          
Sbjct  16    ARACDNCIKKRARWYCAADDAFLCQACDASVHSANPLARRHERVRLKTASNKSSGSESLS  75

Query  469   -NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
              N   PSWHRGFTRK RTPR           KP+ +   V  PL      VPE+ +DE  
Sbjct  76    DNTHVPSWHRGFTRKARTPR--------KTGKPIRN---VTLPL------VPEVGADE-L  117

Query  646   SHDDEKEDQLLLY-RVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
             SH++ +EDQLL   RVP +DP VA++CT+   ++  A          A           +
Sbjct  118   SHEENEEDQLLYNCRVPTYDPFVAELCTSTANSNEAAEHNNATAKTDAHDDESTADDAVN  177

Query  823   GKSSt---------ttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLG  975
             G  S                    +M+LAEFAADVES+LG+GL +E   SF ME LG + 
Sbjct  178   GSESKPVRACYNGDVDSLHGFLPSDMDLAEFAADVESMLGRGLVNE---SFAMEELGLVD  234

Query  976   GN------NVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYT  1137
                      VE+++ +   E +R  E+  V     +         + + F     N  Y 
Sbjct  235   FREKDFTVKVEQQEGAVEAEGARDIEECKVFDNNNNYNNHDQIDLEREPF---ELNFDYD  291

Query  1138  SSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQR  1317
             S ++ C D  E K   +    S     E++ E     + K  ILL+LDYEAVI  W+ Q 
Sbjct  292   SPAT-CGDEDE-KILKEEMETSGEGCHEDDDEAKKNNKKKRKILLSLDYEAVINTWASQG  349

Query  1318  CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGRE  1497
              PW TG RP  +    WPDC+    CG+   H       GD        A  D    GRE
Sbjct  350   SPWTTGDRPNFDPDECWPDCMGT--CGT-EGHKYLQHPYGDFSGIGAHPATVDG---GRE  403

Query  1498  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+F
Sbjct  404   ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  447



>ref|XP_006448477.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
 gb|ESR61717.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
Length=461

 Score =   276 bits (706),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 202/464 (44%), Positives = 247/464 (53%), Gaps = 59/464 (13%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----------  468
             ARACD CI KRARWYCAADDAFLCQACD+SVHSANPLARRH RV+LKT S          
Sbjct  16    ARACDNCIKKRARWYCAADDAFLCQACDASVHSANPLARRHERVRLKTASNKSSGSESLS  75

Query  469   -NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
              N   PSWHRGFTRK RTPR           KP+ +   V  PL      VPE+ +DE  
Sbjct  76    DNTHVPSWHRGFTRKARTPR--------KTGKPIRN---VTLPL------VPEVGADE-L  117

Query  646   SHDDEKEDQLLLY-RVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
             SH++ +EDQLL   RVP +DP VA++CT+   ++  A          A           +
Sbjct  118   SHEENEEDQLLYNCRVPTYDPFVAELCTSTANSNEAAENNNATAKTDAHDDESTADDAVN  177

Query  823   GKSSt---------ttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLG  975
             G  S                    +M+LAEFAADVES+LG+GL +E   SF ME LG + 
Sbjct  178   GSESKPVRACYNGDVDSLHGFLPSDMDLAEFAADVESMLGRGLVNE---SFAMEELGLVD  234

Query  976   GN------NVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYT  1137
                      VE+++ +   E +R  E+  V     +         + + F     N  Y 
Sbjct  235   FREKDFTVKVEQQEGAVEAEGARDIEECKVFDNNNNYNNHDQIDLEREPF---ELNFDYD  291

Query  1138  SSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQR  1317
             S ++ C D  E K   +    S     E++ E     + K  ILL+LDYE+VI +W+ Q 
Sbjct  292   SPAT-CGDEDE-KIVKEEMETSGEGCHEDDDEAKKNNKKKRKILLSLDYESVIKSWASQG  349

Query  1318  CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGRE  1497
              PW  G RP  +    WPDC+    CG+   H       GD        A  D    GRE
Sbjct  350   SPWTNGDRPNFDPEECWPDCMGT--CGT-EGHKYLQHPYGDFSGIGAHPATVDG---GRE  403

Query  1498  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+F
Sbjct  404   ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  447



>ref|XP_008360050.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   273 bits (698),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 194/461 (42%), Positives = 246/461 (53%), Gaps = 56/461 (12%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLCQACDS+VHSAN LA RH RV LKT S+++P      
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCQACDSAVHSANQLAHRHKRVLLKTASSLKPSNKDDR  75

Query  481   ----------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                       PSWHRGFTRK RTPR           K + HH   +  +      VPE+ 
Sbjct  76    ASAVSETSAAPSWHRGFTRKARTPR---------GGKSMTHHGKSQDGVRNLFPQVPEVG  126

Query  631   SDENYSHDDEK-EDQLLLYRVPIFDPVVADICTTLNITDYDAAA-------AAFNQSKCA  786
              D+N S+D+E  EDQ LLYRVPIFDP VA++C   + +  DA            +    +
Sbjct  127   GDDNNSYDEENTEDQQLLYRVPIFDPFVAELCNNSDXSKEDAVPNYEATNLITVSDHVGS  186

Query  787   gggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
                      N++G  +           +M+LAEFAADV+SLLG+GLDD+E   F ME LG
Sbjct  187   ESKAVSSLPNFNGHDA------FLPPSDMDLAEFAADVDSLLGRGLDDDE--CFGMERLG  238

Query  967   FLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSS  1146
              +     +E      +E     E              +      + F A N   +  S +
Sbjct  239   LMDCKK-KESNGRVKLEEDDDQEGTDNVDFMGCQLGESEIDMXREPF-ALNIEDYDDSPA  296

Query  1147  SLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPW  1326
             S      +L+    ++  + ++E+EE  ++      K  ++L LDYEAVI AW     PW
Sbjct  297   SCGEQDDKLRVGIYSNCSTEDHEREEADDDAXDNSKKRKMILRLDYEAVITAWDGS--PW  354

Query  1327  ITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
              +G RP+ +S    PD +    CG     A  +   GD        A+AD     REARV
Sbjct  355   TSGDRPDFDS-ECLPDYM--SACG-----AELHYPYGDXNGLGXHPAMADGX---REARV  403

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK+A+F
Sbjct  404   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKASF  444



>ref|XP_008389292.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   273 bits (698),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 194/461 (42%), Positives = 246/461 (53%), Gaps = 56/461 (12%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD CI KRARWYCAADDAFLCQACDS+VHSAN LA RH RV LKT S+++P      
Sbjct  16    ARACDSCIKKRARWYCAADDAFLCQACDSAVHSANQLAHRHKRVLLKTASSLKPSNKDDR  75

Query  481   ----------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                       PSWHRGFTRK RTPR           K + HH   +  +      VPE+ 
Sbjct  76    ASAVSETSAAPSWHRGFTRKARTPR---------GGKSMTHHGKSQDGVRNLFPQVPEVG  126

Query  631   SDENYSHDDEK-EDQLLLYRVPIFDPVVADICTTLNITDYDAAA-------AAFNQSKCA  786
              D+N S+D+E  EDQ LLYRVPIFDP VA++C   + +  DA            +    +
Sbjct  127   GDDNNSYDEENTEDQQLLYRVPIFDPFVAELCNNSDXSKEDAVPNYEATNLITVSDHVGS  186

Query  787   gggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
                      N++G  +           +M+LAEFAADV+SLLG+GLDD+E   F ME LG
Sbjct  187   ESKAVSSLPNFNGHDA------FLPPSDMDLAEFAADVDSLLGRGLDDDE--CFGMERLG  238

Query  967   FLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSS  1146
              +     +E      +E     E              +      + F A N   +  S +
Sbjct  239   LMDCXK-KESNGRVKLEEDDDQEGTDNVDFMGCQLGESEIDMXREPF-ALNIEDYDDSPA  296

Query  1147  SLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPW  1326
             S      +L+    ++  + ++E+EE  ++      K  ++L LDYEAVI AW     PW
Sbjct  297   SCGEQDDKLRVGIYSNCSTEDHEREEADDDAXDNSKKRKMILRLDYEAVITAWDGS--PW  354

Query  1327  ITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
              +G RP+ +S    PD +    CG     A  +   GD        A+AD     REARV
Sbjct  355   TSGDRPDFDS-ECLPDYM--SACG-----AELHYPYGDXNGLGXHPAMADGX---REARV  403

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK+A+F
Sbjct  404   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKASF  444



>ref|XP_008240273.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=480

 Score =   270 bits (689),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 193/463 (42%), Positives = 249/463 (54%), Gaps = 54/463 (12%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----------  468
             ARACD C+ KRARW+CAADDAFLCQ CD SVHSAN LA RH RV+L+  S          
Sbjct  15    ARACDSCLIKRARWFCAADDAFLCQRCDGSVHSANQLASRHERVKLQAASSKPNQSTLLA  74

Query  469   -NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM-CSDEN  642
              +  PP+WH+GFTRK RTPRH      NN    +   D  K  L+  +  VPE+ C + N
Sbjct  75    ADQSPPAWHKGFTRKARTPRH------NNKPPFMAKDDKEKVSLNPPLPFVPEIGCEEAN  128

Query  643   YSHDD-EKED-QLLLYRVPIFDPVVADIC-----------TTLNITDYDAAAAAFNQSKC  783
             Y  DD E ED + LLYRVPI+DP  A++C           + +N+ D        N  + 
Sbjct  129   YMDDDGENEDLEQLLYRVPIYDPFAAELCNMSSHEVGNITSAINLDDEVTEMGRGNHHEV  188

Query  784   AgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEG-  960
                    ++ N     +     P     +MELAEFAADVE+L+G GLDDE+  S D++G 
Sbjct  189   GDDEEENNNNN--YGGNDLDNLPGFLPSDMELAEFAADVENLIGGGLDDED--SGDIKGV  244

Query  961   LGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTS  1140
             LG L  + +E +     ++   ++  +    +       A     +   +  N+++    
Sbjct  245   LGLLDDSKLEGDGG---VDVCMKNVDINEDRKAVKVEEEAEGMEFNPSMLDWNSDYELRL  301

Query  1141  SSSLCFDTLELKFDYDND---YYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSD  1311
             SSS     L +  + +          +  E    +  +M  K  I L LDYEA+I AW++
Sbjct  302   SSS----PLPMGGEEEEKVVFLMGAQSSDEVALMDNKQMMMKRKICLRLDYEAIITAWAN  357

Query  1312  QRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVG  1491
             Q  PW TG RPE+N   GW DC+     GS  IH +   G    G   G+    DD   G
Sbjct  358   QGSPWTTGTRPELNPDDGWLDCMGM--WGSDQIHQSHGHGES-AGCVGGR---GDD--RG  409

Query  1492  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  410   REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  452



>ref|XP_010066724.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Eucalyptus grandis]
 gb|KCW64739.1| hypothetical protein EUGRSUZ_G02322 [Eucalyptus grandis]
Length=463

 Score =   268 bits (686),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 199/507 (39%), Positives = 257/507 (51%), Gaps = 94/507 (19%)
 Frame = +1

Query  262   IEIKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRH  441
             + I  + A  A  GK    ARACD CI +RARWYCAADDAFLCQ+CD SVHSANPLARRH
Sbjct  5     VMIPHKNAANAFSGK---TARACDNCIQRRARWYCAADDAFLCQSCDRSVHSANPLARRH  61

Query  442   ARVQLKTLSNIE-------------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDV  582
              RV+LKT +  +             P SWHRGFT+KPRTPR A    +   +KP    + 
Sbjct  62    ERVRLKTAATPQKHLGEFSSHHRKKPSSWHRGFTKKPRTPRGAKSALHRA-TKP---ENA  117

Query  583   VKTPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAA  762
              + P  +    VPE+  DE     +E+ ++ LLYRVP +DP VA++CT+       A A 
Sbjct  118   ARNPFPV----VPEVGGDET---SNEESEEHLLYRVPAYDPFVAEMCTSKG-----AEAT  165

Query  763   AFN---QSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDE  933
             AF+   ++  A  G         G +            + +LAEFAADVESLLG+ LD E
Sbjct  166   AFSAEPETVAAFDGSGDGDNRSKGLTDEVENLQEFLPSDADLAEFAADVESLLGRALDTE  225

Query  934   EESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMA  1113
                SF +EG   LG  + +E   ++M                  +         + +   
Sbjct  226   ---SFGIEG---LGFVDCKERDDNSM-------------DCSLGSGGAIKVEEKEGVAEV  266

Query  1114  ANANHHYTSSSSLCFDTLELKFDYDNDYYSPN----------------------Nekeee  1227
                  H      +  +T EL FDYD+     +                      +E    
Sbjct  267   VVELGHDDMEMDVSKETFELNFDYDSPTTCGDEEEEAKVIVELEGEKNVENCGADEGTNI  326

Query  1228  geellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGT  1407
               E  K + K  I L LDYEAVI AW+ Q  PW TG+RP+ +  + WPD +   G     
Sbjct  327   SSEERKKKKKREIFLRLDYEAVISAWAGQGSPWTTGERPDFSPDNCWPDFMGMSGLEFQN  386

Query  1408  IHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1587
             ++       G+ G+  G   + D    GREA+VSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  387   LY-------GEAGVHGGHVGMGD---AGREAKVSRYREKRRTRLFSKKIRYEVRKLNAEK  436

Query  1588  RPRMKGRFVKRAN--------FPLLDQ  1644
             RPRMKGRFVKRA+        FPLL++
Sbjct  437   RPRMKGRFVKRASSASSSAPAFPLLNK  463



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 185/463 (40%), Positives = 242/463 (52%), Gaps = 72/463 (16%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----------  468
             ARACD C+ KRARW+CAADDAFLCQ CD SVHSAN LA RH RV+L+  S          
Sbjct  16    ARACDSCLIKRARWFCAADDAFLCQRCDGSVHSANQLASRHERVKLQAASSKSNQSTLLA  75

Query  469   -NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM-CSDEN  642
              +  PP+WH+GFTRK RTPRH      NN    +   D  K  L+  +  VPE+ C + N
Sbjct  76    ADQSPPAWHKGFTRKARTPRH------NNKPPFMAKDDKEKVSLNPPLPFVPEIGCEEAN  129

Query  643   Y--SHDDEKEDQLLLYRVPIFDPVVADIC-----------TTLNITDYDAAAAAFNQSKC  783
             Y    ++ ++ + LLYRVPI+DP  A++C           + +N+ D        N  + 
Sbjct  130   YMDDDEENEDLEQLLYRVPIYDPFAAELCNMSSHEVGNSTSAINLDDEVTEMGRGNHHEV  189

Query  784   AgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEG-  960
                    ++ N     +     P     +MELAEFAADVE+L+G GLDDE+  S D++G 
Sbjct  190   GDDDEENNNNN--YGGNELDNLPGFLPSDMELAEFAADVENLIGGGLDDED--SGDIKGV  245

Query  961   LGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHY-T  1137
             LG L  + +E    +  ++   ++  +    +       A     +   +  N+++    
Sbjct  246   LGLLDDSKLE---GNGGVDVCMKNVDINEDRKAVKVEEEAEGMEFNPSMLDWNSDYELRL  302

Query  1138  SSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQR  1317
             SSS L     E K  +        +  E    +  +M  K  I L LDYEA+I AW++Q 
Sbjct  303   SSSPLPMGGEEEKVVF---LMGARSSDEVALMDNKQMMMKRKICLRLDYEAIITAWANQG  359

Query  1318  CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGRE  1497
              PW TG RPE+N   GW DC+  RG                           DD   GRE
Sbjct  360   SPWTTGTRPELNPDDGWLDCMGGRG---------------------------DD--RGRE  390

Query  1498  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR +
Sbjct  391   ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  433



>ref|XP_009347093.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=441

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 194/475 (41%), Positives = 241/475 (51%), Gaps = 96/475 (20%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL--  456
             A  AM G     ARACD C+ KRARW+CAADDAFLCQ CD+ VHSAN LA RH RV+L  
Sbjct  7     AANAMGGN---TARACDSCLVKRARWFCAADDAFLCQRCDALVHSANQLASRHQRVRLQG  63

Query  457   ---------KTLSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKP--VVHHDVVKTPLHL  603
                      + +++   P+WH+GF RK RTPRH        N KP      +  K  LH 
Sbjct  64    SSVKANASVQLIADQAAPAWHKGFKRKARTPRH--------NKKPGFAAKDEQEKVGLHP  115

Query  604   SIVPVPEM-CSDENYSHDDEKED-QLLLYRVPIFDPVVADICTTLNITDYD-----AAAA  762
              +  VPE+ C + N   D+E ED + LLYRVPI+DP  A++C   NI+  D       A 
Sbjct  116   PLPFVPEIGCQETNLMEDEENEDLERLLYRVPIYDPFAAELC---NISSSDQVGNNTGAI  172

Query  763   AFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEES  942
               +  +           N  G              +MELAEFAADVE+LLG GLD   E 
Sbjct  173   DLDDEEIEIRNTGNDLDNLGG----------FLRSDMELAEFAADVENLLGGGLD---ED  219

Query  943   SFDMEG-LGFLGGNNVEE--------EKASTMMEFSRRHekvvvkveeedapapaceaad  1095
               D++G LG L      +        E   ++++++  +E+         +     E   
Sbjct  220   CSDIKGILGLLDEGKEVKVEEEVEGIEFNPSILDWNLYYEQSSAVPVLMGSEEDKEEEEK  279

Query  1096  ddIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLN  1275
               +FM A       SS  + F  +E K                     + M+ K+ I L 
Sbjct  280   VVLFMGAQ------SSDEIGF--MENK--------------------QIVMKRKN-ICLK  310

Query  1276  LDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITF  1455
             LDYEAVI AW+ Q  PW TG RPE+N   GW DC+   G     IH A  D  G +    
Sbjct  311   LDYEAVITAWASQGSPWTTGTRPELNPDEGWLDCM---GMWPTEIHQAHGDSAGCV----  363

Query  1456  GQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
               +   DD    REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  364   --SGRGDD--PRREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  414



>gb|EYU29978.1| hypothetical protein MIMGU_mgv1a007591mg [Erythranthe guttata]
Length=402

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 186/461 (40%), Positives = 222/461 (48%), Gaps = 106/461 (23%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----NIEPP  483
             +ARACD CI KRARWYCAADDAFLCQ+CDSSVHSAN LARRH RV LK+ S      EP 
Sbjct  15    SARACDSCIKKRARWYCAADDAFLCQSCDSSVHSANSLARRHERVLLKSASIHKIKSEPS  74

Query  484   SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEK  663
             +WH+GFTRK RTPRH       N             PL L    VPE+ +      ++E+
Sbjct  75    NWHQGFTRKARTPRH-----KKNGKAAAALFSNTNHPLPL----VPEINNSSEEKSNEEE  125

Query  664   EDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSSttt  843
              ++ LLYRVPIF+PV   I    N ++ +  A                            
Sbjct  126   NEEQLLYRVPIFEPVSDFITHEANTSERNILAPP--------------------------  159

Query  844   mpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL-------GGNNVEEEKA  1002
                  +   M+L EFA   E LLGKG+DD  ES  +MEGLGFL       GG  +   + 
Sbjct  160   -----SSSGMDLDEFA---ECLLGKGMDDFHESFNNMEGLGFLDDCDDENGGRGLSSNEL  211

Query  1003  STMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSS-SLCFDTLELKF  1179
               + + S                            +    NHH       +  +T EL F
Sbjct  212   FWLSDES----------------------------VKVEENHHQIEVEFDMGRETFELNF  243

Query  1180  DYDNDYYSPNNe----------keeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWI  1329
             D+D   YSP                   E   M N    LL LDY  V+ AW   + PW 
Sbjct  244   DFD---YSPTRGEEQEQEEEEIAAFNNFENFAMENYEKTLLKLDYGGVMSAWDKHKSPWT  300

Query  1330  TGQR-PEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
             TG+R PE  S   WP+      CG+  ++       G +      AA  D    GREARV
Sbjct  301   TGERPPEPISGCHWPE--FSGACGTMGVNGE----TGKINENIPAAATGDG---GREARV  351

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             SRYREKRR RLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN 
Sbjct  352   SRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANL  392



>ref|XP_006829901.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score =   253 bits (647),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 186/452 (41%), Positives = 234/452 (52%), Gaps = 104/452 (23%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN----IEPPSW  489
             R CD C   RARWYCAADDAFLC ACD ++HSAN +ARRH RV+LKT S+       PSW
Sbjct  22    RPCDSCGKGRARWYCAADDAFLCHACDGTIHSANSVARRHDRVRLKTSSSHRCEFVLPSW  81

Query  490   HRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKED  669
              RG  R  R   H + +   + +KP           H + + VP+M   +  S  DE ++
Sbjct  82    QRGKARSMRP--HPNMKNPIDGAKP-----------HANPLVVPQM---QEESSPDEVDE  125

Query  670   QLLLYRVPIFDPVVADI-----------CTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
             QLL Y+VP+F+P+ AD+           C     T  + A A F+               
Sbjct  126   QLL-YQVPVFEPMAADLRSSPARATPADCKPTIDTPAEMAVAKFS---------------  169

Query  817   WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
                             ++M+LA+FAADVESLLG+GLD   E +F +EGLG L     EEE
Sbjct  170   ------------AIPSLDMDLADFAADVESLLGQGLD---EDAFGIEGLGLLDNYREEEE  214

Query  997   KASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELK  1176
               ++ ++                      E  +D IF    ++H   +   L  +TLE  
Sbjct  215   GVASRVKVE-------------------EEEDEDGIF--GCSHHPDVAEVELSSETLEFN  253

Query  1177  FDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNS  1356
             FDYD    +P    E++ E+   +  KS I L LDYEAVI AW   R PW TGQRPE N 
Sbjct  254   FDYD----TPTTAGEDDEEKCRIVLEKS-ISLRLDYEAVISAWG--RSPWTTGQRPEFNP  306

Query  1357  HHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTR  1536
                WPD       G+     + Y  VG+   + G          GREARVSRYREKRRTR
Sbjct  307   DDCWPDPFT----GNCVPEMSTYSEVGNATASDG----------GREARVSRYREKRRTR  352

Query  1537  LFSKKIRYEVRKLNAEKRPRMKGRFVKRANFP  1632
             LFSKKIRYEVRKLNAEKRPRMKGRFVKR +FP
Sbjct  353   LFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFP  384



>gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea]
Length=412

 Score =   254 bits (649),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 178/449 (40%), Positives = 215/449 (48%), Gaps = 123/449 (27%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS--NIEPPSW  489
             +ARACD C  KRARWYCAADDAFLCQ+CDSSVHS   L+RRH RV+LKT +  ++ PP+W
Sbjct  57    SARACDNCGKKRARWYCAADDAFLCQSCDSSVHSDRALSRRHERVRLKTSTGEDVSPPTW  116

Query  490   HRGFTRKPRTPRH-AHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKE  666
             HRGFT+K RTPR   +G+++    +P         PL+L    VPE+C +E     +E E
Sbjct  117   HRGFTKKARTPRQKKNGKFHLE--EPTGGKTENHNPLYL----VPEICGEEQSQSHEENE  170

Query  667   DQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStttm  846
             +Q LLYRVP+FDP   +     N +    AA                  + D        
Sbjct  171   EQ-LLYRVPVFDPFGTEAELGSNSSSSAGAAIESRTHNFVSNFNGFLQPDMD--------  221

Query  847   pptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMMEFSR  1026
                       LAEFAADVE LLGKGLDD   S FDME LG        E + + +M    
Sbjct  222   ----------LAEFAADVECLLGKGLDD---SCFDMEELGIFDRPLKSEVETALVM----  264

Query  1027  RHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKF------DYD  1188
                                           N NH     S    D L +        +Y+
Sbjct  265   ------------------------------NENHQIDEKS---IDDLPVPVVPCGGEEYE  291

Query  1189  NDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGW  1368
              D                   +  T  L LD + ++ AW+ +  PWITGQ+P+  S   W
Sbjct  292   ED-------------------DTKTTFLKLDLDGILSAWNSRNTPWITGQKPDSKSIDFW  332

Query  1369  PDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWV-----GREARVSRYREKRRT  1533
             PD                          FG  A   DVW      GREARVSRYREKRRT
Sbjct  333   PD-------------------------FFGTTAARGDVWAAGGDGGREARVSRYREKRRT  367

Query  1534  RLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             RLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  368   RLFSKKIRYEVRKLNAEKRPRMKGRFVKR  396



>ref|XP_009360161.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=447

 Score =   255 bits (651),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 196/470 (42%), Positives = 233/470 (50%), Gaps = 78/470 (17%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK-  459
             A  AM G     ARACD C+ KRARW+CAADDAFLCQ CD+SVHSAN LA RH RV+L+ 
Sbjct  7     AANAMGGN---TARACDSCLVKRARWFCAADDAFLCQRCDASVHSANQLASRHERVRLQG  63

Query  460   -TLSNIEP---------PSWHRGFTRKPRTPRHAHGRYNNNNSKP--VVHHDVVKTPLHL  603
              +    EP         P+WHRG  RK RTPRH        N KP   +  +  K  LH 
Sbjct  64    SSFKANEPMQLTADQATPAWHRGVKRKARTPRH--------NKKPGFPIKEEQEKVGLHP  115

Query  604   SIVPVPEM-CSDENYSHDDEKED-QLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQS  777
              +  VPE+ C + N   D+E ED + LLYRVPI+DP  A +C   +    +    A N  
Sbjct  116   PLPFVPEIGCEEANLMEDEENEDLEQLLYRVPIYDPFAAKLCNISSTDQVENNTDAINLD  175

Query  778   KCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDME  957
                         N +G              EMELAEFAADVE+LLG GLD   E   D++
Sbjct  176   D-EEIEIRNMGDNHEGVQDDLDKLGGFLPTEMELAEFAADVENLLGGGLD---EDCSDIK  231

Query  958   G-LGFL-GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHH  1131
             G LG L  G  V+ E+    MEF+                               + N  
Sbjct  232   GVLGLLDDGKEVKVEEEVEGMEFNPS---------------------------ILDWNLD  264

Query  1132  YTSSSSLCF------DTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAV  1293
             Y  SS++        +  E K        S +     E + +   R K  I L LDYE V
Sbjct  265   YDKSSAVPVQMGNEDNEEEEKLVLLTGAQSSDEMAFMENKHMEMKRKK--ICLRLDYETV  322

Query  1294  ILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIA  1473
             I AW+ Q  PW  G RPE+N   GW DC+   G     I     D  G +      +   
Sbjct  323   ITAWASQGSPWTNGTRPELNPDDGWLDCM---GMWPTEIPQPHGDTAGCV------SGRG  373

Query  1474  DDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  1623
             DD   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR 
Sbjct  374   DD--RGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  421



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 194/460 (42%), Positives = 243/460 (53%), Gaps = 86/460 (19%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-------NIE  477
             ARACD CI KRARWYCAADDAFLCQACDSSVHSANPLARRH RV+LKT S         +
Sbjct  16    ARACDSCITKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRLKTASYKSTDEQQQQ  75

Query  478   PPSWHRGFTRKPRTPRHA-HGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHD  654
             PP+WH   T+K RTPRH  H R +N              P HL    VPE+ S+E  S++
Sbjct  76    PPTWH---TKKARTPRHGKHSRSSN--------------PFHL----VPEVGSEEVNSNE  114

Query  655   DEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN--WDGK  828
             + +E   LLYRVPIFDP +A++C T + +     +     +     G +   ++  +   
Sbjct  115   ENEEQ--LLYRVPIFDPFLAELCGTNSSSPSSVTSTDQGAAAAVAEGENKGVQSNFFYQS  172

Query  829   SStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKAST  1008
             ++           + ELAEFAADVESLLG+GL++E      ME LG +     E  + S 
Sbjct  173   NNEMENLHGMLPSDAELAEFAADVESLLGRGLENE---CVGMEDLGLIDAKEEECSEGSG  229

Query  1009  MMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYD  1188
              ++                            +   +           + F   EL FDY+
Sbjct  230   KVK----------------------------VEEESPEMEMEMVGRDVSF---ELSFDYE  258

Query  1189  NDYYSPNN----ekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNS  1356
                    N    E  +E E+  +M  K  I L LDYE+VI AW+ Q+ PW T  +P ++ 
Sbjct  259   TCEEVKENVCDLEFGKEEEKEEEMMKKKKISLQLDYESVITAWASQKSPWTTPHKPNLDP  318

Query  1357  HHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTR  1536
                W  C+    CG+G      Y  VG  GI      I D    GREARVSRYREKRRTR
Sbjct  319   DECWHHCM--ESCGTGM--DDPYGEVGGFGI---HPMINDG---GREARVSRYREKRRTR  368

Query  1537  LFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLLD  1641
             LFSKKIRYEVRKLNAEKRPRMKGRFVKRA+     FPLL+
Sbjct  369   LFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAPPTFPLLN  408



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   253 bits (647),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 236/449 (53%), Gaps = 54/449 (12%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS--NIEP---  480
              ARACD C+ KRARW+CAADDAFLCQACD+SVHSAN LA RH R++L T S   IE    
Sbjct  15    TARACDSCLKKRARWFCAADDAFLCQACDTSVHSANQLASRHERIRLATSSFMPIETKGD  74

Query  481   ----PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHH--DVVKTPLHLSIVPVPEMCSDEN  642
                 P+WH+GFTRK RTPR        NN   +VH   D  K      +  VPE+  DE 
Sbjct  75    ENSLPTWHQGFTRKARTPR--------NNKASLVHQPKDEEKMAKANPLPLVPEISGDE-  125

Query  643   YSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
              +  DE E+Q L  RVP+FDP  A++C+ L+    +  A      +           N D
Sbjct  126   -TSPDESEEQHLFCRVPVFDPFAAELCSELSDEVQNIQADKGTHDEILTSNELNVLLNDD  184

Query  823   GKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKA  1002
                      P     + ELAEFAADVESLLG GLD   E S  ME  G +     +EE  
Sbjct  185   ----QDLDIPELIASDAELAEFAADVESLLGTGLD---EDSCHMEDPGMMV---CKEEDD  234

Query  1003  STMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFD  1182
                + F  +  KV  + ++E     AC           + N  + SSS +  +  ELK  
Sbjct  235   VVDVSFEDKLVKVEDEDDQEVQAVIACHLDPALDMARESLNWDFDSSSPVIEEEEELKVT  294

Query  1183  YDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHH  1362
              D     P+ + + + EE   M       L L+YE VI AW+ Q  PW  G +PE N   
Sbjct  295   KD----MPDKDIKSKEEERRMMH------LKLNYEEVITAWASQGSPWADGTKPEFNLGD  344

Query  1363  GWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLF  1542
              WPD +   G     +H    +G G      G+ +  D+    REARV+RYREKRRTRLF
Sbjct  345   CWPDFM---GMSLNELHHP--NGAGG-----GRVSSHDE---EREARVTRYREKRRTRLF  391

Query  1543  SKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             SKKIRYEVRKLNAEKRPRMKGRFVKR +F
Sbjct  392   SKKIRYEVRKLNAEKRPRMKGRFVKRTSF  420



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 185/469 (39%), Positives = 226/469 (48%), Gaps = 110/469 (23%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
             AM GK    ARACD C+ KRARWYC ADDAFLCQ CD+SVHSAN LA RH RV+L+T S+
Sbjct  11    AMGGK---TARACDGCLLKRARWYCVADDAFLCQGCDASVHSANQLASRHERVRLETASS  67

Query  472   IE--------------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSI  609
                              P WH+GFTRK RTPRH      NNN   +V       PL    
Sbjct  68    CNNNNKLINEHTDKDTVPVWHQGFTRKARTPRH------NNNKAMLVQQAKANEPL----  117

Query  610   VPVPEM-CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCA  786
               VPE+ C D +   DD+  D+ LLY+VP+FDP  A         D +     +N     
Sbjct  118   --VPEIGCEDGSLQADDQVIDEQLLYQVPVFDPFEA------VEPDENLIVDGYN-----  164

Query  787   gggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
                        DG +            +++LAEFAADVESLLG G    +E S D++  G
Sbjct  165   ---------GQDG-TGDLDDLHGFLPSDLDLAEFAADVESLLGGGGGALDEDSCDVKEFG  214

Query  967   FLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSS  1146
              L     EE  A  +                        E  ++ +  AA          
Sbjct  215   TLLDCKEEETIALNL--------------------KIKAEEVEEAVIAAATR--------  246

Query  1147  SLCFDTLELKFDYDNDYYSPNNekeeegeel-lkMRNKSTILLNLDYEAVILAWSDQRCP  1323
                 + ++  FDY +     +       E     MRN   + L L+Y+AVI AW+ Q CP
Sbjct  247   ----EAIDCNFDYQSPVTGDDTAGLMSTECKPKLMRN---VCLKLNYDAVITAWASQGCP  299

Query  1324  WITGQRPEMNSHHGWPDC-------IMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDV  1482
             W  G RPE+N +H WP C       +    CG G +    + G G               
Sbjct  300   WTAGSRPEINLNHCWPHCTGLCCKDVHHHTCGGGAVLRGCHLGAGG--------------  345

Query  1483  WVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
               GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR +F
Sbjct  346   --GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF  392



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score =   243 bits (621),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 179/480 (37%), Positives = 229/480 (48%), Gaps = 95/480 (20%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  AM GK    ARACD C+ KRARWYCAADDAFLCQ CD+SVHSAN LA RH RV+L+T
Sbjct  7     AANAMGGK---TARACDGCLRKRARWYCAADDAFLCQGCDTSVHSANQLASRHERVRLET  63

Query  463   LS-------------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHL  603
              S                PP+WH+GFTRK RTPR           +  V       P+  
Sbjct  64    ASFSKFSASVTNRTNQDAPPAWHQGFTRKARTPRQNKSMLGQQKDEGKVFSLNPLDPV--  121

Query  604   SIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKC  783
                 VPE+ S++     DE E+QLL  RVP+ +P  A++C  +  +D D  A        
Sbjct  122   ----VPEIGSEDGSV--DENEEQLLC-RVPVLNPFAAELCNMV-TSDGDEVAMVNEDGNF  173

Query  784   AgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGL  963
                         +G              +M+LA+FAADVE+LLG GLDD  ++  D +G+
Sbjct  174   VIDDYER-----EGTCELDDGLHGFLPSDMDLADFAADVENLLGVGLDD--DACCDTKGI  226

Query  964   GFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSS  1143
               L   + +EE  S ++   +                           +           
Sbjct  227   ELL---HSKEEDGSNVLHEGK--------------------------IVKVKDEEEVEGI  257

Query  1144  SSLCFD--------TLELKFDYDNDYYSPNNekeeegeellkMRN-------KSTILLNL  1278
             ++ CFD        +L   +DY++       E++          N       K  +LL L
Sbjct  258   TACCFDSAFDVTRESLNWSYDYESPTIGEEEEEKVLPATETTTMNGESKAEMKRNMLLRL  317

Query  1279  DYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM---GI  1449
             +YE+VI AW+ Q  PW  G RPE N     PD  M      G   +    G+  +   G 
Sbjct  318   NYESVITAWARQGSPWTAGSRPEFN-----PDDFMGSNLKEGHHLSGGIGGIYSLQGRGN  372

Query  1450  TFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             T G+          REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR +F
Sbjct  373   TDGE----------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF  422



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 186/454 (41%), Positives = 236/454 (52%), Gaps = 73/454 (16%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK----  459
             AM GK    ARACD C+ KRARWYC ADDAFLCQACD+SVHSAN LA RH RV+L+    
Sbjct  10    AMGGK---TARACDNCLHKRARWYCGADDAFLCQACDASVHSANQLAERHERVRLQAASC  66

Query  460   ----TLSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM  627
                 ++ +   P+WH+GFTRK R+PR+        + +P  H +   TP  L    VPE+
Sbjct  67    KNADSMRDNSTPAWHQGFTRKARSPRNV----KRTSVQPSKHENKFPTPPPL----VPEI  118

Query  628   CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghgh  807
              S+E  +  DE E+Q  L+RVP FDP VA++       D        N SK     GH  
Sbjct  119   GSEE--ASPDENEEQ-FLFRVPTFDPFVAELN-----NDGIREIGMENDSKPLSDYGHEE  170

Query  808   hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNV  987
               + D  +            EM+LAEFAADVES LG GLD   E S  ++G+G L     
Sbjct  171   IGDLDSLTG-------FLPSEMDLAEFAADVESYLGAGLD---EDSCGIKGIGVLDCEQG  220

Query  988   EEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTL  1167
             + +      +   + E+                       +  +A  H      +  + L
Sbjct  221   DMDACFGDQKVKVKEER-----------------------VETDATFHLDPELDMTKELL  257

Query  1168  ELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPE  1347
                 DY++       E EE+    ++MR K  I L+L+YE VI AW+ Q  PW TG RPE
Sbjct  258   AWNLDYESTVMD-EEEHEEKMVAAVEMRRK--ISLSLNYEDVITAWASQGSPWTTGNRPE  314

Query  1348  MNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKR  1527
              + +  WPD +   G     +H    D  G  G   G+          REARV RYREKR
Sbjct  315   FDPNDYWPDYM---GACPTNVHGPCGDVGGVGGNFGGRDGG-------REARVLRYREKR  364

Query  1528  RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+F
Sbjct  365   RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  398



>gb|AHI45077.1| COL domain class transcription factor [Boehmeria nivea]
Length=453

 Score =   243 bits (621),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 181/477 (38%), Positives = 226/477 (47%), Gaps = 87/477 (18%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  A+ GK    ARACD C+ KRARW+CAADDAFLCQACD+SVH+AN LA  H RV+L T
Sbjct  8     AVSAVGGK---TARACDSCLRKRARWFCAADDAFLCQACDTSVHAANRLASSHERVRLLT  64

Query  463   LS-------------NIEPPSWHRGFTRKPRTPRH---AHGRYNNNNSKPVVHHDVVKTP  594
              S             +   P W RG TRK RTPRH   A        +K       V   
Sbjct  65    SSFKGSTSVCGEDSQDESSPKWLRGLTRKARTPRHNSKAAPAALQLAAKDGGDDVFVDKA  124

Query  595   LHLSIVP--VPEMCSDENYS--HDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAA  762
             L+L   P  VPEM + E+ S   D   E+  LLYRVP+ DP  A +C  +     D    
Sbjct  125   LNLVDQPSIVPEMSNGEDRSPIGDRRDEEDELLYRVPVLDPFAAGLCMPI----CDEHEL  180

Query  763   AFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEES  942
                Q             + D             + E+ELAEFAADVESLLG    +E++S
Sbjct  181   QLGQKS-----------DDDDDHELNHQIQGFLQTELELAEFAADVESLLGVAGIEEDQS  229

Query  943   SFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANA  1122
               D +  GF   +++++++     +F                     +        AA +
Sbjct  230   CIDHDVKGFGLMDDLDQDRREEDGDFD---------------IDVDVDLGGVCANTAAKS  274

Query  1123  NHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILA  1302
                            ++  ++ ++  SP      E         K  ILL L+YEAVI A
Sbjct  275   EQRVKVEEDESVLGFQVNPNFGSELSSPATTPATEM-------KKRDILLRLNYEAVIAA  327

Query  1303  WSDQRCPWITGQRPEMNSHHGWPDCI--------MQRGCGSGTIHAAAYDGVGDMGITFG  1458
             W+ Q  PW TG RPE+   HGWPDC+           G   G + +   DG         
Sbjct  328   WASQGSPWTTGIRPEVKPEHGWPDCMDMCHPDFSQINGDWRGLVGSGRRDG---------  378

Query  1459  QAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                       GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR +F
Sbjct  379   ----------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF  425



>ref|XP_009410076.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 177/453 (39%), Positives = 229/453 (51%), Gaps = 71/453 (16%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL---------SN  471
             ARACD C  +RARWYCAADDAFLCQ CDSSVHSANPLARRH R++LKT          S+
Sbjct  23    ARACDGCGRRRARWYCAADDAFLCQNCDSSVHSANPLARRHNRIRLKTATSSGAPDVDSD  82

Query  472   IEPPSWHRGFTRKPRTPR---HAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDEN  642
                PSW RGF RK RTPR   HA        + P    ++V+T L            DE 
Sbjct  83    DSAPSWLRGFKRKARTPRPHQHAKTASEARTAHPTTVPELVETSL------------DET  130

Query  643   YSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
                  E E+Q L+Y VP+FDP  A+  +   + D +A +   N++K           +  
Sbjct  131   -----EDEEQQLIYCVPVFDPAFAEFRSPPPLDDSNAPSG--NEAKPTMDLQECTPASTP  183

Query  823   GKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKA  1002
               ++           +ME+AEFAA++ESLLG GL D  + SF ME LG +  N++E+   
Sbjct  184   TINT-ANRLTAFLPSDMEIAEFAANMESLLGGGL-DVSDGSFSMEKLGLV--NSIEDGVN  239

Query  1003  STMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFD  1182
               + +  R   +                                     +  +TLEL F+
Sbjct  240   YCLGDAGRLKTEQPDDTVGCPVELDI----------------------DMSRETLELDFN  277

Query  1183  YDNDYYSPNNekeeegeellkMRNKST--ILLNLDYEAVILAWSDQ-RCPWITGQRPEMN  1353
             +     +   E EEE   +   + + T    L+LDYEAVI+AWS     PW  G+RP++N
Sbjct  278   WTGSSTAEEEEFEEEKIMVATEQQQVTQKARLSLDYEAVIIAWSSHGSSPWTDGERPQIN  337

Query  1354  SHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRT  1533
                 W DC                +G   +G+  G         VGR+ARV+RYREKRRT
Sbjct  338   LDSCWHDCT-----------GMWVEGADALGVGHGSDTGGGYADVGRQARVTRYREKRRT  386

Query  1534  RLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFP  1632
             RLF+KKIRYEVRKLNAEKRPRMKGRFVKRA  P
Sbjct  387   RLFAKKIRYEVRKLNAEKRPRMKGRFVKRAPGP  419



>gb|KFK44524.1| hypothetical protein AALP_AA1G267800 [Arabis alpina]
Length=407

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 170/453 (38%), Positives = 230/453 (51%), Gaps = 85/453 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL-------SNI  474
              ARACD C+ +RARWYCAADDAFLCQ+CD  VHSANPLARRH RV+LK+        SN 
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDGLVHSANPLARRHERVRLKSASPAVAKHSNH  71

Query  475   EPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHD  654
             E  +WH GFTRK RTPR   G+ N+ +    V HD+           VPE+  ++    D
Sbjct  72    EAATWHHGFTRKARTPRGGSGKKNHQS----VFHDL-----------VPEISVEDQTETD  116

Query  655   DEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSS  834
               + ++ L+ +VP+ DP+VA+      +TD       F   +             +  + 
Sbjct  117   SYELEEQLICQVPVLDPMVAEQF----LTDVVEPKIEFPMMRMIDDLE-------EEDNV  165

Query  835   tttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMM  1014
               +        +MEL EFAADVE+LLG+GLD+E   S+ ME LG            S M 
Sbjct  166   VESCLNGFFPTDMELEEFAADVETLLGRGLDNE---SYVMEELGL---------SNSEMF  213

Query  1015  EFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDN-  1191
             +  +  ++   + +                   A     +  + ++ F   EL FDY++ 
Sbjct  214   KIEKDEDEEEDESK-------------------AMNMETFDENKTVAF---ELTFDYESH  251

Query  1192  -----DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNS  1356
                  +          E  ++ +   K+ ++L L+Y++VI  W  Q  PW  G+RPE++ 
Sbjct  252   KTCEEEVIKSVERSSNECIKVKEEEQKNVLMLRLNYDSVISTWGGQGPPWSPGERPELDI  311

Query  1357  H--HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRR  1530
                + WP   M  G   G  H   + G       FG          GREARVSRYREKRR
Sbjct  312   DIINTWPSVSM--GENGGESHQKPFVGGCLPSSGFGDG--------GREARVSRYREKRR  361

Query  1531  TRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             TRLFSKKIRYEVRKLNAEKRPRMKGRFVKR++ 
Sbjct  362   TRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSL  394



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score =   243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 187/454 (41%), Positives = 235/454 (52%), Gaps = 73/454 (16%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK----  459
             AM GK    ARACD C+ KRARWYC ADDAFLCQACD+SVHSAN LA RH RV+L+    
Sbjct  75    AMGGK---TARACDNCLHKRARWYCGADDAFLCQACDASVHSANQLAERHERVRLQAASC  131

Query  460   ----TLSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM  627
                 ++ +   P+WH+GFTRK R+PR+        + +P  H +   TP  L    VPE+
Sbjct  132   KNADSMRDNSTPAWHQGFTRKARSPRNV----KRTSVQPSKHENKFPTPPPL----VPEI  183

Query  628   CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghgh  807
              S+E  +  DE E+Q  L+RVP FDP VA++       D        N SK     GH  
Sbjct  184   GSEE--ASPDENEEQ-FLFRVPTFDPFVAELN-----NDGIREIGMENDSKPLSDYGHEE  235

Query  808   hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNV  987
               + D  +            EM+LAEFAADVES LG GLD   E S  ++G+G L     
Sbjct  236   IGDLDSLTG-------FLPSEMDLAEFAADVESYLGAGLD---EDSCGIKGIGVL-----  280

Query  988   EEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTL  1167
             + E+      F  +  KV  +                   +  +A  H      +  + L
Sbjct  281   DCEQGDMDACFGDQKVKVKEER------------------VETDATFHLDPELDMTKELL  322

Query  1168  ELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPE  1347
                 DY++       E EE+    ++MR K  I L+L+YE VI AW+ Q  PW TG RPE
Sbjct  323   AWNLDYESTVMD-EEEHEEKMVAAVEMRRK--ISLSLNYEDVITAWASQGSPWTTGNRPE  379

Query  1348  MNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKR  1527
              + +  WPD +   G     +H              G          GREARV RYREKR
Sbjct  380   FDPNDYWPDYM---GACPTNVHGPCG-------DVGGVGGNFGGRDGGREARVLRYREKR  429

Query  1528  RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+F
Sbjct  430   RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  463



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score =   241 bits (614),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 186/469 (40%), Positives = 242/469 (52%), Gaps = 75/469 (16%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  A+ GK    ARACD C  KRARW+CAADDAFLCQACD SVHSAN LA RH RV+L+T
Sbjct  7     AANALSGK---TARACDGCSRKRARWFCAADDAFLCQACDDSVHSANQLASRHERVRLET  63

Query  463   LSNI---------EPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVP  615
              S+            P+WH+GF RK RTPR++  +    +   V    +V  PL L    
Sbjct  64    ASSKISGSRNTVDSVPAWHQGFIRKARTPRNSSNKQQLKDEDKV----LVMNPLPL----  115

Query  616   VPEMCSDE--NYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAg  789
             VPE+  +E  N +  DE +D+ LLYRVP+FDP  +++CT   +T  +         +  G
Sbjct  116   VPEIGGEEEGNSTFADEDDDR-LLYRVPVFDPYASELCTDDMVTCGEGTEITMGNEE--G  172

Query  790   ggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                   +   +G      + P     +M+LAEFAADVE+LLG       E S D+E L  
Sbjct  173   NIVFDGYNGQEGTCDDLDILPEFFSSDMDLAEFAADVENLLGVN-----EDSPDIEDLCL  227

Query  970   LGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSS  1149
             L   + +EE+      F  + + V+   +E                    A  H+  +  
Sbjct  228   L---HCKEEEDDQKCFFDDQDKVVMKVKDE----------------QEVEACDHFDQAFE  268

Query  1150  LCFDTLELKFDYDN-----DYYSPNNekeeegeellkMRNKSTI-LLNLDYEAVILAWSD  1311
                ++L+  F+Y++     D                K   KST  LL L+YE VI AW+ 
Sbjct  269   R--ESLDWSFNYESPTITADEVEEKKRVPVAINSQQKKETKSTASLLRLNYEDVINAWAS  326

Query  1312  QRCPWITGQRPEMNSHHGWPDCI---MQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDV  1482
             Q  PW +G RPE+NS   WPDC+   ++ G      H   Y G+G        A      
Sbjct  327   QGSPWTSGSRPELNSDDCWPDCMDICLKDG------HHHPYGGMGGHTRGGNGA------  374

Query  1483  WVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR +F
Sbjct  375   ---REARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF  420



>ref|XP_009798338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Nicotiana 
sylvestris]
Length=417

 Score =   238 bits (607),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 183/477 (38%), Positives = 221/477 (46%), Gaps = 115/477 (24%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN--------  471
              ARACD C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH RV+L+T SN        
Sbjct  16    TARACDSCLSKRARWFCPADDAFLCQSCDVSVHSANQLASRHERVRLETSSNKSTDTKFV  75

Query  472   ---IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDEN  642
                   PSWH+GFTRK RTPR+   +      +     ++           VPEM S+EN
Sbjct  76    DQTASQPSWHQGFTRKARTPRNGKNKSTQIGQRKKDEENM-----------VPEMGSEEN  124

Query  643   YSHDDEKEDQLLLYRVPIFDPVVADICT--------TLNITDYDAAAAAFNQSKCAgggg  798
              S DDE E+Q LLYRVP+FDP  A++CT        T  I D D    +  +  C     
Sbjct  125   -SPDDENEEQ-LLYRVPVFDPFEAELCTVPNEVVDETTTINDLDILLNS--EDAC-----  175

Query  799   hghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGL-----DDEEESSFDMEGL  963
                              P     E+ELAEFAADVESLLG+       +++EE S  + G+
Sbjct  176   ------------DDLGIPKFLSSEIELAEFAADVESLLGEEFRVVAEEEDEEQSRLISGV  223

Query  964   GFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSS  1143
                    VE+ KA   +E                              M A    H    
Sbjct  224   -------VEDNKA-IKIEVEDEE-------------------------MRAVVACHLDPE  250

Query  1144  SSLCFDTLELKFDYDNDYYSPNNekeeegee------llkMRNKSTILLNLDYEAVILAW  1305
               +  + L   F+Y+       N                K   K  +LL L+YE VI AW
Sbjct  251   LDMAREALNWDFEYEETVEQKVNMAAATEFVPSAECGGSKADAKRRMLLRLNYEEVISAW  310

Query  1306  SDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVW  1485
              +Q  PW  G RP  N    WPD +    C            +G+ G             
Sbjct  311   PNQSSPWTNGIRPHFNPDDCWPDFL--ETC------------IGEGGHQPYGGGNVRGGD  356

Query  1486  VGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN------FPLL  1638
              GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR        FP L
Sbjct  357   GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRTTSFSAPGFPYL  413



>dbj|BAK01505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 176/465 (38%), Positives = 229/465 (49%), Gaps = 74/465 (16%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A+GAM  K   AARACD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH RV+L+ 
Sbjct  9     ADGAMGSK---AARACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERVRLRP  65

Query  463   LSNIEPPSWHRG-------FTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVP  621
              S + P    RG       F RK RTPR          S+ +V               VP
Sbjct  66    TSPLAPRERRRGDEVVPAWFKRKARTPRSQAKGVGRLLSRRLV---------------VP  110

Query  622   EMC---SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAA-FNQSKCAg  789
             E     S E +  D E +++ LLYRVPIFDP +A++C+ L++ +  AA A+  N+     
Sbjct  111   ESSGGESPEEHKCDVETDEEELLYRVPIFDPALAELCSPLSLEEATAAVASCCNEDGVVL  170

Query  790   ggghghhKNWDGKSStt---tmpptttememeLAEFAADVESLLGK-GLDD-EEESSFDM  954
                          ++              + EL EFAAD+E+LLG+ G+DD  EE  F M
Sbjct  171   ENPTKPTTAMPSPAAVEFFPDSLVNLGPTDAELMEFAADMEALLGRPGMDDGNEEEPFCM  230

Query  955   EGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHY  1134
             E LG +   +VE  +    ++                              M A      
Sbjct  231   EALGLIEPMDVEGGRVKLEID-----------------------------PMRACGLEQK  261

Query  1135  TSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQ  1314
                S   FD ++  + YD+   +P+      G          ++ LNL+Y+A++  W   
Sbjct  262   PEVSGDMFD-IDFDYHYDSPQGTPDENAGSSGASADAQFTPRSLALNLNYDAIMENWGSS  320

Query  1315  RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIA-DDVWVG  1491
               PW  G+RP +     WP           ++H  A+   G +G            +  G
Sbjct  321   --PWADGERPNVKLDDCWPHDYY-------SLHEGAWMMGGVVGHGGEGLGTPRPRMDGG  371

Query  1492  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN
Sbjct  372   REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  416



>ref|XP_006307606.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
 gb|EOA40504.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
Length=424

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 178/459 (39%), Positives = 234/459 (51%), Gaps = 87/459 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT S         
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAAAKHSNH  71

Query  469   --NIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM-  627
               +  PP    +WH GFTRK RTPR + G+ NN ++     HD+           VPE+ 
Sbjct  72    SPSASPPHGAATWHHGFTRKARTPRGSAGKKNNLST----FHDL-----------VPEIS  116

Query  628   CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghgh  807
               D+  S++ E E+QL+  +VP+ DP+VA+      + D       F   +         
Sbjct  117   VEDQTDSYELELEEQLIC-QVPVLDPLVAEQF----LNDVVEPKIEFPMIRSGVLID---  168

Query  808   hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNV  987
                 + + +  +        +MEL EFAADVE+LLG+GL+ E   S+ ME LGF   +N 
Sbjct  169   ----EEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLETE---SYAMEDLGF---SNT  218

Query  988   EEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTL  1167
             E                  +   E+D            I M    +       ++ F   
Sbjct  219   E------------------MFKVEKDEIEEEEVEDIKAINMEIFDDDRKDVDGTVPF---  257

Query  1168  ELKFDYDNDYYSPNNekeeegeel-------lkMRNKSTILLNLDYEAVILAWSDQRCPW  1326
             EL FDY++ + +   E+ +  E          +   K+ ++L L+Y++VI  W  Q  PW
Sbjct  258   ELTFDYESSHKTAEEEEIKNVESSGECVVKVKEEEGKNVLMLRLNYDSVISTWGGQGQPW  317

Query  1327  ITGQRPEMN-SHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREAR  1503
              +G+ PE++     WP   M    G  + H   Y  V      FG          GREAR
Sbjct  318   TSGEPPELDIDISSWPPVSMGETKGDLS-HQKQYVSVCLPSSGFGDG--------GREAR  368

Query  1504  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  369   VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  407



>ref|XP_002890690.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66949.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 181/457 (40%), Positives = 227/457 (50%), Gaps = 88/457 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT S         
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAVVKHSNH  71

Query  469   -----NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
                    E  +WH GFTRK RTPR   G+ NN++    + HD+           VPE+ S
Sbjct  72    SSSSPPHEAATWHHGFTRKARTPR-GSGKKNNSS----IFHDL-----------VPEI-S  114

Query  634   DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
              E+ +   E E+QL+  +VP+ DP+VA+      + D       F   +           
Sbjct  115   VEDQTDSYELEEQLIC-QVPVLDPLVAEQF----LNDVVEPKIEFPMMRSGVMIE-----  164

Query  814   NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEE  993
               + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME LG       + 
Sbjct  165   --EEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDSE---SYPMEELGLSNSEMFKL  219

Query  994   EKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLEL  1173
             EK     E   R                   A + +IF     +   T          EL
Sbjct  220   EKDEIEEEVEERK------------------AMNMEIFDDDRRDGDGTV-------PFEL  254

Query  1174  KFDYDNDYYSPNNekeeegeel-------lkMRNKSTILLNLDYEAVILAWSDQRCPWIT  1332
              FDY++ + +   E  +  E          +   K+ +LL L+Y++VI  W  Q  PW +
Sbjct  255   SFDYESSHKTSKEEVMKNVESSGECVVKVKEEEQKNVLLLRLNYDSVISTWGGQGPPWSS  314

Query  1333  GQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVS  1509
             G  PE +    GWP   M    G  T H   Y G       FG          GREARVS
Sbjct  315   GVPPERDMDISGWPAVSMGENGGECT-HKKQYVGGCLPSSGFGDG--------GREARVS  365

Query  1510  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  366   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 178/471 (38%), Positives = 237/471 (50%), Gaps = 72/471 (15%)
 Frame = +1

Query  277   EGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL  456
             + A GAM  K   AARACD C+ +RARWYCAADDAFLCQACD+SVHSANPLARRH RV+L
Sbjct  7     KAAAGAMGSK---AARACDGCLRRRARWYCAADDAFLCQACDASVHSANPLARRHERVRL  63

Query  457   KTLSNIEP----PSWHRG-------FTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHL  603
             +  S ++     P   RG       F RKPRTPR           K V+ H  + +    
Sbjct  64    RPTSPLQAGAGGPRARRGDEVVPAWFKRKPRTPR----------GKSVIGH--LLSSRRP  111

Query  604   SIVP----VPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFN  771
              +VP      E   +E+   + E +++ LLY VP+FDP +A++C+  +    +  A+  N
Sbjct  112   VVVPDEASGGEGSPEEHKLFEGETDEEELLYSVPVFDPALAELCSPSSPRHLEDYASCCN  171

Query  772   QSKCA--gggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDD-EEES  942
             + +             +            +    + EL EFAAD+E+LLG+GLD+  EE 
Sbjct  172   EDRVVVLESPTEPAAPSLAVDQFFPDSVVSFGPTDAELMEFAADMEALLGRGLDEGTEEE  231

Query  943   SFDMEGLGFLGGN-NVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAAN  1119
              F ME LG +    +V+       ME                      +     +F+A  
Sbjct  232   PFCMEALGLIQPMVDVDGAGGRVKME---------------------TDGEARGMFLACG  270

Query  1120  ANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRN-KSTILLNLDYEAVI  1296
                   +  S       L  D+D+DY SP    +E        R    ++ LNL+YEA+I
Sbjct  271   LEREPETEVSGNM----LGIDFDDDYGSPQATPDENAASGSAARFLPRSLSLNLNYEAII  326

Query  1297  LAWSDQRCPWITGQRPEMNSHHGWP-DCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIA  1473
               W  ++ PW  G+RP++     WP D  M      G +      G G   +   +  + 
Sbjct  327   DKW--EKSPWADGKRPDVKLDGCWPHDYSMSVWMMGGVLV-----GHGTEELRTPRTKMD  379

Query  1474  DDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
                  GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN
Sbjct  380   G----GRDARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  426



>ref|XP_009603861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   236 bits (603),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 181/485 (37%), Positives = 225/485 (46%), Gaps = 115/485 (24%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
             A+ GK    ARACD C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH RV+L+T SN
Sbjct  11    AIGGK---TARACDSCLSKRARWFCPADDAFLCQSCDVSVHSANQLASRHERVRLETSSN  67

Query  472   -----------IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPV  618
                        +  PSWH+GFTRK RTPR+   +      +     ++           V
Sbjct  68    KSTDTKFVDQTVSQPSWHQGFTRKARTPRNGKNKSTQIGQRKKDEENM-----------V  116

Query  619   PEMCSDENYSHDDEKE-DQLLLYRVPIFDPVVADICTTL---------NITDYDAAAAAF  768
             PEM S+EN   ++E E ++ LLYRVP+FDP  A++C T+          I D D    + 
Sbjct  117   PEMGSEENSPDENEFENEEQLLYRVPVFDPFEAELCCTVPNEVVDETTTINDLDILLNS-  175

Query  769   NQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLG---KGLDDEEE  939
              +  C                      P     E+ELAEFAADVESLLG   + + +EEE
Sbjct  176   -EDVC-----------------DDLGIPEFLSSEIELAEFAADVESLLGEEFRVVAEEEE  217

Query  940   SSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAAN  1119
              S  + G       +VE+ KA   +E                              M A 
Sbjct  218   QSRLING-------SVEDNKA-IKIEVEDEE-------------------------MRAV  244

Query  1120  ANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegee------llkMRNKSTILLNLD  1281
                H      +  + L   F+Y+       N                K   K  +LL L+
Sbjct  245   VACHLDPELDMAREALNWDFEYEETVEQKVNMTAATEFVPSAECGGSKADAKRRLLLRLN  304

Query  1282  YEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQ  1461
             YEAVI AW +Q  PW  G RP  N    WPD  ++   G G +H                
Sbjct  305   YEAVISAWPNQSSPWTNGIRPHFNPDDCWPD-FLETCIGEGGVHQPY------------G  351

Query  1462  AAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----  1626
                      GRE RVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR       
Sbjct  352   GGKVRGGDGGREERVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRLKGRFVKRTTSFSPP  411

Query  1627  -FPLL  1638
              FP L
Sbjct  412   GFPYL  416



>ref|XP_004965182.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=445

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 176/466 (38%), Positives = 230/466 (49%), Gaps = 88/466 (19%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE--PPSWHRG-  498
             CD C+ +RARWYCAADDAFLCQACD+SVHSANPLARRH RV+L+  S +   PP+W    
Sbjct  24    CDGCLRRRARWYCAADDAFLCQACDTSVHSANPLARRHERVRLQPTSPLRAPPPAWAAQC  83

Query  499   ----------FTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC-----S  633
                       F RK RTPR  H +              V   L   +V VPE       S
Sbjct  84    EPRDDVVPAWFRRKARTPRGGHAKS-------------VAQVLSRRLV-VPEAAGGDGDS  129

Query  634   DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
              E  + + E E++ LLYRVPIFDP +A+ C+   + D  A A++ N+        + H  
Sbjct  130   PEGRNGEGEVEEEQLLYRVPIFDPALAEFCSPPPLEDAAAVASSCNEDGTVEDPANPHPA  189

Query  814   NW---------DGKSStttmpptttememeLAEFAADVESLLGKGLDD-EEESSFDMEGL  963
                        DG +S           + EL EFAAD+E+LLG+GLDD  E+SSF ME L
Sbjct  190   APAPPPVQFFPDGHAS-------FEPTDAELREFAADMEALLGRGLDDGNEDSSFYMETL  242

Query  964   GFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSS  1143
             G L   + +   A   +E                    A       + + A A+      
Sbjct  243   GLLDPVDDDAGVARVKLEID------------GGGAFDASGTPACGVQLEAEASD-----  285

Query  1144  SSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRN---KSTILLNLDYEAVILAWSDQ  1314
                  + L++ FDY +   +P+++                ++++ L L+YEA+I +W   
Sbjct  286   -----EMLDIDFDYGSPQETPDDKAASSDTSAAATDAQFLQTSLSLTLNYEAIIQSWGSS  340

Query  1315  RCPWI-TGQRPEMNSHHGWP-DCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWV  1488
               PW  +G+RP +     WP D       G    H     G   +G+  G          
Sbjct  341   --PWTGSGERPHVKLDGSWPHDYTSMWVVGGMVGHVGEELGTPRLGMMDG----------  388

Query  1489  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKRA 
Sbjct  389   GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  434



>ref|XP_010499109.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Camelina sativa]
Length=419

 Score =   231 bits (589),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 181/458 (40%), Positives = 232/458 (51%), Gaps = 89/458 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL----------  465
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT           
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAAVKHSNH  71

Query  466   -SNIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
              S+  PP    +WH GFTRK RTPR   G+ NN +    + HD+           VPE+ 
Sbjct  72    SSSASPPHEAATWHHGFTRKARTPR-GSGKKNNLS----IFHDL-----------VPEI-  114

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S E+ +   E E+QL+  +VP+ DP+VA+      + D  A    F              
Sbjct  115   SVEDQTDSYELEEQLIC-QVPVLDPLVAEQF----LNDVVAPKIEFPMISVMID------  163

Query  811   KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVE  990
                + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME LG        
Sbjct  164   ---EEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEDLG--------  209

Query  991   EEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLE  1170
                      FS      V K E E+      +A + +IF   +      +         E
Sbjct  210   ---------FSNTEMFKVEKDEIEEEEVEEKKAINMEIFDDDDRKDVDGTV------PFE  254

Query  1171  LKFDYDNDYYSPNNekeeegeellk-------MRNKSTILLNLDYEAVILAWSDQRCPWI  1329
             L FDY++ + +   E  +  E   +          K+ ++L L+Y++VI  W  Q  PW 
Sbjct  255   LSFDYESSHKTSEEEVMKNVESSGECVVKVKEEEEKNVLMLRLNYDSVISTWGGQGPPWT  314

Query  1330  TGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
             +G+ PE++     WP   M    G  + H   Y G       FG          GREARV
Sbjct  315   SGEPPELDIDISSWPPVSMGEFGGDQS-HQKQYVGGCLPSSGFGDG--------GREARV  365

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  366   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010460378.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Camelina sativa]
Length=419

 Score =   231 bits (589),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 181/458 (40%), Positives = 232/458 (51%), Gaps = 89/458 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL----------  465
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT           
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAAVKHSNH  71

Query  466   -SNIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
              S+  PP    +WH GFTRK RTPR   G+ NN +    + HD+           VPE+ 
Sbjct  72    SSSASPPHEAATWHHGFTRKARTPR-GSGKKNNLS----IFHDL-----------VPEI-  114

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S E+ +   E E+QL+  +VP+ DP+VA+      + D  A    F              
Sbjct  115   SVEDQTDSYELEEQLIC-QVPVLDPLVAEQF----LNDVVAPKIEFPMISVMID------  163

Query  811   KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVE  990
                + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME LG        
Sbjct  164   ---EDEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEDLG--------  209

Query  991   EEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLE  1170
                      FS      V K E E+      +A + +IF   +      +         E
Sbjct  210   ---------FSNTEMFKVEKDEIEEEEVEEKKAINMEIFDDDDRKDVDGTV------PFE  254

Query  1171  LKFDYDNDYYSPNNekeeegeellk-------MRNKSTILLNLDYEAVILAWSDQRCPWI  1329
             L FDY++ + +   E  +  E   +          K+ ++L L+Y++VI  W  Q  PW 
Sbjct  255   LSFDYESSHKTSEEEVMKNVESSGECVVKVKEEEEKNVLMLRLNYDSVISTWGGQGRPWT  314

Query  1330  TGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
             +G+ PE++     WP   M    G  + H   Y G       FG          GREARV
Sbjct  315   SGEPPELDIDISSWPPVSMGEFGGDQS-HQKQYVGGCLPSSGFGDG--------GREARV  365

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  366   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_009397482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   229 bits (585),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 174/463 (38%), Positives = 224/463 (48%), Gaps = 100/463 (22%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
             ARACD C+ +RARW+C ADDAFLCQ+CD+SVHSANPLARRH RV+L T S   P      
Sbjct  18    ARACDSCLRRRARWFCEADDAFLCQSCDASVHSANPLARRHRRVRLDTASCSSPSSSSSS  77

Query  481   ------------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
                         P W  GF RKPRTPR   GR         +    V+T     +VP  E
Sbjct  78    PPTDDVSGDHSMPPWLHGFKRKPRTPRGKPGR--------ALAAAKVET-----LVPDLE  124

Query  625   MCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITD----YDAAAAAFNQSKCAgg  792
               S E        E++ LL+ VP  DP++ + C+   + D     D    A   +  A  
Sbjct  125   TMSTEENQ---SNEEEQLLHCVPTLDPLLIESCSQHPVDDGSPSEDDVKPALQLADFAHV  181

Query  793   gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
                     +                +++LAEFA+D+E+LLG+GLDD    SF ++GLG L
Sbjct  182   SAADGLAGF-------------RPSDLDLAEFASDMEALLGRGLDDH---SFCIDGLG-L  224

Query  973   GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSL  1152
                 +E++     ME  +  +                           +A   +    +L
Sbjct  225   ADATLEDDG----MEHVKVED--------------------------GDAACGFGVEIAL  254

Query  1153  CFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRC-PWI  1329
               DT++L FD      +   + ++   E    R     +L LDYEAVI AWS   C PW 
Sbjct  255   SKDTMDLDFDSRTATMAVQVKDQKPSPEAATKRRP---ILRLDYEAVIAAWSSNGCSPWT  311

Query  1330  TGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVS  1509
              G+RP+ +    W D ++    G G +    Y   G M    G          GREARVS
Sbjct  312   DGERPQFDPSDAWADFLVAEAGGGGEVQGM-YQQAGHMAAVDG----------GREARVS  360

Query  1510  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFPLL  1638
             RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK+A  P L
Sbjct  361   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKQAAAPAL  403



>ref|XP_010460380.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Camelina sativa]
Length=427

 Score =   230 bits (586),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 183/467 (39%), Positives = 236/467 (51%), Gaps = 99/467 (21%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT S         
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAAVKHSNH  71

Query  469   --NIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
               +  PP    +WH GFTRK RTPR   G+ NN +    + HD+V           PE+ 
Sbjct  72    SSSASPPHEAATWHHGFTRKARTPR-GSGKKNNLS----IFHDLV-----------PEI-  114

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S E+ +   E E+QL+  +VP+ DP+VA+      + D  A    F              
Sbjct  115   SVEDQTDSYELEEQLIC-QVPVLDPLVAEQF----LNDVVAPKIEFPMISVMID------  163

Query  811   KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVE  990
                + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME LG        
Sbjct  164   ---EDEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEDLG--------  209

Query  991   EEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLE  1170
                      FS      V K E E+      +A + +IF   +      +         E
Sbjct  210   ---------FSNTEMFKVEKDEIEEEEVEEKKAINMEIFDDDDRKDVDGTV------PFE  254

Query  1171  LKFDYDNDYYSPNNekeeegeellkMRN----------------KSTILLNLDYEAVILA  1302
             L FDY++ + + + E+  +  E   M+N                K+ ++L L+Y++VI  
Sbjct  255   LSFDYESSHKT-SEEEVMKNVEKEVMKNVESSGECVVKVKEEEEKNVLMLRLNYDSVIST  313

Query  1303  WSDQRCPWITGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADD  1479
             W  Q  PW +G+ PE++     WP   M    G  + H   Y G       FG       
Sbjct  314   WGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQS-HQKQYVGGCLPSSGFGDG-----  367

Query  1480  VWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
                GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  368   ---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  411



>ref|XP_010460379.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 180/458 (39%), Positives = 232/458 (51%), Gaps = 89/458 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL----------  465
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT           
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAAVKHSNH  71

Query  466   -SNIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
              S+  PP    +WH GFTRK RTPR   G+ NN +    + HD+           VPE+ 
Sbjct  72    SSSASPPHEAATWHHGFTRKARTPR-GSGKKNNLS----IFHDL-----------VPEI-  114

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S E+ +   E E+QL+  +VP+ DP+VA+      + D  A    F              
Sbjct  115   SVEDQTDSYELEEQLIC-QVPVLDPLVAEQF----LNDVVAPKIEFPMISVMID------  163

Query  811   KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVE  990
                + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME LG        
Sbjct  164   ---EDEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEDLG--------  209

Query  991   EEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLE  1170
                      FS      V K E E+      +A + +IF   +      +         E
Sbjct  210   ---------FSNTEMFKVEKDEIEEEEVEEKKAINMEIFDDDDRKDVDGTV------PFE  254

Query  1171  LKFDYDNDYYSPNNekeeegeellk-------MRNKSTILLNLDYEAVILAWSDQRCPWI  1329
             L FDY++ + +   E  +  E   +          K+ ++L L+Y++VI  W  Q  PW 
Sbjct  255   LSFDYESSHKTSEEEVMKNVESSGECVVKVKEEEEKNVLMLRLNYDSVISTWGGQGPPWT  314

Query  1330  TGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
             +G+ P+++     WP   M    G  + H   Y G       FG          GREARV
Sbjct  315   SGEPPKLDIDISSWPPVSMGEFGGDQS-HQKQYVGGCLPSSGFGDG--------GREARV  365

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  366   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010477926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Camelina 
sativa]
Length=419

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 180/458 (39%), Positives = 230/458 (50%), Gaps = 89/458 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT S         
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAAVKHSSH  71

Query  469   ------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                     E  +WH GFTRK RTPR   G+ NN +    + HD+           VPE+ 
Sbjct  72    SSSASPPHEAATWHHGFTRKARTPR-GSGKKNNLS----IFHDL-----------VPEI-  114

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S E+ +   E E+QL+  +VP+ DP+VA+      + D  A    F              
Sbjct  115   SVEDQTDSYELEEQLIC-QVPVLDPLVAEQF----LNDVVAPKIEFPMISVMID------  163

Query  811   KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVE  990
                + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME LG        
Sbjct  164   ---EEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEDLG--------  209

Query  991   EEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLE  1170
                      FS      V K E E+      +A + +IF   +      +         E
Sbjct  210   ---------FSNTEMFKVEKDEIEEEEVEEKKAINMEIFDDDDRKDVDGTV------PFE  254

Query  1171  LKFDYDNDYYSPNNekeeegeellk-------MRNKSTILLNLDYEAVILAWSDQRCPWI  1329
             L FDY++ + +   E  +  E   +          K+ ++L L+Y++VI  W  Q  PW 
Sbjct  255   LSFDYESSHKTSEEEVMKNVESSGECVVKVKEEEEKNVLMLRLNYDSVISTWGGQGRPWT  314

Query  1330  TGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
             +G+ PE++     WP   M    G  + H   Y G       FG          GREARV
Sbjct  315   SGEPPELDIDISSWPPVSMGEFGGDQS-HQKQYVGGCLPSSGFGDG--------GREARV  365

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  366   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>gb|AAG50803.1|AC079281_5 zinc finger protein, putative [Arabidopsis thaliana]
Length=416

 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 176/457 (39%), Positives = 231/457 (51%), Gaps = 88/457 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT S         
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAVVKHSNH  71

Query  469   -NIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
              +  PP    +WH GFTRK RTPR   G+ NN++    + HD+V           P++ S
Sbjct  72    SSASPPHEVATWHHGFTRKARTPR-GSGKKNNSS----IFHDLV-----------PDI-S  114

Query  634   DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
              E+ + + E E+QL+  +VP+ DP+V++      + D       F   +           
Sbjct  115   IEDQTDNYELEEQLIC-QVPVLDPLVSEQF----LNDVVEPKIEFPMIRSGLMIE-----  164

Query  814   NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEE  993
               + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME    LG +N E 
Sbjct  165   --EEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEE---LGLSNSE-  215

Query  994   EKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLEL  1173
                                 + E             + M    +       ++ F   EL
Sbjct  216   ------------------MFKIEKDEIEEEVEEIKAMSMDIFDDDRKDVDGTVPF---EL  254

Query  1174  KFDYDNDYYSPNNekeeegeel-------lkMRNKSTILLNLDYEAVILAWSDQRCPWIT  1332
              FDY++ + +   E  +  E          +  +K+ ++L L+Y++VI  W  Q  PW +
Sbjct  255   SFDYESSHKTSEEEVMKNVESSGECVVKVKEEEHKNVLMLRLNYDSVISTWGGQGPPWSS  314

Query  1333  GQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVS  1509
             G+ PE +    GWP   M    G  T H   Y G       FG          GREARVS
Sbjct  315   GEPPERDMDISGWPAFSMVENGGEST-HQKQYVGGCLPSSGFGDG--------GREARVS  365

Query  1510  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  366   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>ref|NP_173915.2| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
 sp|Q8RWD0.2|COL16_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 16 [Arabidopsis 
thaliana]
 gb|AAU90068.1| At1g25440 [Arabidopsis thaliana]
 dbj|BAE98579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30625.1| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
Length=417

 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 176/457 (39%), Positives = 231/457 (51%), Gaps = 88/457 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------  468
              ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT S         
Sbjct  13    TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAVVKHSNH  72

Query  469   -NIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
              +  PP    +WH GFTRK RTPR   G+ NN++    + HD+V           P++ S
Sbjct  73    SSASPPHEVATWHHGFTRKARTPR-GSGKKNNSS----IFHDLV-----------PDI-S  115

Query  634   DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
              E+ + + E E+QL+  +VP+ DP+V++      + D       F   +           
Sbjct  116   IEDQTDNYELEEQLIC-QVPVLDPLVSEQF----LNDVVEPKIEFPMIRSGLMIE-----  165

Query  814   NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEE  993
               + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME    LG +N E 
Sbjct  166   --EEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEE---LGLSNSE-  216

Query  994   EKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLEL  1173
                                 + E             + M    +       ++ F   EL
Sbjct  217   ------------------MFKIEKDEIEEEVEEIKAMSMDIFDDDRKDVDGTVPF---EL  255

Query  1174  KFDYDNDYYSPNNekeeegeel-------lkMRNKSTILLNLDYEAVILAWSDQRCPWIT  1332
              FDY++ + +   E  +  E          +  +K+ ++L L+Y++VI  W  Q  PW +
Sbjct  256   SFDYESSHKTSEEEVMKNVESSGECVVKVKEEEHKNVLMLRLNYDSVISTWGGQGPPWSS  315

Query  1333  GQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVS  1509
             G+ PE +    GWP   M    G  T H   Y G       FG          GREARVS
Sbjct  316   GEPPERDMDISGWPAFSMVENGGEST-HQKQYVGGCLPSSGFGDG--------GREARVS  366

Query  1510  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  367   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score =   229 bits (583),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 175/464 (38%), Positives = 220/464 (47%), Gaps = 100/464 (22%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
             A+ GK    ARACD C+ KRARW+C ADDAFLCQ+CD S+HSAN LA RH RV+L+T SN
Sbjct  11    AIGGK---TARACDSCLSKRARWFCPADDAFLCQSCDVSIHSANQLASRHERVRLETCSN  67

Query  472   ----------IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVP  621
                          PSWH+GFTRK RTPR         N K        K   +     VP
Sbjct  68    KSTITKLVDKTHQPSWHQGFTRKARTPR---------NGKKAQIRQWKKNEENR----VP  114

Query  622   EMCSDENYSHDDEKE-DQLLLYRVPIFDPVVADICT----TLNITDYDAAAAAFNQSKCA  786
             E+ S+EN   ++E E ++ LLYRVPIFDP  A++C     T +I D D      N     
Sbjct  115   EIGSEENSLDENEFENEEQLLYRVPIFDPFEAELCNVPDETGSIVDLD---ILLNTEDAC  171

Query  787   gggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
                      + D                +ELAEFAADVE+LLG     EEE S  +    
Sbjct  172   HDLNLPEFLSSD----------------IELAEFAADVETLLG----GEEEQSTQLLNAD  211

Query  967   FLGGN----NVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHY  1134
             F         VE+E+   ++      E  + +           E   +   MAA+A    
Sbjct  212   FENNKAIKIEVEDEEMRAVVACHLDPELDMEREALNWNFDEYYEETVEQKVMAADAAVTE  271

Query  1135  TSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQ  1314
               +S+  +     K D  N                        + L+L++EAVI AW +Q
Sbjct  272   FIASAEEYSGSSTKSDEKN-----------------------RLFLSLNHEAVISAWPNQ  308

Query  1315  RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGR  1494
               PW  G RP  N    WPD   +   G+   H    DG                   GR
Sbjct  309   SSPWTNGIRPHFNPDDYWPDFFSETSVGNYGGHVRCGDG-------------------GR  349

Query  1495  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             EARVSRYREKR+ RLFSKKIRYEVRKLNAEKRPR+KGRF+KR++
Sbjct  350   EARVSRYREKRQNRLFSKKIRYEVRKLNAEKRPRLKGRFIKRSS  393



>ref|XP_010527538.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=443

 Score =   228 bits (582),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 169/474 (36%), Positives = 225/474 (47%), Gaps = 90/474 (19%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN--------  471
              ARACD C+ +RARWYC +DDAFLCQACD SVHSANPLARR  RV+LK+ S+        
Sbjct  12    TARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRPERVRLKSASSSRTHRPTT  71

Query  472   IEPPS---WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD--  636
             + PP    WH GFTRK RTPR   G     N + V  HD+           VPE+  +  
Sbjct  72    VSPPGTAKWHHGFTRKARTPR-GSGSAGKPNQRAVFFHDL-----------VPEISVEDQ  119

Query  637   -ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
              ENY      E++ L+++VP+ DP V++      I +       F   +           
Sbjct  120   TENY------EEEQLIFQVPVLDPTVSEQYRDDAIEE----KTGFPLPELIKFADMNEEN  169

Query  814   NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEE  993
             + D   S           +MELAEFAADV++LLG  L+ E   SF  E LG   G +V  
Sbjct  170   DEDNAES---CLDRFFPTDMELAEFAADVDTLLGHNLETE---SFATEDLGLGDGLSVCG  223

Query  994   EKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLEL  1173
               +S M++                         ++ +         +     +     EL
Sbjct  224   RSSSMMLKLE-----------------NEDVHEEETVAREGTPMELFYERKGMDMTPFEL  266

Query  1174  KFDYDNDYYS--------------------PNNekeeegeellkMRNKSTILLNLDYEAV  1293
              FD D+ + +                     +            ++ K+ ++L L++EAV
Sbjct  267   SFDQDHSHRAFEEEEEDEEKNVINVNTGERESVRSGGSSNISHSIKKKNVLMLRLNHEAV  326

Query  1294  ILAWSDQRCPWITGQRPEMN-SHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFG-QAA  1467
             I  W  +  PW  G+ PE++   + W   + + G      +    D  G      G QAA
Sbjct  327   ISTWGGKGPPWTAGKPPELDLDDNSWHISMGENG------NEVPLDRYGGRFCGLGLQAA  380

Query  1468  IADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             + D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+ 
Sbjct  381   MMDG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASI  431



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score =   227 bits (578),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 178/471 (38%), Positives = 229/471 (49%), Gaps = 94/471 (20%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  AM GK    ARACD C+ KRARWYC+ADDAFLCQ CD+SVHSAN LA RH RV+L+T
Sbjct  7     AANAMGGK---TARACDGCLRKRARWYCSADDAFLCQGCDTSVHSANQLASRHTRVRLET  63

Query  463   LSN--------------IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLH  600
              S+                 P+WH+GFTRK RTPR          S   V       PL 
Sbjct  64    ASSRFNASVINNSATDQDALPAWHQGFTRKARTPRQNRSIQGQQKSDGKVWD---LNPL-  119

Query  601   LSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSK  780
                  VPE+  ++  +  +E EDQLL  RVP+FDP  A++    N           ++  
Sbjct  120   -----VPEVGCEDGSA--EETEDQLLC-RVPVFDPFSAELRDMANENGNLVVDGFEDEGT  171

Query  781   CAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEG  960
             C            DG              +++LA+FAADVESLLG GLD+          
Sbjct  172   CQLD---------DG-------LHGFLPSDLDLAQFAADVESLLGDGLDE----------  205

Query  961   LGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTS  1140
                   N     K + +M+  +  E    +  +        E     I  A   +  +  
Sbjct  206   -----NNTCNHTKGTELMDCKQEDESNAFQERKIKDEEEEEEG----IITACCFDSDFDV  256

Query  1141  SSSLCFDTLELKFDYDNDYYSPNNekeeegeellk--------MRNKSTILLNLDYEAVI  1296
             + S    +L   FDY++       E+E+                  K ++LL LDYE+VI
Sbjct  257   TRS----SLNWSFDYESPTIGDQEEEEKVVPVAETPIMDGEIKAEKKRSMLLRLDYESVI  312

Query  1297  LAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIAD  1476
              AW+ Q  PW +G RPE N     PD  M          +   +G+G +  + G+  I D
Sbjct  313   TAWATQGSPWTSGTRPEFN-----PDDFM---------GSNPNEGIGGI-CSQGKRNITD  357

Query  1477  DVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
                  REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKRA+F
Sbjct  358   GE---REARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  405



>ref|XP_009103068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=408

 Score =   226 bits (575),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 175/468 (37%), Positives = 230/468 (49%), Gaps = 110/468 (24%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN--------  471
              ARACD C+ +RARWYCAADDAFLCQ+CD+ VHSAN LARRH RV LK+ S         
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSASKHSNHNHNH  71

Query  472   --IEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
                 PP    +WH GFTRKPRTPR   G+ NN +    + HD+           VPE+ S
Sbjct  72    SPSSPPHEAATWHHGFTRKPRTPR-GSGKKNNLS----IFHDL-----------VPEI-S  114

Query  634   DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
              E+ +   E E+QL+  +VP+ DP VA+      + D   A   F   +           
Sbjct  115   VEDQTESCELEEQLIC-QVPVLDPTVAEQI----LNDVVEAKIEFPIMRSG-----VMMD  164

Query  814   NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGN--NV  987
             + + + +  +        +MEL E+AADVE+LLG+GLD E   S+ ME LG        +
Sbjct  165   DQEDEDNAESCLNGFFPTDMELEEYAADVETLLGRGLDTE---SYAMEELGLSNKEMFKI  221

Query  988   EEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFD--  1161
             E+E+ +  M                                             +C D  
Sbjct  222   EKEEETKDMNI------------------------------------------GICDDDR  239

Query  1162  ----TLELKFDYD--NDYYS---PNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQ  1314
                   EL FDY+  N Y      N E   E  ++ +   K+ ++L L+Y++VI  W  Q
Sbjct  240   DATAPFELSFDYESHNTYEEEVIKNIEGSGECVKVKEEEQKNVLMLRLNYDSVISTWGGQ  299

Query  1315  RCPWITGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVG  1491
               PW +G+ PE +     WP   M      G +  +       +G+    +   D    G
Sbjct  300   CPPWTSGEPPERDIDISNWPFVSM-----GGNVRESQQK--HHVGVCLPSSGFGDG---G  349

Query  1492  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFPL  1635
             REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+  +
Sbjct  350   REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASLAV  397



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   225 bits (574),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 177/489 (36%), Positives = 230/489 (47%), Gaps = 102/489 (21%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
             A+ GK    ARACD C+ +RARWYCAADDAFLCQACD+SVHSAN LARRH R++L+  S 
Sbjct  15    AVGGKE---ARACDACLRRRARWYCAADDAFLCQACDTSVHSANSLARRHERLRLRPTSP  71

Query  472   IEP------------------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL  597
             ++                   P+W   F RK RTPR    + +            V+T  
Sbjct  72    LQTPPPPTPASAKRESHDEVVPAW---FKRKARTPRGGRAKSD------------VRTLS  116

Query  598   HLSIVPVPEMCSDENYSHD-----DEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAA  762
                +VP        +  +D      E+ ++ +LYRVP+FDP +A+ C+   + D  A A+
Sbjct  117   RRLVVPHAAGGDSPDGRNDEGEFEAEEPEEEVLYRVPVFDPALAEFCSPQPLEDAAALAS  176

Query  763   AFNQSKCAgggghghhKNWDGKSStt----tmpptttememeLAEFAADVESLLGKGLDD  930
             + N+            +                      + EL EFAAD+E+LLG GLDD
Sbjct  177   SCNEDGAVEDPAKTDRETPAAAPLVQFFPDGGHANFGPTDAELREFAADMEALLGYGLDD  236

Query  931   --EEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddI  1104
               EE SSF ME LG L    V E+ +   +E                             
Sbjct  237   GNEESSSFCMETLGLLEPVEVGEDASRVKVE-----------------------------  267

Query  1105  FMAANANHHYTSSSSLCF-------DTLELKFDYDNDYYSPNNekeeegeellkMRN---  1254
                 +A     +S +L         D  +   D D +Y SP +    E            
Sbjct  268   ---TDAGSACEASGTLACALELLDPDASDEMLDIDFNYGSPQDTTTTENAASSSHTGTDG  324

Query  1255  ---KSTILLNLDYEAVILAWSDQRCPWITG-QRPEMNSHHGWP-DCIMQRGCGSGTIHAA  1419
                ++++ L L+YEA+I +W     PW  G +RP +     WP DC      G G +   
Sbjct  325   QFLQTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHG  382

Query  1420  AYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
               D +G   +  G     DD  VGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM
Sbjct  383   GEDLLGTPRLGQGM----DD--VGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  436

Query  1600  KGRFVKRAN  1626
             KGRFVKRA 
Sbjct  437   KGRFVKRAT  445



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   224 bits (571),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 176/489 (36%), Positives = 228/489 (47%), Gaps = 102/489 (21%)
 Frame = +1

Query  292   AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL--  465
             A+ GK    ARACD C+ +RARWYCAADDAFLCQ CD+SVHSAN LARRH R++L+    
Sbjct  15    AVGGKE---ARACDACLRRRARWYCAADDAFLCQVCDTSVHSANSLARRHERLRLRPTSP  71

Query  466   -----------SNIEP-----PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL  597
                        +N E      P+W   F RK RTPR    + +            V+T  
Sbjct  72    LQTPPPPTPASANRESHDEVVPAW---FKRKARTPRGGRAKSD------------VRTLS  116

Query  598   HLSIVPVPEMCSDENYSHDDEKEDQL-----LLYRVPIFDPVVADICTTLNITDYDAAAA  762
                +VP        +  +D+ + +       +LYRVP+FDP +A+ C+   + D  A A+
Sbjct  117   RRLVVPHAAGGDSPDGRNDEGEFEAEEPEEEVLYRVPVFDPALAEFCSPQPLEDAAALAS  176

Query  763   AFNQSKCAgggghghhKNWDGKSStt----tmpptttememeLAEFAADVESLLGKGLDD  930
             + N+            +                      + EL EFAAD+E+LLG GLDD
Sbjct  177   SCNEDGAVEDPAKTDRETPAAAPLVQFFPDGGHANFGPTDAELREFAADMEALLGYGLDD  236

Query  931   --EEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddI  1104
               EE SSF ME LG L    V E+ +   +E                             
Sbjct  237   GNEESSSFCMETLGLLEPVEVGEDASRVKVE-----------------------------  267

Query  1105  FMAANANHHYTSSSSLCF-------DTLELKFDYDNDYYSPNNekeeegeellkMRN---  1254
                 +A     +S +L         D  +   D D +Y SP +    E            
Sbjct  268   ---TDAGSACEASGTLACALELLDPDASDEMLDIDFNYGSPQDTTTTENAASSSHTGTDG  324

Query  1255  ---KSTILLNLDYEAVILAWSDQRCPWITG-QRPEMNSHHGWP-DCIMQRGCGSGTIHAA  1419
                ++++ L L+YEA+I +W     PW  G +RP +     WP DC      G G +   
Sbjct  325   QFLQTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHG  382

Query  1420  AYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
               D +G   +  G     DDV  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM
Sbjct  383   GEDLLGTPRLGQGM----DDV--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  436

Query  1600  KGRFVKRAN  1626
             KGRFVKRA 
Sbjct  437   KGRFVKRAT  445



>ref|XP_006302328.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
 gb|EOA35226.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
Length=410

 Score =   222 bits (566),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 170/473 (36%), Positives = 226/473 (48%), Gaps = 115/473 (24%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
              ARACD C+ +RARWYCAADDAFLC  CD SVHSANPLARRH RV+LK+ S+ +      
Sbjct  12    TARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKSASSGKHRHVPT  71

Query  478   --PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
               PP+WH+GFTRK RTPR          S  +V HD V           PEM S E+ + 
Sbjct  72    SPPPTWHQGFTRKARTPR------GGKKSHTMVFHDFV-----------PEM-STEDQAE  113

Query  652   DDEKEDQLLLYRVPIFDPVVADICTTLNI---TDYDAAAAAFNQSKCAgggghghhKNWD  822
               E E QL+ + VP+ +P+V + C   ++    ++      F  S            + +
Sbjct  114   SYEVEGQLI-FEVPVMNPMVEEQCFNESVETKIEFPMRPVCFKSS------------DEE  160

Query  823   GKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKA  1002
              + +  +        ++ELA+F ADVE+LLG G +       D +  G LG         
Sbjct  161   DEDNAESCLNGLFPTDIELAQFTADVETLLGGGAER------DFQPTGELG--------L  206

Query  1003  STMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLC-------FD  1161
               MM+                            I           ++  +C         
Sbjct  207   GEMMK----------------------------IEKEEVEEEEGVATRDMCDLDEVDETS  238

Query  1162  TLELKFDYDNDYYSPNNekeeegeellkMRN------------------KSTILLNLDYE  1287
               E+ FDY++   +  NE+EEE E+   M+N                  +  ++L L+YE
Sbjct  239   PFEISFDYESASKTSTNEEEEEDEKEDVMKNVMDMGVNEMSGKIKEENKEKALMLRLNYE  298

Query  1288  AVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAA  1467
             +VI  W  Q  PW   Q  E++       C       SG   A  Y+    +G+  G+A 
Sbjct  299   SVISTWGGQGIPWTAQQPSEIDLDMVC--CPTDSMGESGVDQAHHYNHFRGLGLRMGEAH  356

Query  1468  IADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
               D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR++
Sbjct  357   -GDG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSS  405



>gb|EAZ00428.1| hypothetical protein OsI_22452 [Oryza sativa Indica Group]
Length=447

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 173/468 (37%), Positives = 226/468 (48%), Gaps = 87/468 (19%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE--------  477
             RACD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+  S           
Sbjct  19    RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLRPSSPPPLVPPSGSG  78

Query  478   ------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE  639
                   P +W   F RK RTPR          S        V   L   +V VPE  +  
Sbjct  79    RRDEAVPAAW---FKRKARTPR----------SHAAKSAAAVGQLLSRRLVVVPEEAAGS  125

Query  640   NYSHDDEKED--------QLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggg  795
                  +E++D        + LLYRVPIFDP +++ C+   + D  AA +  N+       
Sbjct  126   GGDSPEERKDEGEIVEEQEQLLYRVPIFDPALSEFCSPPPLEDAAAAVSCCNEDGAVENP  185

Query  796   ghghhKNWDGKSSttt----mpptttememeLAEFAADVESLLGKGLDD-EEESSFDMEG  960
                        +                + EL EFAAD+E+LLG+GLDD  +E SF ME 
Sbjct  186   TKPSMTTTTATTPPLQFFPDGHANFGPTDAELREFAADMEALLGRGLDDGNDEDSFCMET  245

Query  961   LGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTS  1140
             LG +    V+++     +E                        AD D  M     H   +
Sbjct  246   LGLI--EPVDDDAGRVKVE------------------------ADGDAGMTLAWCHELDT  279

Query  1141  SSSLCFDTLELKFDYDNDY--YSPNNekeeegeellkMR----NKSTILLNLDYEAVILA  1302
              +S   + L++ FDY +     +P+ +    G            +S++ L+L+YEA+I +
Sbjct  280   ETS-SGEMLDIDFDYGSPQAATTPDEKVGSSGPAAAADDDAQFQQSSLALSLNYEAIIES  338

Query  1303  WSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDV  1482
             W     PW  G+RP +     WP         SG   AAA    G  G    + A+   +
Sbjct  339   WGTS--PWTDGERPRVKLDDSWPRDY------SGVWMAAA----GVFGHGGEEQALTPRL  386

Query  1483  WV--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
              +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  387   GMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  434



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 166/459 (36%), Positives = 225/459 (49%), Gaps = 98/459 (21%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK----------TLS  468
             ARAC+ C+  RARWYCAADDAFLC  CD+ VHSAN LA RH RV+L+          TL+
Sbjct  16    ARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHQRVKLQTASSKLNYSDTLN  75

Query  469   NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSK------------PVVHHDVVKTPLHLSIV  612
             + +  +WH GFTRK RTPRH+         K             V  ++ +  PL     
Sbjct  76    HNKKVAWHSGFTRKARTPRHSTKLQEQQQKKIHEEGEEEQQQQQVFFNNTISLPL-----  130

Query  613   PVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgg  792
              VPE+ S+E   ++DE E+QLL  RVP+FD   A++C+  N    +  A           
Sbjct  131   -VPELGSEEAL-YNDESEEQLLC-RVPVFD---AELCSVYNEVKEEVLAG----------  174

Query  793   gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
                   +N+  +             +M+LAEFAADVESLLG G D  E+SS  ++G   +
Sbjct  175   EEVFDLENFSCE---------FLPSDMDLAEFAADVESLLGNGAD--EDSSEHVKGSEIV  223

Query  973   GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSL  1152
                  E+++    ++                         + D  +         + +S 
Sbjct  224   LDCKEEDDEMDACVD----------------------GVGEKDAMVKVKDEEELDADTSC  261

Query  1153  CFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWIT  1332
               D++ L  ++++   S +         L + ++K  + L L+YE VI AW+ Q CPW T
Sbjct  262   HLDSIILDMNWNDIVESES---------LAQEQDKKEMFLRLNYEDVIAAWASQGCPWTT  312

Query  1333  GQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSR  1512
             G  P  NS    P  +   G      +       G+M    G A        GREARV R
Sbjct  313   GTPPNFNSDDFLPGFLGSNGEDVLCCY-------GEMRSLRGHAD------GGREARVLR  359

Query  1513  YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             YREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR +F
Sbjct  360   YREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTSF  398



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 168/467 (36%), Positives = 226/467 (48%), Gaps = 113/467 (24%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
              ARACD C+ +RARWYCAADDAFLC +CD SVHSANPLARRH RV+LK+ S+ +      
Sbjct  13    TARACDSCVKRRARWYCAADDAFLCHSCDGSVHSANPLARRHERVRLKSSSSGKHRHASS  72

Query  478   -PP---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS-DEN  642
              PP   +WH+GFTRK RTPR          S  +V  D+V           P M S D++
Sbjct  73    SPPHRATWHQGFTRKARTPR------GGKKSHTMVFQDLV-----------PVMSSEDQS  115

Query  643   YSHDDEKEDQLLLYRVPIFDPVVADICTTLNI---TDYDAAAAAFNQSKCAgggghghhK  813
             Y    E EDQL+ ++VP+ +P+V + C   ++    ++      F  S            
Sbjct  116   Y----EVEDQLI-FQVPVLNPMVEEQCVNESMETKIEFPMMPLCFKSSD-----------  159

Query  814   NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEE  993
               +   +  +        +MELA+F ADVE+LLG G++ E     DME LG      +E 
Sbjct  160   --EEDENAESCLNGLFPTDMELAQFTADVETLLGGGIERE---IHDMEELGLGEMLKIEH  214

Query  994   EKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLEL  1173
             E+     E + R                             N     TS   + FD    
Sbjct  215   EEE----EVATRE------------------------VCDLNDADDETSPFEISFD----  242

Query  1174  KFDYDNDYYSPNNekeeegeellkM---------------RNKSTILLNLDYEAVILAWS  1308
              ++Y N   S    +EE+ + +  M               + ++  +L LDY+AVI  W 
Sbjct  243   -YEYSNKTASEEEGEEEKEDVIKNMTGVKVNEMSCTVKEEKKENVPMLRLDYQAVISTWG  301

Query  1309  DQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWV  1488
              Q  PW   + PE++        +    C   +     ++    +G+  G A        
Sbjct  302   GQGTPWTALEPPEID--------LDMLCCSPNSTAHQHHNHFHGLGLRMGDAGDG-----  348

Query  1489  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR++ 
Sbjct  349   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  395



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score =   219 bits (559),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 170/494 (34%), Positives = 231/494 (47%), Gaps = 106/494 (21%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE-------  477
             ARACD C+ +RARWYC ADDAFLCQ CDSSVHSAN LARRH RV+L T S++        
Sbjct  16    ARACDSCLRRRARWYCTADDAFLCQGCDSSVHSANQLARRHERVRLGTASSLSSRIGCGG  75

Query  478   -----------------PPSWHRGFTRKPRTPR-------HAHGRYNNNNSKPVVHHDVV  585
                               P+WH GFTRK RTPR        +  R N+     V   ++ 
Sbjct  76    GAKLPSSAPPQFVDNSAAPAWHGGFTRKARTPRISKKILLRSQARNNHCEDDKVSKLNLT  135

Query  586   KTPLHLSIVPVPEMCSDENYS---HDDEKEDQLLLYRVPIFDPVVADI-----CTTLNIT  741
             +    +    VPE+ +D   S   + +E++++  LYRVP+F+P+ +++        L + 
Sbjct  136   RDDNFIDHNLVPELGNDLGGSPNENYNEEDEEQFLYRVPVFNPLASEMIGDEMADLLRVG  195

Query  742   DYDAAAAAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKG  921
             D      +F+                                +M+LAEFAADVE+LL   
Sbjct  196   DDVLRDGSFD-----------------------------LPSDMDLAEFAADVENLLSND  226

Query  922   LDDEEESSF--DMEGLGFLGGNNVE--EEKASTMMEFSRRHekvvvkveeedapapacea  1089
              +   E  F  D++ LG L     E   E+    + F RR + VV               
Sbjct  227   NEGGTEEDFACDVKDLGVLLECKEEGHHEEGVIGVCFDRRDQGVVKVEGLVGGG------  280

Query  1090  adddIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPN--------------Nekeee  1227
                    A + +      ++   D ++  FD+ ND +  +                   +
Sbjct  281   -------ALDCHMEIGFDATGAGDDVDWDFDFYNDDHVQSLGIEEKEDEENKMRTVVSGD  333

Query  1228  geellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGT  1407
              EE   M+ K  +LL L+YE V+ AW+ Q  PW TG RP+     GWP+  M     S  
Sbjct  334   AEEQATMKKKRKMLLRLNYEGVMAAWASQGSPWTTGDRPDFELDEGWPNSNMGTASHSLK  393

Query  1408  IHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1587
              H    + +G       +         GREARVSRYREKRRTR+FSKKIRY+VRKLNAEK
Sbjct  394   YHLPFAEAMGLRAHVGAEDG-------GREARVSRYREKRRTRMFSKKIRYQVRKLNAEK  446

Query  1588  RPRMKGRFVKRANF  1629
             RPRMKGRFVKR +F
Sbjct  447   RPRMKGRFVKRMSF  460



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score =   219 bits (558),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 173/474 (36%), Positives = 217/474 (46%), Gaps = 97/474 (20%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP---------  480
             CD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L   S ++          
Sbjct  24    CDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLCPASPLQTPPDRSAAAA  83

Query  481   ---------------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVP  615
                            P+W   F RK RTPR  H +             V +  L   +V 
Sbjct  84    ATATNKRERHDEVAVPAW---FGRKARTPRGGHAK------------SVGQVALSRRLV-  127

Query  616   VPEMCSDENYSHDDEK--EDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAg  789
             VP     ++ S D+    E++ LLYRVPI DP +A+ C+   +   DAA  A + S C  
Sbjct  128   VPHAAGGDSDSPDERNGGEEEQLLYRVPILDPALAEFCSPPPLE--DAAGLALDASVCNE  185

Query  790   ggghghhKNWDGKSStttmpptt-----tememeLAEFAADVESLLGKGLDD--EEESSF  948
              G        D  +      P +        + EL EFAAD+E+LLG GLDD  EE+SSF
Sbjct  186   DGAIEDPAKPDPAAPLAQFCPVSGHFNFGPTDAELREFAADMEALLGHGLDDGNEEDSSF  245

Query  949   DMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANH  1128
              ME LG L    V ++     +E                                  A+ 
Sbjct  246   YMETLGLLDPMEVGDDATQVKVETDGSSA-------------------------CCEASG  280

Query  1129  HYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTIL-----LNLDYEAV  1293
                    L  +  +   D D DY SP +   +E          +  L     L L+YEA+
Sbjct  281   TLACGLELDLEASDEMLDIDFDYASPQDTATDERAASSDTGADAQFLQTSLSLTLNYEAI  340

Query  1294  ILAWSDQRCPWI-TGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD--GVGDMGITFGQA  1464
             I +W     PW   G+RP +     WP          G +     D  G   +G+     
Sbjct  341   IQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDLPGTPRLGMDG---  395

Query  1465  AIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
                     GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 
Sbjct  396   --------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  441



>gb|EAZ36554.1| hypothetical protein OsJ_20892 [Oryza sativa Japonica Group]
Length=448

 Score =   217 bits (553),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 171/467 (37%), Positives = 227/467 (49%), Gaps = 86/467 (18%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE--------  477
             RACD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+  S           
Sbjct  19    RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLRPSSPPPLVPPSGSG  78

Query  478   ------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE  639
                   P +W   F RK RTPR       ++ +K       +   L   +V VPE  +  
Sbjct  79    RRDEAVPAAW---FKRKARTPR-------SHAAKSAAAFGQL---LSRRLVVVPEAAAGS  125

Query  640   NYSHDDEKED--------QLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggg  795
                  +E++D        + LLYRVPIFDP +++ C+   + D  AA +  N+       
Sbjct  126   GGDSPEERKDEGEIVEEQEQLLYRVPIFDPALSEFCSPPPLEDAAAAVSCCNEDGAVENP  185

Query  796   ghghhKNWDGKSSttt----mpptttememeLAEFAADVESLLGKGLDD-EEESSFDMEG  960
                        +                + EL EFAAD+E+LLG+GLDD  +E SF ME 
Sbjct  186   TKPSMTTTTATTPPLQFFPDGQANFGPTDAELREFAADMEALLGRGLDDGNDEDSFCMET  245

Query  961   LGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTS  1140
             LG +    V+++     +E                        AD D  M     H   +
Sbjct  246   LGLI--EPVDDDAGRVKVE------------------------ADGDAGMTLAWCHELDT  279

Query  1141  SSSLCFDTLELKFDYDNDY--YSPNNekeeegeell---kMRNKSTILLNLDYEAVILAW  1305
              +S   + L++ FD  +     +P+ +    G           +S + L+L+YEA+I +W
Sbjct  280   ETS-SGEMLDIDFDCGSPQAATTPDEKVGSSGPAAADDDAQLQQSNLALSLNYEAIIESW  338

Query  1306  SDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVW  1485
                  PW  G+RP +     WP         SG   AAA    G  G    + A+   + 
Sbjct  339   GTS--PWTDGERPHVKLDDSWPRDY------SGVWMAAA----GVFGHGGEEQALTPRLG  386

Query  1486  V--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  387   MDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  433



>ref|XP_009115317.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=414

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 171/452 (38%), Positives = 228/452 (50%), Gaps = 82/452 (18%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
              ARACD C+ KRARWYCAADDAFLCQ+CD+ VHSANPLARRH RV+LK+ S +       
Sbjct  12    TARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSASPVATKYSSH  71

Query  478   ------PP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM  627
                   PP    +WH+GFTRKPRTPR   G+ NN +    + HD+V           PE+
Sbjct  72    NHSASCPPLEAATWHQGFTRKPRTPR-GSGKKNNLS----IFHDLV-----------PEI  115

Query  628   CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghgh  807
              S E+ +   E E+QL+  +VP+ DP+VA+      + D       F             
Sbjct  116   -SAEDQTDSYEIEEQLIC-QVPVLDPMVAEQF----LNDVVEPKIEF---------PMIT  160

Query  808   hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNV  987
               + + + +  +        +MEL EFAADVE LLG+                   G +V
Sbjct  161   IDDQEDEDNAESCLNGFFPTDMELEEFAADVEILLGR-------------------GLDV  201

Query  988   EEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTL  1167
              E  A   +  S      + K E E+      +A +  I    +         ++ F   
Sbjct  202   TESYAMEELGLSNTEMFKIEKDEIEEEEGEETKAMNMGICCGEDRG---DGDGTVAF---  255

Query  1168  ELKFDYDN-DYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRP  1344
             EL+FD+D+ + Y     K  +  ++ +   K+ ++L+L+YE+VI  W  Q  PW++ + P
Sbjct  256   ELRFDHDSHNTYEEEAIKNADCIKVEEEEQKNVLMLSLNYESVISTWGGQGQPWLSREPP  315

Query  1345  EMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREK  1524
             E +        +     G G  H   Y G       FG          GREARVSRYREK
Sbjct  316   ERDIDISDKPVVSMEING-GESHHKHYVGGCLPSSGFGDG--------GREARVSRYREK  366

Query  1525  RRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             RRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  367   RRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  398



>ref|XP_009381448.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 184/461 (40%), Positives = 232/461 (50%), Gaps = 73/461 (16%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A  A+ GK    ARACD C  +RARWYC ADDAFLCQ CD SVHSANPLARRH RV+L+ 
Sbjct  14    ASSAVAGK---TARACDGCARRRARWYCPADDAFLCQNCDFSVHSANPLARRHRRVRLRA  70

Query  463   L---SNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
                 S    PSW RGF RK RTPR AH            H         L    VPE+  
Sbjct  71    ADVDSEESSPSWLRGFKRKARTPR-AHQ-----------HEKTTSGARRLRPTTVPELI-  117

Query  634   DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
              E    + E+E++ LLY VP+ DP +A+ C+   + D +          C+G        
Sbjct  118   -ETSVDETEEEEEQLLYCVPVVDPALAEFCSPPMLDDSNT---------CSGDETKPTMD  167

Query  814   NWDGKSStttmppttte------memeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLG  975
             + DG  ++T+   T            +LAEFAAD+ESLLG GL D  + SF ME LG + 
Sbjct  168   STDGTPASTSTVDTANRLAPFLPSVTDLAEFAADMESLLGGGL-DSRDGSFSMEKLGLV-  225

Query  976   GNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLC  1155
               N  E+     ++ + R                  +     + +  + +          
Sbjct  226   --NSMEDNVDYCLDSAGR-----------LKTEQPDDTEQCPVELDIDKSR---------  263

Query  1156  FDTLELKFDYDNDYYSPNNekeeegeellkMRNKST--ILLNLDYEAVILAWSD-QRCPW  1326
              +TLEL  D+     +   E EEE  E+   + + T    L LDYEAVI AWS     PW
Sbjct  264   -ETLELDLDWPGSSTAKEEELEEENMEVASEQQQVTKKAKLRLDYEAVISAWSSYGSSPW  322

Query  1327  ITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV--GDMGITFGQAAIADDVWVGREA  1500
               G+RP++N  + WPD +  R    G             D G+ F        V VGR+A
Sbjct  323   TDGERPQINLDYYWPDYMGVRVEVGGGGRGETPGTGHGSDTGVGF--------VDVGRQA  374

Query  1501  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  1623
             RV+RYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKRA
Sbjct  375   RVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA  415



>ref|XP_003630849.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AET05325.1| zinc finger constans-like protein [Medicago truncatula]
Length=416

 Score =   213 bits (542),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 166/473 (35%), Positives = 222/473 (47%), Gaps = 93/473 (20%)
 Frame = +1

Query  262   IEIKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRH  441
             I++K +   GA+  K    ARACD C+ +RARW+CAADDAFLC  CD+ VHSAN LA RH
Sbjct  3     IDMKGDADAGALGAK---TARACDSCLRRRARWFCAADDAFLCHGCDNLVHSANLLASRH  59

Query  442   ARVQLKTLS---NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL--HLS  606
              RV+L+T S        +WH GFTRK RTPRH      N NS        +K  +  + S
Sbjct  60    ERVRLQTASAKVTTTAQAWHSGFTRKARTPRH------NKNSSIQQQQQRLKEKVLFNTS  113

Query  607   IVP-VPEMCSDENYSHD-----DEKEDQLLLYRVPIFD--PVVADICTTLN-ITDYDAAA  759
              +P VPE+  +E    +     DE +++ LL RVP+FD  P   + CT  N   D++   
Sbjct  114   FLPLVPELGGEEEQGQELLVDIDEADEEQLLCRVPVFDANPFDLETCTVKNDAVDFEEMC  173

Query  760   AAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEE  939
                  S C                          E +++LAEFAA+VESLLG        
Sbjct  174   DL--DSFC--------------------------EFDVDLAEFAANVESLLG--------  197

Query  940   SSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAAN  1119
                       +G + ++E  +  + ++ + +E    K E         +  +    M ++
Sbjct  198   ----------VGSSEIQENSSGQVFDYKQENEMDASKSEMLKVKDEELDDLESVFDMTSD  247

Query  1120  ANHHYTSSSSLCFDTLELKFDYDNDYYSP--NNekeeegeellkMRNKSTILLNLDYEAV  1293
                H+        D  ++        Y P  N+        + K   K    L L+YE V
Sbjct  248   DVFHWN------IDNNDVSLAQQEKEYMPLSNSSVGYSESVITKEETKRERFLRLNYEEV  301

Query  1294  ILAWSDQR--CPWITGQRPEMN-SHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQA  1464
             I  WS Q    PW T   P+ N     W + +     GS  +        G +  + G  
Sbjct  302   ITEWSRQGSPSPWTTANPPKFNCDDDSWQNLL-----GSSGVEGEVRSLRGQLMGSGGDG  356

Query  1465  AIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  1623
                     GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR 
Sbjct  357   --------GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  401



>ref|NP_001057333.2| Os06g0264200 [Oryza sativa Japonica Group]
 dbj|BAD54363.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19247.2| Os06g0264200 [Oryza sativa Japonica Group]
Length=481

 Score =   214 bits (544),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 172/494 (35%), Positives = 230/494 (47%), Gaps = 107/494 (22%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE--------  477
             RACD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+  S           
Sbjct  19    RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLRPSSPPPLVPPSGSG  78

Query  478   ------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE  639
                   P +W   F RK RTPR       ++ +K       +   L   +V VPE  +  
Sbjct  79    RRDEAVPAAW---FKRKARTPR-------SHAAKSAAAFGQL---LSRRLVVVPEAAAGS  125

Query  640   NYSHDDEKED--------QLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggg  795
                  +E++D        + LLYRVPIFDP +++ C+   + D  AA +  N+       
Sbjct  126   GGDSPEERKDEGEIVEEQEQLLYRVPIFDPALSEFCSPPPLEDAAAAVSCCNEDGAVENP  185

Query  796   ghghhKNWDGKSSttt----mpptttememeLAEFAADVESLLGKGLDD-EEESSFDMEG  960
                        +                + EL EFAAD+E+LLG+GLDD  +E SF ME 
Sbjct  186   TKPSMTTTTATTPPLQFFPDGQANFGPTDAELREFAADMEALLGRGLDDGNDEDSFCMET  245

Query  961   LGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTS  1140
             LG +    V+++     +E                        AD D  M     H   +
Sbjct  246   LGLI--EPVDDDAGRVKVE------------------------ADGDAGMTLAWCHELDT  279

Query  1141  SSSLCFDTLELKFDYDNDY--YSPNNekeeegeell---kMRNKSTILLNLDYEAVILAW  1305
              +S   + L++ FD  +     +P+ +    G           +S + L+L+YEA+I +W
Sbjct  280   ETS-SGEMLDIDFDCGSPQAATTPDEKVGSSGPAAADDDAQLQQSNLALSLNYEAIIESW  338

Query  1306  SDQRCPWITGQRPEMNSHHGWP---------------------------DCIMQRGCGSG  1404
                  PW  G+RP +     WP                           D + +R    G
Sbjct  339   GTS--PWTDGERPHVKLDDSWPRDYSVRATPCTPYASSHRILHNLAGTDDLLRRRAAVQG  396

Query  1405  TIHAAAYDGVGDMGITFGQAAIADDVWV--GREARVSRYREKRRTRLFSKKIRYEVRKLN  1578
                AAA    G  G    + A+   + +  GREARVSRYREKRRTRLFSKKIRYEVRKLN
Sbjct  397   VWMAAA----GVFGHGGEEQALTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLN  452

Query  1579  AEKRPRMKGRFVKR  1620
             AEKRPRMKGRFVKR
Sbjct  453   AEKRPRMKGRFVKR  466



>ref|XP_002436824.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
 gb|EER88191.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
Length=474

 Score =   213 bits (542),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 177/491 (36%), Positives = 228/491 (46%), Gaps = 107/491 (22%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK-TLSNIEP------  480
             RACD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+   ++  P      
Sbjct  23    RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLQPAAASSSPLHTPPR  82

Query  481   ----------------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIV  612
                             P+W   F RK RTPR  H +         V    +     L +V
Sbjct  83    TGAAANNKRERHDEVVPAW---FRRKARTPRGGHAKS--------VGGQALSRSRRLGVV  131

Query  613   PVPEMCSDENYSHDDEKEDQL--------LLYRVPIFDPVVADICTTLNITDYDAAAAAF  768
              VP   +    S DD +  +         LLYRVPIFDP +A+ C+       DAAA A 
Sbjct  132   -VPHAAAGGGDSPDDGRSAEGEFEAEEEQLLYRVPIFDPALAEFCSPPPAPLEDAAALAS  190

Query  769   NQSKCAgggghghhKNWDGKSStttmpptt----------tememeLAEFAADVESLLGK  918
             + ++        + K   G ++    P                + EL EFAAD+E+LLG 
Sbjct  191   SCNEDGAVEDPANSKPDPGPATPAPAPVVQFFPDSGHANFEPTDAELREFAADMEALLGH  250

Query  919   GLDD--EEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaa  1092
             GLDD  EE+SSF ME LG L    V ++     +E                         
Sbjct  251   GLDDGNEEDSSFYMETLGLLDPVEVGDDATRVKVETD-----------------------  287

Query  1093  dddIFMAANANHHYTSSSSL-CFDTLELK---FDYDNDYYSPNNekeeegeellkMRN--  1254
                   +A      T + +L   D  E+     D D +Y SP +   ++ +         
Sbjct  288   ----GGSACGEASGTLACALELLDPAEVSDEMLDIDFNYGSPLDTMMDDEKAASSDTGGA  343

Query  1255  ------KSTILLNLDYEAVILAWSDQRCPWIT-GQRPEMNSHHGWPDCIMQRGCGSGTIH  1413
                   ++++ L L+YEA+I +W     PW   G+RP +     WP   M          
Sbjct  344   DDAQFLQTSLSLTLNYEAIIQSWGSS--PWTAGGERPHVKLDDSWPHTNMW--------V  393

Query  1414  AAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1593
                  G G   +  G A +  D   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP
Sbjct  394   VGGVAGHGGEDLLLGTARLGMD--GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  451

Query  1594  RMKGRFVKRAN  1626
             RMKGRFVKRA 
Sbjct  452   RMKGRFVKRAT  462



>dbj|BAJ87752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   212 bits (540),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 177/491 (36%), Positives = 229/491 (47%), Gaps = 90/491 (18%)
 Frame = +1

Query  259   GIEIKIEGAE-GAMEGKHKAAARA--------CDYCIGKRARWYCAADDAFLCQACDSSV  411
             G+ + +E AE G  +  HKAA  A        CD C+ +RARWYCAADDAFLCQ C++SV
Sbjct  56    GLHVLVEAAEMGGSDHNHKAAGGAVGGKAARACDGCMRRRARWYCAADDAFLCQGCETSV  115

Query  412   HSANPLARRHARVQLKTLSNIEPPSWHRGFTRKPRTPRH------AHGRYNNNNSKPVVH  573
             HSANPLARRH R++L+  S +            P T         A  +      +P V 
Sbjct  116   HSANPLARRHERLRLRVTSPLPAEGVATAVKGSPATTSKCLDVAPAWPKRKARTRRPTVK  175

Query  574   HDVVKTPLHLSIVPVPEMCSDENYSHDDEK--EDQLLLYRVPIFDPVVADICTTLNITDY  747
                V   L   +V VPE+ + E+ + D+ +  E++ LLYRVP+FDP + + C+   I D 
Sbjct  176   S--VGQLLSRRLV-VPEVGAGESSTSDERRAPEEEQLLYRVPVFDPALGEFCSPPPIDD-  231

Query  748   DAAAAAFNQSKCAgggghghhKNWDGKSStttmp---ptttememeLAEFAADVESLLGK  918
              A AA     +   G      +  D  S    +P    +    + +L EFAAD+E+LLG+
Sbjct  232   -AVAATSRHGEDVEGAVEDAKELMDTPSPVQELPDCFASFGPTDADLREFAADMEALLGQ  290

Query  919   GLDD--EEESSFDMEGLGFLG-----GNNVEEEKASTMMEFSRRHekvvvkveeedapap  1077
             GLDD  E E SF ME LG +      G  V+ E    ++  S                  
Sbjct  291   GLDDGNELEDSFYMEALGLISPPAEHGGRVKVEADGGLVSRSN-----------------  333

Query  1078  aceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNK  1257
                           A H      S    TL    D D+ +    +              K
Sbjct  334   ----------GVLAAGHDLKREFSGSPPTL---VDDDDSFEHKTSSASNGDAVDGAQFLK  380

Query  1258  STILLNLDYEAVILAWSDQRCPWITGQRPE--------MNSHHGWPDCIMQRGCGSGTIH  1413
              ++ L L+YEAVI +W+    PW  G+RP         +N H G     M    G G   
Sbjct  381   RSLDLRLNYEAVIASWASS--PWTDGRRPPGQQLDDLLLNDHAG-----MWTAGGGGRQG  433

Query  1414  AAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1593
              AA+            A    D W  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRP
Sbjct  434   EAAW-----------PARPRTDGW--REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRP  480

Query  1594  RMKGRFVKRAN  1626
             RMKGRFVKR  
Sbjct  481   RMKGRFVKRTG  491



>gb|AFK37106.1| unknown [Medicago truncatula]
Length=416

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 164/473 (35%), Positives = 221/473 (47%), Gaps = 93/473 (20%)
 Frame = +1

Query  262   IEIKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRH  441
             I++K +   GA+  K    ARACD C+ +RARW+CAADDAFLC  CD+ VHSAN LA RH
Sbjct  3     IDMKGDADAGALGAK---TARACDSCLRRRARWFCAADDAFLCHGCDNLVHSANLLASRH  59

Query  442   ARVQLKTLS---NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL--HLS  606
              +V+L+T S        +WH GFTRK RTPRH      N NS        +K  +  + S
Sbjct  60    EKVRLQTASAKVTTTAQAWHSGFTRKARTPRH------NKNSSIQQQQQRLKEKVLFNTS  113

Query  607   IVP-VPEMCSDENYSHD-----DEKEDQLLLYRVPIFD--PVVADICTTLN-ITDYDAAA  759
              +P VPE+  +E    +     DE +++ LL RVP+FD  P   + CT  N   D++   
Sbjct  114   FLPLVPELGGEEEQGQELLVDIDEADEEQLLCRVPVFDANPFDLETCTVKNDAVDFEEMC  173

Query  760   AAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEE  939
                  S C                          E +++LAEFAA+VESLLG        
Sbjct  174   DL--DSFC--------------------------EFDVDLAEFAANVESLLG--------  197

Query  940   SSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAAN  1119
                       +G + ++E  +  + ++ + +E    K E         +  +    M ++
Sbjct  198   ----------VGSSEIQENSSGQVFDYKQENEMDASKSEMLKVKDGELDDLESVFDMTSD  247

Query  1120  ANHHYTSSSSLCFDTLELKFDYDNDYYSP--NNekeeegeellkMRNKSTILLNLDYEAV  1293
                H+        D  ++        Y P  N+        + K   K    L L+YE V
Sbjct  248   DVFHWN------IDNNDVSLAQQEKEYMPLSNSSVGYSESVITKEETKRERFLRLNYEEV  301

Query  1294  ILAWSDQR--CPWITGQRPEMN-SHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQA  1464
             I   S Q    PW T   P+ N     W + +     GS  +        G +  + G  
Sbjct  302   ITECSRQGSPSPWTTASPPKFNCDDDSWQNLL-----GSSGVEGEVRSLRGQLMGSGGDG  356

Query  1465  AIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  1623
                     GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR 
Sbjct  357   --------GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  401



>dbj|BAK04456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score =   203 bits (517),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 170/460 (37%), Positives = 219/460 (48%), Gaps = 123/460 (27%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL---------KTLSNIEP  480
             CD C+ +RARW+CAADDA+LCQACD+SVHSANPLARRH RV+L          +L + +P
Sbjct  16    CDGCMRRRARWHCAADDAYLCQACDASVHSANPLARRHHRVRLPSSSSPAATSSLQHADP  75

Query  481   --PSWHRGFTRKPRTPRHAHGRYNNNNSKP--VVHHDVVKTPLHLSIVPVPE-------M  627
               P+W  G  R+PRTPR          SKP  V  H         S VP  E       +
Sbjct  76    DEPAWVHGLKRRPRTPR----------SKPGTVSKHCAPAKAAAASAVPDLEAEDSGSGI  125

Query  628   CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDY------DAAAAAFNQSKCAg  789
               D +  H  E ED+ LLYRVP+FDP++A++   + + D+        A   F+   C  
Sbjct  126   VGDNDDGHGIEVEDEDLLYRVPVFDPMLAELYNPMPVDDFREPLEQKPAVCCFSSLACQP  185

Query  790   ggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                +          +           +MELA FAAD+ESLL  G+    E  +D   L F
Sbjct  186   SSDYASGV----AGAADGFTGFDVVPDMELASFAADMESLLMGGV----EEGYD--DLRF  235

Query  970   LGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSS  1149
             L     +EEK    ++F                             MA            
Sbjct  236   L-----DEEKPQLNLDFD----------------------------MA------------  250

Query  1150  LCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWS-DQRCPW  1326
                       D+D+   S     E+E E+  + R+ S ++L LDYE VI +W+ D   PW
Sbjct  251   ----------DFDDQSQSAAPAPEQELEDRKRKRSDSGMILKLDYERVIDSWAHDGGSPW  300

Query  1327  ITGQRPEMN-SHHGWPDCIM-QRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREA  1500
               G+RP ++ +   W D     RG G G    A         +T G+          REA
Sbjct  301   FYGERPHIDPTDDSWLDMPAGSRGFGLGAAVTA---------VTGGE----------REA  341

Query  1501  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             RVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  342   RVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  381



>ref|XP_009409257.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   203 bits (517),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 166/442 (38%), Positives = 211/442 (48%), Gaps = 65/442 (15%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNI-EP----  480
             AARAC  C+  RARWYC A  AFLCQ CDSSVHSANPL RRH RV+L T S + EP    
Sbjct  19    AARACYGCLRHRARWYCTAHHAFLCQICDSSVHSANPLVRRHQRVRLTTTSLVGEPGESS  78

Query  481   PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDE  660
             PSW  GF RK RT R  H R N                  ++   +PE   D +   DD+
Sbjct  79    PSWLEGFERKARTSRPQH-RTN-----------------MMAAGDLPEQLVDASVDEDDD  120

Query  661   KEDQLLL-YRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSSt  837
              E +  L Y VPI +P+ A  C+     D   A ++ + +  A         N     ST
Sbjct  121   GEQEEELSYCVPIRNPLFASFCSPPPPLDNSNATSSGDDA--AAKTSVELSDNSPASPST  178

Query  838   ttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMME  1017
                      M++E++EFAA ++SLLG  L   +++ F M  L          E     +E
Sbjct  179   INKMDGFLTMDLEISEFAARIKSLLGGDLVGGDDA-FCMANLELA---EPVAENTGFSIE  234

Query  1018  FSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDY  1197
                RH                       + M         S   L  + LE  F +    
Sbjct  235   DDARH-----------------------VKMEQPDRDEDESQGELELN-LECSFPFTRGE  270

Query  1198  YSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQ-RCPWITGQRPEMNSHHGWPD  1374
                  ++       ++   +    L LDYE++I+AWS Q   PW  G+RP++N  + WPD
Sbjct  271   EESEEDEVAGTAVKVEQGAEKKAKLRLDYESIIMAWSSQGSSPWTDGERPQINVDNCWPD  330

Query  1375  CIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKI  1554
               M    GSG     A  G G++G+  G           REARV+RYREKRRTRLFSKKI
Sbjct  331   -YMDMWTGSGMETERACHG-GEIGVYLGDGK--------REARVTRYREKRRTRLFSKKI  380

Query  1555  RYEVRKLNAEKRPRMKGRFVKR  1620
             RYEVRKLNAEKRPRMKGRFVKR
Sbjct  381   RYEVRKLNAEKRPRMKGRFVKR  402



>ref|XP_004953820.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Setaria italica]
Length=465

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 168/468 (36%), Positives = 215/468 (46%), Gaps = 78/468 (17%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPPSWHRGFT-  504
             CD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+  S + P S   G   
Sbjct  21    CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRLRPTSPMHPLSAFEGGAP  80

Query  505   --------RKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDE  660
                     ++ +    A  R      +P V    V   L   ++ VPE+  + +     E
Sbjct  81    STSTLMSKKRQQVAPAAWSRRKARTRRPQVKS--VGQLLSRKLIVVPEVTVESSEERKAE  138

Query  661   KEDQL------LLYRVPIFDPVVADICTTLNITDYDAAAAA----------FNQSKCAgg  792
              E+        LLY VP FD  +A++C+   I D   AAA              +K A  
Sbjct  139   DEESEEAAEEQLLYCVPTFDRALAELCSPPPIDDDSPAAAPCCREDADDSNVEHAKAAPV  198

Query  793   gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDD--EEESSFDMEGLG  966
                   +                  + EL EFAAD+E+LLG+GLDD  + + SF ME LG
Sbjct  199   AAESPVQQL------PDSFAGFGPTDAELREFAADMEALLGQGLDDGNQLDESFYMESLG  252

Query  967   FL------GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANH  1128
              +      GG  ++ E  S ++     H  +           P   A   DI        
Sbjct  253   LMTTPTEDGGRVLKMEPDSIVVS----HGDMGALGRSPAEVKPEESAEVLDI--------  300

Query  1129  HYTSSSSLCFDTLELKFDYDNDY-YSPNNekeeegeellkMRNKSTILLNLDYEAVILAW  1305
              +  SS    D        D DY +         G        K ++ L L+YEAVI +W
Sbjct  301   DFNCSSPTVIDN-------DEDYCFEQKASAASNGVAADAQFLKRSLDLRLNYEAVIESW  353

Query  1306  SDQRCPWITGQRPEMNSHHGWPDCIMQRGC---GSGTIHAAAYDGVGDMGITFGQAAIAD  1476
                  PW  GQRP++     WP      G    G G +   A      +G+  G      
Sbjct  354   GSS--PWTDGQRPDVQLDDFWPHHAHHSGVWMAGGGRLGGEAL--TPRLGMGGG------  403

Query  1477  DVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
                 GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  404   ----GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  447



>ref|XP_009109881.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=395

 Score =   200 bits (509),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 155/441 (35%), Positives = 216/441 (49%), Gaps = 77/441 (17%)
 Frame = +1

Query  316   AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK--TLSNIEPPSW  489
              AR CD C+ K+A W+CAAD+AFLCQ+CD+SVHSAN LARRH RV+LK  T    E P+W
Sbjct  12    TARTCDNCLKKQAHWFCAADEAFLCQSCDTSVHSANLLARRHERVRLKDSTSPQQEAPTW  71

Query  490   HRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKED  669
             +RGFTRKPRTPR   G+ NN+++      D+           VPE+ S E  +   E E 
Sbjct  72    YRGFTRKPRTPR-GSGKRNNSST----FQDM-----------VPEI-SAEGQTDSSEVEG  114

Query  670   QLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmp  849
              L+  +VP+  P+V +                F   +          ++ D      +  
Sbjct  115   PLIC-QVPVLGPMVVE------------PKIKFPTMRSGVMIDGHEDEDKD-----ESCL  156

Query  850   ptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMMEFSRR  1029
                    ME+ +FAADVE+LLG GLD E   S+ ME LG    +N E  K   + +   +
Sbjct  157   NGIFPTNMEVEDFAADVETLLGHGLDKE---SYTMEELGL---SNTEMFKKDEIEDKETK  210

Query  1030  HekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPN  1209
                                    ++ +    +       +L FD    +  Y+ D    N
Sbjct  211   ---------------------AMNMDIEIGDDDQGNRDGTLPFDLNYPQNAYEEDAIK-N  248

Query  1210  NekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSH-HGWP--DCI  1380
              E   E  +  + + K+ ++L+LDY+ VI AW  Q  PW +G  PE++ +  G P    +
Sbjct  249   VESSGECVQAKEEKKKNVLMLSLDYDQVISAWGGQGLPWTSGGPPELDINISGSPVVSKV  308

Query  1381  MQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRY  1560
              +R  G  +       G          + + D    GREA VSRYREK++TR F+K IRY
Sbjct  309   SKRDNGRKSRKKRRVGGC------LPSSVVGDG---GREASVSRYREKKKTRSFTKTIRY  359

Query  1561  EVRKLNAEKRPRMKGRFVKRA  1623
             EVRKLNAE +PRMKGRFVKR 
Sbjct  360   EVRKLNAENKPRMKGRFVKRT  380



>ref|XP_004953821.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Setaria italica]
Length=441

 Score =   201 bits (510),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 162/467 (35%), Positives = 211/467 (45%), Gaps = 100/467 (21%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPPSWHRGFT-  504
             CD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+  S + P S   G   
Sbjct  21    CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRLRPTSPMHPLSAFEGGAP  80

Query  505   --------RKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDE  660
                     ++ +    A  R      +P V    V   L   ++ VPE+  + +     E
Sbjct  81    STSTLMSKKRQQVAPAAWSRRKARTRRPQVKS--VGQLLSRKLIVVPEVTVESSEERKAE  138

Query  661   KEDQL------LLYRVPIFDPVVADICTTLNITDYDAAAAA----------FNQSKCAgg  792
              E+        LLY VP FD  +A++C+   I D   AAA              +K A  
Sbjct  139   DEESEEAAEEQLLYCVPTFDRALAELCSPPPIDDDSPAAAPCCREDADDSNVEHAKAAPV  198

Query  793   gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDD--EEESSFDMEGLG  966
                   +                  + EL EFAAD+E+LLG+GLDD  + + SF ME LG
Sbjct  199   AAESPVQQL------PDSFAGFGPTDAELREFAADMEALLGQGLDDGNQLDESFYMESLG  252

Query  967   FL------GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANH  1128
              +      GG  ++ E  S ++                     A   +  ++    +A  
Sbjct  253   LMTTPTEDGGRVLKMEPDSIVVSHG---------------DMGALGRSPAEVKPEESAEK  297

Query  1129  HYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWS  1308
                +S+ +  D   LK   D                           L L+YEAVI +W 
Sbjct  298   ASAASNGVAADAQFLKRSLD---------------------------LRLNYEAVIESWG  330

Query  1309  DQRCPWITGQRPEMNSHHGWPDCIMQRG---CGSGTIHAAAYDGVGDMGITFGQAAIADD  1479
                 PW  GQRP++     WP      G    G G +   A      +G+  G       
Sbjct  331   SS--PWTDGQRPDVQLDDFWPHHAHHSGVWMAGGGRLGGEAL--TPRLGMGGG-------  379

Query  1480  VWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
                GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  380   ---GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  423



>ref|XP_009381104.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 172/459 (37%), Positives = 223/459 (49%), Gaps = 84/459 (18%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT------LSNIE-  477
             AR CD C+ +RARW+C ADDAFLCQACD SVHSANPLARRH RV+LKT      LS  E 
Sbjct  18    ARPCDGCLRRRARWFCEADDAFLCQACDVSVHSANPLARRHRRVRLKTASFSGFLSTTED  77

Query  478   ------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVP-VPEMCSD  636
                    P+W  G  RKPRTPR   G              V   P    + P VP++ + 
Sbjct  78    GLGDHATPAWLHGCKRKPRTPRGKPG--------------VAGAPTAAKVEPLVPDLEAL  123

Query  637   ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
                 +   +EDQLL + VPI DPV+A++   L+   +D A  +  ++K A       H +
Sbjct  124   SAEENQFNEEDQLL-HCVPILDPVLAEL---LSQPHHDHANGSDTEAKPAVQLLEQAHVS  179

Query  817   WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
                   T          ++EL +FA+D+E LLG GLD++   SF ++GLG++ G   ++ 
Sbjct  180   ---AVPTADGLGGFHASDLELEQFASDMEVLLGSGLDND---SFCIDGLGWMNGTVEDDS  233

Query  997   KASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELK  1176
                  +E                                A  + ++     L    L+L 
Sbjct  234   DGQVKVEVD---------------------------LDVARTSSNFRMEMDLPKWKLDLG  266

Query  1177  FD-----YDNDYYSP-NNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCP-WITG  1335
             FD      + D + P    +        +   K  ++L LDYEAVI A S      WI G
Sbjct  267   FDSQMMAVEVDEHKPLQQAETASDNYRAEAAAKRKMILRLDYEAVIAACSSNVLSLWIDG  326

Query  1336  QRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRY  1515
              RP+ + +  WPD             A     + +M      A  AD+   GREARVSRY
Sbjct  327   VRPDFDPNDSWPDV---------PAMAGGAAAMKEMHYQQEVAHAADE---GREARVSRY  374

Query  1516  REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFP  1632
             REKRR RLFSKKIRYEVRKLNAEKRPRMKGRFVKR  FP
Sbjct  375   REKRRRRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPAFP  413



>dbj|BAD15937.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16130.1| zinc finger protein-like [Oryza sativa Japonica Group]
Length=452

 Score =   194 bits (492),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 168/467 (36%), Positives = 220/467 (47%), Gaps = 77/467 (16%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPP--------  483
             CD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+  S   PP        
Sbjct  20    CDSCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLRVSS--PPPLTARASVE  77

Query  484   ---SWHRGFTRKPRTPRH-----AHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC---  630
                +   G T    + R      A  +      +P V    V   L   +V VPEM    
Sbjct  78    EEAAAAVGTTTTTTSKREGGVTPAWSKRKARTRRPQVKS--VGQLLSRRLV-VPEMAVES  134

Query  631   SDENYSHDDEKEDQL---LLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggggh  801
             SDE  + +D   ++L   LLYRVP+FDP +A+ C+   I D  AA+++  +   A G   
Sbjct  135   SDERKADEDGAHEELEGQLLYRVPVFDPSLAEFCSPPPIDDAAAASSSCFKEDAADGAVE  194

Query  802   ghhKNWDGKSStttmpptt----tememeLAEFAADVESLLGKGLDD--EEESSFDMEGL  963
                      SS     P +       + EL EFAAD+E+LLG+GLDD  E + SF ME L
Sbjct  195   DAKYPAAAASSPVQQLPDSFVNFEPTDAELREFAADMEALLGQGLDDSNELQDSFYMETL  254

Query  964   GFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSS  1143
             G +      EE     ME                        A +      +   H    
Sbjct  255   GLI--TPPVEESGRVKMELD-------------------GGVASNSRVSLPSCRAHPKPE  293

Query  1144  SSLCFDTLELKFD---YDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQ  1314
                  D L++ F+    D    S +N    + +   +     ++ L L+YEA+I +W + 
Sbjct  294   DVESADVLDIDFNCTSPDEQKSSASNGAAADSQFFHR-----SLDLRLNYEAIIESWGNS  348

Query  1315  RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWV--  1488
               PW  G+ P       WP+            H +     G  G       +     +  
Sbjct  349   --PWTDGRPPHGQLDDFWPN----------DHHYSGLWAAGGGGHGAEVGMMTVRPRMDG  396

Query  1489  -GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
              GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR +
Sbjct  397   PGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPS  443



>ref|XP_004953822.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Setaria italica]
Length=440

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 160/467 (34%), Positives = 207/467 (44%), Gaps = 101/467 (22%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPPSWHRGFT-  504
             CD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+  S + P S   G   
Sbjct  21    CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRLRPTSPMHPLSAFEGGAP  80

Query  505   --------RKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDE  660
                     ++ +    A  R      +P V    V   L   ++ VPE+  + +     E
Sbjct  81    STSTLMSKKRQQVAPAAWSRRKARTRRPQVKS--VGQLLSRKLIVVPEVTVESSEERKAE  138

Query  661   KEDQL------LLYRVPIFDPVVADICTTLNITDYDAAAAA----------FNQSKCAgg  792
              E+        LLY VP FD  +A++C+   I D   AAA              +K A  
Sbjct  139   DEESEEAAEEQLLYCVPTFDRALAELCSPPPIDDDSPAAAPCCREDADDSNVEHAKAAPV  198

Query  793   gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDD--EEESSFDMEGLG  966
                   +                  + EL EFAAD+E+LLG+GLDD  + + SF ME LG
Sbjct  199   AAESPVQQL------PDSFAGFGPTDAELREFAADMEALLGQGLDDGNQLDESFYMESLG  252

Query  967   FL------GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANH  1128
              +      GG  ++ E  S ++     H  +           P   A          A+ 
Sbjct  253   LMTTPTEDGGRVLKMEPDSIVVS----HGDMGALGRSPAEVKPEESAEASAASNGVAADA  308

Query  1129  HYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWS  1308
              +   S      L+L+ +Y                                 EAVI +W 
Sbjct  309   QFLKRS------LDLRLNY---------------------------------EAVIESWG  329

Query  1309  DQRCPWITGQRPEMNSHHGWPDCIMQRGC---GSGTIHAAAYDGVGDMGITFGQAAIADD  1479
                 PW  GQRP++     WP      G    G G +   A      +G+  G       
Sbjct  330   SS--PWTDGQRPDVQLDDFWPHHAHHSGVWMAGGGRLGGEAL--TPRLGMGGG-------  378

Query  1480  VWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
                GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  379   ---GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  422



>ref|XP_008646195.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 gb|AFW73247.1| hypothetical protein ZEAMMB73_807545 [Zea mays]
 gb|AIB05540.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=496

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 156/453 (34%), Positives = 217/453 (48%), Gaps = 51/453 (11%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL----SNIEPPSWHR  495
             CD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+      + +E      
Sbjct  19    CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRLRPTDPHSTTLEAGVATA  78

Query  496   GFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS-----DENYSHDDE  660
              + ++ +    A  +      +P  H   V   L   +V VPE+       +     ++E
Sbjct  79    TWKKRQQQVAPAWSKRKARTRRP--HVKSVGELLSRKLVVVPEVSPIESSEERKAEEEEE  136

Query  661   KEDQLLLYRVPIFDPVVADICTTLNITDYDAAA---------AAFNQSKCAgggghghhK  813
             +E+  LLY VP FD  +A++C+     D   A+         A  N +K           
Sbjct  137   EEEGQLLYCVPTFDRALAELCSPPPPVDDPTASSCCRDDVDGAVENNTKAPPVVVAESPV  196

Query  814   NWDGKSStttmpptttememeLAEFAADVESLLGKGLDD--EEESSFDMEGLGFLGGNNV  987
                  S            + EL EFAAD+E+LLG+GLDD  E + SF ME LG +     
Sbjct  197   QQLPDS-----FAGFGPTDAELREFAADMEALLGQGLDDGNELDRSFYMESLGLMA--QQ  249

Query  988   EEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTL  1167
              E+     ME        +V        AP     +     ++ A     +  + C  T+
Sbjct  250   AEDVGRIKME-----PNGIVSSRSRGEGAPGFGPTEMKPEASSAAAEVLDTDFNCCSPTV  304

Query  1168  ELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPE  1347
              +  + ++ +    +              K ++ L+L+YEA+I +W     PW  GQRP 
Sbjct  305   MMDNEDEDSFEQKASASNAAAAAAGTQFLKRSLDLSLNYEAIIESWGSS--PWTDGQRPS  362

Query  1348  MNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVG--REARVSRYRE  1521
             +     WP             HA     +   G   G+AA+   + +G  REARV+RYRE
Sbjct  363   VQLDDFWP-------------HAHLTGWMAGGGRLGGEAAVTPRLGMGGGREARVTRYRE  409

Query  1522  KRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             KRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  410   KRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  442



>ref|XP_004512860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=405

 Score =   186 bits (471),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 161/467 (34%), Positives = 216/467 (46%), Gaps = 95/467 (20%)
 Frame = +1

Query  268   IKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHAR  447
             +K +   GA+  K    ARACD C+ +RARW+C ADDAFLC  CD+ VHSAN LA RH R
Sbjct  1     MKGDADSGALGAK---TARACDSCLRRRARWFCGADDAFLCHGCDTLVHSANQLASRHER  57

Query  448   VQLKTLSN--IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVV-KTPLHLSIVP-  615
             V+L+T S       +WH GFTRK RTPRH +        +  +   V+  T + L +VP 
Sbjct  58    VRLQTASAKVTTAQAWHSGFTRKARTPRHHNKNLLLQQKQQRLKEKVLFNTSVFLPLVPE  117

Query  616   -------VPEMCSDENYSHDDEKEDQLLLYRVPIF--DPVVADICTTLNITDYDAAAAAF  768
                     P +  D++ + ++E+E   L+ RVP+F  DP   + C   N       AA F
Sbjct  118   IGGEEEHEPALVVDDHEAEEEEEEQ--LMCRVPVFDVDPFDLETCNLKN------DAADF  169

Query  769   NQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSF  948
              +                          +  E +++LAEFAA+VESLLG           
Sbjct  170   EE---------------------MCDLDSFVEFDVDLAEFAANVESLLG-----------  197

Query  949   DMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANH  1128
                         V E   + + ++ + + ++     E            + +F       
Sbjct  198   ------------VHENSTTQVFDYKQENNEMDASKNEMLKVKDEELDDLESVF-------  238

Query  1129  HYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWS  1308
               TS      +  +   D +N+  +   ++   G    K   K    L L+YE VI AW+
Sbjct  239   DMTSD-----EVFQWNIDCNNETVAQEEKECVVGSFDAKEETKRERFLRLNYEDVISAWN  293

Query  1309  DQR--CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM-GITFGQAAIADD  1479
              Q    PW TG  P+  SH    DC  Q   G   +        G + G   G       
Sbjct  294   IQGSPSPWTTGNPPKFISHD---DC-WQNFLGPSGVDEEVRSLRGQLIGNINGDG-----  344

Query  1480  VWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
                GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  345   ---GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  388



>ref|XP_002452605.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
 gb|EES05581.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
Length=488

 Score =   186 bits (473),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 160/481 (33%), Positives = 218/481 (45%), Gaps = 82/481 (17%)
 Frame = +1

Query  328   CDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPP--------  483
             CD C+ +RARWYCAADDAFLCQ CD+SVHSANPLARRH R++L+ +++   P        
Sbjct  22    CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRLRPMTSPPDPAHSTLEAG  81

Query  484   --------SWH-RGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD  636
                     +W  R   ++   P  A  +      +P  H   V   L   +V VPE+ + 
Sbjct  82    GVGVASTSTWKKRQQQQQQVAP--AWSKRKARTRRP--HVKSVGQLLSRKLVVVPEVATV  137

Query  637   ENYSHDDEKEDQL--------LLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgg  792
             E+      +E+          LLY VP FD  +A++CT     D   A A  + S C   
Sbjct  138   ESSEERKVEEEDEEEEEEEEQLLYCVPTFDRALAELCTPPPPLDDPTATA--SSSCCRDN  195

Query  793   gghghhKNWDGKSStttmppttteme-----------meLAEFAADVESLLGKGLDDEEE  939
                G   N         +  +  +              EL EFAAD+E+LLG+GL D  E
Sbjct  196   DVDGAVDNAKAAPPAVVVAESPVQQLPDSFAGFGPTDAELREFAADMEALLGQGLGDSNE  255

Query  940   --SSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMA  1113
                SF ME LG +      E+     ++  R   +    V        A      ++   
Sbjct  256   LDESFYMESLGLMTTTQQAED-----VDVGRVKMEPNGSVISRSRGEGAPGFGPAELM--  308

Query  1114  ANANHHYTSSSSLCFD--------TLELKFDYDNDYYSPNNekeeegeellkMRNKSTIL  1269
                    +S+  L  D        T+ +  + ++ +    +    +         K ++ 
Sbjct  309   ---KPEASSAEVLVLDIDFNCSSPTVMMDHEDEDSFEHKASASNGDAAAAGTQFLKRSLD  365

Query  1270  LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDC----IMQRGCGSGTIHAAAYDGVG  1437
             L+L+YEA+I +W     PW  GQRP +     WP       M  G   G   AA    +G
Sbjct  366   LSLNYEAIIESWGSS--PWTDGQRPNVQLDDFWPHAHLTGWMAGGGRLGGEAAAVSPRLG  423

Query  1438  DMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  1617
              +G              GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVK
Sbjct  424   MVG--------------GREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVK  469

Query  1618  R  1620
             R
Sbjct  470   R  470



>gb|AHI45078.1| COL domain class transcription factor [Boehmeria nivea]
Length=458

 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 142/232 (61%), Gaps = 30/232 (13%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----------  468
            ARACD C+ KRARWYCAADDAFLCQACD+SVHSAN LARRH RV+LKT S          
Sbjct  17   ARACDSCVKKRARWYCAADDAFLCQACDNSVHSANSLARRHTRVRLKTASSSPSSSSSWS  76

Query  469  -NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
             +   P+WHRGFTRK RTPR ++G+ +  NS  V H +  + P+      VPE+  DE  
Sbjct  77   RDKPAPTWHRGFTRKARTPR-SNGK-SKTNSDHVPHVEASRDPM---FPVVPEIFGDETT  131

Query  646  SHDDEKEDQLLLYRVPIFDPVVADICTTLNITDY---DAAAAAFNQSKCAgggghghhKN  816
            +   E+ D+ LLYRVPI DP+VA++C+    T      + A A N+SK          +N
Sbjct  132  TTSHEESDEQLLYRVPILDPLVAELCSAAAATTTSGNSSEAVAINESKVV-----SASEN  186

Query  817  WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
             +G      +       EM+LAEFAADVESLLG+GL  E E  F +EGLGF+
Sbjct  187  CEGD----MIAQGFLPTEMDLAEFAADVESLLGRGL--ENECDFGIEGLGFV  232


 Score =   135 bits (341),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 87/127 (69%), Gaps = 10/127 (8%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM  1443
             ILL L+YEAVI  W+ Q  PW TG RP+ +    WP+C+     G+       +    D+
Sbjct  339   ILLRLNYEAVITEWASQGSPWTTGDRPDFDPDTCWPNCM-----GTFDTQLHHHHHYMDL  393

Query  1444  -GITFGQ-AAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  1617
              G+  G  AA+AD    GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPRMKGRFVK
Sbjct  394   SGLVGGNPAALADG---GREARVSRYREKRRNRLFSKKIRYEVRKLNAEKRPRMKGRFVK  450

Query  1618  RANFPLL  1638
             RA+FP +
Sbjct  451   RASFPTV  457



>ref|XP_009356271.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=454

 Score =   182 bits (462),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 134/236 (57%), Gaps = 29/236 (12%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
            ARACD CI KRARWYCAADD FLCQACDS+VHSAN LA RH RV LKT S+++P      
Sbjct  16   ARACDSCIKKRARWYCAADDGFLCQACDSAVHSANQLAHRHKRVLLKTASSLKPSNKDDR  75

Query  481  ----------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMC  630
                      PSWHRGFTRK RTPR           K + HH   +  +      VPE+ 
Sbjct  76   ASAVSETSAAPSWHRGFTRKARTPR---------GGKSMTHHGKSEEGVRNLFPQVPEVG  126

Query  631  SDENYSHDDE-KEDQLLLYRVPIFDPVVADICTTLNITDYDAAAA-AFNQSKCAgggghg  804
             D+  S+D+E KEDQ LLYRVPIFDP VA++C     ++ DA A    N           
Sbjct  127  GDDINSYDEENKEDQQLLYRVPIFDPFVAELCNNSGNSNEDAVANYEANNLSTVSDHVGI  186

Query  805  hhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
              K      +           +M+LAEFAADV+SLLG+G+DD+E   F ME LGF+
Sbjct  187  ESKAVSSLPNFNCHDGFPLPSDMDLAEFAADVDSLLGRGVDDDE--CFGMERLGFM  240


 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 81/125 (65%), Gaps = 13/125 (10%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K  ++L LDYEAVI AW     PW +G RP+ +S    PD +       G   A  +   
Sbjct  333   KRKMILRLDYEAVITAWDGS--PWTSGDRPDFDSE-CLPDYM-------GACGAELHYPY  382

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             G+M       A+ D    GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPRMKGRFV
Sbjct  383   GEMNGLGVHPAMVDG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAQKRPRMKGRFV  439

Query  1615  KRANF  1629
             KRA+F
Sbjct  440   KRASF  444



>ref|XP_004299078.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Fragaria 
vesca subsp. vesca]
Length=450

 Score =   179 bits (455),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 139/229 (61%), Gaps = 37/229 (16%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNI--------  474
            ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV+LKT S+I        
Sbjct  24   ARACDSCIKKRARWYCAADDAFLCQACDSSVHSANQLARRHERVRLKTASSIKSTTNSGS  83

Query  475  ----EPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDEN  642
                E PSWHRGFTRKPRTPR         N  P+                VPE+ +D +
Sbjct  84   CDKSEVPSWHRGFTRKPRTPRGQGKSAAPRNRFPL----------------VPEVGAD-D  126

Query  643  YSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
             S+++ +E+Q LLYRVPI+DP VA++CT+ N ++  +     N+SK      +    N +
Sbjct  127  LSYEENEEEQ-LLYRVPIYDPFVAELCTSPN-SNAVSNDLNGNESKAVSMPNYYGVGNRN  184

Query  823  GKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
              SS           +M+LAEFAADV+SLLG+GLDD E   F MEGLG 
Sbjct  185  SPSS----HGFDLPSDMDLAEFAADVDSLLGRGLDDHE--CFGMEGLGL  227


 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 79/127 (62%), Gaps = 10/127 (8%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQR--CPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             K  I L LDY+ VI  W  Q    P+  G RP+++ +   PD  M    G+  +H     
Sbjct  320   KRKIFLRLDYDEVITKWDSQSNGSPFAFGDRPDID-YDCLPD-FMGTASGAELLHYP---  374

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
               GD+    G      D   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  375   -YGDLNRVIGLHPTMTDG--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  431

Query  1609  FVKRANF  1629
             FVKRA+F
Sbjct  432   FVKRASF  438



>ref|XP_007222133.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
 gb|EMJ23332.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
Length=447

 Score =   178 bits (452),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 138/235 (59%), Gaps = 40/235 (17%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
            ARACD CI KRARWYCAADDAFLCQACDSSVHSAN LARRH RV LKT S+++P      
Sbjct  16   ARACDSCIRKRARWYCAADDAFLCQACDSSVHSANQLARRHERVLLKTASSVKPTDKDDQ  75

Query  481  ---------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
                     PSWH GFTRK RTPR   G++ +                      VPE+ +
Sbjct  76   VSVSDNPAAPSWHGGFTRKARTPR--QGKHKSQEG------------ARNRFPQVPEVGA  121

Query  634  DENYSHDDEKED--QLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghgh  807
            D++ S+D+E E+  Q LLYRVP+FDP VA++CT     + +  A A N    +       
Sbjct  122  DDSNSYDEENEEDQQQLLYRVPVFDPFVAEMCTATTSANSNEEAVA-NTCDVSKVSSSSP  180

Query  808  hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
            + N +G+             +M+LAEFAADV+S+LG+GL+D+E   F MEGLG +
Sbjct  181  NYNHNGRDG------FLLPSDMDLAEFAADVDSMLGRGLEDDE--CFGMEGLGLM  227


 Score =   127 bits (320),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 86/125 (69%), Gaps = 13/125 (10%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K  I L LDYEAVI AW     PW +G RP+ +S    PDC+    CG+  +H   Y  +
Sbjct  326   KKEIFLRLDYEAVITAWDGS--PWTSGGRPDFSSEC-LPDCMGV--CGT-ELHYP-YGDL  378

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
               +G+     A+AD    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV
Sbjct  379   NGLGV---HPAMADG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  432

Query  1615  KRANF  1629
             KRA+F
Sbjct  433   KRASF  437



>ref|XP_010103762.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB97040.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=464

 Score =   179 bits (453),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 149/251 (59%), Gaps = 51/251 (20%)
 Frame = +1

Query  289  GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS  468
            G + GK    ARACD C+ KRARWYCAADDAFLCQACD SVHSAN LARRH RV+LKT S
Sbjct  15   GVVGGK---TARACDNCVKKRARWYCAADDAFLCQACDLSVHSANSLARRHERVRLKTAS  71

Query  469  N---IEP----------PSWHRGFTRKPRTPRHA-----HGRYNNNNSKPVVHHDVVKTP  594
            +   I+P          P+WHRGFTRK RTPR+      H +   N S+   HH     P
Sbjct  72   SSSLIKPLPTEESDLTAPTWHRGFTRKARTPRNGKNHVTHPKLQKNQSRDHHHHHQQFDP  131

Query  595  LHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICT-----TLNITDYDAAA  759
            L      VPE+CSDE  SH +E EDQ LLYRVPIFDP VA++CT     +  + +  A +
Sbjct  132  L------VPEICSDET-SH-EENEDQ-LLYRVPIFDPFVAELCTANSANSNGLIESKAVS  182

Query  760  AAFNQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEE  939
             + N    A    + + + +                EM+LAEFAADV+SLLG+GL++E  
Sbjct  183  PSVNDCGGAHEVENTNMQQF-------------LPTEMDLAEFAADVDSLLGRGLENE--  227

Query  940  SSFDMEGLGFL  972
              F +EGLGF+
Sbjct  228  -CFGIEGLGFV  237


 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 85/123 (69%), Gaps = 9/123 (7%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGT-IHAAAYDGVGD  1440
             ILL LDYEAVI AW+ Q  PW TG RP+ +    WPDC+   G    T +H   Y  +  
Sbjct  338   ILLRLDYEAVITAWASQGSPWTTGDRPDFDPDACWPDCM---GTYYPTQLHHHQYMDLS-  393

Query  1441  MGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
              G+    A +AD    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV R
Sbjct  394   -GVELNPAILADG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVNR  449

Query  1621  ANF  1629
             A+F
Sbjct  450   ASF  452



>ref|XP_003573014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
 ref|XP_010236028.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
Length=448

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 159/469 (34%), Positives = 215/469 (46%), Gaps = 91/469 (19%)
 Frame = +1

Query  322   RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPP------  483
             RACD C+ +RARWYCAADDAFLCQ+CD+SVHSANPLARRH R++L+    +  P      
Sbjct  24    RACDGCMRRRARWYCAADDAFLCQSCDTSVHSANPLARRHERLRLRGAMPMPMPVEGGVA  83

Query  484   --------------------SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHL  603
                                 +W +   R  R P  + G+        +    VV+ P   
Sbjct  84    SETTMATKTATKAKRLQGGVAWAKRKARTRRPPVKSVGQLL------LSRRLVVRVPDDH  137

Query  604   SIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKC  783
                   E   ++  +  +++E+Q LLYRVP+FDP + + C+   + DY A     N +  
Sbjct  138   QAGAGGESSDEQRAAAAEDEEEQQLLYRVPVFDPALGEFCSPPPVEDYYAIG---NDNDN  194

Query  784   AgggghghhKNWDGKSStttmpptt-------tememeLAEFAADVESLLGKGLDDEEES  942
             A   G   +K   G +S+++               + EL EFAAD+E+LLG         
Sbjct  195   AFVVGEDTNKQLVGPASSSSPVQELPDCFASFGPTDAELREFAADMEALLG---------  245

Query  943   SFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANA  1122
                  G   LGGN     + S  ME         + +    +       A   + +  + 
Sbjct  246   -----GQDALGGNEQLMAEDSFYME--------ALGLVSPLSGDHKGVDAGRPVKVETDG  292

Query  1123  NHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILA  1302
                 +S  +L         D D+  +         GE       K ++ L L+YEAVI  
Sbjct  293   GARRSSPPTL--------VDDDDGSFEHKAATASYGEAADAGFLKRSLDLRLNYEAVIEG  344

Query  1303  WSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV---GDMGITFGQAAIA  1473
             W     PW  G+RP    H G  D ++        +H   Y G+      G    + A  
Sbjct  345   WGSS--PWTDGRRP----HGGQLDDLL--------LHDHYYSGMWTAAAGGGRAARPAAD  390

Query  1474  DDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             D  W  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  391   DGGW--REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  437



>ref|XP_010094760.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB56925.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=444

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 140/249 (56%), Gaps = 34/249 (14%)
 Frame = +1

Query  292  AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
            AM GK    ARACD C+ KRARW+CAADDAFLCQACD+SVHSAN LA RH RV+L+T S+
Sbjct  10   AMAGK---TARACDSCLRKRARWFCAADDAFLCQACDTSVHSANQLASRHERVRLQTSSH  66

Query  472  IE--------------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL----  597
                             P+WHRGFTRK RTPRH     NN  +     +D V+  L    
Sbjct  67   KGNYNHSHHDLHDDECSPAWHRGFTRKARTPRH-----NNKPAAQQAKYDDVEKVLSAAN  121

Query  598  --HLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFN  771
              H  +  VPEM ++E     DE E++ LLYRVP+FDP  A++C ++N  D D  A    
Sbjct  122  HRHDPLPFVPEMSNEEESPITDENEEEQLLYRVPVFDPFAAELCNSINGDD-DERAGMTT  180

Query  772  QSKCAgggghghhKNWDGKSStttmppttte-----memeLAEFAADVESLLGKGLDDEE  936
              K    G   + K+    S+                E+ELAEFAADVESLLG GL+D +
Sbjct  181  TEKGKELGQQDYGKSVISTSTAHEAEFDHEIHGFLPSELELAEFAADVESLLGGGLEDHD  240

Query  937  ESSFDMEGL  963
            +S  D+ GL
Sbjct  241  QSCQDINGL  249


 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K  I+L L+YEAVI AW+ Q  PW TG RP+ N   GWPDC+        T H    +G 
Sbjct  303   KRDIILRLNYEAVIAAWASQGSPWTTGNRPDFNPDDGWPDCLDV----CHTDHVGPANGD  358

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
                G              GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV
Sbjct  359   SSRGGLGLGGVGGSVGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  418

Query  1615  KRANF  1629
             KR  F
Sbjct  419   KRTFF  423



>gb|AGM20692.1| COL6-2 [Populus tomentosa]
Length=447

 Score =   167 bits (424),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 133/232 (57%), Gaps = 28/232 (12%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS---------N  471
            ARACD CI KRA WYCAADDAFLCQACDSSVHSAN LARRH RV+LK+ S          
Sbjct  16   ARACDSCIKKRASWYCAADDAFLCQACDSSVHSANLLARRHERVRLKSASLKSSDAGSKE  75

Query  472  IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
               PS H GFTRK RTPRH          KPV    + +T  ++ I  VPE+ SDE    
Sbjct  76   NSMPSGHGGFTRKARTPRHG---------KPVSRSKIEETTRNIPIPLVPEVGSDELSLE  126

Query  652  DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAA---AAAFNQSKCAgggghghhKNWD  822
            D+E+E   LLY VPIFDP  A++CT+  +++   A   A   +  + A        K   
Sbjct  127  DNEEEH--LLYSVPIFDPFAAELCTSTTVSNEAGAVVPAGGTDTDQRAADSSGTESKVLL  184

Query  823  GKSStttmppttt--ememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
            G S    +         +M+LAEFAAD+ES LG+GL++E   SF +E LG +
Sbjct  185  GGSEGKDVESLHGFLPSDMDLAEFAADMESSLGRGLENE---SFGIEELGLM  233


 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 84/128 (66%), Gaps = 9/128 (7%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + K   LL+LDYEAV+ AW+ Q  PW  G RP+ ++   WPD      CG+   H     
Sbjct  325   KKKRRTLLSLDYEAVMSAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHP----  380

Query  1429  GVGDM-GITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  1605
               GD+ G+    AA+ D     REARVSRYREKRRTRLFSKK+RYEVRKLNAEKRPRMKG
Sbjct  381   -YGDVSGLGADPAALVDGA---REARVSRYREKRRTRLFSKKLRYEVRKLNAEKRPRMKG  436

Query  1606  RFVKRANF  1629
             RFVKR  F
Sbjct  437   RFVKRTTF  444



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score =   161 bits (407),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 136/243 (56%), Gaps = 41/243 (17%)
 Frame = +1

Query  283  AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
            A  AM GK    ARACD C+ KRARW+C ADDAFLCQACD+SVHSAN LA RH RV+L+T
Sbjct  7    AANAMGGK---TARACDSCLRKRARWFCVADDAFLCQACDASVHSANQLASRHQRVRLET  63

Query  463  LS------------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLS  606
             S            +  PP+WH+GFTRK RTPRH     N+N++K ++   ++K      
Sbjct  64   ASSYRISSSLNTDQDYSPPAWHQGFTRKARTPRH-----NSNSNKSLLVQKLLKDDREKV  118

Query  607  IVP---VPEMCSDENYSH-DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQ  774
            + P   VPE+ S+E  +   DE EDQLL  RVP+FDP  A +C  +   D + A   + Q
Sbjct  119  LNPLPLVPEIGSEEEPNMAADENEDQLLC-RVPVFDPFAAKMCDIVTSEDGNMAVEVYGQ  177

Query  775  SKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDM  954
                         N  G              +M+LAEFAADVE+LLG+  D+E   + D+
Sbjct  178  EGAC------GLDNLPG----------FLPSDMDLAEFAADVENLLGRETDEEYHDTKDL  221

Query  955  EGL  963
            E L
Sbjct  222  ELL  224


 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K  + L LDYE+VI+AW++Q CPW TG RPE+N+   W D +       GT      +  
Sbjct  308   KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNADDSWTDSM-------GTSPKDVNNPY  360

Query  1435  GDMGI-TFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
             G +G  T G           REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF
Sbjct  361   GGLGSHTRGGDG-------EREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  413

Query  1612  VKRANF  1629
             VKR + 
Sbjct  414   VKRTSL  419



>gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score =   158 bits (399),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 141/257 (55%), Gaps = 41/257 (16%)
 Frame = +1

Query  268   IKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHAR  447
             I    A  A+ GK    ARAC+ C  KRARW+CAADDAFLCQ+CD SVHSAN LARRH R
Sbjct  2     INERKAANALSGK---TARACEGCSRKRARWFCAADDAFLCQSCDESVHSANQLARRHER  58

Query  448   VQLK------TLSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSI  609
             V+L+      T+SN   P+WH+GFTRK RTPRH      NNNS   + ++    PL    
Sbjct  59    VRLESSSFKPTVSNEYIPAWHQGFTRKARTPRH------NNNSNKKIFNNNSNLPL----  108

Query  610   VPVPEMCSDE--NYSHDDEKEDQLLLYRVPIFDPVVADICT--TLNITDYDAAAAAFNQS  777
               VPE+ ++E  N    DE EDQ  LYRVP+FDP  A++C     N  + +  A   +Q 
Sbjct  109   --VPEIGNEEEGNGIAADEDEDQ-FLYRVPVFDPFEAELCADDLYNEEEGNEIAIGNDQE  165

Query  778   KCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDME  957
             +                 +   +       +M+LAEFAADVE+LLG GLDD   S     
Sbjct  166   RI-------------NMGTDDNLDNYYLPSDMDLAEFAADVENLLGAGLDD--NSPDRNN  210

Query  958   GLGFLGGNNVEEEKAST  1008
              LGFL   N ++E+  +
Sbjct  211   DLGFLEYCNKKQEQEES  227


 Score =   120 bits (302),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 75/125 (60%), Gaps = 15/125 (12%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K  + L L+YEAVI AW+    PW TG RPE+N    WPDC+   G      H   Y   
Sbjct  316   KRDVSLRLNYEAVITAWASHGSPWTTGTRPELNPDDCWPDCL---GTCPKDGHHHPY---  369

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
                               GREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR++GRFV
Sbjct  370   ---------RGHNGGGNGGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRLQGRFV  420

Query  1615  KRANF  1629
             KR +F
Sbjct  421   KRTSF  425



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score =   157 bits (397),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 132/243 (54%), Gaps = 42/243 (17%)
 Frame = +1

Query  283  AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
            A  AM GK    ARACD C+ KRARW+C ADDAFLCQACD+SVHSAN LA RH RV+L+T
Sbjct  7    AANAMGGK---TARACDSCLRKRARWFCVADDAFLCQACDASVHSANQLASRHQRVRLET  63

Query  463  LS------------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLS  606
             S            +  PP+WH+GFTRK RTPRH       N++K ++   ++K      
Sbjct  64   ASSYRISSSLNTDQDYSPPAWHQGFTRKARTPRH-------NSNKSLLVQQLLKDDREKV  116

Query  607  IVP---VPEMCSDENYSH-DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQ  774
            + P   VPE+ S+E  +   DE ED  LL RVP+FDP  A +C  +   D +     + Q
Sbjct  117  LNPLPLVPEIGSEEEPNMAPDENEDDQLLCRVPVFDPFAAKMCDIVTSEDENMVVEVYGQ  176

Query  775  SKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDM  954
                         N  G              +M+LAEFAADVE+LLG+  D+E   + D+
Sbjct  177  EGAC------GLDNLPG----------FLPSDMDLAEFAADVENLLGREADEEYHDTKDL  220

Query  955  EGL  963
            E L
Sbjct  221  ELL  223


 Score =   126 bits (316),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 81/125 (65%), Gaps = 13/125 (10%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K  + L LDYE+VI+AW++Q CPW TG RPE+N    W D +   G     ++   Y G+
Sbjct  307   KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNPDDSWTDSM---GACPKDVNNP-YGGL  362

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             G    T G           REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV
Sbjct  363   GSH--TRGGDG-------EREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  413

Query  1615  KRANF  1629
             KR + 
Sbjct  414   KRTSL  418



>gb|KHN05568.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=242

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/268 (40%), Positives = 143/268 (53%), Gaps = 51/268 (19%)
 Frame = +1

Query  877   LAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkve  1056
             LAEFAADVESLLG+GL++E      ME LG +     E    S  ++   + E  +V++E
Sbjct  14    LAEFAADVESLLGRGLENE---CVGMEELGLVDAKEEECSVGSGKVKMEDQEESPLVEME  70

Query  1057  eedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDN-------DYYSPNNe  1215
                            + M    +            + EL FDY+        D    N  
Sbjct  71    ---------------MDMVVGRDDQ----------SFELSFDYETCEEVKVCDLGLGNEL  105

Query  1216  keeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGC  1395
               ++  +  +++ K  + L LDYEA+I+AW+ Q+ PW T  +P ++    W  C+     
Sbjct  106   GAKKENDDDEVKRKK-VSLQLDYEAIIIAWASQKSPWTTADKPNLDPDECWKQCM-----  159

Query  1396  GSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKL  1575
               G+   A +   G+MG  FG   +  D   GREARVSRYREKRRTRLFSKKIRYEVRKL
Sbjct  160   --GSCETAYHHPCGEMG-GFGIHPVIIDG--GREARVSRYREKRRTRLFSKKIRYEVRKL  214

Query  1576  NAEKRPRMKGRFVKRAN-----FPLLDQ  1644
             NAEKRPRMKGRFVKRA+     FPLL++
Sbjct  215   NAEKRPRMKGRFVKRASFAPPTFPLLNK  242



>ref|XP_008374747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=442

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 133/249 (53%), Gaps = 44/249 (18%)
 Frame = +1

Query  283  AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL--  456
            A  AM G     +RACD C+ KRARW+CAADDAFLCQ CD+SVHSAN LA RH RV+L  
Sbjct  7    AANAMGGN---TSRACDSCLVKRARWFCAADDAFLCQRCDASVHSANQLASRHERVRLQG  63

Query  457  ---------KTLSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSI  609
                     + +++   P+WH+GF RK RTPRH      NN    V   +  K  LH  +
Sbjct  64   SSFKANASVQLIADQAAPAWHKGFKRKARTPRH------NNKPGFVAKDEQEKVGLHPPL  117

Query  610  VPVPEM-CSDENYSHDDEKED-QLLLYRVPIFDPVVADICTTLNITDYD-----AAAAAF  768
              VPE+ C + N   D+E ED + LLYRVPI+DP  A++C   NI+  D       A   
Sbjct  118  PFVPEIGCQEANLMEDEENEDLEQLLYRVPIYDPFAAELC---NISSSDQVGNNTGAIDL  174

Query  769  NQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSF  948
            +  +           N  G              +MELAEFAADVE+LLG GLD   E   
Sbjct  175  DAEEIEIRNTGNDLDNLGG----------FLRSDMELAEFAADVENLLGGGLD---EDCS  221

Query  949  DMEG-LGFL  972
            D++G LG L
Sbjct  222  DIKGVLGLL  230


 Score =   135 bits (340),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 83/122 (68%), Gaps = 10/122 (8%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             +  I L LDYEAVI AW+ Q   W TG RPE+N+  GW DC+   G     IH    D  
Sbjct  304   RKNICLKLDYEAVITAWASQGSQWTTGTRPELNADEGWLDCM---GMWPTEIHQPHGDSA  360

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             G   ++ G+    DD   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV
Sbjct  361   G--CVSRGKG---DDP--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  413

Query  1615  KR  1620
             KR
Sbjct  414   KR  415



>ref|XP_003637430.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
Length=166

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 103/167 (62%), Gaps = 18/167 (11%)
 Frame = +1

Query  1162  TLELKFDYDNDYYSPNNekee---egeellkMRNKSTILLNLDYEAVILAWSDQRCPWIT  1332
             + EL FDYD+ + +    KE+   + E     + K  I L LDY+AVI+AW  Q+CPW  
Sbjct  9     SFELNFDYDDSHETCEEVKEKCGEQNENNDYNKGKRKISLQLDYDAVIIAWDSQKCPWTN  68

Query  1333  GQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSR  1512
             G +P +++   WPDC+       GT     +   G+ G       + D    GREARVSR
Sbjct  69    GDKPILDADENWPDCM-------GTFGTEVHYAYGEFGGYGCHPVMVDG---GREARVSR  118

Query  1513  YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN-----FPLL  1638
             YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+     FPLL
Sbjct  119   YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPLL  165



>ref|XP_008393304.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=349

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 128/249 (51%), Gaps = 27/249 (11%)
 Frame = +1

Query  268  IKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHAR  447
            I  + A  AM G     ARACD C+ KRARW+C ADDAFLCQ CD+SVHSAN LA RH R
Sbjct  2    ITDKKAANAMGGN---TARACDSCLVKRARWFCXADDAFLCQRCDASVHSANQLASRHER  58

Query  448  VQLK--TLSNIEP---------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTP  594
            V+L+  +    EP         P+WH GF RK R PRH      NN     V  +  K  
Sbjct  59   VRLQGSSFKANEPMQLTADQATPAWHNGFKRKARXPRH------NNKPGFAVKEEQEKLG  112

Query  595  LHLSIVPVPEM-CSDENYSHDDEKED-QLLLYRVPIFDPVVADICTTLNITDYDAAAAAF  768
            LH  +  VPE+ C + N   ++E ED + LLYRVPI+DP  A +C   +    +      
Sbjct  113  LHPPLPFVPEIGCEEANLMEBEENEDLEQLLYRVPIYDPFAAKLCNISSTDQVENNTDXI  172

Query  769  NQSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSF  948
            N              N +G              +MELAEFAADVE+LLG GLD   E   
Sbjct  173  NLDD-EEIEIRNMGNNHEGVQDDLDKLGGFLPTDMELAEFAADVENLLGGGLD---EDCS  228

Query  949  DMEG-LGFL  972
            D++G LG L
Sbjct  229  DIKGVLGLL  237



>ref|XP_004300528.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 135/249 (54%), Gaps = 48/249 (19%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN-------I  474
             ARACD C+ KRARW+C ADDAFLCQ CD+SVHSAN LA RH RV+LK+ S+       I
Sbjct  15   TARACDSCLVKRARWFCGADDAFLCQRCDASVHSANLLASRHERVRLKSSSHKVSDHLAI  74

Query  475  EP--PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE-NY  645
            EP  P+W +G TRK RTPR  HG + +         D     L  S+  VPE+ S+E +Y
Sbjct  75   EPPVPAWQQGVTRKARTPR-GHGNHKSGK-------DEAGKALGQSMPFVPEIGSEEVDY  126

Query  646  ---SHDDEKED-QLLLYRVPIFDPVVADICTTLNITDY--------DAAAAAFNQSKCAg  789
                 D E ED + LLYRVPIFDP   ++C  +   D+        D  A   + S C  
Sbjct  127  CCLEDDHESEDLEQLLYRVPIFDPFEGELCNNMTNIDHHKVKMGHEDYGARTSSTSPC--  184

Query  790  ggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                    N+ G              +MELAEFAADVE++LGKGLD   E   D++GLG 
Sbjct  185  ----DELDNFQG---------LILPSDMELAEFAADVENMLGKGLD---EDCSDIKGLGL  228

Query  970  LGGNNVEEE  996
            L     EE+
Sbjct  229  LDETKEEED  237


 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 84/129 (65%), Gaps = 6/129 (5%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + +  I L L++EAVI AW+ +  PW TG +PE+N   GWPDC+       GT       
Sbjct  307   KKRKKICLRLNHEAVISAWASKGSPWTTGVKPELNPDDGWPDCMGV----WGTNQIMNLQ  362

Query  1429  GVGDMGITFGQAAIADDVWV--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             G GD      +  +  D     GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK
Sbjct  363   GHGDSSAAAHRMGMRGDTEQRPGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  422

Query  1603  GRFVKRANF  1629
             GRFVKR +F
Sbjct  423   GRFVKRTSF  431



>gb|EMT27110.1| hypothetical protein F775_43077 [Aegilops tauschii]
Length=343

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 115/337 (34%), Positives = 156/337 (46%), Gaps = 45/337 (13%)
 Frame = +1

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S E    D E +++ LLYRVPIFDP +A++C+ L + +   A A+      A        
Sbjct  31    SPEEQKCDVETDEEELLYRVPIFDPALAELCSPLTLEEATTAVASCCNEDGAIVEDPTKP  90

Query  811   KNWDGKSSt---ttmpptttememeLAEFAADVESLLGK-GLDD-EEESSFDMEGLGFLG  975
                   +     +         + EL EFAAD+E+LLG+ G+DD +EE  F ME LG + 
Sbjct  91    AATPTPAPVQFFSDSLVNLGPTDAELMEFAADMEALLGRPGMDDGDEEEPFCMEALGLIE  150

Query  976   GNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLC  1155
               +V+  +    ++  R                            A         S    
Sbjct  151   PMDVDGGRVKLEIDPMR----------------------------ACGLEQKPEVSG---  179

Query  1156  FDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITG  1335
              D  ++ FDYD+   +P+      G          ++ LNL+YEA++  W     PW  G
Sbjct  180   -DMFDIDFDYDSPLGTPDENAASSGASADAQFTPRSLALNLNYEAIMENWGSS--PWADG  236

Query  1336  QRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRY  1515
             +RP +     WP        G+  +      G   +G    +      +  GREARVSRY
Sbjct  237   ERPHVKLDDCWPHDYYSLQEGAWMMGGVVGHGGEGLGTPRLR------MDGGREARVSRY  290

Query  1516  REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN
Sbjct  291   REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  327



>ref|XP_010551268.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=424

 Score =   149 bits (375),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 132/238 (55%), Gaps = 43/238 (18%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPP---SW  489
             ARACD C+ +RARWYCAADDAFLCQ CD SVHSANPLARRH RV+LK+ S++ PP   +W
Sbjct  13    ARACDSCVKRRARWYCAADDAFLCQVCDGSVHSANPLARRHERVRLKSASSVPPPGPATW  72

Query  490   HRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD---ENYSHDDE  660
             H GF RK RTPR   GR   N+    + HD+           VPE+ ++   ENY     
Sbjct  73    HHGFARKARTPRGGGGRKKTNHR--AIFHDL-----------VPEISAEDQTENY-----  114

Query  661   KEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStt  840
              E++ L+ +VP+ D  +A+  T+  +         F   K             +G     
Sbjct  115   -EEEQLICQVPVLDHPMAESNTSFPL----PVRMKFADIKDKDDDQDNAESCLNG-----  164

Query  841   tmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEEKASTMM  1014
                      +MELAEFAADVE+LLG GL+ E   SF ME LG LG  ++   ++S+M+
Sbjct  165   -----FFPSDMELAEFAADVETLLGHGLETE---SFAMEELG-LGYGSLSCGRSSSMV  213


 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 87/131 (66%), Gaps = 15/131 (11%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMN-SHHGWPDCIMQRGCGSGTIHAAAY-DGVG  1437
             ++L LDYE+VI +W  Q  PW  G+ PE++  +  WP  +       G ++   Y  G+ 
Sbjct  303   LMLRLDYESVISSWGGQGPPWTAGEPPELDLKNDSWPISM-------GEVNGGQYGSGIC  355

Query  1438  DMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  1617
              +G+T    A+ D   VGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK
Sbjct  356   GVGLTM---AMGD---VGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  409

Query  1618  RANFPLLDQQI  1650
             RA+   L   I
Sbjct  410   RASLSALASSI  420



>ref|XP_008775153.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=420

 Score =   149 bits (375),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 125/227 (55%), Gaps = 41/227 (18%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL---------SN  471
            ARACD C+ +RARWYC ADDAFLCQACDSSVHSANPLARRH R++LKT          S 
Sbjct  21   ARACDSCLRRRARWYCGADDAFLCQACDSSVHSANPLARRHHRLRLKTSSSSPPSTANSE  80

Query  472  IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
              PP W  GF RK RTPR           KP         PL      VP++ +DE    
Sbjct  81   DAPPPWLHGFRRKARTPR----------GKPAPAGPPKLEPL------VPDLEADEKLYI  124

Query  652  DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKS  831
            ++E     LLYRVPIFDPV+A+ C+   +   D A+   +++K A              +
Sbjct  125  EEEH----LLYRVPIFDPVLAEFCSPPAL---DEASGLTDEAKPAVQQQPPE------HA  171

Query  832  StttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
                        +++LAEFAADVESLLG+GLDD++   F ++ LG +
Sbjct  172  PVFAAAAGLHPSDLDLAEFAADVESLLGRGLDDDK---FCIDALGLM  215


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 82/130 (63%), Gaps = 17/130 (13%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRC-PWITGQRPEMNSHHGWPDCIMQRGCGSGTIH-----AAAY  1425
             + L LDYEAVI AWS + C PW  G+RP+ N    WPD       G+G        A  Y
Sbjct  300   MTLRLDYEAVIAAWSCKGCSPWTDGERPQFNPDDCWPDFAGMMWGGAGGGGGGGEVAPVY  359

Query  1426  DGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  1605
                G++G+  G          GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG
Sbjct  360   ---GEVGMVAGNG--------GREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  408

Query  1606  RFVKRANFPL  1635
             RFVKRA  P 
Sbjct  409   RFVKRAAAPF  418



>ref|XP_006656860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=336

 Score =   144 bits (364),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 161/344 (47%), Gaps = 55/344 (16%)
 Frame = +1

Query  631   SDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghh  810
             S E    + E  ++ LLYRVP+FDP +A+ C+   + D  AA +  N+            
Sbjct  27    SPEERKDEGEIVEEQLLYRVPVFDPALAEFCSPPPLEDAAAAGSCCNEDGAVENPTKMAV  86

Query  811   KNWDGKSStttmp------ptttememeLAEFAADVESLLGKGLDD-EEESSFDMEGLGF  969
                   +    +             + EL EFAAD+E+LLG+GLDD  +E SF ME LG 
Sbjct  87    TTTTTTTPPPPLQFFPDSHANFGPTDAELREFAADMEALLGRGLDDGNDEDSFCMETLGL  146

Query  970   L--GGNNVEEEKASTMMEFSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSS  1143
             +  GG++    K                            +          N     TSS
Sbjct  147   IEPGGDDGGRVKVEA-------------------------DGDAGLTLPWCNDLDPETSS  181

Query  1144  SSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCP  1323
               +    L++ FD  +   +  +EK         +  +S++ L+L+YEA+I +W     P
Sbjct  182   GEM----LDIDFDCGSPQAATPDEKVASSGAADAL--QSSLALSLNYEAIIESWGSS--P  233

Query  1324  WITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWV---GR  1494
             W  G+RP +  +  WP         SG   AAA    G  G    Q A+   +     GR
Sbjct  234   WTDGERPHVKLNDSWPHDY------SGVWMAAA----GVFGHGEEQQALTPRLQGMDGGR  283

Query  1495  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 
Sbjct  284   EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  327



>ref|XP_010546462.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like, partial 
[Tarenaya hassleriana]
Length=258

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 98/248 (40%), Positives = 128/248 (52%), Gaps = 42/248 (17%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN--------I  474
             ARACD C+ +RARWYC +DDAFLCQACD SVHSANPLARRH RV+LK+ S+        +
Sbjct  13    ARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRHERVRLKSASSSRTHRPTTV  72

Query  475   EPPS---WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD---  636
              PP    WH GFTRK RTPR   G     N + V  HD+           VPE+  +   
Sbjct  73    SPPGTAKWHHGFTRKARTPR-GSGSAGKPNQRAVFFHDL-----------VPEISVEDQT  120

Query  637   ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
             ENY      E++ L+++VP+ DP V++      I +       F   +           +
Sbjct  121   ENY------EEEQLIFQVPVLDPTVSEQYRDDAIEE----KTGFPLPELIKFADMNEEND  170

Query  817   WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
              D   S           +MELAEFAADV++LLG  L+ E   SF  E LG   G +V   
Sbjct  171   EDNAES---CLDRFFPTDMELAEFAADVDTLLGHNLETE---SFATEDLGLGDGLSVCGR  224

Query  997   KASTMMEF  1020
              +S M++ 
Sbjct  225   SSSMMLKL  232



>ref|XP_010543105.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=311

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 135/263 (51%), Gaps = 45/263 (17%)
 Frame = +1

Query  274   IEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQ  453
             ++ +  A+ GK    ARACD C+ +RARWYC +DDAFLCQACD SVHSANPLARRH RV+
Sbjct  1     MKSSANAVGGK---TARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRHERVR  57

Query  454   LKTLSN--------IEPPS---WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLH  600
             LK+ S+        + PP    WH GFTRK RTPR   G     N + V  HD+      
Sbjct  58    LKSASSSRTHRPTTVSPPGTAKWHHGFTRKARTPR-GSGSAGKPNQRAVFFHDL------  110

Query  601   LSIVPVPEMCSD---ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFN  771
                  VPE+  +   ENY      E++ L+++VP+ DP V++      I +       F 
Sbjct  111   -----VPEISVEDQTENY------EEEQLIFQVPVLDPTVSEQYRDDAIEE----KTGFP  155

Query  772   QSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFD  951
               +           + D   S           +MELAEFAADV++LLG  L+ E   SF 
Sbjct  156   LPELIKFADMNEENDEDNAES---CLDRFFPTDMELAEFAADVDTLLGHNLETE---SFA  209

Query  952   MEGLGFLGGNNVEEEKASTMMEF  1020
              E LG   G +V    +S M++ 
Sbjct  210   TEDLGLGDGLSVCGRSSSMMLKL  232



>ref|XP_008802436.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Phoenix 
dactylifera]
Length=440

 Score =   143 bits (361),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 129/237 (54%), Gaps = 42/237 (18%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
            ARACD C+ +RARWYCAADDAFLC ACD+SVHSANPLARRH R++LK  S+         
Sbjct  21   ARACDSCLRRRARWYCAADDAFLCMACDASVHSANPLARRHHRLRLKISSSSSSPPPSSN  80

Query  481  -----PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
                 P W  GF R  RTPR           KP +       PL      VP++ +DE  
Sbjct  81   SDDALPPWLHGFKRGARTPR----------IKPTMAGPPKLEPL------VPDLEADEKL  124

Query  646  SHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDG  825
                  E++ LLYRVPIFDPV+A+ C+   I D D  A   +++K         H     
Sbjct  125  ----HAEEEYLLYRVPIFDPVLAEFCSPPAINDADTLA---DEAKPVVQLPEHAHVA---  174

Query  826  KSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEEE  996
             ++           +++LAEF ADVE+LLG+GLDD    +F ++GLG +  N+ E++
Sbjct  175  AAAAADSLAGFHSTDLDLAEFVADVETLLGRGLDD---GAFCIDGLGLM--NSAEDD  226


 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 78/126 (62%), Gaps = 20/126 (16%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRC-PWITGQRPEMNSHHGWP---DCIMQRGCGSGTIHAAAYDG  1431
             ++L LDYEAVI AWS   C PW  G+RP+ N     P     +   G G G         
Sbjct  302   MILKLDYEAVIAAWSCNGCSPWTDGERPQFNPDDCCPIFTGMMWSGGVGEGD--------  353

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
              G++G+  G          GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF
Sbjct  354   AGEVGMMAGGG--------GREARVARYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  405

Query  1612  VKRANF  1629
             VKR  F
Sbjct  406   VKRTAF  411



>ref|XP_010916170.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 131/243 (54%), Gaps = 45/243 (19%)
 Frame = +1

Query  271  KIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARV  450
            K   + GA+  K    ARACD C+ +RARWYCAADDA LCQACDSSVHSANPLARRH R+
Sbjct  8    KQRSSAGALGAK---TARACDSCLRRRARWYCAADDACLCQACDSSVHSANPLARRHHRL  64

Query  451  QLKTLS---------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHL  603
            +LKT S         +  PP W  GF RK RTPR           KP         PL  
Sbjct  65   RLKTTSFSPPSSASSDDAPPPWLHGFRRKARTPR----------GKPAPAGPPKLEPL--  112

Query  604  SIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKC  783
                VP++ +DE        E++ LLYRVPIFDP +A+ C+   + D   A A  +++K 
Sbjct  113  ----VPDLEADEKL----HTEEEHLLYRVPIFDPALAEFCSPPALDD---ANALTDEAKP  161

Query  784  AgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGL  963
            A              +            +++LAEFAADVESLLG+GLDD+   +F ++ L
Sbjct  162  AVQQPPE-------HAHVPAAAAGFHPSDLDLAEFAADVESLLGRGLDDD---TFCIDAL  211

Query  964  GFL  972
            G +
Sbjct  212  GLM  214


 Score =   129 bits (323),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRC-PWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGD  1440
             + L LDYEAVI AWS + C PW  G+RP+ N    WPD       G+G     A    G+
Sbjct  299   MTLRLDYEAVIAAWSCKDCSPWTDGERPQFNPDDCWPDFTGMMWGGAGGGREVA-PVYGE  357

Query  1441  MGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             +G+  G          GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  358   LGMVAGDG--------GREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  409

Query  1621  ANFPLL  1638
             A FP +
Sbjct  410   AAFPAV  415



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 82/128 (64%), Gaps = 12/128 (9%)
 Frame = +1

Query  1246  MRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAY  1425
             MRN S   L L+Y+AVI AW+ Q CPW  G RPE+N +H WP C     C  G  H    
Sbjct  277   MRNVS---LKLNYDAVITAWASQGCPWTAGSRPEINLNHCWPYCTGL--CCKGVHHHTCG  331

Query  1426  DGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  1605
              G    G   G          GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG
Sbjct  332   GGAVLRGCHLGAGG-------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  384

Query  1606  RFVKRANF  1629
             RFVKR +F
Sbjct  385   RFVKRTSF  392


 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 91/156 (58%), Gaps = 30/156 (19%)
 Frame = +1

Query  292  AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
            AM GK    ARACD C+ KRARWYC ADDAFLCQ CD+SVHSAN LA RH RV+L+T S+
Sbjct  11   AMGGK---TARACDGCLRKRARWYCVADDAFLCQGCDASVHSANQLASRHERVRLETASS  67

Query  472  IE--------------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSI  609
                             P WH+GFTRK RTPRH      NNN   ++       PL    
Sbjct  68   CNNNNKLINEHTDKDTVPVWHQGFTRKARTPRH------NNNKAMLMQQAKANEPL----  117

Query  610  VPVPEM-CSDENYSHDDEKEDQLLLYRVPIFDPVVA  714
              VPE+ C D +   DD+  D+ LLY+VP+FDP  A
Sbjct  118  --VPEIGCEDGSLQADDQVIDEQLLYQVPVFDPFEA  151



>ref|XP_007153446.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
 gb|ESW25440.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
Length=384

 Score =   139 bits (351),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 118/238 (50%), Gaps = 70/238 (29%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP-----  480
             ARACD CI  RARWYCAADDAFLCQACDSSVHSANPLARRH RV+LK +S+IE      
Sbjct  15   TARACDSCIRNRARWYCAADDAFLCQACDSSVHSANPLARRHHRVRLKIVSHIEANKKSF  74

Query  481  ------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDEN  642
                  PSWH+GFT+KPRTPRH     N N +        +K P  +    VPE   D N
Sbjct  75   SGTGNGPSWHKGFTKKPRTPRHGK---NGNKA--------LKNPFDV----VPE---DTN  116

Query  643  YSHDDEKEDQLLLYRVPIFDPVVADICTT-LNITDYDAAAAAFNQSKCAgggghghhKNW  819
             +  +E  D+ +LYRVP        +  +     D     +AF  +              
Sbjct  117  SNSHEESVDE-VLYRVPATPSAEQGVSVSDERRVDLLGCESAFEIA--------------  161

Query  820  DGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGGNNVEE  993
                                  F+ADVESLL +GL+ E      ME LG +G + VEE
Sbjct  162  ----------------------FSADVESLLREGLESE---CVGMEELGLVGTDEVEE  194


 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 87/133 (65%), Gaps = 20/133 (15%)
 Frame = +1

Query  1279  DYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFG  1458
             DYEAVI AW+ QR  W T  +P++ +   WP C+  R CG    H +        G  FG
Sbjct  264   DYEAVITAWTSQRSLWTTSHKPDLGTTQFWPHCM--RTCGVEFEHRS--------GELFG  313

Query  1459  -QAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN---  1626
               AA+AD    GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPRMKGRFVKR +   
Sbjct  314   CDAAMADG---GREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSLAT  370

Query  1627  ---FPLLDQQIGR  1656
                FPLL+++  R
Sbjct  371   PPIFPLLNKKEER  383



>dbj|BAH19571.1| AT1G68520 [Arabidopsis thaliana]
Length=280

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 121/224 (54%), Gaps = 38/224 (17%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEPP  483
            ARACD C+ +RARWYCAADDAFLC ACD SVHSANPLARRH RV+LK+ S     +  PP
Sbjct  14   ARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSASAGKYRHASPP  73

Query  484  ---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHD  654
               +WH+GFTRK RTPR          S  +V HD+           VPEM S E+ +  
Sbjct  74   HQATWHQGFTRKARTPR------GGKKSHTMVFHDL-----------VPEM-STEDQAES  115

Query  655  DEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSS  834
             E E+Q L++ VP+ + +V + C   ++           Q++           + +   +
Sbjct  116  YEVEEQ-LIFEVPVMNSMVEEQCFNQSLE---------KQNEFPMMPLSFKSSDEEDDDN  165

Query  835  tttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
              +        +MELA+F ADVE+LLG G  D E  S +  GLG
Sbjct  166  AESCLNGLFPTDMELAQFTADVETLLGGG--DREFHSIEELGLG  207



>emb|CDY03851.1| BnaC07g10760D [Brassica napus]
Length=372

 Score =   137 bits (344),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 130/250 (52%), Gaps = 45/250 (18%)
 Frame = +1

Query  319   ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN---------  471
             ARACD C+ +RARWYCAADDAFLCQ+CD+ VHSAN LARRH RV LK+ S          
Sbjct  13    ARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSASKHSNHNHNHS  72

Query  472   -IEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD  636
                PP    +WH GFTRKPRTPR   G+ NN               L +    VPE+ S 
Sbjct  73    PSSPPHEAATWHHGFTRKPRTPR-GSGKKNN---------------LSIFHALVPEI-SV  115

Query  637   ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
             E+ +   E E+QL+  +VP+ DP VA+      + D   A   F   +            
Sbjct  116   EDQTEGCELEEQLIC-QVPVLDPTVAEQI----LNDVVEAKIEFPIMRSGVMMDDQED--  168

Query  817   WDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF-LGGNNVEE  993
                + +  +         MEL E+AADVESLLG+GLD E   S+ ME LGF    +N  E
Sbjct  169   ---EDNDESCLNGFFPTGMELEEYAADVESLLGRGLDTE---SYAMEELGFDYESHNTYE  222

Query  994   EKASTMMEFS  1023
             E+A   +E S
Sbjct  223   EEALKNVESS  232


 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 93/162 (57%), Gaps = 16/162 (10%)
 Frame = +1

Query  1168  ELKFDYD--NDYYS---PNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWIT  1332
             EL FDY+  N Y      N E   E   + +   K+ ++L L+YE+VI  W  Q  PW +
Sbjct  210   ELGFDYESHNTYEEEALKNVESSGECITVKEEEQKNVLMLRLNYESVISTWGGQGPPWTS  269

Query  1333  GQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVS  1509
             G+ PE +    GWP   M      G +  +       +G     +   D    GREARVS
Sbjct  270   GEPPERDVDISGWPVVSM-----GGNVRESQQKH--HVGGCLPSSGFGDG---GREARVS  319

Query  1510  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFPL  1635
             RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+  +
Sbjct  320   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASLAV  361



>dbj|BAJ89584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   137 bits (346),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 124/389 (32%), Positives = 173/389 (44%), Gaps = 64/389 (16%)
 Frame = +1

Query  259   GIEIKIEGAE-GAMEGKHKAAARA--------CDYCIGKRARWYCAADDAFLCQACDSSV  411
             G+ + +E AE G  +  HKAA  A        CD C+ +RARWYCAADDAFLCQ C++SV
Sbjct  56    GLHVLVEAAEMGGSDHNHKAAGGAVGGKAARACDGCMRRRARWYCAADDAFLCQGCETSV  115

Query  412   HSANPLARRHARVQLKTLSNIEPPSWHRGFTRKPRTPRH------AHGRYNNNNSKPVVH  573
             HSANPLARRH R++L+  S +            P T         A  +      +P V 
Sbjct  116   HSANPLARRHERLRLRVTSPLPAEGVATAVKGSPATTSKCLDVAPAWPKRKARTRRPTVK  175

Query  574   HDVVKTPLHLSIVPVPEMCSDENYSHDDEK--EDQLLLYRVPIFDPVVADICTTLNITDY  747
                V   L   +V VPE+ + E+ + D+ +  E++ LLYRVP+FDP + + C+   I D 
Sbjct  176   S--VGQLLSRRLV-VPEVGAGESSTSDERRAPEEEQLLYRVPVFDPALGEFCSPPPIDD-  231

Query  748   DAAAAAFNQSKCAgggghghhKNWDGKSStttmp---ptttememeLAEFAADVESLLGK  918
              A AA     +   G      +  D  S    +P    +    + +L EFAAD+E+LLG+
Sbjct  232   -AVAATSRHGEDVEGAVEDAKELMDTPSPVQELPDCFASFGPTDADLREFAADMEALLGQ  290

Query  919   GLDD--EEESSFDMEGLGFLG-----GNNVEEEKASTMMEFSRRHekvvvkveeedapap  1077
             GLDD  E E SF ME LG +      G  V+ E    ++  S                  
Sbjct  291   GLDDGNELEDSFYMEALGLISPPAEHGGRVKVEADGGLVSRSN-----------------  333

Query  1078  aceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMRNK  1257
                           A H      S    TL    D D+ +    +              K
Sbjct  334   ----------GVLAAGHDLKREFSGSPPTL---VDDDDSFEHKTSSASNGDAVDGAQFLK  380

Query  1258  STILLNLDYEAVILAWSDQRCPWITGQRP  1344
              ++ L L+YEAVI +W+    PW  G+RP
Sbjct  381   RSLDLRLNYEAVIASWASS--PWTDGRRP  407



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 124/231 (54%), Gaps = 46/231 (20%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT--------LSN  471
             ARACD C+ +RARWYCAADDAFLC  CD SVHSANPLARRH RV+LKT         S+
Sbjct  13   TARACDSCVKRRARWYCAADDAFLCHTCDGSVHSANPLARRHERVRLKTASTGKHRHASS  72

Query  472  IEPP---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDEN  642
              PP   +WH+GFTRK RTPR          S  +V HD+           VPEM S E+
Sbjct  73   SSPPHQATWHQGFTRKARTPR------GGKKSHTMVFHDL-----------VPEM-STED  114

Query  643  YSHDDEKEDQLLLYRVPIFDPVVADICTTLNI---TDYDAAAAAFNQSKCAgggghghhK  813
             +   E E Q L++ VP+ +P+V + C   ++    ++      F  S            
Sbjct  115  QTESYEVEGQ-LIFEVPVMNPMVEEQCFNESVETKIEFPMMPVCFKSS------------  161

Query  814  NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
            + + + +  +        +MELA+F ADVE+LLG G++ +   + D+ GLG
Sbjct  162  DEEDEDNAESCLNGLFPTDMELAQFTADVETLLGGGIERDFHPTEDL-GLG  211


 Score =   114 bits (284),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 7/127 (6%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + +  ++L LDYE+V+  W  Q  PW   +  E++       C       +G   A  Y+
Sbjct  304   KKEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVC--CPTDSMGETGADQAHHYN  361

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
                 +G+  G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  362   HFRGLGLHMGEAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  416

Query  1609  FVKRANF  1629
             FVKR++ 
Sbjct  417   FVKRSSI  423



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score =   137 bits (344),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 120/229 (52%), Gaps = 49/229 (21%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
             ARACD C+ KRARWYCAADDAFLC +CDSSVHSANPLA RH RV+LKT S  +      
Sbjct  13   TARACDSCVKKRARWYCAADDAFLCHSCDSSVHSANPLACRHERVRLKTASAGKHRHASS  72

Query  478  ----PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS-DEN  642
                P +WH+GFTRK RTPR          S  +V HD+           VPEM S D+ 
Sbjct  73   SPPHPATWHQGFTRKARTPR------GGKKSHTMVFHDL-----------VPEMSSEDQR  115

Query  643  YSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
            Y    E E+Q L++ VP+ +P+  + C       +      F               N +
Sbjct  116  Y----EVEEQ-LIFEVPVLNPMGNEQCLKETKIVFPMMPVCFKS-------------NEE  157

Query  823  GKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
               +T +        EMELA+F+ADVE+LLG G D E  +   ME +GF
Sbjct  158  EDDNTESCLNGLFPTEMELAQFSADVETLLGGGTDREFHA---MEEIGF  203


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 77/127 (61%), Gaps = 8/127 (6%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + +  ++L LDYE VI  W  Q  PW   +  E++       C     C SG   A  ++
Sbjct  280   KKEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDL--DMLCCQTNSMCESGG-EAHHHN  336

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
                 +G+   +A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  337   HFPGLGLHMREAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  391

Query  1609  FVKRANF  1629
             FVKR++ 
Sbjct  392   FVKRSSI  398



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score =   137 bits (344),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 121/225 (54%), Gaps = 38/225 (17%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEP  480
             ARACD C+ +RARWYCAADDAFLC ACD SVHSANPLARRH RV+LK+ S     +  P
Sbjct  13   TARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSASAGKYRHASP  72

Query  481  P---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
            P   +WH+GFTRK RTPR          S  +V HD+           VPEM S E+ + 
Sbjct  73   PHQATWHQGFTRKARTPR------GGKKSHTMVFHDL-----------VPEM-STEDQAE  114

Query  652  DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKS  831
              E E+Q L++ VP+ + +V + C   ++           Q++           + +   
Sbjct  115  SYEVEEQ-LIFEVPVMNSMVEEQCFNQSLE---------KQNEFPMMPLSFKSSDEEDDD  164

Query  832  StttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
            +  +        +MELA+F ADVE+LLG G  D E  S +  GLG
Sbjct  165  NAESCLNGLFPTDMELAQFTADVETLLGGG--DREFHSIEELGLG  207


 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 75/127 (59%), Gaps = 8/127 (6%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + +  ++L LDYE+VI  W  Q  PW      E++       C      G     A  ++
Sbjct  284   KKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDM---VCFPTHTMGESGAEAHHHN  340

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
                 +G+  G A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  341   HFRGLGLHLGDAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  395

Query  1609  FVKRANF  1629
             FVKR++ 
Sbjct  396   FVKRSSI  402



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   137 bits (344),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 129/232 (56%), Gaps = 46/232 (20%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN--------  471
             ARACD C+ +RARWYCAADDAFLC ACD SVHSANPLARRH RV+LK+ S+        
Sbjct  13   TARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSASSGKHRHASS  72

Query  472  ---IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD-E  639
                   +WH+GFTRK RTPR          S  +V HD+           VPEM ++ +
Sbjct  73   SSPSHQSTWHQGFTRKARTPR------GGKKSHTMVFHDL-----------VPEMSTENQ  115

Query  640  NYSHDDEKEDQLLLYRVPIFDPVVADICTTLNI---TDYDAAAAAFNQSKCAgggghghh  810
              S++ E E+Q L++ VP+ +P+V + C   ++    ++     +F   KC+        
Sbjct  116  AESYEVEVEEQ-LIFEVPVMNPMVKEQCFHQSVETKVEFPMMPLSF---KCS--------  163

Query  811  KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
             + + + +  +        +MELA+F ADVE+LLG G++ E  S  ++ GLG
Sbjct  164  -DEEDEDNAESCLNGLFPTDMELAQFTADVETLLGGGMEREFHSIEEL-GLG  213


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 78/126 (62%), Gaps = 9/126 (7%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
              +  ++L LDYE+VI  W+ Q  PW   +  E++       C       SG  H   ++ 
Sbjct  292   KEKALMLRLDYESVISTWNGQGIPWTDREPSEIDL--DMVCCPTHSLGESGEAHH--HNH  347

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
                +G+  G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF
Sbjct  348   FRGLGLHMGEAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  402

Query  1612  VKRANF  1629
             VKR++ 
Sbjct  403   VKRSSI  408



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score =   137 bits (344),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 121/225 (54%), Gaps = 38/225 (17%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEP  480
             ARACD C+ +RARWYCAADDAFLC ACD SVHSANPLARRH RV+LK+ S     +  P
Sbjct  12   TARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSASAGKYRHASP  71

Query  481  P---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
            P   +WH+GFTRK RTPR          S  +V HD+           VPEM S E+ + 
Sbjct  72   PHQATWHQGFTRKARTPR------GGKKSHTMVFHDL-----------VPEM-STEDQAE  113

Query  652  DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKS  831
              E E+Q L++ VP+ + +V + C   ++           Q++           + +   
Sbjct  114  SYEVEEQ-LIFEVPVMNSMVEEQCFNQSLE---------KQNEFPMMPLSFKSSDEEDDD  163

Query  832  StttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
            +  +        +MELA+F ADVE+LLG G  D E  S +  GLG
Sbjct  164  NAESCLNGLFPTDMELAQFTADVETLLGGG--DREFHSIEELGLG  206


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 75/127 (59%), Gaps = 8/127 (6%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + +  ++L LDYE+VI  W  Q  PW      E++       C      G     A  ++
Sbjct  283   KKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDM---VCFPTHTMGESGAEAHHHN  339

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
                 +G+  G A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  340   HFRGLGLHLGDAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  394

Query  1609  FVKRANF  1629
             FVKR++ 
Sbjct  395   FVKRSSI  401



>gb|AAM61001.1| putative B-box zinc finger protein [Arabidopsis thaliana]
Length=405

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 121/225 (54%), Gaps = 38/225 (17%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEP  480
             ARACD C+ +RARWYCAADDAFLC ACD SVHSANPLARRH RV+LK+ S     +  P
Sbjct  12   TARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSASAGKYRHASP  71

Query  481  P---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSH  651
            P   +WH+GFTRK RTPR          S  +V HD+           VPEM S E+ + 
Sbjct  72   PHQATWHQGFTRKARTPR------GGKKSHTMVFHDL-----------VPEM-STEDQAE  113

Query  652  DDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKS  831
              E E+Q L++ VP+ + +V + C   ++           Q++           + +   
Sbjct  114  SYEVEEQ-LIFEVPVMNSMVEEQCFNQSLE---------KQNEFPMMPLSFKSSDEEDDD  163

Query  832  StttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
            +  +        +MELA+F ADVE+LLG G  D E  S +  GLG
Sbjct  164  NAESCLNGLFPTDMELAQFTADVETLLGGG--DREFHSIEELGLG  206


 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 75/127 (59%), Gaps = 8/127 (6%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + +  ++L LDYE+VI  W  Q  PW      E++       C      G     A  ++
Sbjct  283   KKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDM---VCFPTHTMGESGAEAHHHN  339

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
                 +G+  G A        GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPRMKGR
Sbjct  340   HFRGLGLHLGDAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNADKRPRMKGR  394

Query  1609  FVKRANF  1629
             FVKR++ 
Sbjct  395   FVKRSSI  401



>ref|XP_006341612.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=402

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 118/232 (51%), Gaps = 56/232 (24%)
 Frame = +1

Query  292  AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
            A+ GK    ARACD C+ KRARW+C ADDAFLCQ+CD S+HSAN LA RH RV+L T SN
Sbjct  11   AIGGK---TARACDSCLSKRARWFCPADDAFLCQSCDVSIHSANQLASRHERVRLDTCSN  67

Query  472  ----------IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVP  621
                         P+WH+GFTRK RTPR+          K   +              VP
Sbjct  68   KSTITKLVDKTHQPAWHQGFTRKARTPRNGKKAQIRQRKKNEENR-------------VP  114

Query  622  EMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICT----TLNITDYDAAAAAFNQSKCAg  789
            E+ SDEN   ++E+    LLYRVPIFDP  A++C     T +I D D      N      
Sbjct  115  EIGSDENEFENEEQ----LLYRVPIFDPFEAELCNVPDETGSIADLD---ILLNTEDACD  167

Query  790  ggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESS  945
                    + D                +ELAEFAADVE+LLG    +EE+S+
Sbjct  168  DLNLPEFLSSD----------------IELAEFAADVETLLG---GEEEQST  200


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 75/122 (61%), Gaps = 17/122 (14%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K+ + L L++EAVI AW +Q  PW  G RP  N    WPD      CG            
Sbjct  280   KNRLFLRLNHEAVISAWPNQSSPWTNGIRPHFNPDDYWPD--FSETCG------------  325

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             G++G   G     D    GREARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF+
Sbjct  326   GNLGYYGGHVRSGDG---GREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFI  382

Query  1615  KR  1620
             KR
Sbjct  383   KR  384



>emb|CDY44890.1| BnaA02g13920D [Brassica napus]
Length=401

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 117/229 (51%), Gaps = 47/229 (21%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
             ARACD C+ +RARWYCAADDAFLC +CD SVHSANPLARRH RV LK+ S  +      
Sbjct  13   TARACDSCLKRRARWYCAADDAFLCHSCDGSVHSANPLARRHERVLLKSASPGKQRHDSS  72

Query  478  ----PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
                PP+WH+GFTRK RTPR          S  ++ HD+           VPEM S++  
Sbjct  73   SPPHPPTWHQGFTRKARTPR------GGKKSHTMIFHDL-----------VPEMSSEDQS  115

Query  646  SHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDG  825
               +E+    L++ VP+ +P+  + C   ++           ++K          K  D 
Sbjct  116  FEVEEQ----LIFEVPVLNPMSHEKCLNESV-----------ETKIELPLMSMCFKGSDE  160

Query  826  KSStttm-pptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
            +              + ELA+F+ADVE LLG G D E    ++ME LG 
Sbjct  161  EDDNAESCLNGLFPTDTELAQFSADVEILLGGGTDRE----YNMEELGL  205


 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 82/129 (64%), Gaps = 15/129 (12%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPE--MNSHHGWPDCIMQRGCGSGTIHAAA  1422
             +N+   +L LDYE+VI  W  Q  PW   + P+  +N      D +++ G   G  H   
Sbjct  282   KNEKVHMLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESG---GEAHHHN  338

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             Y  V  +G+  G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK
Sbjct  339   Y--VRGLGLHMGEA--------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  388

Query  1603  GRFVKRANF  1629
             GRFVKR++ 
Sbjct  389   GRFVKRSSI  397



>gb|AAM13173.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 128/230 (56%), Gaps = 46/230 (20%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL----------  465
             ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LKT           
Sbjct  13   TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAVVKHSNH  72

Query  466  SNIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
            S+  PP    +WH GFTRK RTPR   G+ NN++    + HD+           VP++ S
Sbjct  73   SSASPPHEVATWHHGFTRKARTPR-GSGKKNNSS----IFHDL-----------VPDI-S  115

Query  634  DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
             E+ + + E E+QL+  +VP+ DP++++      + D       F   +           
Sbjct  116  IEDQTDNYELEEQLIC-QVPVLDPLLSEQF----LNDVVEPKIEFPMIRSGLMIE-----  165

Query  814  NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGL  963
              + + +  +        +MEL EFAADVE+LLG+GLD E   S+ ME L
Sbjct  166  --EEEDNAESCLNGFFPTDMELEEFAADVETLLGRGLDTE---SYAMEEL  210


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 91/160 (57%), Gaps = 17/160 (11%)
 Frame = +1

Query  1165  LELKFDYDNDYYSPNNekeeegeel-------lkMRNKSTILLNLDYEAVILAWSDQRCP  1323
              EL FDY++ + +   E  +  E          +  +K+ ++L L+Y++VI  W  Q  P
Sbjct  253   FELSFDYESSHKTSEEEVMKNVESSGECVVKVKEEEHKNVLMLRLNYDSVISTWGGQGPP  312

Query  1324  WITGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREA  1500
             W +G+ PE +    GWP   M    G  T H   Y G       FG          GREA
Sbjct  313   WSSGEPPERDMDISGWPAFSMVENGGEST-HQKQYVGGCLPSSGFGDG--------GREA  363

Query  1501  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  364   RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>emb|CDX81527.1| BnaC02g18310D [Brassica napus]
Length=401

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 119/229 (52%), Gaps = 47/229 (21%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
             ARACD C+ +RARW+CAADDAFLC +CD SVHSANPLARRH RV LK+ S  +      
Sbjct  13   TARACDSCLKRRARWFCAADDAFLCHSCDGSVHSANPLARRHERVLLKSASPGKQRHDSS  72

Query  478  ----PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
                PP+WH+GFTRK RTPR          S  ++ HD+           VPEM S++  
Sbjct  73   SPPHPPTWHQGFTRKARTPR------GGKKSHTMIFHDL-----------VPEMSSEDQS  115

Query  646  SHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDG  825
               +E+    L++ VP+ +P+  + C   ++           +SK          K  D 
Sbjct  116  FEVEEQ----LIFEVPVLNPMCHEKCLNESV-----------ESKIELPLMSMCFKGSDE  160

Query  826  K-SStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
            +  +  +        + ELA+F+ADVE LLG G D E    ++ME LG 
Sbjct  161  EDDNAESCLNGLFPTDTELAQFSADVEILLGGGTDRE----YNMEELGL  205


 Score =   116 bits (291),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 82/129 (64%), Gaps = 15/129 (12%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPE--MNSHHGWPDCIMQRGCGSGTIHAAA  1422
             +N+   +L LDYE+VI  W  Q  PW   + P+  +N      D +++ G   G  H   
Sbjct  282   KNEKVHMLRLDYESVISTWGGQGTPWTAREPPQIDLNMLCCPTDSMVESG---GEAHHHN  338

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             Y  V  +G+  G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK
Sbjct  339   Y--VRGLGLHMGEA--------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  388

Query  1603  GRFVKRANF  1629
             GRFVKR++ 
Sbjct  389   GRFVKRSSI  397



>ref|XP_010470801.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
 ref|XP_010470802.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=413

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 124/231 (54%), Gaps = 46/231 (20%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT--------LSN  471
             ARACD C+ +RARWYCAADDAFLC  CD SVHSANPLARRH RV+LKT         S+
Sbjct  13   TARACDSCVKRRARWYCAADDAFLCHCCDGSVHSANPLARRHERVRLKTASTGKHRHASS  72

Query  472  IEPP---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDEN  642
              PP   +WH+GFTRK RTPR    R+       +V HD+           VPEM S E+
Sbjct  73   SSPPHETTWHQGFTRKARTPRGGKKRHT------MVFHDL-----------VPEM-STED  114

Query  643  YSHDDEKEDQLLLYRVPIFDPVVADICTTLNI---TDYDAAAAAFNQSKCAgggghghhK  813
             +   E E Q L++ VP+ +P+V + C   ++    +       F  S            
Sbjct  115  QTESYEVEGQ-LIFEVPVMNPMVEEQCFNESVETKIEVPMMPVCFKSS------------  161

Query  814  NWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
            + + + +  +        +MELA+F ADVE+LLG G++ +   + D+ GLG
Sbjct  162  DEEDEDNAESCLNGLFPTDMELAQFTADVETLLGGGIERDFYPTEDL-GLG  211


 Score =   114 bits (284),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
              +  ++L LDYE+V+  W  Q  PW   +  E++       C       SG   A  Y+ 
Sbjct  291   KEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVC--CPTDSMGESGADQAHHYNH  348

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
                +G+  G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF
Sbjct  349   FRGLGLHMGEAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  403

Query  1612  VKRANF  1629
             VKR++ 
Sbjct  404   VKRSSI  409



>gb|AEF12203.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN20727.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=427

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 116/225 (52%), Gaps = 49/225 (22%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEPP  483
            ARAC+ C+  RARWYCAADDAFLC  CD+ VHSAN LA RH RV+L+T S     ++ P 
Sbjct  16   ARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKLQTASSKVNYSVTPK  75

Query  484  -SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLH-------------LSIVP-V  618
             +WH GFTRK RTPRH      NNN    +     K PLH             +S++P V
Sbjct  76   VAWHSGFTRKARTPRH------NNNRHSSLKQQQQKKPLHEERGEEEVFFNNTISLLPLV  129

Query  619  PEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggg  798
            PE+ S+E    +DE E+QLL  RVP+FD   A++C+  N    +  AA            
Sbjct  130  PELGSEEPL-LNDETEEQLLC-RVPVFD---AELCSIYNEVKDEVVAAGEEALDLENFSS  184

Query  799  hghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDE  933
                 + D                  LAEF ADV+S LG G D++
Sbjct  185  EFLPSDTD------------------LAEFTADVKSFLGNGADED  211


 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 78/126 (62%), Gaps = 14/126 (11%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEM-NSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
             K  I L L+YE VI AW+ Q  PW  G  P+  NS   W D +   G   G +    Y  
Sbjct  307   KKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLDFL---GSNGGNVQCC-YGA  362

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
             VG + +       AD    GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRF
Sbjct  363   VGSLRVH------ADG---GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  413

Query  1612  VKRANF  1629
             VKR  F
Sbjct  414   VKRTPF  419



>ref|XP_010511850.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=411

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 123/233 (53%), Gaps = 48/233 (21%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT----------L  465
             ARACD C+ +RARWYCAADDAFLC  CD SVHSANPLARRH RV+LKT          +
Sbjct  13   TARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKTASTGKHRHADV  72

Query  466  SNIEPP---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD  636
            S+  PP   +WH+GFTRK RTPR             +V HD+           VPEM S 
Sbjct  73   SSPSPPHQATWHQGFTRKARTPR------GGKKGHTMVFHDL-----------VPEM-ST  114

Query  637  ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNI---TDYDAAAAAFNQSKCAgggghgh  807
            E+     E E Q L++ VP+ +P+V + C   ++    ++      F  S          
Sbjct  115  EDQMESYEVEGQ-LIFEVPVMNPMVEEQCFNESVETKIEFPMMPVCFKSS----------  163

Query  808  hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
              + + + +  +        +MELA+F ADVE+LLG G++ +   + D+ GLG
Sbjct  164  --DEEDEDNAESCLNGLFPTDMELAQFTADVETLLGGGIERDFHPTEDL-GLG  213


 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 68/114 (60%), Gaps = 7/114 (6%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM  1443
             ++L LDYE+V+  W  Q  PW T Q+P          C       SG   A  Y+    +
Sbjct  297   LMLRLDYESVLSTWGGQGIPW-TAQKPS-EIDLDMVCCPTDSMGESGADQAHHYNHFRGL  354

Query  1444  GITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  1605
             G   G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG
Sbjct  355   GFHMGEAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  403



>ref|XP_010511849.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
Length=415

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 123/232 (53%), Gaps = 48/232 (21%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT----------LS  468
            ARACD C+ +RARWYCAADDAFLC  CD SVHSANPLARRH RV+LKT          +S
Sbjct  14   ARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKTASTGKHRHADVS  73

Query  469  NIEPP---SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE  639
            +  PP   +WH+GFTRK RTPR             +V HD+           VPEM S E
Sbjct  74   SPSPPHQATWHQGFTRKARTPR------GGKKGHTMVFHDL-----------VPEM-STE  115

Query  640  NYSHDDEKEDQLLLYRVPIFDPVVADICTTLNI---TDYDAAAAAFNQSKCAgggghghh  810
            +     E E Q L++ VP+ +P+V + C   ++    ++      F  S           
Sbjct  116  DQMESYEVEGQ-LIFEVPVMNPMVEEQCFNESVETKIEFPMMPVCFKSS-----------  163

Query  811  KNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
             + + + +  +        +MELA+F ADVE+LLG G++ +   + D+ GLG
Sbjct  164  -DEEDEDNAESCLNGLFPTDMELAQFTADVETLLGGGIERDFHPTEDL-GLG  213


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 75/122 (61%), Gaps = 7/122 (6%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM  1443
             ++L LDYE+V+  W  Q  PW T Q+P          C       SG   A  Y+    +
Sbjct  297   LMLRLDYESVLSTWGGQGIPW-TAQKPS-EIDLDMVCCPTDSMGESGADQAHHYNHFRGL  354

Query  1444  GITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  1623
             G   G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR+
Sbjct  355   GFHMGEAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  409

Query  1624  NF  1629
             + 
Sbjct  410   SI  411



>gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Erythranthe guttata]
Length=394

 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 96/149 (64%), Gaps = 17/149 (11%)
 Frame = +1

Query  292  AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN  471
            A+ GK   +ARACD C+ KRARW+CAADDAFLCQ+CD+SVHSAN LA RH RV+L   SN
Sbjct  11   ALGGK---SARACDSCLVKRARWFCAADDAFLCQSCDASVHSANQLASRHDRVRLDKTSN  67

Query  472  IEP----PSWHRGF-TRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD  636
              P    P+W +GF TRK RTPRH         +K ++H      P +  + PVPE+ + 
Sbjct  68   ASPPANAPAWQQGFTTRKARTPRHGKP-----TTKRLLHE---YPPANQLLPPVPEIDAH  119

Query  637  EN-YSHDDEKEDQLLLYRVPIFDPVVADI  720
            E+ ++ +D +  Q LLYRVP+FDP   D 
Sbjct  120  EDPFAEEDNEGGQFLLYRVPVFDPFGQDF  148


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 72/123 (59%), Gaps = 10/123 (8%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
             N + + L L+YEAVI AW+ + CPW  G  P+ ++     D  M    G  +       G
Sbjct  264   NNNNMFLRLNYEAVIAAWATKGCPWTNGTPPQFDNL----DQFMDEWSGGSSEWCGGRIG  319

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
                 G         +D    REARV RY+EKRRTRLFSKKIRY+VRKLNAE RPRMKGRF
Sbjct  320   ----GNNNNNNNNNNDA--EREARVLRYKEKRRTRLFSKKIRYQVRKLNAENRPRMKGRF  373

Query  1612  VKR  1620
             VKR
Sbjct  374   VKR  376



>ref|XP_006415872.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
 dbj|BAJ34058.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34225.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
Length=433

 Score =   135 bits (339),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 94/236 (40%), Positives = 123/236 (52%), Gaps = 46/236 (19%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNI-------  474
             ARACD C+ +RARWYCAADDAFLCQ+CDS VHSANPLARRH RV+LK+ ++        
Sbjct  12   TARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKSSASPKHSNHNH  71

Query  475  -----------EPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVP  621
                       E  +WH GFTRK RTPR +        S P + HD+           VP
Sbjct  72   NHSASSSSPLHEAATWHHGFTRKARTPRGS-----GKKSHPSIFHDL-----------VP  115

Query  622  EMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggggh  801
            E+ S E+ +   E E+QL+  +VP+ DP+VA+      + D       F   +       
Sbjct  116  EI-SVEDQTDSYELEEQLIC-QVPVLDPMVAE----QFLNDVVEPKIEFPTMRSGVMIHE  169

Query  802  ghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                  D  ++  +        +MEL EFAADVE LLG+GLD E   S+ +E LG 
Sbjct  170  DQE---DEDNNAESCLNGFFPTDMELEEFAADVEILLGRGLDTE---SYAIEELGL  219


 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYD  1428
              K+ ++L L+Y++VI  W  Q  PW +G  PE++    GWP  I   G G  + H   Y 
Sbjct  303   QKNVLMLRLNYDSVISTWGGQGPPWTSGDPPELDIDISGWP-AISMVGNGGESHHQKQYV  361

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
             G       FG          GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  362   GGCLPSSGFGDG--------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  413

Query  1609  FVKRANFPL  1635
             FVKRA+  +
Sbjct  414   FVKRASLAV  422



>emb|CDY24402.1| BnaCnng04690D [Brassica napus]
Length=369

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 123/243 (51%), Gaps = 46/243 (19%)
 Frame = +1

Query  301   GKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK-TLSNIE  477
             G     AR CD C+ KRA W+CAAD+AFLCQ+CD+SVHSAN LARRH RV LK T    E
Sbjct  7     GVRAKTARTCDNCLKKRAHWFCAADEAFLCQSCDTSVHSANLLARRHERVPLKDTSPQQE  66

Query  478   PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDD  657
              P+WH GFTRKPRTPR   G+ NN+++     HD+           VPE+ ++     D 
Sbjct  67    APTWHHGFTRKPRTPR-GSGKRNNSST----FHDM-----------VPEITAEGQT--DS  108

Query  658   EKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSSt  837
              + +  L+ +VP+ DP+V                    + K             + +   
Sbjct  109   SEVEGPLICQVPVLDPMVV-------------------EPKIKFPTMRSGIDGHEDEDKD  149

Query  838   ttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF-----LGGNNVEEEKA  1002
              +         ME+ +FAADVE+LLG GLD E   S+ ME LG      L  + +E+++ 
Sbjct  150   ESCLNEIFPTNMEVEDFAADVETLLGHGLDKE---SYTMEELGLSNTEMLKKDEIEDKET  206

Query  1003  STM  1011
               M
Sbjct  207   KAM  209


 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 9/127 (7%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + K+ ++L+LDY+ VI  W  Q  PW +G  P+++ +      + +R  G  +       
Sbjct  239   KKKNVLMLSLDYDQVISTWGGQGLPWTSGGPPDIDINISGSPVVSKRDNGRKSRKKRRGG  298

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
             G          + + D    GREARVSRYREK++TR F+K IRYEVRKLNAE +PRMKGR
Sbjct  299   G------RLPSSVVGDG---GREARVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGR  349

Query  1609  FVKRANF  1629
             FVKRA+ 
Sbjct  350   FVKRASL  356



>ref|XP_004135402.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=403

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 91/140 (65%), Gaps = 15/140 (11%)
 Frame = +1

Query  1246  MRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA-AA  1422
             ++NK  + L+LD EAVI+AW  +  PW +G RP ++  + WPD +       GT  +   
Sbjct  272   VKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYM-------GTYESDCY  324

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             Y   G+ G   G+ A+   V   REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMK
Sbjct  325   YQPYGEFGSGIGRQAVTG-VEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMK  383

Query  1603  GRFVKRAN------FPLLDQ  1644
             GRFVKR++       PL +Q
Sbjct  384   GRFVKRSSCFAPPPLPLFNQ  403


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 6/75 (8%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS------NIEP  480
            ARACD CI KRARWYCAADDAFLCQACD+SVHSAN LARRH RV+L+T S      N   
Sbjct  17   ARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERVRLQTASFRPSSDNSSA  76

Query  481  PSWHRGFTRKPRTPR  525
             SWH+GFT+KPR+PR
Sbjct  77   ASWHQGFTKKPRSPR  91



>gb|KGN52081.1| hypothetical protein Csa_5G609670 [Cucumis sativus]
Length=403

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 91/140 (65%), Gaps = 15/140 (11%)
 Frame = +1

Query  1246  MRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA-AA  1422
             ++NK  + L+LD EAVI+AW  +  PW +G RP ++  + WPD +       GT  +   
Sbjct  272   VKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYM-------GTYESDCY  324

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             Y   G+ G   G+ A+   V   REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMK
Sbjct  325   YQPYGEFGSGIGRQAVTG-VEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMK  383

Query  1603  GRFVKRAN------FPLLDQ  1644
             GRFVKR++       PL +Q
Sbjct  384   GRFVKRSSCFAPPPLPLFNQ  403


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 6/75 (8%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS------NIEP  480
            ARACD CI KRARWYCAADDAFLCQACD+SVHSAN LARRH RV+L+T S      N   
Sbjct  17   ARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERVRLQTASFRPSSDNSSA  76

Query  481  PSWHRGFTRKPRTPR  525
             SWH+GFT+KPR+PR
Sbjct  77   ASWHQGFTKKPRSPR  91



>ref|XP_009127638.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brassica rapa]
Length=401

 Score =   131 bits (330),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 118/229 (52%), Gaps = 47/229 (21%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
             ARACD C+ +RARWYCAADDAFLC +CD S+HSANPLARRH RV LK+ S  +      
Sbjct  13   TARACDSCLKRRARWYCAADDAFLCHSCDGSIHSANPLARRHERVLLKSASPGKQRHDSS  72

Query  478  ----PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENY  645
                PP+WH+GFTRK RT      R     S  ++ HD+           VPEM S++  
Sbjct  73   SPPHPPTWHQGFTRKART------RRGGKKSHTMIFHDL-----------VPEMSSEDQS  115

Query  646  SHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDG  825
               +E+    L++ VP+ +P+  + C   ++           ++K          K  D 
Sbjct  116  FEVEEQ----LIFEVPVLNPMCHEKCLNESM-----------ETKIELPLMSMCFKGSDE  160

Query  826  K-SStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
            +  +  +        + ELA+F+ADVE LLG G D E    ++ME LG 
Sbjct  161  EDDNAESCLNGLFPTDTELAQFSADVEILLGGGTDRE----YNMEELGL  205


 Score =   117 bits (292),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 82/129 (64%), Gaps = 15/129 (12%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPE--MNSHHGWPDCIMQRGCGSGTIHAAA  1422
             +N+   +L LDYE+VI  W  Q  PW   + P+  +N      D +++ G   G  H   
Sbjct  282   KNEKVHMLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESG---GEAHHHN  338

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             Y  V  +G+  G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK
Sbjct  339   Y--VRGLGLHMGEA--------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  388

Query  1603  GRFVKRANF  1629
             GRFVKR++ 
Sbjct  389   GRFVKRSSI  397



>emb|CDY65591.1| BnaC05g50730D [Brassica napus]
Length=348

 Score =   130 bits (327),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 95/150 (63%), Gaps = 34/150 (23%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNI-------  474
             ARACD C+ KRARWYCAADDAFLCQ+CD+ VHSANPLARRH RV+LK+ S +       
Sbjct  12   TARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSASPVATKYSSH  71

Query  475  -----EPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM  627
                  PP    +WH+GFTRKPRTPR   G+ NN +    + HD+           VPE+
Sbjct  72   NHSASSPPLEAATWHQGFTRKPRTPR-GSGKKNNLS----IFHDL-----------VPEI  115

Query  628  CSDENYSHDDEKEDQLLLYRVPIFDPVVAD  717
             +++    D  + ++LL+ +VP+ DP+VA+
Sbjct  116  SAEDQT--DSYEIEELLICQVPVLDPMVAE  143


 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 76/123 (62%), Gaps = 9/123 (7%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
              K+ ++L+L+YE+VI  W  Q  PW++G+ PE +        +     G G  H   Y G
Sbjct  219   QKNVLMLSLNYESVISTWGGQGQPWMSGEPPERDIDISDKPVVSMEING-GESHHKHYVG  277

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
                    FG          GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF
Sbjct  278   GCLPSSGFGDG--------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  329

Query  1612  VKR  1620
             VKR
Sbjct  330   VKR  332



>ref|XP_011072947.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Sesamum indicum]
Length=393

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 112/221 (51%), Gaps = 46/221 (21%)
 Frame = +1

Query  283  AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
            A  A+ GK    ARACD C+ KRARW+CAADDAFLCQ+CD SVHSAN LA RH RV+L+ 
Sbjct  9    AANALGGK---TARACDSCLLKRARWFCAADDAFLCQSCDVSVHSANQLASRHERVRLEA  65

Query  463  LS-----NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM  627
             S         P+WH+GFTRK RTPR           KP         PL     P+   
Sbjct  66   SSFKGSEGHSSPAWHQGFTRKARTPRQG---------KPAAR----LQPLANHAFPLVPE  112

Query  628  CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghgh  807
             + E+ +  +E E+Q  LYRVP+FDP   + C+     +        N ++         
Sbjct  113  INAEDGAFSEENEEQ-FLYRVPVFDPFADEFCSETVKGEEADGGHDLNLAE---------  162

Query  808  hKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDD  930
                             +  + +LAEFAADVE+LLG G+++
Sbjct  163  ---------------LLSTCDDDLAEFAADVENLLGTGVEE  188


 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 75/125 (60%), Gaps = 19/125 (15%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K+ + L L+YEAVI AW+ Q  PW  G RP  N       C+                  
Sbjct  276   KTRMFLRLNYEAVIAAWAAQGSPWTNGVRPHFNLDDFMVTCLE-----------------  318

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             GD   + G  + A+D    REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV
Sbjct  319   GDSHPSCGGRSGANDA--EREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  376

Query  1615  KRANF  1629
             KR NF
Sbjct  377   KRTNF  381



>emb|CDY67920.1| BnaAnng25560D [Brassica napus]
Length=348

 Score =   129 bits (323),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 95/150 (63%), Gaps = 34/150 (23%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIE------  477
             ARACD C+ KRARWYCAADDAFLCQ+CD+ VHSANPLARRH RV+LK+ S +       
Sbjct  12   TARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSASPVATKYSSH  71

Query  478  ------PP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM  627
                  PP    +WH+GFTRKPRTPR   G+ NN +    + HD+           VPE+
Sbjct  72   NHSASCPPLEAATWHQGFTRKPRTPR-GSGKKNNLS----IFHDL-----------VPEI  115

Query  628  CSDENYSHDDEKEDQLLLYRVPIFDPVVAD  717
             S E+ +   E E+QL+  +VP+ DP+VA+
Sbjct  116  -SAEDQTDSYEIEEQLIC-QVPVLDPMVAE  143


 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 75/123 (61%), Gaps = 9/123 (7%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
              K+ ++L+L+YE+VI  W  Q  PW++ + PE +        +     G G  H   Y G
Sbjct  219   QKNVLMLSLNYESVISTWGGQGQPWLSREPPERDIDISDKPVVSMEING-GESHHKHYVG  277

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
                    FG          GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF
Sbjct  278   GCLPSSGFGDG--------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  329

Query  1612  VKR  1620
             VKR
Sbjct  330   VKR  332



>gb|EEC73943.1| hypothetical protein OsI_08813 [Oryza sativa Indica Group]
Length=324

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 145/325 (45%), Gaps = 41/325 (13%)
 Frame = +1

Query  676   LLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmppt  855
             LLYRVP+FDP + + C+   I D  AA+++  +   A G            SS     P 
Sbjct  24    LLYRVPVFDPSLTEFCSPPPIDDAAAASSSCFKEDAADGAVEDAKYPAAAASSPVQQLPD  83

Query  856   t----tememeLAEFAADVESLLGKGLDDEEE--SSFDMEGLGFLGGNNVEEEKASTMME  1017
             +       + EL EFAAD+E+LLG+GLDD  E   SF ME LG +      EE +   ME
Sbjct  84    SFVNFEPTDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLI--TPPVEESSRVKME  141

Query  1018  FSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDY  1197
                                     A        +   H         D L++ F+     
Sbjct  142   LD-------------------GGVASSSRVSLPSCRAHPKPEDVESADVLDIDFNC----  178

Query  1198  YSPNNekeeegeellkMRN--KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWP  1371
              SP+ +K                ++ L L+YEA+I +W +   PW  G+ P       WP
Sbjct  179   TSPDEQKSSASNGAAADSQFFHRSLDLRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWP  236

Query  1372  DCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKK  1551
             +         G         VG M +             GREARV+RYREKRRTRLFSKK
Sbjct  237   NDHHYSVRVVGAGGGGHGAEVGMMTVRPRMDG------PGREARVTRYREKRRTRLFSKK  290

Query  1552  IRYEVRKLNAEKRPRMKGRFVKRAN  1626
             IRYEVRKLNAEKRPRMKGRFVKR +
Sbjct  291   IRYEVRKLNAEKRPRMKGRFVKRPS  315



>gb|AEF12205.1| CONSTANS-like zinc finger protein [Glycine max]
Length=430

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 123/219 (56%), Gaps = 36/219 (16%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEPP  483
            ARAC+ C+  RARWYCAADDAFLC  CD+ VHSAN LA RH RV+L+T S     ++ P 
Sbjct  16   ARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKLQTASSKVNYSVTPK  75

Query  484  -SWHRGFTRKPRTPR--HAHGRYNNNNSKPV-----VHHDVVKTPLHLSIVP-VPEMCSD  636
             +WH GFTRK RTPR  + H        KP+        +V      +S+ P VPE+ S+
Sbjct  76   VAWHSGFTRKARTPRSNNKHSSLQQQQQKPLHEEQGEEEEVFFNNTIISVQPLVPELGSE  135

Query  637  ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
            E    +DE E+QLL  RVP+FD   A++C+  N           ++   AGG      +N
Sbjct  136  EPL-LNDETEEQLLC-RVPVFD---AELCSIYNEVK--------DEVNVAGGEVAFDLEN  182

Query  817  WDGKSStttmpptttememeLAEFAADVESLLGKGLDDE  933
            +  +             +M+LAEF+ADVESLLG G+D++
Sbjct  183  FSSE---------FLPTDMDLAEFSADVESLLGNGVDED  212


 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 81/130 (62%), Gaps = 15/130 (12%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
             NK  I L L+YE VI AW+ Q  PW TG  P+  +     DC +  G   G +    Y  
Sbjct  302   NKKDIFLRLNYEEVITAWASQGSPWTTGTPPKFFNSD---DCWLDLGSNGGGVQCY-YGE  357

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
             V  + +       AD    GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRF
Sbjct  358   VRSLRVH------ADG---GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  408

Query  1612  VKRANFPLLD  1641
             VK  + PLL+
Sbjct  409   VK--SVPLLE  416



>ref|NP_001048022.1| Os02g0731700 [Oryza sativa Japonica Group]
 dbj|BAD15938.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16131.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF09936.1| Os02g0731700 [Oryza sativa Japonica Group]
 gb|EEE57750.1| hypothetical protein OsJ_08268 [Oryza sativa Japonica Group]
Length=323

 Score =   127 bits (319),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 144/325 (44%), Gaps = 42/325 (13%)
 Frame = +1

Query  676   LLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmppt  855
             LLYRVP+FDP +A+ C+   I D  AA+++  +   A G            SS     P 
Sbjct  24    LLYRVPVFDPSLAEFCSPPPIDDAAAASSSCFKEDAADGAVEDAKYPAAAASSPVQQLPD  83

Query  856   t----tememeLAEFAADVESLLGKGLDDEEE--SSFDMEGLGFLGGNNVEEEKASTMME  1017
             +       + EL EFAAD+E+LLG+GLDD  E   SF ME LG +      EE     ME
Sbjct  84    SFVNFEPTDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLI--TPPVEESGRVKME  141

Query  1018  FSRRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDY  1197
                                     A +      +   H         D L++ F+     
Sbjct  142   LD-------------------GGVASNSRVSLPSCRAHPKPEDVESADVLDIDFNC----  178

Query  1198  YSPNNekeeegeellkMRN--KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWP  1371
              SP+ +K                ++ L L+YEA+I +W +   PW  G+ P       WP
Sbjct  179   TSPDEQKSSASNGAAADSQFFHRSLDLRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWP  236

Query  1372  DCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKK  1551
             +                  G     +T            GREARV+RYREKRRTRLFSKK
Sbjct  237   N---DHHYSGLWAAGGGGHGAEVGMMTVRPRMDG----PGREARVTRYREKRRTRLFSKK  289

Query  1552  IRYEVRKLNAEKRPRMKGRFVKRAN  1626
             IRYEVRKLNAEKRPRMKGRFVKR +
Sbjct  290   IRYEVRKLNAEKRPRMKGRFVKRPS  314



>gb|KHN32039.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=436

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 123/219 (56%), Gaps = 36/219 (16%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEPP  483
            ARAC+ C+  RARWYCAADDAFLC  CD+ VHSAN LA RH RV+L+T S     ++ P 
Sbjct  16   ARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKLQTASSKVNYSVTPK  75

Query  484  -SWHRGFTRKPRTPR--HAHGRYNNNNSKPV-----VHHDVVKTPLHLSIVP-VPEMCSD  636
             +WH GFTRK RTPR  + H        KP+        +V      +S+ P VPE+ S+
Sbjct  76   VAWHSGFTRKARTPRSNNKHSSLQQQQQKPLHEEQGEEEEVFFNNTIISVQPLVPELGSE  135

Query  637  ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
            E    +DE E+QLL  RVP+FD   A++C+  N           ++   AGG      +N
Sbjct  136  EPL-LNDETEEQLLC-RVPVFD---AELCSIYNEVK--------DEVNVAGGEVAFDLEN  182

Query  817  WDGKSStttmpptttememeLAEFAADVESLLGKGLDDE  933
            +  +             +M+LAEF+ADVESLLG G+D++
Sbjct  183  FSSE---------FLPTDMDLAEFSADVESLLGNGVDED  212



>ref|XP_008446600.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 
6-like [Cucumis melo]
Length=402

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 88/137 (64%), Gaps = 15/137 (11%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA-AAYDG  1431
             +  I L+LD EAVI+AW  +  PW +G RP ++  + WPD +       GT  +   Y  
Sbjct  274   QKKISLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYM-------GTYESDCYYQP  326

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
              G+ G   G+ A+   V   REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRF
Sbjct  327   YGEFGSGIGRHAVTG-VEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  385

Query  1612  VKRAN------FPLLDQ  1644
             VKR++       PL +Q
Sbjct  386   VKRSSCFAPPPLPLFNQ  402


 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 6/75 (8%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS------NIEP  480
            ARACD CI KRARWYCAADDAFLCQACD+SVHSAN LARRH RV+L+T S      N   
Sbjct  17   ARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERVRLQTASFRPSSDNSSA  76

Query  481  PSWHRGFTRKPRTPR  525
             SWH+GFT+KPR+PR
Sbjct  77   ASWHQGFTKKPRSPR  91



>gb|EMS53816.1| Zinc finger protein CONSTANS-LIKE 16 [Triticum urartu]
Length=282

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 122/252 (48%), Gaps = 42/252 (17%)
 Frame = +1

Query  877   LAEFAADVESLLGK-GLDD-EEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvk  1050
             L EFAAD+E+LLG+ G+DD +EE  F ME LG +   +V+  +    ++  R        
Sbjct  55    LMEFAADMEALLGRPGMDDGDEEEPFCMEALGLIEPMDVDGGRVKLEIDPMR--------  106

Query  1051  veeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeeg  1230
                                 A         S     D  ++ FDYD+   +P+      G
Sbjct  107   --------------------ACGLEQKPEVSG----DMFDIDFDYDSPLGTPDENAASSG  142

Query  1231  eellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTI  1410
                       ++ LNL+YEA++  W     PW  G+RP +     WP        G+  +
Sbjct  143   ASAEAQFTPRSLALNLNYEAIMENWGSS--PWADGERPHVKLDDCWPHDYYSLQEGAWMM  200

Query  1411  HAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1590
                   G   +G    +      +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  201   GGVVGHGGEGLGTPRLR------MDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  254

Query  1591  PRMKGRFVKRAN  1626
             PRMKGRFVKRAN
Sbjct  255   PRMKGRFVKRAN  266



>ref|XP_008445668.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
melo]
 gb|ADN34083.1| zinc finger (B-box type) family protein [Cucumis melo subsp. 
melo]
Length=335

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 85/135 (63%), Gaps = 25/135 (19%)
 Frame = +1

Query  1249  RNKSTIL-LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPD----CIMQRG--CGSGT  1407
             +NK  +L L LD EAVI AW + + PW  GQRP+ +    WP+    C ++ G  CG   
Sbjct  208   KNKRRVLSLRLDCEAVIAAWGNLQSPWTNGQRPDFDPDQPWPNSMEVCEVRYGQRCGEHG  267

Query  1408  IHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1587
             +  AA   +GD G               REARVSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  268   LRTAA---MGDGG---------------REARVSRYREKRRTRLFSKKIRYEVRKLNAEK  309

Query  1588  RPRMKGRFVKRANFP  1632
             RPRMKGRFVKR  FP
Sbjct  310   RPRMKGRFVKRTPFP  324


 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 84/137 (61%), Gaps = 21/137 (15%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN--IEPPSW  489
             ARACD C+ +RARWYCAADDAFLCQ+CD++VHSANPLARRH R++L + ++  +  PSW
Sbjct  15   TARACDSCVRRRARWYCAADDAFLCQSCDTTVHSANPLARRHQRLRLNSSNSPTLNSPSW  74

Query  490  HRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKED  669
              GFTRK                     +D++    H+S+VP     +D+  SH+DE  +
Sbjct  75   VSGFTRK-----------PRTPRPRPKSNDLI----HVSVVPE----TDDATSHEDEHLE  115

Query  670  QLLLYRVPIFDPVVADI  720
              LLYRVP  D  V+D 
Sbjct  116  DQLLYRVPTLDVNVSDF  132



>ref|XP_004982006.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=406

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 132/263 (50%), Gaps = 47/263 (18%)
 Frame = +1

Query  283   AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
             A GA+ G     AR+CD C+ +RARW+C ADDAFLCQACD+SVHSANPLARRH RV+L +
Sbjct  7     ATGAVLGAR--TARSCDGCMRRRARWHCPADDAFLCQACDTSVHSANPLARRHHRVRLPS  64

Query  463   LSNIEP------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVV--HHDVVKTPLHLSIVPV  618
              S   P      P+W  G  R+PRTPR          SKP V  H     +        V
Sbjct  65    ASCSSPPRDPDAPAWLHGLKRRPRTPR----------SKPGVSKHETTPASIAAAVSAAV  114

Query  619   PEMCSDE---------NYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFN  771
             P++ ++E         N  H  E++D+ LLYRVP+FDP++A++   +        AA   
Sbjct  115   PDLEAEESAGSGIVGDNDYHGLEEDDEDLLYRVPVFDPMLAELYNPVADEGEQKPAA---  171

Query  772   QSKCAgggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFD  951
                C           +    +           +MELA FAAD+ESLL  G+D+     FD
Sbjct  172   ---CLISSLAETSPEFASGLAEADGLSGYDVPDMELASFAADMESLL-MGVDE----GFD  223

Query  952   MEGLGFLGGNNVEEEKASTMMEF  1020
                LGFL     +EEK    ++ 
Sbjct  224   --DLGFL-----DEEKPQVNVDL  239


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 78/125 (62%), Gaps = 22/125 (18%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWS-DQRCPWITGQRPEMNSHHGWPDCIM-QRGCGSGTIHAAA  1422
             R +  ++L L+Y+ VI +W+ D   PW  G+RP ++ H  W D     RG   GT+ A  
Sbjct  259   RKRPEMILKLNYDGVIASWARDGGSPWFHGERPHLDPHESWSDFPAGSRGLLGGTVTA--  316

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
                     +T G+          REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMK
Sbjct  317   --------VTGGE----------REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMK  358

Query  1603  GRFVK  1617
             GRFVK
Sbjct  359   GRFVK  363



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 95/156 (61%), Gaps = 23/156 (15%)
 Frame = +1

Query  265  EIKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHA  444
            ++K  GA GA        ARACD CI +RARW+CAADDAFLC  CD+ VHSAN LA RH 
Sbjct  3    DMKDAGALGA------KTARACDSCISRRARWFCAADDAFLCHGCDTLVHSANQLASRHE  56

Query  445  RVQLKTLSN---IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHL---S  606
            RV+L+T S+       +WH GFTRK RTPRH      NNNSK       +K  +     S
Sbjct  57   RVRLQTASSKVATTTHAWHSGFTRKARTPRH------NNNSKHSALQQRLKEEVLFNNGS  110

Query  607  IVP-VPEMCSDENYS---HDDEKEDQLLLYRVPIFD  702
            ++P VPE+  +E  +    +DE E+Q+L  RVP+FD
Sbjct  111  VLPLVPELGGEEQETVVVDNDETEEQMLC-RVPVFD  145


 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 75/127 (59%), Gaps = 21/127 (17%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQ-RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
              K  I L L+Y+ VI AWS Q   PW T   P+ NS  G+  C+                
Sbjct  253   TKRDIFLRLNYDEVISAWSTQGSSPWTTSNPPKFNS--GYDFCL----------------  294

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
               G  G+     ++   +  GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGR
Sbjct  295   --GLSGVDGEVRSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGR  352

Query  1609  FVKRANF  1629
             FVKR  F
Sbjct  353   FVKRTCF  359



>ref|XP_003525256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=365

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 117/239 (49%), Gaps = 65/239 (27%)
 Frame = +1

Query  289  GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS  468
            GA+ GK    ARACD C+ +RARW+CAADDAFLC  CD+ VHSAN LA RH RV+L+T S
Sbjct  8    GALGGK---TARACDSCVSRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRLQTAS  64

Query  469  N--IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL---HLSIVP-VPEMC  630
            +      +WH GFTRK RTPRH        NSK       +K  +   + S++P VPE+ 
Sbjct  65   SKVTTTHAWHSGFTRKARTPRH--------NSKHFALQQRLKDEVLFNNTSVLPLVPELG  116

Query  631  SDEN---YSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggggh  801
             +E       +DE E+Q+L  RVP+FDP         + +D D                 
Sbjct  117  GEEQEPVVVDNDETEEQMLC-RVPVFDPFDVRTDDLDSFSDMD-----------------  158

Query  802  ghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFLGG  978
                                      AEFAADVESLL K  +D+E S+    G G  G 
Sbjct  159  -------------------------FAEFAADVESLLDK--EDDEISACVGGGEGVQGA  190


 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 74/127 (58%), Gaps = 21/127 (17%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQ-RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
              K  I L L+Y+ VI AWS Q   PW T   P+ NS + +                    
Sbjct  249   TKRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDF--------------------  288

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
              +G  G+     ++   +  GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGR
Sbjct  289   SLGLSGVGGEVRSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGR  348

Query  1609  FVKRANF  1629
             FVKR  F
Sbjct  349   FVKRTCF  355



>gb|ACX42573.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN21563.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=366

 Score =   125 bits (313),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 111/224 (50%), Gaps = 64/224 (29%)
 Frame = +1

Query  289  GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS  468
            GA+ GK    ARACD C+ +RARW+CAADDAFLC  CD+ VHSAN LA RH RV+L+T S
Sbjct  5    GALGGK---TARACDSCVSRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRLQTAS  61

Query  469  N--IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL---HLSIVP-VPEMC  630
            +      +WH GFTRK RTPRH        NSK       +K  +   + S++P VPE+ 
Sbjct  62   SKVTTTHAWHSGFTRKARTPRH--------NSKHFALQQRLKDEVLFNNTSVLPLVPELG  113

Query  631  SDEN---YSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggggh  801
             +E       +DE E+Q+L  RVP+FDP         + +D D                 
Sbjct  114  GEEQEPVVVDNDETEEQMLC-RVPVFDPFDVRTDDLDSFSDMD-----------------  155

Query  802  ghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDE  933
                                      AEFAADVESLL K  DDE
Sbjct  156  -------------------------FAEFAADVESLLDKE-DDE  173


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 74/127 (58%), Gaps = 21/127 (17%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQ-RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
              K  I L L+Y+ VI AWS Q   PW T   P+ NS + +                    
Sbjct  250   TKRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDF--------------------  289

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
              +G  G+     ++   +  GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGR
Sbjct  290   SLGLSGVGGEVRSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGR  349

Query  1609  FVKRANF  1629
             FVKR  F
Sbjct  350   FVKRTCF  356



>ref|XP_004140861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 ref|XP_004172358.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 gb|KGN45963.1| hypothetical protein Csa_6G039540 [Cucumis sativus]
Length=334

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 81/128 (63%), Gaps = 13/128 (10%)
 Frame = +1

Query  1249  RNKSTIL-LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAY  1425
             +NK  +L L LD EAVI AW + + PW  GQRP+ +    WP+ +               
Sbjct  207   KNKRRVLSLRLDCEAVIAAWGNLQSPWTNGQRPDFDPDQPWPNSM-------DLCEVRYG  259

Query  1426  DGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  1605
                G+ G  F  AAI D    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG
Sbjct  260   QRCGEYG--FRTAAIGDG---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  314

Query  1606  RFVKRANF  1629
             RFVKR  F
Sbjct  315   RFVKRTPF  322


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 82/137 (60%), Gaps = 21/137 (15%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT--LSNIEPPSW  489
             ARACD C+ KRARWYCAADDAFLCQ+CD++VHSANPLARRH R++L     S +  PSW
Sbjct  15   TARACDSCVRKRARWYCAADDAFLCQSCDTTVHSANPLARRHQRLRLNASNSSPLNSPSW  74

Query  490  HRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKED  669
              GFTRK                     +D++    H+S+VP     +D+  SH++E  +
Sbjct  75   VSGFTRK-----------PRTPRPRPKSNDLI----HVSVVPE----TDDATSHENEHLE  115

Query  670  QLLLYRVPIFDPVVADI  720
              LLYRVP  D  V+D 
Sbjct  116  DQLLYRVPNLDVNVSDF  132



>ref|NP_001149548.1| CCT motif family protein [Zea mays]
 gb|ACG35795.1| CCT motif family protein [Zea mays]
 gb|AFW67846.1| CCT motif family protein [Zea mays]
 gb|AIB05334.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=413

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 125/236 (53%), Gaps = 33/236 (14%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
            AR+CD C+ +RARW+C ADDAFLCQ CD SVHSANPLARRH RV+L + S   P      
Sbjct  17   ARSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRVRLPSASCSSPPRDPDA  76

Query  481  PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL--HLSIVPVPEMCSDENYS--  648
            P+W  G  R+PRTPR   G   +N       H+   + +    S   VP++ ++E+ S  
Sbjct  77   PTWLHGLKRRPRTPRSKPGGSKSNK------HEATPSFIAAAASSAAVPDLEAEESGSGI  130

Query  649  ---HDD-----EKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghg  804
               +DD     + +D+ LLYRVP+FDP++A+    +        A +      A      
Sbjct  131  LGGNDDHHGFLQDDDEDLLYRVPVFDPMLAEFYNPVADEGEQKPACSLLMPSLAETSPEF  190

Query  805  hhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
                  G +    +  +    +MELA FAAD+ESLL  G+DD+    FD   LGFL
Sbjct  191  ASG---GSAEADGLSVSFHVPDMELASFAADMESLL-MGVDDD---GFDC--LGFL  237


 Score =   114 bits (284),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 77/127 (61%), Gaps = 19/127 (15%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAW-SDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAY  1425
             R +  ++L L+YE VI +W  D   PW  G+RP ++ H  W D       GS  +   A 
Sbjct  263   RKRPEMILKLNYEGVIASWVRDGGSPWFHGERPHLDCHELWSDDFTT---GSRELLGGAV  319

Query  1426  DGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  1605
               V     T G+          REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKG
Sbjct  320   TPV-----TGGE----------REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKG  364

Query  1606  RFVKRAN  1626
             RFVKRA 
Sbjct  365   RFVKRAT  371



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 102/171 (60%), Gaps = 24/171 (14%)
 Frame = +1

Query  289  GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS  468
            GA+ GK    ARACD C+ +RARW+CAADDAFLC ACD+ VHSAN LA RH RV+L+T S
Sbjct  8    GALGGK---TARACDSCVSRRARWFCAADDAFLCHACDTLVHSANQLASRHERVRLQTAS  64

Query  469  NIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL---HLSIVP-VPE  624
            +        +WH GFTRK RTPRH       NNSK       +K  +   + S++P VPE
Sbjct  65   SKATTTTTHAWHSGFTRKARTPRH-------NNSKHFALQQRLKDEVLFNNTSVLPLVPE  117

Query  625  MCSDEN---YSHDDEKEDQLLLYRVPIFDP--VVADICTTLNITDYDAAAA  762
            +  +E       +DE E+Q+L  RVP+FDP  V  D   + +  D+   AA
Sbjct  118  LGGEEQEPVVVDNDETEEQMLC-RVPVFDPFDVRTDDLDSFSDMDFSEFAA  167


 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 76/126 (60%), Gaps = 21/126 (17%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQ-RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
             K  I L L+Y+ VI AWS Q   PW T   P+ NS + +            ++  +  DG
Sbjct  256   KRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDF------------SLGLSGVDG  303

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
              G         ++   +  GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRF
Sbjct  304   EG--------RSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  355

Query  1612  VKRANF  1629
             VKR  F
Sbjct  356   VKRTCF  361



>ref|XP_010926126.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 125/237 (53%), Gaps = 40/237 (17%)
 Frame = +1

Query  289  GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS  468
            GA+ GK    A ACD C+ +RARWYCAADDAFLC ACD+SVHSAN LA RH R++L+T S
Sbjct  12   GALGGK---TAHACDGCLRRRARWYCAADDAFLCMACDASVHSANTLALRHHRLRLQTSS  68

Query  469  NIEP---------PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVP  621
            +  P         P W  GF R+ RTPR           KP         PL      VP
Sbjct  69   SSPPLSSNFDDALPPWLHGFKRRARTPR----------VKPSPAGPPKLEPL------VP  112

Query  622  EMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAggggh  801
            ++ +DE    ++E     LL+RVPIFDPV+A+  +   I D D      +++K       
Sbjct  113  DLEADEKLYAEEEH----LLHRVPIFDPVLAEFFSPPAINDADTLT---DEAKPVAQLPE  165

Query  802  ghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
              H      ++           +++L EFAA+VE+LLG+GLDD    +F ++ LG +
Sbjct  166  HAHVP--APAAAAGSLAGFQPSDLDLDEFAANVETLLGRGLDD---GTFCIDALGLI  217


 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 76/122 (62%), Gaps = 16/122 (13%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRC-PWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV--  1434
             ++L LDYEAVI AWS   C PW  G+RP+ N      D +M    G        +     
Sbjct  299   MMLRLDYEAVIAAWSCNGCSPWTDGERPQFNLD----DFMMMMWSGGSVREGGGWKVAPV  354

Query  1435  -GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
              G++G+  G          GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF
Sbjct  355   YGEVGMAAGNG--------GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  406

Query  1612  VK  1617
             VK
Sbjct  407   VK  408



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 102/171 (60%), Gaps = 24/171 (14%)
 Frame = +1

Query  289  GAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS  468
            GA+ GK    ARACD C+ +RARW+CAADDAFLC ACD+ VHSAN LA RH RV+L+T S
Sbjct  8    GALGGK---TARACDSCVSRRARWFCAADDAFLCHACDTLVHSANQLASRHERVRLQTAS  64

Query  469  NIEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPL---HLSIVP-VPE  624
            +        +WH GFTRK RTPRH       NNSK       +K  +   + S++P VPE
Sbjct  65   SKATTTTTHAWHSGFTRKARTPRH-------NNSKHFALQQRLKHEVLFNNTSVLPLVPE  117

Query  625  MCSDEN---YSHDDEKEDQLLLYRVPIFDP--VVADICTTLNITDYDAAAA  762
            +  +E       +DE E+Q+L  RVP+FDP  V  D   + +  D+   AA
Sbjct  118  LGGEEQEPVVVDNDETEEQMLC-RVPVFDPFDVRTDDLDSFSDMDFSEFAA  167


 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 76/126 (60%), Gaps = 21/126 (17%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQ-RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
             K  I L L+Y+ VI AWS Q   PW T   P+ NS + +            ++  +  DG
Sbjct  256   KRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDF------------SLGLSGVDG  303

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
              G         ++   +  GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRF
Sbjct  304   EG--------RSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  355

Query  1612  VKRANF  1629
             VKR  F
Sbjct  356   VKRTCF  361



>emb|CDY36106.1| BnaA08g19420D [Brassica napus]
Length=384

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 114/220 (52%), Gaps = 40/220 (18%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLK--TLSNIEPPSW  489
             AR CD C+ K+A W+CAAD+AFLCQ+CD+SVHSAN LARRH RV+LK  T    E P+W
Sbjct  12   TARTCDNCLKKQAHWFCAADEAFLCQSCDTSVHSANLLARRHERVRLKDSTSPQQEAPTW  71

Query  490  HRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKED  669
            + GFTRKPRTPR   G+ NN+++      D+           VPE+ S E  +   E E 
Sbjct  72   YHGFTRKPRTPR-GSGKRNNSST----FQDM-----------VPEI-SAEGQTDSSEVEG  114

Query  670  QLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSStttmp  849
             L+  +VP+  P V +                F   +          ++ D      +  
Sbjct  115  PLIC-QVPVLGPTVVE------------PKIKFPTMRSGVMIDGHEDEDKD-----ESCL  156

Query  850  ptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGF  969
                   ME+ +FAADVE+LLG GLD E   S+ +E LG 
Sbjct  157  NGIFPTNMEVEDFAADVETLLGHGLDKE---SYTLEELGL  193



>ref|XP_008801158.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=381

 Score =   122 bits (306),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 126/239 (53%), Gaps = 46/239 (19%)
 Frame = +1

Query  271  KIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARV  450
            K + A  A+ GK    ARACD C+ +RARWYCAADD FLCQ+CDSSVHSANP+ARRH R 
Sbjct  16   KQQSAASAIAGKM---ARACDGCVRRRARWYCAADDVFLCQSCDSSVHSANPVARRHQRD  72

Query  451  QLKTLSNIEPPSWHRGFT-------------RKPRTPRHAHGRYNNNNSKPVVHHDVVKT  591
            +LK  +     S++  F              RK RTPR          +KP         
Sbjct  73   RLKPAT-----SYYSSFMEAKTEELILGWLKRKARTPRP------RQQTKPA-------Q  114

Query  592  PLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFN  771
            PL   ++   E  +D N S     E++ LLY VP+FDP++A++C+  ++ D +++     
Sbjct  115  PLAPDLL---ESSTDGNCS-----EEEQLLYCVPVFDPMLAELCSPPSLNDSNSSG---E  163

Query  772  QSKCAgggghghhKNWDGK-SStttmpptttememeLAEFAADVESLLGKGLDDEEESS  945
             +K A      +   +     +T +        + ELAEFA  +ESLLG+GLD+ + SS
Sbjct  164  DTKLAVAQLPDNAITYISPVDATGSGTVGFVPSDDELAEFATKMESLLGRGLDNSKNSS  222


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 74/123 (60%), Gaps = 26/123 (21%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHH-GWPDCIMQRGCGSGTIHAAAYDGVGD  1440
             + L LDYEA++ AWS    PW  G+RP+ N +   WP                     GD
Sbjct  270   VALRLDYEAIMEAWSSS--PWTNGERPQFNLNVCRWP---------------------GD  306

Query  1441  MG--ITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             MG  +  G          GREA+V+RYREKRRTR+F+KKIRYEVR+LNAE+RPRMKGRFV
Sbjct  307   MGMWVGEGGEEDKGGGRQGREAKVTRYREKRRTRMFAKKIRYEVRRLNAEQRPRMKGRFV  366

Query  1615  KRA  1623
             KRA
Sbjct  367   KRA  369



>emb|CDY51133.1| BnaA07g37160D [Brassica napus]
Length=377

 Score =   122 bits (306),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 93/245 (38%), Positives = 127/245 (52%), Gaps = 45/245 (18%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN--------  471
             ARACD C+ +RARWYCAADDAFLCQ+CD+ VHSAN LARRH RV LK+ S         
Sbjct  12   TARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSASKHSNHNHNH  71

Query  472  --IEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCS  633
                PP    +WH GFTRKPRTPR   G+ NN +    + HD+           VPE+ S
Sbjct  72   SPSSPPHEAATWHHGFTRKPRTPR-GSGKKNNLS----IFHDL-----------VPEI-S  114

Query  634  DENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhK  813
             E+ +   E E+QL+  +VP+ DP VA+      + D   A   F   +           
Sbjct  115  VEDQTESCELEEQLIC-QVPVLDPTVAEQI----LNDVVEAKIEFPIMRSG-----VMMD  164

Query  814  NWDGKSStttmpptttememeLAEFAADVESLLGKGL---DDEEESSFDME-GLGFLGGN  981
            + + + +  +        +MEL E+AADVE+LL   +   DD+ +++   E    +   N
Sbjct  165  DQEDEDNAESCLNGFFPTDMELEEYAADVETLLDMNIGICDDDRDATAPFELSFDYESHN  224

Query  982  NVEEE  996
              EEE
Sbjct  225  TYEEE  229


 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 94/163 (58%), Gaps = 16/163 (10%)
 Frame = +1

Query  1165  LELKFDYD--NDYYS---PNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWI  1329
              EL FDY+  N Y      N E   E  ++ +   K+ ++L L+Y++VI  W  Q  PW 
Sbjct  214   FELSFDYESHNTYEEEVIKNIEGSGECVKVKEEEQKNVLMLRLNYDSVISTWGGQGPPWT  273

Query  1330  TGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARV  1506
             +G+ PE +     WP   M      G +  +       +G+    +   D    GREARV
Sbjct  274   SGEPPERDIDISSWPFVSM-----GGNVRESQQKH--HVGVCLPSSGFGDG---GREARV  323

Query  1507  SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFPL  1635
             SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+  +
Sbjct  324   SRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASLAV  366



>ref|XP_006649016.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=331

 Score =   121 bits (304),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 113/348 (32%), Positives = 149/348 (43%), Gaps = 74/348 (21%)
 Frame = +1

Query  676   LLYRVPIFDPVVADICTTLNITDYDAAAAA-FNQ-SKCAgggghghhKNWDGKSStttmp  849
             LLYRVP+FDP + + C+  +I D  AA+++ F + +  A                     
Sbjct  26    LLYRVPVFDPALVEFCSPPSIDDAAAASSSCFKEHADGAVEDTKYPAAAPSPVQQLPDSF  85

Query  850   ptttememeLAEFAADVESLLGKGLD--DEEESSFDMEGLGFLGGNNVEEEKASTMMEFS  1023
                   + EL EFAAD+E+LLG+GLD  +E + SF ME LG +    VEE+    M    
Sbjct  86    VNFEPTDAELREFAADMEALLGQGLDVSNELQDSFYMETLGLI--TPVEEDGRVKM----  139

Query  1024  RRHekvvvkveeedapapaceaadddIFMAANANHHYTSSSSLCFDTLELKFD------Y  1185
                          +    A  + D  +             S+   D L++ F+       
Sbjct  140   -------------EPDGVASISRDVSLPPCRPHPPKPEEESA---DVLDIDFNCTSPTVG  183

Query  1186  DNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHG  1365
             D+D  S                 + ++ L L+YE +I +W     PW  G+RP     HG
Sbjct  184   DDDDGSDQKSSASNVAAADAKFFQKSLDLRLNYEEIIESWGS--SPWTDGRRP-----HG  236

Query  1366  ------WPD-----------CIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGR  1494
                   WP+                     T+     DG G                  R
Sbjct  237   HQLDDFWPNDHHYQGLWAAGGGGHGAEAGTTVMRPRMDGPG------------------R  278

Query  1495  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFPLL  1638
             EARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR    LL
Sbjct  279   EARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPAETLL  326



>ref|XP_003559520.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brachypodium 
distachyon]
Length=423

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 78/126 (62%), Gaps = 18/126 (14%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWS-DQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGD  1440
             ++L LDYE VI +W+ D   PW  G+RP ++S   W D     G G G        G   
Sbjct  292   MILKLDYEGVISSWTHDGASPWFYGERPHLDSSDSWLDFPAGSGRGFGL-------GAAV  344

Query  1441  MGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
               +T G+          REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  345   TAVTGGE----------REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  394

Query  1621  ANFPLL  1638
             A  P L
Sbjct  395   AALPPL  400


 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 88/253 (35%), Positives = 122/253 (48%), Gaps = 54/253 (21%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL-------------K  459
            ARACD C+ +RARW+CAADDA+LCQACD+SVHSANPLARRH RV+L              
Sbjct  13   ARACDGCMRRRARWHCAADDAYLCQACDASVHSANPLARRHHRVRLSSSASSSSSPAAAS  72

Query  460  TLSNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE  639
              ++ + P+W  G  R+PRTPR   G  N +  +    HD + T   ++           
Sbjct  73   QQADPDAPAWLHGLKRRPRTPRRKPGGINGSKQQ---QHDALGTKAAVA-----ASAPVP  124

Query  640  NYSHDDEKEDQLLL----------------YRVPIFDPVVADICTTLNITDYDAAAAAFN  771
            +   +DE    +++                YRVP+FDP++A++ +   + D D    A  
Sbjct  125  DLEAEDESLSGIIMGAGNEVDQVDEDDDLLYRVPVFDPMLAELYSH-TMPDDD---QALE  180

Query  772  QSKC--AgggghghhKNWDGKSStttmppttte----memeLAEFAADVESLLGKGLDDE  933
            Q  C             + G S         +      +MELA FAAD+ESLL  G+D  
Sbjct  181  QKPCFAPLLATDPSSDQYGGVSGLADGTDGFSGFDLVPDMELASFAADMESLL-MGVD--  237

Query  934  EESSFDMEGLGFL  972
              S +D   LGFL
Sbjct  238  --SGYD--DLGFL  246



>ref|NP_001239992.1| uncharacterized protein LOC100802113 [Glycine max]
 gb|ACU23240.1| unknown [Glycine max]
Length=350

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 78/127 (61%), Gaps = 14/127 (11%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEM-NSHHGWPDCIMQRGCGSGTIHAAAYD  1428
              K  I L L+YE VI AW+ Q  PW  G  P+  NS   W D +   G   G +    Y 
Sbjct  229   TKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLDFL---GSNGGNVQCC-YG  284

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
              VG + +       AD    GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGR
Sbjct  285   AVGSLRVH------ADG---GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGR  335

Query  1609  FVKRANF  1629
             FVKR  F
Sbjct  336   FVKRTPF  342



>emb|CDX77359.1| BnaC08g04040D [Brassica napus]
Length=160

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 79/129 (61%), Gaps = 16/129 (12%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYD  1428
              K+ ++L L+Y++VI  W  Q  PW +G+ PE +     WP   M++   +       ++
Sbjct  36    KKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMRKSAEASRWWMFTFE  95

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
              V D G               REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  96    WVWDGG---------------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  140

Query  1609  FVKRANFPL  1635
             FVKRA+  +
Sbjct  141   FVKRASLAV  149



>gb|ADK63396.1| B-box type zinc finger protein [Brassica rapa]
Length=265

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 82/129 (64%), Gaps = 15/129 (12%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPE--MNSHHGWPDCIMQRGCGSGTIHAAA  1422
             +N+   +L LDYE+VI  W  Q  PW   + P+  +N      D +++ G   G  H   
Sbjct  146   KNEKVHMLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESG---GEAHHHN  202

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             Y  V  +G+  G+A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK
Sbjct  203   Y--VRGLGLHMGEA--------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  252

Query  1603  GRFVKRANF  1629
             GRFVKR++ 
Sbjct  253   GRFVKRSSI  261



>ref|XP_010907326.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=367

 Score =   119 bits (298),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 123/232 (53%), Gaps = 35/232 (15%)
 Frame = +1

Query  277  EGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL  456
            + A  A+ GK     RACD C+ ++ARWYC+ADD FLCQ CDSSVHS NP+ARRH R++L
Sbjct  18   QSAASAIAGKM---TRACDGCVRRQARWYCSADDVFLCQICDSSVHSPNPVARRHQRLRL  74

Query  457  K------TLSNIEPPSWHRGF---TRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSI  609
            K      + S++E  +    F    RK RTPR       +  +KP         PL    
Sbjct  75   KPATSSYSSSDVEAKTEELIFGWLKRKARTPRP------HQQAKPA-------QPL----  117

Query  610  VPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAg  789
              VP++   EN    +  E++ LLY VP+FDP+ A++C+   + D++++    +    A 
Sbjct  118  --VPDLL--ENSPDGNCSEEEQLLYCVPVFDPMPAELCSPPCLNDWNSSDE--DPKLVAA  171

Query  790  ggghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESS  945
                          +T +        + ELAEFAA++ESLLGKGLD+ E  S
Sbjct  172  QLPDNAITYTSPVDATGSRLVGFVPSDDELAEFAANMESLLGKGLDNSENPS  223


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 77/139 (55%), Gaps = 32/139 (23%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHH-GWPDCIMQRGCGSGTIHAAAYD  1428
             ++  + L LDYEA++ AWS    PW  G RP+ N     WPD  M  G G         +
Sbjct  252   SRKKVALRLDYEAIMAAWSSS--PWTNGARPQFNLDVCSWPDMGMWAGEGGEDKGGGRQE  309

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
                                  RE++V+RYREKRRTRLF+KKIRYEVR+LNAEKRPRMKGR
Sbjct  310   ---------------------RESKVTRYREKRRTRLFAKKIRYEVRRLNAEKRPRMKGR  348

Query  1609  FVKRANF--------PLLD  1641
             FVKRA+         P+LD
Sbjct  349   FVKRASMAPTPAFAGPVLD  367



>gb|EEE59794.1| hypothetical protein OsJ_12314 [Oryza sativa Japonica Group]
Length=201

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 76/125 (61%), Gaps = 20/125 (16%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWS-DQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAY  1425
             R +  ++L LDYE VI +W+ D   PW  G+RP  +    WPD             A + 
Sbjct  21    RKRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPD-----------FPAGSR  69

Query  1426  DGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  1605
              G+G        AA+       REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKG
Sbjct  70    GGLG--------AAVTAVTGGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKG  121

Query  1606  RFVKR  1620
             RFVKR
Sbjct  122   RFVKR  126



>gb|ACF84125.1| unknown [Zea mays]
Length=226

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 115/253 (45%), Gaps = 48/253 (19%)
 Frame = +1

Query  898   VESLLGKGLDD--EEESSFDMEGLGFLGGNNVEEEKASTMMEFSRRHekvvvkveeedap  1071
             +E+LLG GLDD  EE+SSF ME LG L    V ++     +E                  
Sbjct  1     MEALLGHGLDDGNEEDSSFYMETLGLLDPMEVGDDATQVKVETDGSSA------------  48

Query  1072  apaceaadddIFMAANANHHYTSSSSLCFDTLELKFDYDNDYYSPNNekeeegeellkMR  1251
                             A+        L  +  +   D D DY SP +   +E        
Sbjct  49    -------------CCEASGTLACGLELDLEASDEMLDIDFDYASPQDTATDERAASSDTG  95

Query  1252  N-----KSTILLNLDYEAVILAWSDQRCPWITG-QRPEMNSHHGWPDCIMQRGCGSGTIH  1413
                   ++++ L L+YEA+I +W     PW  G +RP +     WP          G + 
Sbjct  96    ADAQFLQTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMWVVGGVVG  153

Query  1414  AAAYD--GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  1587
                 D  G   +G+  G           REARVSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  154   HGGEDLPGTPRLGMDGG-----------REARVSRYREKRRTRLFSKKIRYEVRKLNAEK  202

Query  1588  RPRMKGRFVKRAN  1626
             RPRMKGRFVKRA 
Sbjct  203   RPRMKGRFVKRAT  215



>emb|CDY53119.1| BnaCnng24470D [Brassica napus]
Length=376

 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 121/236 (51%), Gaps = 50/236 (21%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSN---------  471
            ARACD C+ +RARWYCAADDAFLCQ+CD+ VHSAN LARRH RV LK+ S          
Sbjct  13   ARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSASKHSNHNHNHS  72

Query  472  -IEPP----SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD  636
               PP    +WH G +RKPRTPR   G+ NN +    + HD+           VPE+ S 
Sbjct  73   PSSPPHEAATWHHGVSRKPRTPR-GSGKKNNLS----IFHDL-----------VPEI-SV  115

Query  637  ENYSHDDEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKN  816
            E+ +   E E+QL+  +VP+ DP VA+         +D A A         G      ++
Sbjct  116  EDQTESCELEEQLIC-QVPVLDPTVAEQLL------HDVAEAKIEFPIMRSGVMMDDQED  168

Query  817  WDGKSStttmpptttememeLAEFAADVESLLGKGL---DDEE------ESSFDME  957
             D   S           +MEL E+AADVESLL   +   DD+       E SFD E
Sbjct  169  EDNAES---CLNGFFPTDMELEEYAADVESLLDMNIGICDDDRDATAPFELSFDYE  221


 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 92/160 (58%), Gaps = 15/160 (9%)
 Frame = +1

Query  1165  LELKFDYD--NDYYS--PNNekeeegeellkMRNKSTILLNLDYEAVILAWSDQRCPWIT  1332
              EL FDY+  N Y     N E   E  ++ +   K+ ++L L+Y++VI  W  Q  PW +
Sbjct  214   FELSFDYESHNTYEEVIKNIEGSGECVKVKEEEKKNVLMLRLNYDSVISTWGGQGPPWTS  273

Query  1333  GQRPEMNSH-HGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVS  1509
             G+ PE +     WP   M      G +  +       +G     +   D    GREARVS
Sbjct  274   GEPPERDIDISSWPFVSM-----GGNVRESQQKH--HVGGCLPSSGFGDG---GREARVS  323

Query  1510  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA+ 
Sbjct  324   RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  363



>gb|AIE41597.1| zinc finger protein CONSTANS-LIKE 6 [Lagerstroemia indica]
Length=376

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 86/158 (54%), Gaps = 33/158 (21%)
 Frame = +1

Query  283  AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
            A   + GK    ARACD C+ KRARW+C  DDAFLCQ+CD SVHSAN LA RH RV+L+T
Sbjct  11   ASNVLGGK---TARACDNCLVKRARWFCPGDDAFLCQSCDHSVHSANLLASRHKRVRLET  67

Query  463  LSN------------IEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLS  606
             S+              PPSWH GFTRK RTPR           +     D  + PL   
Sbjct  68   SSSSFKKEILIDNSTTSPPSWHHGFTRKARTPRPW---------RRTPQLDRHQLPL---  115

Query  607  IVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDPVVADI  720
               VPE+ S++ +    E+ D+ L  RVP+FDP   D 
Sbjct  116  ---VPEINSEDPFM---EESDEQLFCRVPVFDPFCTDF  147


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 76/124 (61%), Gaps = 20/124 (16%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K  +LL L+YEAVI +W+ Q  PW  G RP+ N       C+            + Y+  
Sbjct  259   KKRMLLRLNYEAVIASWATQGSPWTDGIRPQFNLDEFMVACL----------GGSCYELG  308

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             G       +A I      GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV
Sbjct  309   G-----LSRAKIG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  358

Query  1615  KRAN  1626
             KR+ 
Sbjct  359   KRST  362



>gb|AGI62036.1| CONSTANS-like 12 [Erycina pusilla]
Length=339

 Score =   117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 78/120 (65%), Gaps = 14/120 (12%)
 Frame = +1

Query  1270  LNLDYEAVILAWS-DQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMG  1446
             L+LDYEAV  AW      PW+TG+RP M     W +C+ + G   G      + G G   
Sbjct  229   LSLDYEAVKEAWMVTGSSPWMTGERPRMGVEDYWHECLGKFGETGGE-----FIGSGTGI  283

Query  1447  ITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             I F        + +GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR +
Sbjct  284   IQF--------MDLGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTD  335


 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 78/137 (57%), Gaps = 32/137 (23%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQ----LKTLSNIEPP  483
             ARACD CI +RARW+CAADDAFLC  CDS +HSAN LA RH R++      T  ++  P
Sbjct  22   TARACDGCIRRRARWFCAADDAFLCDPCDSHIHSANQLAGRHHRLRLKSSSSTTLSVATP  81

Query  484  SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEK  663
            SWH GFTRKPRTPR  H        KP+V                     D   S ++E+
Sbjct  82   SWHHGFTRKPRTPRSHH--------KPLV--------------------PDLESSVEEEE  113

Query  664  EDQLLLYRVPIFDPVVA  714
            E + LLYRVP+FDP  A
Sbjct  114  EGEQLLYRVPVFDPPSA  130



>ref|NP_001051053.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|AAX95654.1| CCT motif, putative [Oryza sativa Japonica Group]
 gb|ABF98509.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12967.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|EAY91607.1| hypothetical protein OsI_13241 [Oryza sativa Indica Group]
 dbj|BAH00071.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 87/153 (57%), Gaps = 22/153 (14%)
 Frame = +1

Query  1165  LELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWS-DQRCPWITGQR  1341
             ++L  D D D+ S +     E EE    R +  ++L LDYE VI +W+ D   PW  G+R
Sbjct  249   VKLDLDMDMDFASISPAPAPEREERK--RKRPEMILKLDYEGVIDSWARDGASPWFHGER  306

Query  1342  PEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYRE  1521
             P  +    WPD       G G    A         +T G+          REARVSRYRE
Sbjct  307   PRFDPSESWPDFPAGSRGGLGAAVTA---------VTGGE----------REARVSRYRE  347

Query  1522  KRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             KRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  348   KRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  380


 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 121/243 (50%), Gaps = 42/243 (17%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL-----------  465
            ARACD C+ +RARW+C ADDAFLCQACD+SVHSANPLARRH RV+L +            
Sbjct  17   ARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPRSA  76

Query  466  -------SNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
                    + + P+W  G  R+PRTPR   G           H     T    +   VP+
Sbjct  77   AAPRAGSDDPDAPAWLHGLKRRPRTPRTKPGGGGK-------HDASAATVAAAAASAVPD  129

Query  625  MCSDE-----NYSHD-DEKEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCA  786
            + ++E     +  HD  E++D+ LLYRVP+FDP++A++   +   D +       Q   A
Sbjct  130  LEAEESGIVGDTDHDVGEEDDEDLLYRVPVFDPMLAELYNPVAADDEE---QQIEQKPAA  186

Query  787  gggg-hghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGL  963
                       +   S            +MELA FAAD+ESLL  G+D+     FD   L
Sbjct  187  RVVPFSEPSPEFASGSVEADGLSGFDVPDMELASFAADMESLL-MGVDE----GFD--DL  239

Query  964  GFL  972
            GFL
Sbjct  240  GFL  242



>gb|ABF98510.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=345

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 88/153 (58%), Gaps = 22/153 (14%)
 Frame = +1

Query  1165  LELKFDYDNDYYSPNNekeeegeellkMRNKSTILLNLDYEAVILAWS-DQRCPWITGQR  1341
             ++L  D D D+ S +     E EE    R +  ++L LDYE VI +W+ D   PW  G+R
Sbjct  173   VKLDLDMDMDFASISPAPAPEREERK--RKRPEMILKLDYEGVIDSWARDGASPWFHGER  230

Query  1342  PEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYRE  1521
             P  +    WPD             A +  G+G        AA+       REARVSRYRE
Sbjct  231   PRFDPSESWPD-----------FPAGSRGGLG--------AAVTAVTGGEREARVSRYRE  271

Query  1522  KRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             KRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  272   KRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  304


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 83/152 (55%), Gaps = 31/152 (20%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTL-----------  465
            ARACD C+ +RARW+C ADDAFLCQACD+SVHSANPLARRH RV+L +            
Sbjct  17   ARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPRSA  76

Query  466  -------SNIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
                    + + P+W  G  R+PRTPR   G           H     T    +   VP+
Sbjct  77   AAPRAGSDDPDAPAWLHGLKRRPRTPRTKPGGGGK-------HDASAATVAAAAASAVPD  129

Query  625  MCSDE-----NYSHD-DEKEDQLLLYRVPIFD  702
            + ++E     +  HD  E++D+ LLYRVP FD
Sbjct  130  LEAEESGIVGDTDHDVGEEDDEDLLYRVPGFD  161



>ref|XP_002466587.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
 gb|EER93585.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
Length=420

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 119/242 (49%), Gaps = 39/242 (16%)
 Frame = +1

Query  322  RACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------P  483
            R+CD C+ +RARW+C ADDAFLCQ CD SVHSANPLARRH RV+L + S   P      P
Sbjct  19   RSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRVRLPSASCSSPPCDPDAP  78

Query  484  SWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYS-----  648
            +W  G  R+PRTPR   G   +  + P        +    +   VP++ ++E+ S     
Sbjct  79   TWLHGLKRRPRTPRSKPGGGKHEATTP-------NSMAAAASAAVPDLEAEESGSGIVGD  131

Query  649  HDDE----KEDQLLLYRVPIFDPVVADICTTLNITDYDAAAAAF---------NQSKCAg  789
            +DD      +D+ LLYRVP+FDP++A+    +         A F          +  C  
Sbjct  132  NDDHGFLVDDDEDLLYRVPVFDPMLAEFYNPVADEGEQKPLAEFYNLVADEGEQKPACLM  191

Query  790  ggghghhKNW-DGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLG  966
                     +  G  +           +MELA FAAD+ESLL  G+ D     FD   LG
Sbjct  192  PPLVETSPEFASGGLAEADGLSGFDVPDMELASFAADMESLL-MGVHD----GFD--DLG  244

Query  967  FL  972
            FL
Sbjct  245  FL  246


 Score =   110 bits (276),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 77/128 (60%), Gaps = 22/128 (17%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAW-SDQRCPWITGQRPEMNSHHGWPDCIM-QRGCGSGTIHAAA  1422
             R +  ++L L+Y+ VI +W  D   PW  G+RP ++ +  W D     RG   G + A  
Sbjct  274   RKRPEMILKLNYDGVIASWVRDGGSPWFHGERPHLDPYELWSDFPAGSRGLLGGAVTA--  331

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
                     +T G+          REARVSRYREKRRTRLF+KKIRYEVRK+NAEKRPRMK
Sbjct  332   --------VTGGE----------REARVSRYREKRRTRLFAKKIRYEVRKVNAEKRPRMK  373

Query  1603  GRFVKRAN  1626
             GRFVKR  
Sbjct  374   GRFVKRTT  381



>ref|XP_008453390.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis melo]
Length=368

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 108/212 (51%), Gaps = 57/212 (27%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS------NIEP  480
            AR CD C+ KRARW+CAADDAFLCQ+CD SVHSAN LARRH R++L+T S      ++ P
Sbjct  21   ARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSSFNSTTDHLPP  80

Query  481  PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHD--  654
              W +GFTRK RTPR      +NNN        V       SIVP     ++  +S D  
Sbjct  81   TPWLKGFTRKARTPR------SNNNKISSSKASV------FSIVPEIGNDNELGFSIDEN  128

Query  655  DEKEDQLLLYR--VPIFDPVVAD--ICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
            D++  Q L ++  VP+FDP+  D  +  T  + D+      F  S+              
Sbjct  129  DDEHHQFLGHQQEVPVFDPLFDDQKLLLTHELEDF---GDGFLPSEV-------------  172

Query  823  GKSStttmpptttememeLAEFAADVESLLGK  918
                             +LAEF ADVE+LLGK
Sbjct  173  -----------------DLAEFVADVENLLGK  187


 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 84/137 (61%), Gaps = 29/137 (21%)
 Frame = +1

Query  1246  MRNKSTIL-LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRG--CGSGTIHA  1416
             ++NK  I+ L L+Y+AVI AW  Q  P+ TG RP+ +      DC+ +    C  G  + 
Sbjct  247   IKNKKNIISLRLNYDAVITAWDAQSSPYTTGNRPQFD----LDDCLEEWSGICSKGGRNV  302

Query  1417  AA--------YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRK  1572
             A         Y+G+    I+ G+          REARVSRYREKRRTRLFSKKIRY+VRK
Sbjct  303   AVDDQEWRRNYNGI----ISNGE----------REARVSRYREKRRTRLFSKKIRYQVRK  348

Query  1573  LNAEKRPRMKGRFVKRA  1623
             LNAEKRPRMKGRFVKR 
Sbjct  349   LNAEKRPRMKGRFVKRT  365



>ref|XP_010471465.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Camelina sativa]
Length=402

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 84/135 (62%), Gaps = 14/135 (10%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA-AAYD-  1428
             K+++ L LDYEAVI AW +   PW TG +PE N      DC +  G  +   H    +D 
Sbjct  275   KASLFLRLDYEAVISAWDNHGSPWETGIKPEFNL-----DCCLLGGNNTCPSHVMGGFDE  329

Query  1429  ---GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
                 VG +    G+     DV   REARV RYR+KRRTRLF+KKIRYEVRKLNAE+RPR+
Sbjct  330   LESAVGSVTRQQGRDGGGSDVE--REARVLRYRDKRRTRLFAKKIRYEVRKLNAEQRPRI  387

Query  1600  KGRFVKRA--NFPLL  1638
             KGRFVKR   NF +L
Sbjct  388   KGRFVKRTSLNFDVL  402


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 85/161 (53%), Gaps = 28/161 (17%)
 Frame = +1

Query  268  IKIEGAEGAMEGKHKAAARACDYCIGK--RARWYCAADDAFLCQACDSSVHSANPLARRH  441
            +++E     + G  K AAR CD C+ +  RA W+C ADDAFLCQ+CD+S+HSAN LA+RH
Sbjct  3    VEVESRAAGVTG-GKTAARGCDVCMKRSSRASWFCPADDAFLCQSCDASIHSANSLAKRH  61

Query  442  ARVQLKTLSNIE-----------PPSWHRGFTRKPRTPRHAHGRYN--NNNSKPVVHHDV  582
             RV+L++ S+ E              W+ GF RK RTPR    +    NN++ P+V    
Sbjct  62   ERVRLQSPSSPELLMKTKATDKTTSVWYEGFRRKARTPRSKLLQIQDVNNSNDPLV----  117

Query  583  VKTPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDP  705
               P               ++S  DE E+ L    VP+FDP
Sbjct  118  ---PELGVEEEEGVF----SFSSTDENEESLNCC-VPVFDP  150



>ref|XP_004164163.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=375

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 6/75 (8%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS------NIEP  480
            ARACD CI KRARWYCAADDAFLCQACD+SVHSAN LARRH RV+L+T S      N   
Sbjct  17   ARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERVRLQTASFRPSSDNSSA  76

Query  481  PSWHRGFTRKPRTPR  525
             SWH+GFT+KPR+PR
Sbjct  77   ASWHQGFTKKPRSPR  91


 Score =   114 bits (284),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 15/122 (12%)
 Frame = +1

Query  1300  AWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA-AAYDGVGDMGITFGQAAIAD  1476
             AW  +  PW +G RP ++  + WPD +       GT  +   Y   G+ G   G+ A+  
Sbjct  262   AWGSRGTPWTSGDRPNLDLDYYWPDYM-------GTYESDCYYQPYGEFGSGIGRQAVTG  314

Query  1477  DVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN------FPLL  1638
              V   REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR++       PL 
Sbjct  315   -VEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSSCFAPPPLPLF  373

Query  1639  DQ  1644
             +Q
Sbjct  374   NQ  375



>ref|XP_006302335.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
 gb|EOA35233.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
Length=407

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 79/128 (62%), Gaps = 5/128 (4%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K+++ L LDYEAVI AW +   PW T  +PE N      DC+++       +     +  
Sbjct  284   KTSLFLRLDYEAVISAWDNHGSPWKTEIKPEFN----LDDCLLEGNTYPSHVMGGFEEWT  339

Query  1435  GDMG-ITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
               +G +T  Q        V REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRF
Sbjct  340   SAVGSVTRRQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRF  399

Query  1612  VKRANFPL  1635
             VKR +  L
Sbjct  400   VKRTSLSL  407


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 84/153 (55%), Gaps = 38/153 (25%)
 Frame = +1

Query  310  KAAARACDYCIGK-RARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPP-  483
            K AAR CD C+ + RA WYC ADDAFLCQ+CD+S+HSAN LA+RH RV+L++ S+ E P 
Sbjct  16   KTAARGCDLCMKRSRASWYCPADDAFLCQSCDASIHSANSLAKRHERVRLQSSSSPELPM  75

Query  484  ----------SWHRGFTRKPRTPRHAHGR---YNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
                       W+ GF RK RTPR+   +    N N++ P+                VP+
Sbjct  76   KTKTAEKTTSVWYEGFRRKARTPRNKLFQIEDVNKNSNDPL----------------VPD  119

Query  625  MCSDE------NYSHDDEKEDQLLLYRVPIFDP  705
            +  +E      ++S  DE  D  L   VP+FDP
Sbjct  120  LGVEEEEDGVFSFSSTDEN-DASLSCCVPVFDP  151



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 83/135 (61%), Gaps = 14/135 (10%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K+++ L LDYEAVI AW +   PW TG +PE N       C++    G+ T  +    G 
Sbjct  276   KASLFLRLDYEAVISAWDNHGSPWETGIKPEFN----LDGCLLG---GNNTCPSHVMGGF  328

Query  1435  GDMG-----ITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
              ++      +T  Q        V REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+
Sbjct  329   EELASAVRSVTRQQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRI  388

Query  1600  KGRFVKRA--NFPLL  1638
             KGRFVKR   NF +L
Sbjct  389   KGRFVKRTSLNFDVL  403


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 87/159 (55%), Gaps = 23/159 (14%)
 Frame = +1

Query  268  IKIEGAEGAMEGKHKAAARACDYCIGK--RARWYCAADDAFLCQACDSSVHSANPLARRH  441
            +++E     + G  K AAR CD C+ +  RA WYC ADDAFLCQ+CD+S+HSAN LA+RH
Sbjct  3    VEVESRAAGVTGV-KTAARGCDVCMKRSSRASWYCPADDAFLCQSCDASIHSANNLAKRH  61

Query  442  ARVQLKTLSNIE-----------PPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVK  588
             RV+L++ S+ E              W+ GF RK RTPR    +  NN++ P+V      
Sbjct  62   ERVRLQSPSSPELLMKTKATDKTTSVWYEGFRRKARTPRSKQLQDVNNSNDPLVP-----  116

Query  589  TPLHLSIVPVPEMCSDENYSHDDEKEDQLLLYRVPIFDP  705
                L +    E     ++S  DE E+ L    VP+FDP
Sbjct  117  ---ELGVEEEEEEEGVFSFSSTDENEESLNCC-VPVFDP  151



>ref|XP_004138344.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=273

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 109/212 (51%), Gaps = 54/212 (25%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEP  480
             AR CD C+ KRARW+CAADDAFLCQ+CD SVHSAN LARRH R++L+T S     ++ P
Sbjct  6    TARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSSFNSTDHLPP  65

Query  481  PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHD--  654
              W +GFTRK RTPR  +     ++SK  V           SIVP     ++  +S D  
Sbjct  66   TPWLKGFTRKARTPRSNNNNNKISSSKASV----------FSIVPEIGNDNELGFSIDEN  115

Query  655  DEKEDQLLLYR--VPIFDPVVAD--ICTTLNITDYDAAAAAFNQSKCAgggghghhKNWD  822
            D++  Q L ++  VP+FDP+  D  +  T  + D+      F  S+              
Sbjct  116  DDEHHQFLGHQQEVPVFDPLFDDQKLLLTDELEDF---GDGFLPSEV-------------  159

Query  823  GKSStttmpptttememeLAEFAADVESLLGK  918
                             +LAEF ADVE+LLG+
Sbjct  160  -----------------DLAEFVADVENLLGR  174


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 56/86 (65%), Gaps = 14/86 (16%)
 Frame = +1

Query  1399  SGTIHAAAYDGVGDMGITFGQAAIADDV-WVGR----------EARVSRYREKRRTRLFS  1545
             +  I    + GV   G   G+  + DD  W GR          EARVSRYREKRRTRLFS
Sbjct  189   TNIIVKEEWSGVCSKG---GRNVVVDDQEWRGRNNNGISNEEREARVSRYREKRRTRLFS  245

Query  1546  KKIRYEVRKLNAEKRPRMKGRFVKRA  1623
             KKIRY+VRKLNAEKRPRMKGRFVKR 
Sbjct  246   KKIRYQVRKLNAEKRPRMKGRFVKRT  271



>ref|XP_010416209.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=401

 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 83/135 (61%), Gaps = 14/135 (10%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K+T+ L LDYEAVI AW +   PW TG +PE N       C++    G+ T  +    G 
Sbjct  274   KTTLFLRLDYEAVISAWDNHGSPWETGIKPEFN----LDGCLLG---GNNTCPSHVMGGF  326

Query  1435  GDMG-----ITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
              ++      +T  Q        V REAR+ RYREKRRTRLF+KKIRYEVRKLNAE+RPR+
Sbjct  327   EELASAVGSVTRQQGRDRGGSDVEREARMLRYREKRRTRLFAKKIRYEVRKLNAEQRPRI  386

Query  1600  KGRFVKRA--NFPLL  1638
             KGRFVKR   NF +L
Sbjct  387   KGRFVKRTSLNFDVL  401


 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 90/165 (55%), Gaps = 37/165 (22%)
 Frame = +1

Query  268  IKIEGAEGAMEGKHKAAARACDYCIGK--RARWYCAADDAFLCQACDSSVHSANPLARRH  441
            +++E     + G  K AAR CD C+ +  RA WYC ADDAFLCQ+CD+S+HSAN LA+RH
Sbjct  3    VEVESRAAGVTG-GKTAARGCDVCMKRSSRASWYCPADDAFLCQSCDASIHSANNLAKRH  61

Query  442  ARVQLKTLSNIE-----------PPSWHRGFTRKPRTPRHA--HGRYNNNNSKPVVHHDV  582
             RV+L++ S+ E              W+ GF RK RTPR      ++ NN++ P+     
Sbjct  62   ERVRLQSSSSPELLMKTKATDKTTSVWYEGFRRKARTPRSKLLQIQHVNNSNDPL-----  116

Query  583  VKTPLHLSIVPVPEMCSDE----NYSHDDEKEDQLLLYRVPIFDP  705
                       VPE+  +E    ++S  DE E+ L    VP+FDP
Sbjct  117  -----------VPELGVEEEGVFSFSSTDENEESLNCC-VPVFDP  149



>emb|CDY07383.1| BnaA07g24620D [Brassica napus]
Length=230

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 77/127 (61%), Gaps = 8/127 (6%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             + +  ++L LDYE VI  W  Q  PW   +  E++       C     C SG   A  ++
Sbjct  108   KKEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDL--DMLCCQTNSMCESGG-EAHHHN  164

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
                 +G+   +A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR
Sbjct  165   HFPGLGLHMREAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  219

Query  1609  FVKRANF  1629
             FVKR++ 
Sbjct  220   FVKRSSI  226



>emb|CDY04230.1| BnaC06g25850D [Brassica napus]
Length=230

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 14/129 (11%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRG---CGSGTIHAAA  1422
              +  ++L LDYE VI AW   R PW   +  E++      D + ++    C SG   A  
Sbjct  109   KEKVLMLRLDYENVISAWGSHRTPWTALEPSEIDL-----DMLRRQTNSVCESGG-EAHH  162

Query  1423  YDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             ++    +G+   +A        GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK
Sbjct  163   HNHFRGLGLHMREAGDG-----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  217

Query  1603  GRFVKRANF  1629
             GRFVKR++ 
Sbjct  218   GRFVKRSSI  226



>gb|KGN63817.1| hypothetical protein Csa_1G023050 [Cucumis sativus]
Length=360

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 112/220 (51%), Gaps = 56/220 (25%)
 Frame = +1

Query  292  AMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-  468
            AM G     AR CD C+ KRARW+CAADDAFLCQ+CD SVHSAN LARRH R++L+T S 
Sbjct  6    AMTGGR--TARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSSF  63

Query  469  ----NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSD  636
                ++ P  W +GFTRK RTPR  +     ++SK  V           SIVP     ++
Sbjct  64   NSTDHLPPTPWLKGFTRKARTPRSNNNNNKISSSKASV----------FSIVPEIGNDNE  113

Query  637  ENYSHD--DEKEDQLLLYR--VPIFDPVVAD--ICTTLNITDYDAAAAAFNQSKCAgggg  798
              +S D  D++  Q L ++  VP+FDP+  D  +  T  + D+      F  S+      
Sbjct  114  LGFSIDENDDEHHQFLGHQQEVPVFDPLFDDQKLLLTDELEDF---GDGFLPSEV-----  165

Query  799  hghhKNWDGKSStttmpptttememeLAEFAADVESLLGK  918
                                     +LAEF ADVE+LLG+
Sbjct  166  -------------------------DLAEFVADVENLLGR  180


 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (63%), Gaps = 12/124 (10%)
 Frame = +1

Query  1258  STILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPD--CIMQRGCGSGTIHAAAYDG  1431
             + I L L+Y+AVI AW  Q  P+ TG RP+ +    W +   +  +G  +  +    + G
Sbjct  245   NIISLRLNYDAVITAWDAQSSPYTTGNRPQFDLDDCWEEWSGVCSKGGRNVVVDDQEWRG  304

Query  1432  VGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
               + GI+  +          REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPRMKGRF
Sbjct  305   RNNNGISNEE----------REARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRF  354

Query  1612  VKRA  1623
             VKR 
Sbjct  355   VKRT  358



>gb|EPS70096.1| hypothetical protein M569_04666, partial [Genlisea aurea]
Length=81

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 61/81 (75%), Gaps = 5/81 (6%)
 Frame = +1

Query  283  AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
            A  A+ G+    ARACDYC+  RARWYCAADDAFLCQ+CDS+VHS++   RRH RV+LKT
Sbjct  6    AANAVAGR---TARACDYCVKTRARWYCAADDAFLCQSCDSTVHSSSA-KRRHHRVRLKT  61

Query  463  LSNIEPPSWHRGFTRKPRTPR  525
             S +  P W  GFTRKPRTPR
Sbjct  62   TS-VLVPKWESGFTRKPRTPR  81



>gb|AFX97569.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 76/130 (58%), Gaps = 28/130 (22%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPE--------MNSHHGWPDCIMQRGCGSGTI  1410
             K ++ L L+YEAVI +W+    PW  G+RP         +N H G     M    G G  
Sbjct  64    KRSLDLRLNYEAVIASWAS--SPWTDGRRPPGQQLDDLLLNDHAG-----MWTAGGGGRQ  116

Query  1411  HAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1590
               AA+            A    D W  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKR
Sbjct  117   GEAAW-----------PARPRTDGW--REARVSRYREKRRTRLFAKKIRYEVRKLNAEKR  163

Query  1591  PRMKGRFVKR  1620
             PRMKGRFVKR
Sbjct  164   PRMKGRFVKR  173



>ref|XP_004155029.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=202

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 100/209 (48%), Gaps = 66/209 (32%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS-----NIEP  480
             AR CD C+ KRARW+CAADDAFLCQ+CD SVHSAN LARRH R++L+T S     ++ P
Sbjct  6    TARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSSFNSTDHLPP  65

Query  481  PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDE  660
              W +GFTRK RTPR                          S     ++ S  +   +D+
Sbjct  66   TPWLKGFTRKARTPR--------------------------SNNNNNKISSRFSIDENDD  99

Query  661  KEDQLLLYR--VPIFDPVVADICTTLNITD-YDAAAAAFNQSKCAgggghghhKNWDGKS  831
            +  Q L ++  VP+FDP+  D    L +TD  +     F  S+                 
Sbjct  100  EHHQFLGHQQEVPVFDPLFDD--QKLLLTDELEDFGDGFLPSEV----------------  141

Query  832  StttmpptttememeLAEFAADVESLLGK  918
                          +LAEF ADVE+LLG+
Sbjct  142  --------------DLAEFVADVENLLGR  156



>gb|ACL53155.1| unknown [Zea mays]
Length=157

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 83/158 (53%), Gaps = 21/158 (13%)
 Frame = +1

Query  1177  FDYDNDYYSPNNekeeegeellkMRN-----KSTILLNLDYEAVILAWSDQRCPWITG-Q  1338
              D D DY SP +   +E              ++++ L L+YEA+I +W     PW  G +
Sbjct  2     LDIDFDYASPQDTATDERAASSDTGADAQFLQTSLSLTLNYEAIIQSWGS--SPWTGGGE  59

Query  1339  RPEMNSHHGWPD--CIMQRGCGSGTIHAAAYDGVGDMGITFGQAAIADDVWVGREARVSR  1512
             RP +     WP     M    G          G   +G+  G           REARVSR
Sbjct  60    RPHVKLDTRWPHDYTNMWVVGGVVGHGGEDLPGTPRLGMDGG-----------REARVSR  108

Query  1513  YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 
Sbjct  109   YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  146



>gb|EEE59793.1| hypothetical protein OsJ_12313 [Oryza sativa Japonica Group]
Length=167

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 89/158 (56%), Gaps = 31/158 (20%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLS----------  468
            ARACD C+ +RARW+C ADDAFLCQACD+SVHSANPLARRH RV+L + S          
Sbjct  17   ARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPRSA  76

Query  469  --------NIEPPSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPE  624
                    + + P+W  G  R+PRTPR   G           H     T    +   VP+
Sbjct  77   AAPRAGSDDPDAPAWLHGLKRRPRTPRTKPGGGGK-------HDASAATVAAAAASAVPD  129

Query  625  MCSDE-----NYSHD-DEKEDQLLLYRVPIFDPVVADI  720
            + ++E     +  HD  ++  + LLYRVP+FDP+VA++
Sbjct  130  LEAEESGIVGDTDHDVGKRTTRDLLYRVPVFDPMVAEL  167



>gb|AFX97570.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 76/130 (58%), Gaps = 28/130 (22%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPE--------MNSHHGWPDCIMQRGCGSGTI  1410
             K ++ L L+YEAVI +W+    PW  G+RP         +N H G     M    G G  
Sbjct  64    KRSLDLRLNYEAVIESWAS--SPWTDGRRPPGQQLDDLLLNDHAG-----MWTAGGGGRQ  116

Query  1411  HAAAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  1590
               AA+            A    D W  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKR
Sbjct  117   GEAAW-----------PARPRTDGW--REARVSRYREKRRTRLFAKKIRYEVRKLNAEKR  163

Query  1591  PRMKGRFVKR  1620
             PRMKGRFVKR
Sbjct  164   PRMKGRFVKR  173



>gb|AFK49208.1| unknown [Medicago truncatula]
Length=197

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 69/121 (57%), Gaps = 14/121 (12%)
 Frame = +1

Query  1267  LLNLDYEAVILAWSDQ--RCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGD  1440
              L L+YE VI  WS Q    PW T   P+ N      D   Q   GS  +        G 
Sbjct  74    FLRLNYEEVITEWSRQGSPSPWTTANPPKFNCD----DDSWQNLLGSSGVEGEVRSLRGQ  129

Query  1441  MGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             +  + G          GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPRMKGRFVKR
Sbjct  130   LMGSGGDG--------GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  181

Query  1621  A  1623
              
Sbjct  182   T  182



>ref|XP_008665284.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 tpg|DAA50967.1| TPA: hypothetical protein ZEAMMB73_914054 [Zea mays]
 gb|AIB05335.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=454

 Score =   109 bits (273),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 118/240 (49%), Gaps = 43/240 (18%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEP------  480
            AR+CD C+ +RARW+C AD+AFLCQ+CD SVHSANPLARRH RV+L + S   P      
Sbjct  17   ARSCDSCMRRRARWHCPADNAFLCQSCDVSVHSANPLARRHHRVRLPSASCSSPPRDPDA  76

Query  481  PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEM-----------  627
            P+W  G  R+PRTPR   G  N        H     +    +   VP++           
Sbjct  77   PTWLHGLKRRPRTPRSKPGGSNK-------HEAAPSSIAAAASAAVPDLEAEAEAEAEES  129

Query  628  ----CSDENYSHDDEKEDQLLLYRVPIFDPVVADICTTL-NITDYDAAAAAFNQSKCAgg  792
                  D +  H  + +D+ LLY VP+FDP++A+    + +  +   A       + +  
Sbjct  130  GSGILGDNDDDHGFQDDDENLLYCVPVFDPMLAEFYNPVADEGEQKPACLMLPLVETSPE  189

Query  793  gghghhKNWDGKSStttmpptttememeLAEFAADVESLLGKGLDDEEESSFDMEGLGFL  972
               G     DG S            +M+LA FAAD+ESLL  G+DD     FD   LGFL
Sbjct  190  FASGGLAEADGLSG-------FDVPDMDLASFAADMESLL-MGVDD----GFD--DLGFL  235


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 78/130 (60%), Gaps = 24/130 (18%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAW-SDQRCPWITGQRPEMN-SHHGWPD--CIMQRGCGSGTIHA  1416
             R ++ ++L L+YE VI +W  D   PW  G+RP ++  +  W +      RG   GT+ A
Sbjct  302   RKRTDMILKLNYEGVIASWVRDGGSPWYHGERPHLDDPYELWLEFPATGSRGLFGGTMTA  361

Query  1417  AAYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1596
                       +T G+          REARVSRYREKRR RLF+KKIRYEVRKLNAEKRPR
Sbjct  362   ----------VTGGE----------REARVSRYREKRRRRLFAKKIRYEVRKLNAEKRPR  401

Query  1597  MKGRFVKRAN  1626
             MKGRFVKR  
Sbjct  402   MKGRFVKRTT  411



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 80/131 (61%), Gaps = 20/131 (15%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K+++ L+LDYEAVI AW +   PW TG + E         C++    G  T  + A  G 
Sbjct  273   KTSLFLSLDYEAVITAWDNHGSPWKTGIKSE---------CLL----GGNTCPSHAVGGF  319

Query  1435  GDMGITFGQAAIADDVWVG------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1596
              ++  T G +     V  G      REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR
Sbjct  320   DELVSTVG-SVTRQQVKDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPR  378

Query  1597  MKGRFVKRANF  1629
             +KGRFVKR + 
Sbjct  379   IKGRFVKRTSL  389


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 83/152 (55%), Gaps = 28/152 (18%)
 Frame = +1

Query  310  KAAARACDYCIGK-RARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPPS  486
            K  AR CD C+ + RA WYC ADDAFLCQ+CDSS+HSAN LA+RH RV+L++ S  E   
Sbjct  16   KMVARGCDACMKRSRASWYCPADDAFLCQSCDSSIHSANHLAKRHERVRLQSSSWTETTE  75

Query  487  -----WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDE----  639
                 W+ GF RK RTPR      N   +   +       PL      VP++  +E    
Sbjct  76   KTTSVWYEGFRRKARTPR------NKGLASEKLLQMEANDPL------VPDLGGEEEEVF  123

Query  640  -NYSHDDEKEDQLLLYRVPIFDP----VVADI  720
             ++S  +E E+ L    VP+FDP    V+ DI
Sbjct  124  FSFSSVEENEESLNCC-VPVFDPFSDMVIDDI  154



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 76/125 (61%), Gaps = 6/125 (5%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGW--PDCIMQRG-CGSGTIHAAAYDGV  1434
             I L LDYE V+ AWSD+   W  G RP+         P   +  G      + +   + V
Sbjct  321   ITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCMESTEVEAV  380

Query  1435  GDMGIT-FGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
             G + +  FG+  +      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPR+KGRF
Sbjct  381   GQVPVVNFGEDRLT--PQGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  1612  VKRAN  1626
             VKR N
Sbjct  439   VKRTN  443


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL  456
            A R CD C  +RA+W+C AD+A+LC+ CD SVH AN ++ RH R ++
Sbjct  25   ALRPCDVCGRERAKWFCKADEAYLCENCDGSVHGANAVSLRHERFRM  71



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score =   108 bits (270),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 76/125 (61%), Gaps = 6/125 (5%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGW--PDCIMQRGCGSG-TIHAAAYDGV  1434
             I L LDYE V+ AWSD+   W  G RP+         P   +  G      + +   + V
Sbjct  321   ITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCMESTEVEAV  380

Query  1435  GDMGIT-FGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  1611
             G + +  FG+  +      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPR+KGRF
Sbjct  381   GQVPVVNFGEDRLTP--RGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  1612  VKRAN  1626
             VKR N
Sbjct  439   VKRTN  443


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL  456
            A R CD C  +RA+W+C AD+A+LC+ CD SVH AN ++ RH R ++
Sbjct  25   ALRPCDVCGRERAKWFCKADEAYLCENCDGSVHGANAVSLRHERFRM  71



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 75/125 (60%), Gaps = 8/125 (6%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K+++ L LDY AVI AW +   PW TG +PE     G   C+     G   + ++     
Sbjct  274   KTSLFLRLDYGAVISAWDNHGSPWKTGIKPE--CMLGGNTCLPHVVGGYEKLMSS-----  326

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
              D  +T  Q          REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFV
Sbjct  327   -DGSVTRQQGRDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFV  385

Query  1615  KRANF  1629
             KR + 
Sbjct  386   KRTSL  390


 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 88/157 (56%), Gaps = 25/157 (16%)
 Frame = +1

Query  268  IKIEGAEGAMEGKHKAAARACDYCIGK-RARWYCAADDAFLCQACDSSVHSANPLARRHA  444
            + +E    ++ G  K AAR CD C+ + RA WYC ADDAFLCQ+CD+S+HSAN LA+RH 
Sbjct  3    VDVESRTASVTG-EKMAARGCDACMKRSRASWYCPADDAFLCQSCDASIHSANHLAKRHE  61

Query  445  RVQLKTLSNIEPPS-----WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSI  609
            RV+L++ S  E        W+ GF RK RTPR          SK      +++   +  +
Sbjct  62   RVRLQSSSPTETADKTTSVWYEGFRRKARTPR----------SKSCAFEKLLQIESNDPL  111

Query  610  VPVPEMCSDEN-----YSHDDEKEDQLLLYRVPIFDP  705
              VPE+  DE+     +S  +E E+ L    VP+FDP
Sbjct  112  --VPELGGDEDDGFFSFSSVEETEESLNCC-VPVFDP  145



>gb|AGI62031.1| CONSTANS-like 7 [Erycina pusilla]
Length=314

 Score =   103 bits (258),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 76/132 (58%), Gaps = 25/132 (19%)
 Frame = +1

Query  313  AAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPPSWH  492
            + ARACD C+ KRARWYC ADDAFLCQ+CDSSVHSANPLARRH R++L T S+  P +W 
Sbjct  18   STARACDGCLRKRARWYCGADDAFLCQSCDSSVHSANPLARRHQRLRLHT-SSPPPITWR  76

Query  493  RGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDEKEDQ  672
            +   RK RTPR    +  +  ++P+V       P         EM              Q
Sbjct  77   K---RKARTPRPYRNKLPDVKTEPIV-------PELEDDEDDIEM--------------Q  112

Query  673  LLLYRVPIFDPV  708
             L+Y VP+ DP+
Sbjct  113  QLMYCVPVHDPL  124


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 68/120 (57%), Gaps = 24/120 (20%)
 Frame = +1

Query  1270  LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGI  1449
             L LDY+AVI AW+      I  Q   ++S+   P   M                + D G 
Sbjct  208   LRLDYDAVIDAWTR-----IGAQ---IDSNGSLPSSGM---------------AMSDSGT  244

Query  1450  TFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
              + +     +    REARV+RYREKRRTRLFSKKIRY+VRKLNAEKRPRMKGRFVKR   
Sbjct  245   KWSRGKWGAN-GEEREARVTRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTTL  303



>ref|XP_009409258.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=346

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 105/209 (50%), Gaps = 26/209 (12%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNI-EP----  480
            AARAC  C+  RARWYC A  AFLCQ CDSSVHSANPL RRH RV+L T S + EP    
Sbjct  19   AARACYGCLRHRARWYCTAHHAFLCQICDSSVHSANPLVRRHQRVRLTTTSLVGEPGESS  78

Query  481  PSWHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSIVPVPEMCSDENYSHDDE  660
            PSW  GF RK RT R  H R N                  ++   +PE   D +   DD+
Sbjct  79   PSWLEGFERKARTSRPQH-RTN-----------------MMAAGDLPEQLVDASVDEDDD  120

Query  661  KEDQLLL-YRVPIFDPVVADICTTLNITDYDAAAAAFNQSKCAgggghghhKNWDGKSSt  837
             E +  L Y VPI +P+ A  C+     D   A ++ + +  A         N     ST
Sbjct  121  GEQEEELSYCVPIRNPLFASFCSPPPPLDNSNATSSGDDA--AAKTSVELSDNSPASPST  178

Query  838  ttmpptttememeLAEFAADVESLLGKGL  924
                     M++E++EFAA ++SLLG  L
Sbjct  179  INKMDGFLTMDLEISEFAARIKSLLGGDL  207



>dbj|BAE98863.1| hypothetical protein [Arabidopsis thaliana]
Length=245

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 89/157 (57%), Gaps = 25/157 (16%)
 Frame = +1

Query  268  IKIEGAEGAMEGKHKAAARACDYCIGK-RARWYCAADDAFLCQACDSSVHSANPLARRHA  444
            + +E    ++ G+ K AAR CD C+ + RA WYC ADDAFLCQ+CD+S+HSAN LA+RH 
Sbjct  3    VDVESRTASVTGE-KMAARGCDACMKRSRASWYCPADDAFLCQSCDASIHSANHLAKRHE  61

Query  445  RVQLKTLSNIEPPS-----WHRGFTRKPRTPRHAHGRYNNNNSKPVVHHDVVKTPLHLSI  609
            RV+L++ S  E        W+ GF RK RTPR          SK      +++   +  +
Sbjct  62   RVRLQSSSPTETADKTTSVWYEGFRRKARTPR----------SKSCAFEKLLQIESNDPL  111

Query  610  VPVPEMCSDEN-----YSHDDEKEDQLLLYRVPIFDP  705
              VPE+  DE+     +S  +E E+ L    VP+FDP
Sbjct  112  --VPELGGDEDDGFFSFSSVEETEESLNCC-VPVFDP  145



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 73/120 (61%), Gaps = 16/120 (13%)
 Frame = +1

Query  1267  LLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM-  1443
             LL L+++ V+ AWSD R  W  G+RP+       PD        S  +       V D+ 
Sbjct  385   LLRLNFDDVLSAWSD-RSLWTDGKRPQT-----VPDD------SSEAVGGLDLGLVPDLS  432

Query  1444  -GITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
              G   GQ     D   GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRMKGRFVKR
Sbjct  433   KGCAQGQPGTGGDR--GREARVLRYREKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKR  490


 Score = 75.5 bits (184),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNIEPPSWHR  495
            A+RACD C  +RARWYC AD+A+LC  CD +VHSAN LA RH RV+L +  NI   S  +
Sbjct  24   ASRACDVCGSQRARWYCNADNAYLCYRCDQNVHSANALALRHERVRLNSQGNISSQSPRK  83

Query  496  GFTRKPRTPRHA  531
                     +H+
Sbjct  84   ALVVDTSARKHS  95



>emb|CDY09849.1| BnaC09g43120D [Brassica napus]
Length=331

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 79/127 (62%), Gaps = 21/127 (17%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAA--YD  1428
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A  + 
Sbjct  219   RRSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASADVFT  262

Query  1429  GVGDMGI--TFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
             G GD G   T  +    + +W G REA + RY+EKR+ RLFSK+IRYEVRKLNAEKRPR+
Sbjct  263   GGGDSGSLWTVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYEVRKLNAEKRPRV  322

Query  1600  KGRFVKR  1620
             KGRFVKR
Sbjct  323   KGRFVKR  329



>ref|XP_010519196.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X1 [Tarenaya 
hassleriana]
Length=450

 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 6/124 (5%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             K ++ L LDYEAV++AW  +  PW TG+ P+    + W DC++Q     G+  A     V
Sbjct  328   KQSLFLRLDYEAVMIAWDSECSPWTTGRCPDFRPSNFWLDCLLQGFVIDGSEEATP--AV  385

Query  1435  GDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  1614
             G M    G+     +    REARV RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFV
Sbjct  386   GSMPRRQGRGGSDGE----REARVLRYREKRRRRLFAKKIRYEVRKLNAEKRPRIKGRFV  441

Query  1615  KRAN  1626
             +R +
Sbjct  442   RRTS  445


 Score = 84.7 bits (208),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 56/97 (58%), Gaps = 24/97 (25%)
 Frame = +1

Query  283  AEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKT  462
            A   M GK    ARACD C+ +RA W+CAADDAFLCQ CDSS+HSAN LA RH RV+L+T
Sbjct  7    AANVMGGK---TARACDACMRRRAHWFCAADDAFLCQTCDSSIHSANQLAIRHERVRLRT  63

Query  463  L-------------SNIEPPS--------WHRGFTRK  510
                          S IE  +        W+ GFTRK
Sbjct  64   CSMSPSSSFSSSVHSQIEKSTGVNAGTLVWYEGFTRK  100



>emb|CDX85600.1| BnaA02g02130D [Brassica napus]
Length=318

 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 80/130 (62%), Gaps = 21/130 (16%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAY--D  1428
             ++++ L LDYE ++ AW D+   ++ G+ P+       PD           +HA+ Y   
Sbjct  205   RTSLALKLDYEEIMEAWPDKGTLYVDGEPPQT-----VPD-----------LHASTYVVT  248

Query  1429  GVGDMGI--TFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
             G G+ G   T  +    + +W G REA + RY+EKR++RLFSK+IRY+VRKLNAEKRPR+
Sbjct  249   GGGEAGSLWTVPEMETTESLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRV  308

Query  1600  KGRFVKRANF  1629
             KGRFVKR + 
Sbjct  309   KGRFVKRDDL  318



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   100 bits (249),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 71/118 (60%), Gaps = 12/118 (10%)
 Frame = +1

Query  1267  LLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMG  1446
             LL L+++ V+ AWSD R  W  G+RP+       PD        S  +       V D+ 
Sbjct  365   LLRLNFDDVLSAWSD-RSLWTDGRRPQT-----VPDD------SSEAVGGTDVGLVPDIN  412

Query  1447  ITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
               + Q A       GRE RV RY+EKRRTRLFSKKIRYEVRKLNAE+RPRMKGRFVK+
Sbjct  413   TQYAQGATLAAGDKGREFRVMRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKQ  470


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +1

Query  319  ARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQLKTLSNI--EPPSWH  492
            +RACD C   RARWYC+ D+A LC+ CD +VHSAN LA  H RV+L    N    P    
Sbjct  26   SRACDVCGLHRARWYCSVDNAHLCRRCDQNVHSANALALHHERVRLDLQGNALHTPRKAL  85

Query  493  RGFTRKPR  516
            +G T  P+
Sbjct  86   KGNTSAPQ  93



>emb|CDX69586.1| BnaA10g19350D [Brassica napus]
Length=330

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 79/127 (62%), Gaps = 21/127 (17%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAA--YD  1428
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +H +A  ++
Sbjct  218   RRSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHGSADVFN  261

Query  1429  GVGDMGI--TFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
             G GD G   T  +    + +W G REA + RY+EKR+ RLFSK+IRYEVRKLNAEKRPR+
Sbjct  262   GGGDSGSLWTVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYEVRKLNAEKRPRV  321

Query  1600  KGRFVKR  1620
             KGRFVKR
Sbjct  322   KGRFVKR  328



>ref|XP_009121672.1| PREDICTED: uncharacterized protein LOC103846490 [Brassica rapa]
Length=330

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 79/127 (62%), Gaps = 21/127 (17%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAA--YD  1428
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +H +A  ++
Sbjct  218   RRSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHGSADVFN  261

Query  1429  GVGDMGI--TFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
             G GD G   T  +    + +W G REA + RY+EKR+ RLFSK+IRYEVRKLNAEKRPR+
Sbjct  262   GGGDSGSLWTVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYEVRKLNAEKRPRV  321

Query  1600  KGRFVKR  1620
             KGRFVKR
Sbjct  322   KGRFVKR  328



>ref|XP_010483220.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Camelina sativa]
Length=456

 Score = 99.8 bits (247),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 74/129 (57%), Gaps = 31/129 (24%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGT-IHA--A  1419
             R  +  LL LDY+ V+ AWSD+  P+              PD I+     +G  ++A  A
Sbjct  348   RTTTGPLLKLDYDGVLEAWSDKTSPF--------------PDDILGTEAATGIDVNARLA  393

Query  1420  AYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
               D  GD G+              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRM
Sbjct  394   QIDLFGDSGM--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRM  439

Query  1600  KGRFVKRAN  1626
             KGRFV+R N
Sbjct  440   KGRFVRRPN  448



>ref|XP_010451861.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Camelina 
sativa]
Length=466

 Score = 99.8 bits (247),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 69/123 (56%), Gaps = 31/123 (25%)
 Frame = +1

Query  1267  LLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSG---TIHAAAYDGVG  1437
             LL LDY+ V+ AWSD+  P+              PD I+     SG       A  D  G
Sbjct  364   LLKLDYDGVLEAWSDKTSPF--------------PDDILGTEAASGIDVNARIAQIDLFG  409

Query  1438  DMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  1617
             D G+              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRMKGRFV+
Sbjct  410   DSGM--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVR  455

Query  1618  RAN  1626
             R N
Sbjct  456   RPN  458



>ref|XP_010443395.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Camelina 
sativa]
Length=467

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 71/129 (55%), Gaps = 31/129 (24%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSG---TIHAA  1419
             R  +  LL LDY+ V+ AWSD+  P+              PD I+     +G       A
Sbjct  359   RTTTGPLLKLDYDGVLEAWSDKTSPF--------------PDDILGTEAATGIDVNARLA  404

Query  1420  AYDGVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
               D  GD G+              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRM
Sbjct  405   QIDLFGDSGM--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRM  450

Query  1600  KGRFVKRAN  1626
             KGRFV+R N
Sbjct  451   KGRFVRRPN  459



>ref|XP_006286526.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 ref|XP_006286527.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 ref|XP_006286528.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19424.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19425.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19426.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
Length=337

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 80/132 (61%), Gaps = 24/132 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A DG 
Sbjct  223   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASA-DGF  265

Query  1435  GDMGITFGQAAI------ADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1593
             GD G      A+       + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRP
Sbjct  266   GDGGEAGSIWAVPEMETTTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRP  325

Query  1594  RMKGRFVKRANF  1629
             R+KGRFVKR + 
Sbjct  326   RIKGRFVKRDDL  337



>gb|KFK25676.1| hypothetical protein AALP_AA8G144900 [Arabis alpina]
Length=329

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 79/131 (60%), Gaps = 23/131 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             ++++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+  DG 
Sbjct  216   RTSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASP-DGF  258

Query  1435  GDMGI-----TFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1596
              D G      T  +    + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR
Sbjct  259   ADAGEAGSLWTVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPR  318

Query  1597  MKGRFVKRANF  1629
             +KGRFVKR + 
Sbjct  319   IKGRFVKRDDL  329



>emb|CDX91067.1| BnaC02g05300D [Brassica napus]
Length=323

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 80/130 (62%), Gaps = 21/130 (16%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAA--YD  1428
             ++++ L LDYE ++ AW D+   ++ G+ P+       PD           +HA+A    
Sbjct  210   RTSLALKLDYEQIMEAWPDKGTLYVDGEPPQT-----VPD-----------LHASADVVT  253

Query  1429  GVGDMGI--TFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
             G G+ G   T  +    + +W G REA + RY+EKR++RLFSK+IRY+VRKLNAEKRPR+
Sbjct  254   GGGEAGSLWTVPEMETTETLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRV  313

Query  1600  KGRFVKRANF  1629
             KGRFVKR + 
Sbjct  314   KGRFVKRDDL  323



>ref|XP_002864503.1| hypothetical protein ARALYDRAFT_495815 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40762.1| hypothetical protein ARALYDRAFT_495815 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 70/122 (57%), Gaps = 30/122 (25%)
 Frame = +1

Query  1267  LLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA--AAYDGVGD  1440
             LL LDY+ V+ AWSD+  P+              PD I+        ++A  A  D  GD
Sbjct  325   LLKLDYDGVLEAWSDKTSPF--------------PDEILGSEATGIDVNARLAEIDLFGD  370

Query  1441  MGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
              G+              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRMKGRFV+R
Sbjct  371   SGM--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  416

Query  1621  AN  1626
              N
Sbjct  417   PN  418



>ref|XP_006399947.1| hypothetical protein EUTSA_v10014044mg [Eutrema salsugineum]
 gb|ESQ41400.1| hypothetical protein EUTSA_v10014044mg [Eutrema salsugineum]
Length=337

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 79/127 (62%), Gaps = 21/127 (17%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAA--YD  1428
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A  + 
Sbjct  224   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASADAFT  267

Query  1429  GVGDMGITFG--QAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  1599
             G G+ G  +   +    + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR+
Sbjct  268   GGGEAGSLWAVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRI  327

Query  1600  KGRFVKR  1620
             KGRFVKR
Sbjct  328   KGRFVKR  334



>ref|XP_006280489.1| hypothetical protein CARUB_v10026429mg [Capsella rubella]
 gb|EOA13387.1| hypothetical protein CARUB_v10026429mg [Capsella rubella]
Length=436

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 69/126 (55%), Gaps = 28/126 (22%)
 Frame = +1

Query  1249  RNKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYD  1428
             R  +  LL LDY+ V+ AWSD+  P+              PD I+           A  D
Sbjct  331   RATTGPLLKLDYDGVLDAWSDKTSPF--------------PDDILGLEPADVNARIAQID  376

Query  1429  GVGDMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
               GD G+              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRMKGR
Sbjct  377   LFGDSGM--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGR  422

Query  1609  FVKRAN  1626
             FV+R N
Sbjct  423   FVRRPN  428



>gb|EMS59726.1| Zinc finger protein CONSTANS-LIKE 6 [Triticum urartu]
Length=168

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = +1

Query  1399  SGTIHAAAYDGVGDMGITFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKL  1575
             SG I    Y+  G  G   G A  A  V  G REARVSRYREKRRTRLF+KKIRYEVRKL
Sbjct  68    SGMILKLDYERAGSRGFGLGAAVTA--VTGGEREARVSRYREKRRTRLFAKKIRYEVRKL  125

Query  1576  NAEKRPRMKGRFVKR  1620
             NAEKRPRMKGRFVKR
Sbjct  126   NAEKRPRMKGRFVKR  140



>ref|XP_008797174.1| PREDICTED: uncharacterized protein LOC103712429 [Phoenix dactylifera]
Length=232

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 72/120 (60%), Gaps = 16/120 (13%)
 Frame = +1

Query  1270  LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGI  1449
             L LDYE V+ AWSD+   +I G  P++                   +H  A   + ++G 
Sbjct  128   LKLDYEDVLTAWSDRGSLYIDGDGPQVVPE----------------LHHTASPVMVEVGS  171

Query  1450  TFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  1629
             T  +   +D     REARV RY+EKRR+RLFSK++RYEVRKLNAE+RPR+KGRFVKR + 
Sbjct  172   TGWRVPESDREAGNREARVMRYKEKRRSRLFSKRVRYEVRKLNAERRPRLKGRFVKRKDV  231



>ref|XP_007140857.1| hypothetical protein PHAVU_008G147400g [Phaseolus vulgaris]
 gb|ESW12851.1| hypothetical protein PHAVU_008G147400g [Phaseolus vulgaris]
Length=331

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 76/133 (57%), Gaps = 19/133 (14%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM  1443
             + L LD++ ++ AWSD+   ++ G+       H  PD +      +  +H  A+DG G+ 
Sbjct  203   LSLKLDHQGILNAWSDKGSLYVAGE----GGPHTVPDFLNGFLLHNAFLHHVAWDGWGN-  257

Query  1444  GITFGQAAIADDVWVG--------------REARVSRYREKRRTRLFSKKIRYEVRKLNA  1581
             G+      + +D                  REA V RY+EKR++RLFSKKIRYEVRKLNA
Sbjct  258   GVVGNAWGVPEDCGANKTNVKEENGWKLGQREASVQRYKEKRQSRLFSKKIRYEVRKLNA  317

Query  1582  EKRPRMKGRFVKR  1620
             EKRPRMKGRFVKR
Sbjct  318   EKRPRMKGRFVKR  330



>ref|NP_568852.2| chloroplast import apparatus 2 protein [Arabidopsis thaliana]
 sp|Q9LU68.1|CIA2_ARATH RecName: Full=Protein CHLOROPLAST IMPORT APPARATUS 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK51445.1|AF359387_1 CIA2 [Arabidopsis thaliana]
 dbj|BAA97368.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAH19527.1| AT5G57180 [Arabidopsis thaliana]
 gb|AED96860.1| chloroplast import apparatus 2 protein [Arabidopsis thaliana]
Length=435

 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 66/120 (55%), Gaps = 28/120 (23%)
 Frame = +1

Query  1267  LLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMG  1446
             LL LDY+ V+ AWSD+  P+              PD I            A  D  GD G
Sbjct  336   LLKLDYDGVLEAWSDKTSPF--------------PDEIQGSEAVDVNARLAQIDLFGDSG  381

Query  1447  ITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  1626
             +              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRMKGRFV+R N
Sbjct  382   M--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRRPN  427



>ref|XP_002873661.1| hypothetical protein ARALYDRAFT_488277 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49920.1| hypothetical protein ARALYDRAFT_488277 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 78/128 (61%), Gaps = 23/128 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             + ++ L LDYE ++ AWSD+   ++ G+ P+M      PD           +HA+  DG 
Sbjct  222   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQM-----VPD-----------LHAST-DGF  264

Query  1435  GDMGITFGQAAI-----ADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1596
              D G      A+      + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR
Sbjct  265   TDCGEAGNLWAVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPR  324

Query  1597  MKGRFVKR  1620
             +KGRFVKR
Sbjct  325   VKGRFVKR  332



>gb|AAM63153.1| unknown [Arabidopsis thaliana]
Length=305

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 78/128 (61%), Gaps = 23/128 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A DG 
Sbjct  192   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASA-DGF  234

Query  1435  GDMGITFGQAAI-----ADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1596
              D G      A+      + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR
Sbjct  235   NDGGEAGNLWAVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPR  294

Query  1597  MKGRFVKR  1620
             +KGRFVKR
Sbjct  295   VKGRFVKR  302



>gb|KHN16247.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=99

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 57/96 (59%), Gaps = 10/96 (10%)
 Frame = +1

Query  268  IKIEGAEGAMEGKHKAAARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHAR  447
            +K+ GA GA        A ACD C+ +R RW+CAADDAFLC A ++ VHSAN LA  H R
Sbjct  1    MKVAGALGA------KTALACDSCVSRRPRWFCAADDAFLCHASNTLVHSANQLASTHER  54

Query  448  VQLKTLSNI----EPPSWHRGFTRKPRTPRHAHGRY  543
             QL+T S+         WH GFT K RTPRH    Y
Sbjct  55   AQLQTASSKVMTNTTHGWHSGFTSKARTPRHNREEY  90



>ref|NP_568300.1| CCT motif family protein [Arabidopsis thaliana]
 gb|AAK92829.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14235.1| unknown protein [Arabidopsis thaliana]
 gb|AED92023.1| CCT motif family protein [Arabidopsis thaliana]
Length=339

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 78/128 (61%), Gaps = 23/128 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A DG 
Sbjct  226   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASA-DGF  268

Query  1435  GDMGITFGQAAI-----ADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  1596
              D G      A+      + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR
Sbjct  269   NDGGEAGNLWAVPEMETTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPR  328

Query  1597  MKGRFVKR  1620
             +KGRFVKR
Sbjct  329   VKGRFVKR  336



>ref|XP_009125969.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Brassica 
rapa]
Length=156

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 13/127 (10%)
 Frame = +1

Query  1252  NKSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDG  1431
              ++++ L LDYE ++ AW D+   ++ G+ P+       PD        +G   A +   
Sbjct  42    GRTSLALKLDYEEIMEAWPDKGTLYVDGEPPQTV-----PDLHASTDVVTGGGEAGSLWT  96

Query  1432  VGDMGITFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  1608
             V +M  T       + +W G REA + RY+EKR++RLFSK+IRY+VRKLNAEKRPR+KGR
Sbjct  97    VPEMETT-------ETLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRVKGR  149

Query  1609  FVKRANF  1629
             FVKR + 
Sbjct  150   FVKRDDL  156



>ref|XP_010492239.1| PREDICTED: uncharacterized protein LOC104769672 [Camelina sativa]
Length=351

 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 24/132 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A DG 
Sbjct  237   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASA-DGY  279

Query  1435  GDMGITFGQAAI------ADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1593
              D G      A+       + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRP
Sbjct  280   TDGGEAGSLWAVPEMETTTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRP  339

Query  1594  RMKGRFVKRANF  1629
             R+KGRFVKR + 
Sbjct  340   RIKGRFVKRDDL  351



>ref|XP_009120241.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 isoform X1 
[Brassica rapa]
Length=418

 Score = 95.9 bits (237),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 70/123 (57%), Gaps = 30/123 (24%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA--AAYDGVG  1437
             ++L LDY+ V+ AWS++  P+               D I+        ++A  A  D  G
Sbjct  316   LMLKLDYDGVLEAWSEKELPF--------------SDEILGSEAAGADVNARLAQIDLFG  361

Query  1438  DMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  1617
             D GI              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRMKGRFV+
Sbjct  362   DSGI--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVR  407

Query  1618  RAN  1626
             R N
Sbjct  408   RPN  410



>emb|CDY38274.1| BnaA10g11220D [Brassica napus]
Length=397

 Score = 95.5 bits (236),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 70/123 (57%), Gaps = 30/123 (24%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA--AAYDGVG  1437
             ++L LDY+ V+ AWS++  P+               D I+        ++A  A  D  G
Sbjct  295   LMLKLDYDGVLEAWSEKESPF--------------SDEILASEAAGADVNARLAQIDLFG  340

Query  1438  DMGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  1617
             D GI              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRMKGRFV+
Sbjct  341   DSGI--------------REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVR  386

Query  1618  RAN  1626
             R N
Sbjct  387   RPN  389



>ref|XP_010938521.1| PREDICTED: uncharacterized protein LOC105057575 [Elaeis guineensis]
Length=233

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 22/123 (18%)
 Frame = +1

Query  1270  LNLDYEAVILAWSDQRCPWITGQRPEM--NSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM  1443
             L LDYE V+ AWSD+   +I G  P++  + +H     +++               VG  
Sbjct  129   LKLDYEEVLTAWSDRGSLYIDGDGPQVVPDLYHTTSPVLVE---------------VGST  173

Query  1444  GITFGQAAIADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
             G T  ++ +     VG REARV RY+EKRR+RLFSK+IRYEVRKLNAEKRPR KGRFV+R
Sbjct  174   GWTVPESELE----VGNREARVMRYKEKRRSRLFSKRIRYEVRKLNAEKRPRSKGRFVRR  229

Query  1621  ANF  1629
              + 
Sbjct  230   KDV  232



>ref|XP_010248760.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Nelumbo nucifera]
Length=364

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 75/126 (60%), Gaps = 18/126 (14%)
 Frame = +1

Query  1264  ILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCI----MQRGC-GSGTIHAAAYD  1428
             + L LDYE ++ AWSD+   +I G+ P+       PD      +  GC G G       D
Sbjct  249   LSLKLDYEQILNAWSDRSPFYIDGECPQT-----VPDITDNASLDFGCSGDGRQWRVPDD  303

Query  1429  GVGDMGITFGQAAIADDV--WVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
             G G      G   +++ V     REARV RYREKR++RLFSKKIRYEVRKLNAE RPR+K
Sbjct  304   GSG------GAKEMSEAVSKIKQREARVLRYREKRQSRLFSKKIRYEVRKLNAEIRPRLK  357

Query  1603  GRFVKR  1620
             GRFVKR
Sbjct  358   GRFVKR  363



>ref|XP_010453557.1| PREDICTED: uncharacterized protein LOC104735456 [Camelina sativa]
Length=345

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 24/132 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A DG 
Sbjct  231   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASA-DGY  273

Query  1435  GDMGITFGQAAIAD------DVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1593
              D G      A+ +       +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRP
Sbjct  274   TDGGEAGSLWAVPEMETTRERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRP  333

Query  1594  RMKGRFVKRANF  1629
             R+KGRFVKR + 
Sbjct  334   RIKGRFVKRDDL  345



>gb|KDP46366.1| hypothetical protein JCGZ_10206 [Jatropha curcas]
Length=339

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 22/126 (17%)
 Frame = +1

Query  1270  LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDM--  1443
             L LDY+ ++ AWSD+   +I G  P++      PD +          H A+ DG G++  
Sbjct  224   LKLDYQQILNAWSDKGPLYIKGDSPQI-----VPDVLH--------AHTASMDGWGNLWR  270

Query  1444  -----GITFGQAAIADDVWV--GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  1602
                   I         + W    REA V RY+EKR++RLF+KKIRYEVRKLNAEKRPR+K
Sbjct  271   VPEMESIKMKDKGEEKEGWKLGQREASVLRYKEKRQSRLFAKKIRYEVRKLNAEKRPRLK  330

Query  1603  GRFVKR  1620
             GRFVKR
Sbjct  331   GRFVKR  336



>ref|XP_010539413.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2 [Tarenaya hassleriana]
Length=452

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 69/122 (57%), Gaps = 30/122 (25%)
 Frame = +1

Query  1267  LLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHA--AAYDGVGD  1440
             LL LDY+ ++ AWSD+  P+               D I+        +HA  A  D  G+
Sbjct  350   LLKLDYDGILEAWSDKGLPFS--------------DEILGPDAAGADVHARVAQIDLFGE  395

Query  1441  MGITFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
              G+              REA V RY+EKRRTRLFSKKIRY+VRKLNA++RPRMKGRFV+R
Sbjct  396   GGV--------------REASVMRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  441

Query  1621  AN  1626
              N
Sbjct  442   PN  443



>ref|XP_010420071.1| PREDICTED: uncharacterized protein LOC104705709 [Camelina sativa]
Length=345

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 24/132 (18%)
 Frame = +1

Query  1255  KSTILLNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGV  1434
             + ++ L LDYE ++ AWSD+   ++ G+ P+       PD           +HA+A DG 
Sbjct  231   RPSLALKLDYEQIMEAWSDKGTLYVDGEPPQT-----VPD-----------LHASA-DGY  273

Query  1435  GDMGITFGQAAI------ADDVWVG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  1593
              D G      A+       + +W G REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRP
Sbjct  274   TDGGEAGSLWAVPEMETTTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRP  333

Query  1594  RMKGRFVKRANF  1629
             R+KGRFVKR + 
Sbjct  334   RIKGRFVKRDDL  345



>ref|XP_001765504.1| predicted protein [Physcomitrella patens]
 gb|EDQ69765.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 66/117 (56%), Gaps = 25/117 (21%)
 Frame = +1

Query  1270  LNLDYEAVILAWSDQRCPWITGQRPEMNSHHGWPDCIMQRGCGSGTIHAAAYDGVGDMGI  1449
             L L+YE VI AWSD+  PW             +P         +G +   A +G      
Sbjct  380   LRLNYEDVITAWSDRGEPWF------------YPHDCTSDATDAGLVPDMAQEG------  421

Query  1450  TFGQAAIADDVWVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  1620
                    ADD    REA V R++EKRR+RLFSK+IRYEVRKLNAEKRPRMKGRFVK+
Sbjct  422   -------ADDCQGSREASVMRFKEKRRSRLFSKRIRYEVRKLNAEKRPRMKGRFVKK  471


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  316  AARACDYCIGKRARWYCAADDAFLCQACDSSVHSANPLARRHARVQL  456
            A+RACD C+ K ARWYC AD A+LC+ CD  VHSAN LA+RH RV L
Sbjct  20   ASRACDVCMNKSARWYCGADRAYLCEKCDIQVHSANALAQRHERVPL  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5368531198704