BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c118720_g1_i1 len=145 path=[1:0-144]

Length=145
                                                                      Score     E

ref|XP_008442237.1|  PREDICTED: protein TRANSPARENT TESTA 1             103   4e-25   
ref|XP_002526735.1|  TRANSPARENT TESTA 1 protein, putative              103   5e-25   Ricinus communis
gb|KDP37348.1|  hypothetical protein JCGZ_06802                         103   9e-25   
ref|XP_010246927.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        102   9e-25   
ref|XP_002277537.1|  PREDICTED: zinc finger protein WIP2                102   1e-24   Vitis vinifera
ref|XP_010265244.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        102   1e-24   
ref|XP_009593388.1|  PREDICTED: protein TRANSPARENT TESTA 1             102   1e-24   
ref|XP_011080270.1|  PREDICTED: zinc finger protein WIP2-like           102   2e-24   
ref|XP_010647907.1|  PREDICTED: zinc finger protein WIP6                101   2e-24   
ref|XP_010695304.1|  PREDICTED: zinc finger protein WIP5-like iso...    102   2e-24   
emb|CBI29881.3|  unnamed protein product                                101   2e-24   
ref|XP_010105333.1|  Protein TRANSPARENT TESTA 1                        101   3e-24   
ref|XP_011033300.1|  PREDICTED: zinc finger protein WIP2-like           101   3e-24   
ref|XP_010262985.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   4e-24   
ref|XP_008795700.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   4e-24   
ref|XP_009624990.1|  PREDICTED: protein TRANSPARENT TESTA 1             101   4e-24   
ref|XP_009391814.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   4e-24   
ref|XP_010695311.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...    101   4e-24   
emb|CBI16404.3|  unnamed protein product                                100   5e-24   
ref|XP_006361385.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   5e-24   
emb|CDY06390.1|  BnaC05g31400D                                          100   5e-24   
ref|XP_004305379.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   5e-24   
ref|XP_009780788.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   6e-24   
ref|XP_009417317.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   6e-24   
ref|XP_002323306.1|  zinc finger family protein                         100   6e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008465836.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   6e-24   
ref|XP_009400647.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.8    6e-24   
ref|XP_007028866.1|  C2H2-type zinc finger family protein               100   6e-24   
ref|XP_004140390.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   6e-24   
ref|XP_009405574.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.8    7e-24   
ref|XP_003521192.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   7e-24   
ref|XP_009356291.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   7e-24   
gb|KGN54875.1|  hypothetical protein Csa_4G571220                       100   7e-24   
ref|XP_010695319.1|  PREDICTED: zinc finger protein WIP5-like iso...    100   8e-24   
ref|XP_006573265.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   8e-24   
ref|XP_010524180.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   8e-24   
ref|XP_007046299.1|  C2H2-like zinc finger protein                    99.8    9e-24   
ref|XP_004513518.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.8    9e-24   
ref|XP_006484574.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.8    9e-24   
gb|KDO70084.1|  hypothetical protein CISIN_1g046329mg                 99.8    9e-24   
ref|XP_010927153.1|  PREDICTED: zinc finger protein WIP6-like         99.8    9e-24   
ref|XP_007208550.1|  hypothetical protein PRUPE_ppa024429mg             100   9e-24   
ref|XP_010528971.1|  PREDICTED: protein TRANSPARENT TESTA 1           99.8    1e-23   
ref|XP_010481105.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   1e-23   
gb|EMT05403.1|  Protein TRANSPARENT TESTA 1                             100   1e-23   
ref|XP_006437731.1|  hypothetical protein CICLE_v10033535mg           99.8    1e-23   
ref|XP_003614466.1|  Zinc finger-like protein                           100   1e-23   
ref|XP_006833554.1|  hypothetical protein AMTR_s00093p00164790        99.8    1e-23   
emb|CDP10077.1|  unnamed protein product                                100   1e-23   
ref|XP_011008503.1|  PREDICTED: zinc finger protein WIP6              99.4    1e-23   
ref|XP_009104072.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...    100   1e-23   
ref|XP_010547082.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   1e-23   
gb|KHG03266.1|  Protein TRANSPARENT TESTA 1 -like protein             99.4    1e-23   
ref|XP_010501954.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.8    1e-23   
ref|XP_009792207.1|  PREDICTED: protein TRANSPARENT TESTA 1-like        100   1e-23   
gb|KDP29369.1|  hypothetical protein JCGZ_18290                       99.4    1e-23   
ref|XP_002314883.2|  hypothetical protein POPTR_0010s13910g           99.4    1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009403121.1|  PREDICTED: protein SENSITIVE TO PROTON RHIZO...  99.8    1e-23   
ref|XP_006850176.1|  hypothetical protein AMTR_s00022p00243980        99.8    1e-23   
ref|XP_009390641.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.8    1e-23   
ref|XP_010461955.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.8    1e-23   
ref|XP_006574881.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.4    1e-23   
ref|XP_002282950.1|  PREDICTED: zinc finger protein WIP2              99.4    1e-23   Vitis vinifera
ref|XP_009405038.1|  PREDICTED: zinc finger and BTB domain-contai...    100   1e-23   
ref|XP_007153349.1|  hypothetical protein PHAVU_003G027900g           99.4    1e-23   
ref|XP_006306545.1|  hypothetical protein CARUB_v10012613mg           99.4    2e-23   
ref|XP_008780503.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.0    2e-23   
ref|XP_008219758.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.4    2e-23   
gb|KHN12831.1|  Protein TRANSPARENT TESTA 1                           99.0    2e-23   
gb|AAD30636.1|AC006085_9  Hypothetical protein                        99.0    2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791254.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.6    2e-23   
ref|XP_010102319.1|  Protein TRANSPARENT TESTA 1                      99.4    2e-23   
ref|XP_009387999.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.0    2e-23   
ref|XP_010924131.1|  PREDICTED: zinc finger protein WIP6-like         96.3    2e-23   
ref|XP_008384541.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.0    2e-23   
ref|XP_002526768.1|  TRANSPARENT TESTA 1 protein, putative            99.0    2e-23   Ricinus communis
ref|XP_010913168.1|  PREDICTED: zinc finger protein WIP2              99.0    2e-23   
ref|XP_003519064.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.0    2e-23   
gb|ACU24084.1|  unknown                                               99.0    2e-23   Glycine max [soybeans]
ref|XP_010110978.1|  Protein TRANSPARENT TESTA 1                      98.6    2e-23   
ref|XP_011077223.1|  PREDICTED: zinc finger protein WIP6              98.6    2e-23   
ref|XP_007202337.1|  hypothetical protein PRUPE_ppa008185mg           99.0    2e-23   
ref|XP_008392177.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.0    2e-23   
gb|EYU39883.1|  hypothetical protein MIMGU_mgv1a009268mg              99.0    3e-23   
ref|XP_009796838.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.2    3e-23   
gb|ADL36630.1|  C2H2L domain class transcription factor               99.0    3e-23   
gb|KDP22072.1|  hypothetical protein JCGZ_25903                       99.0    3e-23   
ref|XP_008243178.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.6    3e-23   
ref|XP_009376165.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.0    3e-23   
ref|XP_007014983.1|  C2H2-type zinc finger family protein             98.6    3e-23   
ref|XP_010046596.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.6    3e-23   
ref|XP_009613284.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.2    3e-23   
gb|KHN22371.1|  Protein TRANSPARENT TESTA 1                           99.0    3e-23   
ref|XP_003537201.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      99.0    3e-23   
ref|XP_011090493.1|  PREDICTED: zinc finger protein WIP2              98.6    3e-23   
emb|CDY22834.1|  BnaA06g02430D                                        98.6    3e-23   
ref|XP_009148198.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.6    3e-23   
gb|EPS71120.1|  hypothetical protein M569_03639                       97.8    3e-23   
ref|XP_003553422.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.6    3e-23   
ref|XP_010257283.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.6    3e-23   
ref|XP_007227701.1|  hypothetical protein PRUPE_ppa020013m2g          97.4    3e-23   
ref|XP_008240853.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.6    3e-23   
ref|XP_009336615.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.2    3e-23   
ref|XP_003625178.1|  Protein TRANSPARENT TESTA                        98.6    4e-23   
gb|KEH43450.1|  C2H2-type zinc finger protein                         98.2    4e-23   
ref|XP_009145538.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.2    4e-23   
emb|CDY25224.1|  BnaC06g04490D                                        98.2    4e-23   
ref|XP_007052543.1|  TRANSPARENT TESTA 1 protein, putative            98.2    4e-23   
ref|XP_002513471.1|  TRANSPARENT TESTA 1 protein, putative            98.2    4e-23   Ricinus communis
ref|XP_010057579.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.2    5e-23   
ref|XP_010928501.1|  PREDICTED: zinc finger protein WIP2-like         97.8    5e-23   
ref|XP_010547254.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.2    5e-23   
ref|XP_008339700.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.8    5e-23   
gb|KDP43464.1|  hypothetical protein JCGZ_16751                       97.8    5e-23   
ref|XP_009609728.1|  PREDICTED: protein TRANSPARENT TESTA 1           98.2    5e-23   
ref|XP_008390016.1|  PREDICTED: protein TRANSPARENT TESTA 1           97.8    5e-23   
ref|XP_004234792.2|  PREDICTED: protein TRANSPARENT TESTA 1           97.8    5e-23   
ref|XP_004170522.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.8    5e-23   
ref|XP_009387719.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.2    5e-23   
ref|XP_004144691.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.8    5e-23   
ref|XP_009374494.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.2    5e-23   
ref|XP_010545885.1|  PREDICTED: protein SENSITIVE TO PROTON RHIZO...  98.2    5e-23   
ref|XP_008679544.1|  PREDICTED: uncharacterized protein LOC103654491  98.6    5e-23   
ref|XP_009391887.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.2    5e-23   
ref|XP_007162251.1|  hypothetical protein PHAVU_001G136700g           97.8    5e-23   
emb|CDP00581.1|  unnamed protein product                              97.4    5e-23   
ref|XP_002314032.2|  hypothetical protein POPTR_0009s06700g           97.8    5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_004151309.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.8    6e-23   
ref|XP_006493895.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      98.2    6e-23   
ref|XP_006362569.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.4    6e-23   
gb|KDO57204.1|  hypothetical protein CISIN_1g040794mg                 98.2    6e-23   
ref|XP_004956529.1|  PREDICTED: zinc finger protein STOP1 homolog     97.8    6e-23   
ref|XP_008808222.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    6e-23   
ref|XP_011075201.1|  PREDICTED: zinc finger protein WIP2              97.8    6e-23   
ref|XP_006421457.1|  hypothetical protein CICLE_v10005189mg           97.8    6e-23   
ref|XP_011025425.1|  PREDICTED: zinc finger protein WIP2-like         97.8    6e-23   
gb|KCW90245.1|  hypothetical protein EUGRSUZ_A02400                   97.1    6e-23   
ref|XP_010554847.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.8    6e-23   
ref|XP_008443097.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.8    6e-23   
gb|KGN59334.1|  hypothetical protein Csa_3G810580                     97.4    7e-23   
ref|XP_006393069.1|  hypothetical protein EUTSA_v10011987mg           97.4    7e-23   
gb|KFK35012.1|  hypothetical protein AALP_AA5G222700                  97.8    7e-23   
ref|XP_006406336.1|  hypothetical protein EUTSA_v10021932mg           97.4    8e-23   
ref|XP_006354269.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.4    8e-23   
ref|XP_010928863.1|  PREDICTED: zinc finger protein WIP2-like         97.4    8e-23   
ref|XP_010913946.1|  PREDICTED: zinc finger protein WIP2-like         97.4    8e-23   
ref|XP_003541613.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.4    8e-23   
ref|XP_010672755.1|  PREDICTED: zinc finger protein WIP2              97.4    8e-23   
emb|CDX88959.1|  BnaA04g02270D                                        97.4    8e-23   
ref|XP_004173674.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.1    8e-23   
gb|KHN37611.1|  Protein TRANSPARENT TESTA 1                           97.4    9e-23   
ref|XP_009763748.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.1    9e-23   
gb|AAO64176.1|  putative zinc finger protein                          97.4    9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004250873.1|  PREDICTED: protein TRANSPARENT TESTA 1           97.4    9e-23   
ref|NP_191326.1|  transcription factor NO TRANSMITTING TRACT          97.4    9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009599843.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.1    1e-22   
ref|XP_002876430.1|  hypothetical protein ARALYDRAFT_486217           97.4    1e-22   
dbj|BAK04496.1|  predicted protein                                    97.4    1e-22   
ref|XP_009104073.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...  97.4    1e-22   
ref|XP_008798774.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.1    1e-22   
gb|KDP32686.1|  hypothetical protein JCGZ_14750                       97.1    1e-22   
ref|XP_002523788.1|  TRANSPARENT TESTA 1 protein, putative            97.1    1e-22   Ricinus communis
emb|CDY35565.1|  BnaC05g27160D                                        97.1    1e-22   
ref|XP_008782901.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.0    1e-22   
ref|XP_010427649.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.1    1e-22   
ref|XP_006402857.1|  hypothetical protein EUTSA_v10006035mg           97.1    1e-22   
ref|XP_006291292.1|  hypothetical protein CARUB_v10017428mg           97.1    1e-22   
ref|XP_010516391.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...  97.1    1e-22   
ref|XP_004957169.1|  PREDICTED: zinc finger and BTB domain-contai...  97.8    1e-22   
ref|XP_003539640.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.1    1e-22   
ref|XP_009387483.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      96.7    1e-22   
ref|XP_010504701.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      97.1    1e-22   
ref|XP_004231115.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      96.7    1e-22   
ref|XP_004239423.1|  PREDICTED: protein TRANSPARENT TESTA 1           96.3    1e-22   
emb|CDY57608.1|  BnaC06g42710D                                        95.9    1e-22   
ref|XP_002981844.1|  hypothetical protein SELMODRAFT_57114            94.0    1e-22   
ref|NP_175533.1|  WIP domain protein 5                                96.7    1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002979166.1|  hypothetical protein SELMODRAFT_110681           95.1    1e-22   
ref|XP_011011045.1|  PREDICTED: zinc finger protein WIP2-like         96.7    1e-22   
gb|EYU27068.1|  hypothetical protein MIMGU_mgv1a026475mg              96.7    1e-22   
ref|XP_010088245.1|  Protein TRANSPARENT TESTA 1                      96.7    2e-22   
emb|CDX67704.1|  BnaA07g17440D                                        95.9    2e-22   
ref|XP_002894301.1|  zinc finger protein                              96.7    2e-22   
gb|EYU30485.1|  hypothetical protein MIMGU_mgv1a024792mg              95.9    2e-22   
ref|XP_002298437.2|  hypothetical protein POPTR_0001s27490g           96.7    2e-22   Populus trichocarpa [western balsam poplar]
gb|EYU40863.1|  hypothetical protein MIMGU_mgv1a018051mg              96.3    2e-22   
gb|ACX85637.1|  WIP1                                                  96.7    2e-22   Cucumis melo [Oriental melon]
ref|XP_004298304.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      96.3    2e-22   
ref|XP_006661103.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.1    2e-22   
emb|CDY29624.1|  BnaA05g15460D                                        96.3    2e-22   
ref|XP_009144966.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      96.3    2e-22   
ref|XP_003627702.1|  Zinc finger-like protein                         96.3    2e-22   
ref|XP_010031820.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      96.3    2e-22   
ref|XP_007145633.1|  hypothetical protein PHAVU_007G255500g           96.3    2e-22   
ref|XP_009364992.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      96.7    2e-22   
ref|XP_004496311.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.5    2e-22   
ref|XP_004510958.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...  96.3    2e-22   
ref|XP_007140559.1|  hypothetical protein PHAVU_008G122800g           95.5    2e-22   
ref|XP_003576402.1|  PREDICTED: protein TRANSPARENT TESTA 1           95.9    2e-22   
ref|XP_004295197.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.9    3e-22   
emb|CDX72006.1|  BnaC08g28680D                                        96.3    3e-22   
ref|XP_009139023.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.9    3e-22   
gb|EMS56204.1|  Protein TRANSPARENT TESTA 1                           94.7    3e-22   
ref|XP_002460014.1|  hypothetical protein SORBIDRAFT_02g020840        95.9    3e-22   Sorghum bicolor [broomcorn]
ref|XP_008352513.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.9    3e-22   
ref|XP_006345504.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.5    3e-22   
ref|XP_006347241.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.9    3e-22   
emb|CDY06083.1|  BnaA09g36970D                                        95.9    3e-22   
ref|XP_009795232.1|  PREDICTED: protein TRANSPARENT TESTA 1           95.9    3e-22   
ref|XP_004493528.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.9    3e-22   
gb|EPS74449.1|  hypothetical protein M569_00308                       92.4    4e-22   
ref|XP_002304767.2|  hypothetical protein POPTR_0003s20400g           95.5    4e-22   Populus trichocarpa [western balsam poplar]
gb|EMT27915.1|  Protein TRANSPARENT TESTA 1                           95.1    4e-22   
ref|XP_008392201.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.5    4e-22   
ref|XP_004136115.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.1    4e-22   
ref|XP_011042088.1|  PREDICTED: zinc finger protein WIP2-like         95.5    4e-22   
ref|XP_001776296.1|  predicted protein                                94.4    4e-22   
ref|XP_004241317.1|  PREDICTED: protein TRANSPARENT TESTA 1           95.1    4e-22   
gb|KFK39406.1|  hypothetical protein AALP_AA3G240700                  95.5    5e-22   
ref|XP_008351586.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    5e-22   
ref|NP_001150708.1|  zinc finger, C2H2 type family protein            95.5    5e-22   Zea mays [maize]
gb|EYU46275.1|  hypothetical protein MIMGU_mgv1a019930mg              95.5    5e-22   
dbj|BAD36700.1|  putative WIP1 protein                                95.5    5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08540.1|  hypothetical protein OsI_30809                        95.5    5e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_006482890.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.1    5e-22   
ref|XP_010227506.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.1    6e-22   
emb|CDY27556.1|  BnaC01g32390D                                        95.1    6e-22   
ref|XP_009110075.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      95.1    6e-22   
ref|XP_009415409.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    6e-22   
emb|CDY57920.1|  BnaA01g36760D                                        95.1    6e-22   
ref|XP_004158240.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    6e-22   
emb|CDP20881.1|  unnamed protein product                              94.7    6e-22   
ref|XP_010089843.1|  Protein TRANSPARENT TESTA 1                      94.7    7e-22   
ref|XP_002976646.1|  hypothetical protein SELMODRAFT_36986            92.8    7e-22   
ref|XP_002973204.1|  hypothetical protein SELMODRAFT_36987            92.8    7e-22   
gb|ACU19877.1|  unknown                                               94.7    7e-22   Glycine max [soybeans]
ref|NP_188724.2|  WIP domain protein 4                                95.5    7e-22   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA39869.1|  TPA: zinc finger, C2H2 type family protein           95.1    7e-22   
gb|EYU18350.1|  hypothetical protein MIMGU_mgv1a023897mg              95.1    7e-22   
dbj|BAK01075.1|  predicted protein                                    94.7    7e-22   
ref|XP_003547110.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    7e-22   
ref|XP_009395241.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    7e-22   
ref|XP_008349934.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    8e-22   
ref|XP_004513647.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    8e-22   
ref|XP_006446092.1|  hypothetical protein CICLE_v10017716mg           94.7    8e-22   
ref|XP_002277045.1|  PREDICTED: zinc finger protein WIP3              94.7    8e-22   Vitis vinifera
ref|XP_009395527.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    8e-22   
ref|NP_001150040.1|  zinc finger, C2H2 type family protein            94.7    8e-22   Zea mays [maize]
gb|EMS54305.1|  Protein TRANSPARENT TESTA 1                           94.0    8e-22   
ref|XP_010686027.1|  PREDICTED: zinc finger protein WIP3              94.7    9e-22   
ref|XP_002313674.2|  hypothetical protein POPTR_0009s14590g           94.4    9e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008461280.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.4    9e-22   
ref|XP_011045037.1|  PREDICTED: zinc finger protein WIP3 isoform X1   94.4    9e-22   
ref|NP_001058064.1|  Os06g0612300                                     95.5    9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008663470.1|  PREDICTED: uncharacterized protein LOC103641945  95.1    9e-22   
dbj|BAB02496.1|  zinc finger-like protein                             94.4    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597443.1|  Zinc finger-like protein                         94.4    1e-21   
ref|XP_011037986.1|  PREDICTED: zinc finger protein WIP2-like         94.4    1e-21   
gb|EEC80967.1|  hypothetical protein OsI_23689                        94.4    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010475619.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.0    1e-21   
ref|XP_007015850.1|  WIP domain protein 3                             94.4    1e-21   
ref|NP_001175646.1|  Os08g0504000                                     91.7    1e-21   
ref|XP_001783334.1|  predicted protein                                91.7    1e-21   
ref|XP_003535504.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.6    1e-21   
ref|XP_002437277.1|  hypothetical protein SORBIDRAFT_10g024040        94.7    1e-21   Sorghum bicolor [broomcorn]
gb|KHN33339.1|  Protein TRANSPARENT TESTA 1                           94.0    1e-21   
ref|XP_010521663.1|  PREDICTED: protein TRANSPARENT TESTA 1           94.0    1e-21   
ref|XP_003555454.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.6    1e-21   
ref|XP_010045228.1|  PREDICTED: protein TRANSPARENT TESTA 1           94.0    2e-21   
ref|XP_008649306.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.4    2e-21   
ref|XP_003572359.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.7    2e-21   
ref|XP_010557407.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.0    2e-21   
ref|XP_008449944.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.9    2e-21   
ref|XP_002885409.1|  hypothetical protein ARALYDRAFT_318837           94.0    2e-21   
ref|NP_001144611.1|  uncharacterized protein LOC100277627             94.7    2e-21   Zea mays [maize]
tpg|DAA62022.1|  TPA: zinc finger protein                             94.7    2e-21   
ref|XP_004486954.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.6    2e-21   
ref|XP_004291611.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.6    2e-21   
ref|XP_002297782.2|  hypothetical protein POPTR_0001s05630g           93.6    2e-21   Populus trichocarpa [western balsam poplar]
dbj|BAG88834.1|  unnamed protein product                              90.9    2e-21   
ref|NP_001063518.1|  Os09g0485600                                     90.9    2e-21   
emb|CDP07762.1|  unnamed protein product                              93.6    2e-21   
ref|XP_004965894.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      94.0    2e-21   
ref|XP_008813791.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.2    2e-21   
gb|EPS60506.1|  hypothetical protein M569_14297                       92.0    2e-21   
ref|XP_004516564.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.6    2e-21   
ref|XP_007133835.1|  hypothetical protein PHAVU_011G212900g           93.2    2e-21   
ref|XP_009148084.1|  PREDICTED: protein TRANSPARENT TESTA 1           93.2    2e-21   
emb|CDX95075.1|  BnaC05g05960D                                        93.2    2e-21   
ref|XP_009116471.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  93.6    2e-21   
ref|XP_003543541.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.2    2e-21   
ref|XP_011087571.1|  PREDICTED: zinc finger protein WIP2-like         93.2    3e-21   
gb|KFK35868.1|  hypothetical protein AALP_AA4G047200                  92.8    3e-21   
gb|ABR21212.1|  WIP4                                                  92.8    3e-21   
ref|XP_002460444.1|  hypothetical protein SORBIDRAFT_02g028220        94.4    3e-21   
ref|NP_001241401.1|  uncharacterized protein LOC100802773             92.8    3e-21   
gb|KDO58061.1|  hypothetical protein CISIN_1g039549mg                 92.8    3e-21   
ref|XP_006424259.1|  hypothetical protein CICLE_v10028757mg           93.2    3e-21   
ref|XP_006592748.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...  92.8    3e-21   
ref|XP_010274048.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    3e-21   
ref|XP_004973849.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.6    3e-21   
ref|XP_010438939.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    3e-21   
ref|XP_006487965.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    3e-21   
ref|XP_002305556.1|  hypothetical protein POPTR_0004s19460g           92.8    3e-21   
ref|XP_010458063.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    3e-21   
gb|EAZ09551.1|  hypothetical protein OsI_31828                        94.0    3e-21   
dbj|BAJ88029.1|  predicted protein                                    93.6    3e-21   
ref|XP_003538121.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...  92.8    3e-21   
ref|XP_006591084.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...  92.8    3e-21   
dbj|BAD08819.1|  putative transparent testa                           94.0    3e-21   
ref|XP_010271690.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    3e-21   
gb|KHN38637.1|  Protein TRANSPARENT TESTA 1                           92.8    3e-21   
ref|XP_010673606.1|  PREDICTED: zinc finger protein WIP2              92.8    4e-21   
ref|XP_003539062.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    4e-21   
ref|XP_010488679.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    4e-21   
ref|XP_004515204.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    4e-21   
ref|XP_008391103.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.4    4e-21   
ref|XP_003576670.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      93.2    4e-21   
emb|CBI19172.3|  unnamed protein product                              92.4    4e-21   
ref|XP_002445917.1|  hypothetical protein SORBIDRAFT_07g028010        93.6    4e-21   
gb|EAZ45173.1|  hypothetical protein OsJ_29814                        93.6    4e-21   
ref|XP_006305247.1|  hypothetical protein CARUB_v10009617mg           92.8    4e-21   
ref|XP_009342737.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.4    4e-21   
ref|XP_007148861.1|  hypothetical protein PHAVU_005G020400g           92.4    4e-21   
ref|XP_004142226.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.8    4e-21   
gb|KGN54168.1|  hypothetical protein Csa_4G290830                     92.8    4e-21   
ref|XP_003606141.1|  hypothetical protein MTR_4g053560                92.4    5e-21   
ref|NP_001140483.1|  uncharacterized protein LOC100272543             92.8    5e-21   
gb|KHN27654.1|  Protein TRANSPARENT TESTA 1                           92.4    5e-21   
ref|XP_004162102.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.0    5e-21   
ref|XP_003539466.1|  PREDICTED: protein TRANSPARENT TESTA 1-like ...  92.4    5e-21   
ref|XP_003541972.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.4    5e-21   
ref|XP_007132422.1|  hypothetical protein PHAVU_011G093300g           92.4    5e-21   
ref|XP_007150080.1|  hypothetical protein PHAVU_005G124800g           92.0    5e-21   
gb|EMS51405.1|  Protein TRANSPARENT TESTA 1                           91.7    5e-21   
gb|KHN21142.1|  Protein TRANSPARENT TESTA 1                           90.9    6e-21   
gb|AFW76307.1|  hypothetical protein ZEAMMB73_297211                  90.9    6e-21   
gb|KHN30129.1|  Protein TRANSPARENT TESTA 1                           91.7    6e-21   
ref|XP_002513936.1|  TRANSPARENT TESTA 1 protein, putative            91.7    6e-21   
ref|XP_009354729.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.4    6e-21   
ref|XP_009406280.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.0    6e-21   
ref|XP_009418869.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.0    6e-21   
ref|XP_008378253.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.0    7e-21   
gb|ACU21319.1|  unknown                                               92.0    7e-21   
ref|XP_006660256.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      91.3    7e-21   
ref|XP_006853201.1|  hypothetical protein AMTR_s00038p00210940        89.0    7e-21   
ref|XP_009364303.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      92.0    7e-21   
ref|XP_010910253.1|  PREDICTED: zinc finger protein WIP3-like         91.7    7e-21   
ref|XP_009384245.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      91.7    7e-21   
ref|XP_008228977.1|  PREDICTED: protein TRANSPARENT TESTA 1           91.7    7e-21   
ref|XP_007207163.1|  hypothetical protein PRUPE_ppa023619mg           91.7    8e-21   
ref|XP_010064216.1|  PREDICTED: protein TRANSPARENT TESTA 1           91.3    8e-21   
ref|XP_003627731.1|  Zinc finger-like protein                         89.4    8e-21   
ref|XP_002275710.2|  PREDICTED: zinc finger protein WIP2-like         91.7    9e-21   
ref|XP_002892452.1|  zinc finger protein                              91.7    1e-20   
gb|KCW66539.1|  hypothetical protein EUGRSUZ_F00336                   90.9    1e-20   
emb|CBI24873.3|  unnamed protein product                              91.3    1e-20   
ref|XP_010448488.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      91.7    1e-20   
ref|XP_004505848.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.9    1e-20   
ref|XP_006417709.1|  hypothetical protein EUTSA_v10008125mg           91.3    1e-20   
ref|NP_172306.1|  WIP domain protein 3                                91.3    1e-20   
dbj|BAJ90433.1|  predicted protein                                    92.0    1e-20   
ref|XP_009374106.1|  PREDICTED: protein TRANSPARENT TESTA 1           91.3    1e-20   
ref|XP_011046282.1|  PREDICTED: zinc finger protein WIP3-like         91.3    1e-20   
gb|EMT12137.1|  Protein TRANSPARENT TESTA 1                           90.5    1e-20   
ref|XP_008379354.1|  PREDICTED: protein TRANSPARENT TESTA 1           90.9    1e-20   
ref|XP_007132003.1|  hypothetical protein PHAVU_011G058600g           91.3    1e-20   
emb|CDY22690.1|  BnaC08g43240D                                        91.3    1e-20   
ref|XP_003566203.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      91.3    1e-20   
emb|CDX93575.1|  BnaA06g04730D                                        91.3    1e-20   
gb|KHN24343.1|  Protein TRANSPARENT TESTA 1                           90.1    1e-20   
gb|KDP41395.1|  hypothetical protein JCGZ_15802                       90.9    2e-20   
ref|XP_003542356.2|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.1    2e-20   
emb|CDY06308.1|  BnaA09g48950D                                        90.9    2e-20   
ref|XP_007150382.1|  hypothetical protein PHAVU_005G148600g           90.9    2e-20   
ref|XP_006300196.1|  hypothetical protein CARUB_v10016432mg           90.9    2e-20   
ref|XP_004506167.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.9    2e-20   
ref|XP_003544798.1|  PREDICTED: protein TRANSPARENT TESTA 1           90.1    2e-20   
ref|NP_001055679.1|  Os05g0444200                                     91.3    2e-20   
emb|CAC86165.1|  WIP1 protein                                         90.1    2e-20   
gb|ACU19504.1|  unknown                                               90.1    2e-20   
gb|EAY98224.1|  hypothetical protein OsI_20137                        91.3    2e-20   
ref|XP_008804851.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.5    2e-20   
ref|XP_008375258.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.9    2e-20   
ref|NP_172787.1|  protein DOT5                                        90.5    2e-20   
ref|XP_010458780.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.1    2e-20   
ref|XP_003531439.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.5    2e-20   
ref|XP_002892738.1|  zinc finger family protein                       90.1    3e-20   
gb|KFK43594.1|  hypothetical protein AALP_AA1G146400                  90.1    3e-20   
ref|XP_009761488.1|  PREDICTED: protein TRANSPARENT TESTA 1           90.1    3e-20   
ref|XP_006304718.1|  hypothetical protein CARUB_v10012013mg           90.1    3e-20   
ref|XP_010495185.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      90.1    3e-20   
gb|KFK43143.1|  hypothetical protein AALP_AA1G085500                  89.7    3e-20   
ref|XP_010476325.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.7    3e-20   
ref|XP_009402618.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.4    4e-20   
ref|XP_010913089.1|  PREDICTED: zinc finger protein WIP3-like         89.7    4e-20   
ref|XP_006363312.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.4    4e-20   
ref|XP_009148529.1|  PREDICTED: protein TRANSPARENT TESTA 1           90.1    4e-20   
ref|XP_011090357.1|  PREDICTED: zinc finger protein WIP3              89.4    5e-20   
ref|XP_006417136.1|  hypothetical protein EUTSA_v10009489mg           89.7    5e-20   
ref|XP_008219455.1|  PREDICTED: protein TRANSPARENT TESTA 1           89.4    5e-20   
ref|XP_009614226.1|  PREDICTED: protein TRANSPARENT TESTA 1           89.4    5e-20   
dbj|BAJ92261.1|  predicted protein                                    89.7    5e-20   
ref|XP_003596796.1|  Protein TRANSPARENT TESTA                        89.4    5e-20   
ref|XP_007225090.1|  hypothetical protein PRUPE_ppa016755mg           89.0    6e-20   
gb|EEC83838.1|  hypothetical protein OsI_29790                        90.5    6e-20   
ref|XP_010908183.1|  PREDICTED: zinc finger protein WIP3-like         89.0    6e-20   
gb|KHN47699.1|  Protein TRANSPARENT TESTA 1                           88.2    6e-20   
ref|XP_004139578.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.4    6e-20   
gb|KHN29222.1|  Protein TRANSPARENT TESTA 1                           89.0    6e-20   
ref|XP_008461629.1|  PREDICTED: protein TRANSPARENT TESTA 1           89.4    6e-20   
ref|XP_010501453.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      87.4    7e-20   
ref|XP_009118382.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.4    7e-20   
ref|XP_004238530.1|  PREDICTED: protein TRANSPARENT TESTA 1           88.2    7e-20   
gb|KHN25249.1|  Protein TRANSPARENT TESTA 1                           89.0    7e-20   
emb|CDX97995.1|  BnaA06g07460D                                        89.0    7e-20   
ref|XP_010098614.1|  Protein TRANSPARENT TESTA 1                      88.6    8e-20   
ref|XP_008812244.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.0    8e-20   
dbj|BAJ94276.1|  predicted protein                                    86.7    8e-20   
emb|CDY19385.1|  BnaC05g08940D                                        89.0    8e-20   
gb|EPS60033.1|  hypothetical protein M569_14770                       87.4    8e-20   
ref|XP_004970649.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      86.7    8e-20   
gb|KHN21898.1|  Protein TRANSPARENT TESTA 1                           88.2    9e-20   
ref|XP_007141186.1|  hypothetical protein PHAVU_008G174200g           88.2    9e-20   
ref|NP_001044864.1|  Os01g0859100                                     89.4    1e-19   
ref|NP_001062772.1|  Os09g0282300                                     88.6    1e-19   
gb|EAZ08432.1|  hypothetical protein OsI_30698                        88.6    1e-19   
dbj|BAD82058.1|  putative zinc finger protein                         89.0    1e-19   
ref|XP_004961925.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.4    1e-19   
ref|XP_010676259.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      88.2    1e-19   
ref|XP_002439878.1|  hypothetical protein SORBIDRAFT_09g021850        89.4    1e-19   
ref|XP_004487506.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      88.2    1e-19   
ref|XP_002301059.2|  hypothetical protein POPTR_0002s09840g           87.8    1e-19   
ref|XP_007018746.1|  C2H2 and C2HC zinc fingers superfamily protein   87.8    1e-19   
ref|XP_006433965.1|  hypothetical protein CICLE_v10003648mg           87.8    2e-19   
gb|ABK22978.1|  unknown                                               87.4    2e-19   
gb|KHG04066.1|  Protein TRANSPARENT TESTA 1 -like protein             87.8    2e-19   
ref|XP_008649681.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      89.0    2e-19   
ref|XP_010244598.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      88.2    2e-19   
ref|XP_006473007.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      87.8    2e-19   
gb|EYU36492.1|  hypothetical protein MIMGU_mgv1a011923mg              87.8    2e-19   
ref|XP_003564660.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      88.2    2e-19   
ref|XP_002458800.1|  hypothetical protein SORBIDRAFT_03g040490        88.6    2e-19   
ref|XP_011074196.1|  PREDICTED: protein TRANSPARENT TESTA 1           87.4    2e-19   
emb|CDM80077.1|  unnamed protein product                              87.8    3e-19   
gb|KHN07699.1|  Protein TRANSPARENT TESTA 1                           87.4    3e-19   
ref|XP_003545973.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      87.4    3e-19   
ref|XP_010092005.1|  Protein TRANSPARENT TESTA 1                      87.0    3e-19   
gb|EPS68326.1|  hypothetical protein M569_06444                       85.1    3e-19   
gb|EMT24611.1|  Protein TRANSPARENT TESTA 1                           87.4    4e-19   
ref|XP_004301931.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      86.7    4e-19   
ref|XP_011016612.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  86.3    5e-19   
ref|XP_002284131.1|  PREDICTED: protein TRANSPARENT TESTA 1           86.3    6e-19   
emb|CDP01071.1|  unnamed protein product                              86.3    7e-19   
dbj|BAJ90620.1|  predicted protein                                    86.3    7e-19   
dbj|BAJ88681.1|  predicted protein                                    85.9    8e-19   
ref|XP_009114722.1|  PREDICTED: protein TRANSPARENT TESTA 1           85.9    9e-19   
emb|CDY03134.1|  BnaC06g08390D                                        85.5    1e-18   
gb|AAS79539.1|  At1g34790                                             85.9    1e-18   
ref|NP_174737.2|  protein TRANSPARENT TESTA 1                         85.9    1e-18   
ref|XP_006397425.1|  hypothetical protein EUTSA_v10001872mg           85.5    1e-18   
gb|KFK23380.1|  hypothetical protein AALP_AAs59400U000200             85.5    1e-18   
gb|AAL66407.1|AF190299_1  transparent testa 1                         85.5    1e-18   
emb|CDY12025.1|  BnaAnng02100D                                        85.5    1e-18   
emb|CDY26642.1|  BnaA09g46350D                                        85.1    1e-18   
ref|XP_002891159.1|  At1g34790                                        85.1    2e-18   
ref|XP_004959330.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      82.8    2e-18   
ref|XP_006306363.1|  hypothetical protein CARUB_v10012266mg           84.7    2e-18   
ref|XP_010500011.1|  PREDICTED: protein TRANSPARENT TESTA 1           84.3    3e-18   
ref|XP_010543922.1|  PREDICTED: protein TRANSPARENT TESTA 1           84.3    3e-18   
ref|XP_010461287.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      84.3    3e-18   
ref|NP_001046191.2|  Os02g0196100                                     83.6    4e-18   
ref|XP_010478920.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      84.0    4e-18   
gb|EEC72675.1|  hypothetical protein OsI_06231                        84.0    5e-18   
ref|XP_002462102.1|  hypothetical protein SORBIDRAFT_02g019110        83.6    6e-18   
ref|XP_003576382.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      83.6    6e-18   
ref|XP_008656238.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      82.8    3e-17   
ref|XP_010032420.1|  PREDICTED: protein TRANSPARENT TESTA 1-like      81.3    5e-17   
gb|KCW51817.1|  hypothetical protein EUGRSUZ_J01266                   80.9    5e-17   
gb|EYU36073.1|  hypothetical protein MIMGU_mgv1a022635mg              79.7    2e-16   
gb|EAZ37626.1|  hypothetical protein OsJ_21961                        73.2    6e-14   
ref|XP_011045046.1|  PREDICTED: zinc finger protein WIP3 isoform X2   70.9    2e-13   
gb|KDO53761.1|  hypothetical protein CISIN_1g0372342mg                67.0    5e-13   
gb|EMS63910.1|  Protein TRANSPARENT TESTA 1                           68.6    4e-12   
ref|XP_006426804.1|  hypothetical protein CICLE_v10027410mg           65.1    2e-11   
gb|EAZ44051.1|  hypothetical protein OsJ_28672                        64.3    9e-11   
ref|XP_009620710.1|  PREDICTED: zinc finger protein NUTCRACKER-like   63.2    6e-10   
ref|XP_010026140.1|  PREDICTED: zinc finger protein NUTCRACKER-like   63.2    6e-10   
gb|KCW58517.1|  hypothetical protein EUGRSUZ_H01190                   63.2    6e-10   
ref|XP_004247541.1|  PREDICTED: zinc finger protein NUTCRACKER-like   63.2    6e-10   
ref|XP_010680044.1|  PREDICTED: zinc finger protein JACKDAW           62.8    7e-10   
ref|XP_002269036.2|  PREDICTED: zinc finger protein NUTCRACKER        62.8    9e-10   
ref|XP_006359407.1|  PREDICTED: zinc finger protein JACKDAW-like      62.4    1e-09   
ref|XP_010093357.1|  Zinc finger protein MAGPIE                       62.4    1e-09   
ref|XP_011079713.1|  PREDICTED: zinc finger protein NUTCRACKER-like   62.4    1e-09   
ref|XP_006355017.1|  PREDICTED: zinc finger protein JACKDAW-like ...  62.4    1e-09   
ref|XP_007045371.1|  Indeterminate(ID)-domain 5, putative isoform 6   62.4    1e-09   
ref|XP_007045372.1|  Indeterminate(ID)-domain 5, putative isoform 1   62.4    1e-09   
ref|XP_004236896.1|  PREDICTED: zinc finger protein JACKDAW-like ...  62.4    1e-09   
ref|XP_006355018.1|  PREDICTED: zinc finger protein JACKDAW-like ...  62.0    1e-09   



>ref|XP_008442237.1| PREDICTED: protein TRANSPARENT TESTA 1 [Cucumis melo]
Length=366

 Score =   103 bits (258),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  276  THYKRKHGLKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  323



>ref|XP_002526735.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
 gb|EEF35649.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
Length=344

 Score =   103 bits (257),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  256  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  303



>gb|KDP37348.1| hypothetical protein JCGZ_06802 [Jatropha curcas]
Length=376

 Score =   103 bits (256),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  291  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  338



>ref|XP_010246927.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nelumbo nucifera]
Length=339

 Score =   102 bits (255),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  251  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  298



>ref|XP_002277537.1| PREDICTED: zinc finger protein WIP2 [Vitis vinifera]
Length=345

 Score =   102 bits (255),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  257  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  304



>ref|XP_010265244.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nelumbo nucifera]
Length=285

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK FACRKCGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  192  THYKRKHGAKPFACRKCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  239



>ref|XP_009593388.1| PREDICTED: protein TRANSPARENT TESTA 1 [Nicotiana tomentosiformis]
Length=360

 Score =   102 bits (254),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  272  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  319



>ref|XP_011080270.1| PREDICTED: zinc finger protein WIP2-like [Sesamum indicum]
Length=361

 Score =   102 bits (254),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  272  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  319



>ref|XP_010647907.1| PREDICTED: zinc finger protein WIP6 [Vitis vinifera]
 emb|CBI27059.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F+CRKCGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  183  THYKRKHGAKPFSCRKCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  230



>ref|XP_010695304.1| PREDICTED: zinc finger protein WIP5-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=418

 Score =   102 bits (254),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAV+GDW+THEKNCGR+W+C+CGSDFKH
Sbjct  331  THYKRKHGVKPFMCRKCGKAFAVKGDWRTHEKNCGRVWYCVCGSDFKH  378



>emb|CBI29881.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   101 bits (252),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  227  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  274



>ref|XP_010105333.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
 gb|EXC04354.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
Length=423

 Score =   101 bits (252),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  335  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  382



>ref|XP_011033300.1| PREDICTED: zinc finger protein WIP2-like [Populus euphratica]
Length=359

 Score =   101 bits (251),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  271  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  318



>ref|XP_010262985.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nelumbo nucifera]
Length=283

 Score =   100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  191  THYKRKHGAKPFGCRKCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  238



>ref|XP_008795700.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Phoenix dactylifera]
Length=330

 Score =   100 bits (250),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  242  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  289



>ref|XP_009624990.1| PREDICTED: protein TRANSPARENT TESTA 1 [Nicotiana tomentosiformis]
Length=345

 Score =   101 bits (251),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  255  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  302



>ref|XP_009391814.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=341

 Score =   100 bits (250),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  250  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  297



>ref|XP_010695311.1| PREDICTED: protein TRANSPARENT TESTA 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=390

 Score =   101 bits (251),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAV+GDW+THEKNCGR+W+C+CGSDFKH
Sbjct  303  THYKRKHGVKPFMCRKCGKAFAVKGDWRTHEKNCGRVWYCVCGSDFKH  350



>emb|CBI16404.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   100 bits (250),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  245  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCACGSDFKH  292



>ref|XP_006361385.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Solanum tuberosum]
Length=318

 Score =   100 bits (249),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  226  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  273



>emb|CDY06390.1| BnaC05g31400D [Brassica napus]
Length=334

 Score =   100 bits (250),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ FACR+CGKAFAV+GDW+THEKNCGRLW+C CGSDFKH
Sbjct  247  THYKRKHGARPFACRRCGKAFAVKGDWRTHEKNCGRLWYCSCGSDFKH  294



>ref|XP_004305379.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Fragaria vesca subsp. 
vesca]
Length=379

 Score =   100 bits (250),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  294  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  341



>ref|XP_009780788.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nicotiana sylvestris]
Length=342

 Score =   100 bits (249),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  252  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  299



>ref|XP_009417317.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   100 bits (249),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAV+GDW+THEKNCG+LW+C+CGSDFKH
Sbjct  243  THYKRKHGIKPFMCRKCGKAFAVKGDWRTHEKNCGKLWYCVCGSDFKH  290



>ref|XP_002323306.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF05067.1| zinc finger family protein [Populus trichocarpa]
Length=358

 Score =   100 bits (250),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  270  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  317



>ref|XP_008465836.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis melo]
Length=289

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F+CRKCGK+FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  187  THYKRKHGAKPFSCRKCGKSFAVRGDWRTHEKNCGKLWFCICGSDFKH  234



>ref|XP_009400647.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=161

 Score = 97.8 bits (242),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ FACR+CGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  63   THYKRKHGARSFACRRCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  110



>ref|XP_007028866.1| C2H2-type zinc finger family protein [Theobroma cacao]
 gb|EOY09368.1| C2H2-type zinc finger family protein [Theobroma cacao]
Length=361

 Score =   100 bits (249),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  273  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  320



>ref|XP_004140390.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus]
 gb|KGN50949.1| hypothetical protein Csa_5G365160 [Cucumis sativus]
Length=286

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F+CRKCGK+FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  184  THYKRKHGAKPFSCRKCGKSFAVRGDWRTHEKNCGKLWFCICGSDFKH  231



>ref|XP_009405574.1| PREDICTED: protein TRANSPARENT TESTA 1-like, partial [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 99.8 bits (247),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG + FACR+CGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  195  THYKRKHGVRPFACRRCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  242



>ref|XP_003521192.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
 gb|KHN07394.1| Protein TRANSPARENT TESTA 1 [Glycine soja]
Length=358

 Score =   100 bits (249),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  269  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  316



>ref|XP_009356291.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Pyrus x bretschneideri]
Length=291

 Score =   100 bits (248),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  197  THYKRKHGTKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  244



>gb|KGN54875.1| hypothetical protein Csa_4G571220 [Cucumis sativus]
Length=335

 Score =   100 bits (248),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  245  THYKRKHGLKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  292



>ref|XP_010695319.1| PREDICTED: zinc finger protein WIP5-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=381

 Score =   100 bits (249),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAV+GDW+THEKNCGR+W+C+CGSDFKH
Sbjct  294  THYKRKHGVKPFMCRKCGKAFAVKGDWRTHEKNCGRVWYCVCGSDFKH  341



>ref|XP_006573265.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
 gb|KHN42481.1| Protein TRANSPARENT TESTA 1 [Glycine soja]
Length=332

 Score =   100 bits (248),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCGRLWFCICGSDFKH
Sbjct  230  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGRLWFCICGSDFKH  277



>ref|XP_010524180.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Tarenaya hassleriana]
Length=374

 Score =   100 bits (249),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C+CGSDFKH
Sbjct  277  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCLCGSDFKH  324



>ref|XP_007046299.1| C2H2-like zinc finger protein [Theobroma cacao]
 gb|EOY02131.1| C2H2-like zinc finger protein [Theobroma cacao]
Length=291

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  190  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  237



>ref|XP_004513518.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cicer arietinum]
Length=298

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  188  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  235



>ref|XP_006484574.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Citrus sinensis]
Length=296

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  191  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  238



>gb|KDO70084.1| hypothetical protein CISIN_1g046329mg, partial [Citrus sinensis]
Length=280

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  191  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  238



>ref|XP_010927153.1| PREDICTED: zinc finger protein WIP6-like [Elaeis guineensis]
Length=311

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ F CR+CGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  211  THYKRKHGARPFGCRRCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  258



>ref|XP_007208550.1| hypothetical protein PRUPE_ppa024429mg [Prunus persica]
 gb|EMJ09749.1| hypothetical protein PRUPE_ppa024429mg [Prunus persica]
Length=375

 Score =   100 bits (248),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  288  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  335



>ref|XP_010528971.1| PREDICTED: protein TRANSPARENT TESTA 1 [Tarenaya hassleriana]
Length=296

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGKAFAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  178  THYKRKHGAKPFGCRKCGKAFAVRGDWRTHEKNCGKLWFCVCGSDFKH  225



>ref|XP_010481105.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Camelina sativa]
Length=345

 Score =   100 bits (248),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  250  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  297



>gb|EMT05403.1| Protein TRANSPARENT TESTA 1 [Aegilops tauschii]
Length=354

 Score =   100 bits (248),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CR+CGKAFAV+GDW+THEKNCG+LW+C+CGS+FKH
Sbjct  259  THYKRKHGLKPFLCRRCGKAFAVKGDWRTHEKNCGKLWYCLCGSEFKH  306



>ref|XP_006437731.1| hypothetical protein CICLE_v10033535mg [Citrus clementina]
 gb|ESR50971.1| hypothetical protein CICLE_v10033535mg [Citrus clementina]
Length=296

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  191  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  238



>ref|XP_003614466.1| Zinc finger-like protein [Medicago truncatula]
Length=391

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  188  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  235



>ref|XP_006833554.1| hypothetical protein AMTR_s00093p00164790 [Amborella trichopoda]
 gb|ERM98832.1| hypothetical protein AMTR_s00093p00164790 [Amborella trichopoda]
Length=335

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK FACRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  211  THYKRKHGAKPFACRKCGKLFAVRGDWRTHEKNCGKLWFCICGSDFKH  258



>emb|CDP10077.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   100 bits (248),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  258  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  305



>ref|XP_011008503.1| PREDICTED: zinc finger protein WIP6 [Populus euphratica]
Length=275

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  187  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  234



>ref|XP_009104072.1| PREDICTED: protein TRANSPARENT TESTA 1-like isoform X1 [Brassica 
rapa]
Length=418

 Score =   100 bits (249),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  281  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  328



>ref|XP_010547082.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Tarenaya hassleriana]
Length=378

 Score =   100 bits (248),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  282  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  329



>gb|KHG03266.1| Protein TRANSPARENT TESTA 1 -like protein [Gossypium arboreum]
Length=298

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  197  THYKRKHGAKPFECRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  244



>ref|XP_010501954.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Camelina sativa]
Length=346

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  251  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  298



>ref|XP_009792207.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nicotiana sylvestris]
Length=364

 Score =   100 bits (248),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  276  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  323



>gb|KDP29369.1| hypothetical protein JCGZ_18290 [Jatropha curcas]
Length=282

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  185  THYKRKHGAKPFGCRKCGKTFAVRGDWRTHEKNCGKLWFCICGSDFKH  232



>ref|XP_002314883.2| hypothetical protein POPTR_0010s13910g [Populus trichocarpa]
 gb|EEF01054.2| hypothetical protein POPTR_0010s13910g [Populus trichocarpa]
Length=275

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  187  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  234



>ref|XP_009403121.1| PREDICTED: protein SENSITIVE TO PROTON RHIZOTOXICITY 1-like [Musa 
acuminata subsp. malaccensis]
Length=313

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ +ACR+CGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  211  THYKRKHGARPYACRRCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  258



>ref|XP_006850176.1| hypothetical protein AMTR_s00022p00243980 [Amborella trichopoda]
 gb|ERN11757.1| hypothetical protein AMTR_s00022p00243980 [Amborella trichopoda]
Length=311

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  224  THYKRKHGIKPFMCRKCSKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  271



>ref|XP_009390641.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=345

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  254  THYKRKHGIKPFMCRKCGKAFAVKGDWRTHEKNCGKLWYCICGSDFKH  301



>ref|XP_010461955.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Camelina sativa]
Length=345

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  250  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  297



>ref|XP_006574881.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
Length=334

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  224  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  271



>ref|XP_002282950.1| PREDICTED: zinc finger protein WIP2 [Vitis vinifera]
Length=334

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  245  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCACGSDFKH  292



>ref|XP_009405038.1| PREDICTED: zinc finger and BTB domain-containing protein 49-like 
[Musa acuminata subsp. malaccensis]
Length=485

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKR+HG K F CRKC KAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  234  THYKRRHGIKPFVCRKCSKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  281



>ref|XP_007153349.1| hypothetical protein PHAVU_003G027900g [Phaseolus vulgaris]
 gb|ESW25343.1| hypothetical protein PHAVU_003G027900g [Phaseolus vulgaris]
Length=308

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  199  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  246



>ref|XP_006306545.1| hypothetical protein CARUB_v10012613mg [Capsella rubella]
 gb|EOA39443.1| hypothetical protein CARUB_v10012613mg [Capsella rubella]
Length=345

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  250  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  297



>ref|XP_008780503.1| PREDICTED: protein TRANSPARENT TESTA 1-like, partial [Phoenix 
dactylifera]
Length=275

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ F CR+CGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  211  THYKRKHGARPFGCRRCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  258



>ref|XP_008219758.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Prunus mume]
Length=374

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  287  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  334



>gb|KHN12831.1| Protein TRANSPARENT TESTA 1, partial [Glycine soja]
Length=305

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  191  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  238



>gb|AAD30636.1|AC006085_9 Hypothetical protein [Arabidopsis thaliana]
Length=299

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG+K FACR CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  213  THYKRKHGSKPFACRMCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  260



>ref|XP_008791254.1| PREDICTED: protein TRANSPARENT TESTA 1-like, partial [Phoenix 
dactylifera]
Length=280

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ F CR+CGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  217  THYKRKHGARPFGCRRCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  264



>ref|XP_010102319.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
 gb|EXB93280.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
Length=383

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  293  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCSCGSDFKH  340



>ref|XP_009387999.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=350

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  259  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  306



>ref|XP_010924131.1| PREDICTED: zinc finger protein WIP6-like [Elaeis guineensis]
Length=161

 Score = 96.3 bits (238),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ F CR+CGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  63   THYKRKHGARPFGCRRCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  110



>ref|XP_008384541.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Malus domestica]
Length=356

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  269  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  316



>ref|XP_002526768.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
 gb|EEF35622.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
Length=329

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK+FAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  242  THYKRKHGIKPFMCRKCGKSFAVKGDWRTHEKNCGKVWYCVCGSDFKH  289



>ref|XP_010913168.1| PREDICTED: zinc finger protein WIP2 [Elaeis guineensis]
Length=333

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  245  THYKRKHGIKPFMCRKCSKAFAVKGDWRTHEKNCGKLWYCICGSDFKH  292



>ref|XP_003519064.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
 gb|KHN05954.1| Protein TRANSPARENT TESTA 1 [Glycine soja]
Length=371

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  286  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  333



>gb|ACU24084.1| unknown [Glycine max]
Length=371

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  286  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  333



>ref|XP_010110978.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
 gb|EXC29364.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
Length=297

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  195  THYKRKHGAKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  242



>ref|XP_011077223.1| PREDICTED: zinc finger protein WIP6 [Sesamum indicum]
Length=283

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG+K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  192  THYKRKHGSKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  239



>ref|XP_007202337.1| hypothetical protein PRUPE_ppa008185mg [Prunus persica]
 gb|EMJ03536.1| hypothetical protein PRUPE_ppa008185mg [Prunus persica]
Length=342

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  254  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  301



>ref|XP_008392177.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Malus domestica]
Length=348

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  259  THYKRKHGIKHFMCRKCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  306



>gb|EYU39883.1| hypothetical protein MIMGU_mgv1a009268mg [Erythranthe guttata]
Length=347

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  258  THYKRKHGIKPFMCRKCSKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  305



>ref|XP_009796838.1| PREDICTED: protein TRANSPARENT TESTA 1 [Nicotiana sylvestris]
Length=284

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  186  THYKRKHGAKPFTCRKCGKNFAVRGDWRTHEKNCGKLWFCICGSDFKH  233



>gb|ADL36630.1| C2H2L domain class transcription factor [Malus domestica]
Length=348

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  259  THYKRKHGIKHFMCRKCGKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  306



>gb|KDP22072.1| hypothetical protein JCGZ_25903 [Jatropha curcas]
Length=352

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  261  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  308



>ref|XP_008243178.1| PREDICTED: protein TRANSPARENT TESTA 1 [Prunus mume]
Length=294

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG+K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  207  THYKRKHGSKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  254



>ref|XP_009376165.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Pyrus x bretschneideri]
 ref|XP_009379450.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Pyrus x bretschneideri]
Length=355

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  268  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  315



>ref|XP_007014983.1| C2H2-type zinc finger family protein [Theobroma cacao]
 gb|EOY32602.1| C2H2-type zinc finger family protein [Theobroma cacao]
Length=344

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  256  THYKRKHGIKPFMCRKCGKTFAVRGDWRTHEKNCGKLWYCTCGSDFKH  303



>ref|XP_010046596.1| PREDICTED: protein TRANSPARENT TESTA 1 [Eucalyptus grandis]
 gb|KCW86363.1| hypothetical protein EUGRSUZ_B03047 [Eucalyptus grandis]
Length=299

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK FACRKC K FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  198  THYKRKHGAKPFACRKCSKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  245



>ref|XP_009613284.1| PREDICTED: protein TRANSPARENT TESTA 1 [Nicotiana tomentosiformis]
Length=280

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  186  THYKRKHGAKPFTCRKCGKNFAVRGDWRTHEKNCGKLWFCICGSDFKH  233



>gb|KHN22371.1| Protein TRANSPARENT TESTA 1 [Glycine soja]
Length=385

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  301  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  348



>ref|XP_003537201.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
Length=386

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  302  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  349



>ref|XP_011090493.1| PREDICTED: zinc finger protein WIP2 [Sesamum indicum]
Length=321

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K FACRKCGKAFAVRGDW+THEKNCG+LW+C CGS+FKH
Sbjct  235  THYKRKHGIKPFACRKCGKAFAVRGDWRTHEKNCGKLWYCACGSNFKH  282



>emb|CDY22834.1| BnaA06g02430D [Brassica napus]
Length=338

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  243  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  290



>ref|XP_009148198.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Brassica rapa]
Length=337

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  242  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  289



>gb|EPS71120.1| hypothetical protein M569_03639, partial [Genlisea aurea]
Length=260

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K FACRKCGKAFAVRGDW+THEKNCG+LW+C+CGSDFKH
Sbjct  171  THYKRKHGIKPFACRKCGKAFAVRGDWRTHEKNCGKLWYCVCGSDFKH  218



>ref|XP_003553422.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
 gb|KHN26343.1| Protein TRANSPARENT TESTA 1 [Glycine soja]
Length=349

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  260  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  307



>ref|XP_010257283.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nelumbo nucifera]
Length=337

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  249  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  296



>ref|XP_007227701.1| hypothetical protein PRUPE_ppa020013m2g, partial [Prunus persica]
 gb|EMJ28900.1| hypothetical protein PRUPE_ppa020013m2g, partial [Prunus persica]
Length=241

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG+K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  154  THYKRKHGSKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  201



>ref|XP_008240853.1| PREDICTED: protein TRANSPARENT TESTA 1 [Prunus mume]
Length=354

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  266  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  313



>ref|XP_009336615.1| PREDICTED: protein TRANSPARENT TESTA 1 [Pyrus x bretschneideri]
Length=293

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  199  THYKRKHGTKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  246



>ref|XP_003625178.1| Protein TRANSPARENT TESTA [Medicago truncatula]
Length=347

 Score = 98.6 bits (244),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  262  THYKRKHGIKPFMCRKCSKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  309



>gb|KEH43450.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=294

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC K FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  191  THYKRKHGGKSFECRKCRKTFAVRGDWRTHEKNCGKLWFCICGSDFKH  238



>ref|XP_009145538.1| PREDICTED: protein TRANSPARENT TESTA 1 [Brassica rapa]
Length=359

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ FACR+CGKAFAV+GDW+THEKNCGRLW+C CGSDFKH
Sbjct  272  THYKRKHGARPFACRRCGKAFAVKGDWRTHEKNCGRLWYCSCGSDFKH  319



>emb|CDY25224.1| BnaC06g04490D [Brassica napus]
Length=338

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  243  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  290



>ref|XP_007052543.1| TRANSPARENT TESTA 1 protein, putative [Theobroma cacao]
 gb|EOX96700.1| TRANSPARENT TESTA 1 protein, putative [Theobroma cacao]
Length=331

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  243  THYKRKHGIKPFMCRKCEKAFAVKGDWRTHEKNCGKIWYCICGSDFKH  290



>ref|XP_002513471.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
 gb|EEF48874.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
Length=336

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  248  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  295



>ref|XP_010057579.1| PREDICTED: protein TRANSPARENT TESTA 1 [Eucalyptus grandis]
Length=370

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  282  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  329



>ref|XP_010928501.1| PREDICTED: zinc finger protein WIP2-like [Elaeis guineensis]
Length=330

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  242  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  289



>ref|XP_010547254.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Tarenaya hassleriana]
Length=372

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            TH+KRKHGAK F+CR+CGK FAV+GDW+THEKNCGR+WFC+CGSDF+H
Sbjct  288  THFKRKHGAKPFSCRRCGKPFAVKGDWRTHEKNCGRVWFCVCGSDFRH  335



>ref|XP_008339700.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Malus domestica]
Length=291

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  197  THYKRKHGTKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  244



>gb|KDP43464.1| hypothetical protein JCGZ_16751 [Jatropha curcas]
Length=319

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAV+GDW+THEKNCGR WFCICGSDFKH
Sbjct  231  THYKRKHGIKPFMCRKCGKPFAVKGDWRTHEKNCGRFWFCICGSDFKH  278



>ref|XP_009609728.1| PREDICTED: protein TRANSPARENT TESTA 1 [Nicotiana tomentosiformis]
Length=352

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F+CRKCGK FAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  262  THYKRKHGTKAFSCRKCGKTFAVKGDWRTHEKNCGKLWYCICGSDFKH  309



>ref|XP_008390016.1| PREDICTED: protein TRANSPARENT TESTA 1 [Malus domestica]
Length=293

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  199  THYKRKHGTKPFGCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  246



>ref|XP_004234792.2| PREDICTED: protein TRANSPARENT TESTA 1 [Solanum lycopersicum]
Length=325

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  228  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  275



>ref|XP_004170522.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus]
Length=292

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  202  THYKRKHGLKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  249



>ref|XP_009387719.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=355

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  257  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  304



>ref|XP_004144691.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus]
Length=292

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  202  THYKRKHGLKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  249



>ref|XP_009374494.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Pyrus x bretschneideri]
Length=357

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  269  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  316



>ref|XP_010545885.1| PREDICTED: protein SENSITIVE TO PROTON RHIZOTOXICITY 1 [Tarenaya 
hassleriana]
Length=370

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG + FACRKCGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  281  THYKRKHGTRPFACRKCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  328



>ref|XP_008679544.1| PREDICTED: uncharacterized protein LOC103654491 [Zea mays]
 gb|AFW65203.1| hypothetical protein ZEAMMB73_775982 [Zea mays]
Length=415

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAV+GDW+THEKNCGRLW+C+CGS+FKH
Sbjct  321  THYKRKHGLKPFLCRKCGKAFAVKGDWRTHEKNCGRLWYCLCGSEFKH  368



>ref|XP_009391887.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=361

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  258  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  305



>ref|XP_007162251.1| hypothetical protein PHAVU_001G136700g [Phaseolus vulgaris]
 gb|ESW34245.1| hypothetical protein PHAVU_001G136700g [Phaseolus vulgaris]
Length=347

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  258  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  305



>emb|CDP00581.1| unnamed protein product [Coffea canephora]
Length=285

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  196  THYKRKHGTKPFQCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  243



>ref|XP_002314032.2| hypothetical protein POPTR_0009s06700g [Populus trichocarpa]
 gb|EEE87987.2| hypothetical protein POPTR_0009s06700g [Populus trichocarpa]
Length=325

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK+FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  237  THYKRKHGIKPFMCRKCGKSFAVKGDWRTHEKNCGKIWYCICGSDFKH  284



>ref|XP_004151309.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus]
Length=304

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  220  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  267



>ref|XP_006493895.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Citrus sinensis]
Length=375

 Score = 98.2 bits (243),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  287  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  334



>ref|XP_006362569.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Solanum tuberosum]
Length=285

 Score = 97.4 bits (241),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAVRGDW+THEKNCG++WFCICGSDFKH
Sbjct  192  THYKRKHGAKPFNCRKCGKNFAVRGDWRTHEKNCGKIWFCICGSDFKH  239



>gb|KDO57204.1| hypothetical protein CISIN_1g040794mg [Citrus sinensis]
Length=375

 Score = 98.2 bits (243),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  287  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  334



>ref|XP_004956529.1| PREDICTED: zinc finger protein STOP1 homolog [Setaria italica]
Length=355

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCGRLWFC+CGSDFKH
Sbjct  250  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGRLWFCVCGSDFKH  297



>ref|XP_008808222.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Phoenix dactylifera]
Length=147

 Score = 94.7 bits (234),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  59   THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  106



>ref|XP_011075201.1| PREDICTED: zinc finger protein WIP2 [Sesamum indicum]
Length=328

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  243  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  290



>ref|XP_006421457.1| hypothetical protein CICLE_v10005189mg [Citrus clementina]
 gb|ESR34697.1| hypothetical protein CICLE_v10005189mg [Citrus clementina]
Length=375

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  287  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  334



>ref|XP_011025425.1| PREDICTED: zinc finger protein WIP2-like [Populus euphratica]
Length=323

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK+FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  235  THYKRKHGIKPFMCRKCGKSFAVKGDWRTHEKNCGKIWYCICGSDFKH  282



>gb|KCW90245.1| hypothetical protein EUGRSUZ_A02400 [Eucalyptus grandis]
Length=273

 Score = 97.1 bits (240),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  185  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  232



>ref|XP_010554847.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Tarenaya hassleriana]
Length=368

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  275  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWFCVCGSDFKH  322



>ref|XP_008443097.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis melo]
Length=355

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  247  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  294



>gb|KGN59334.1| hypothetical protein Csa_3G810580 [Cucumis sativus]
Length=353

 Score = 97.4 bits (241),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  248  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  295



>ref|XP_006393069.1| hypothetical protein EUTSA_v10011987mg [Eutrema salsugineum]
 gb|ESQ30355.1| hypothetical protein EUTSA_v10011987mg [Eutrema salsugineum]
Length=344

 Score = 97.4 bits (241),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  249  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  296



>gb|KFK35012.1| hypothetical protein AALP_AA5G222700 [Arabis alpina]
Length=380

 Score = 97.8 bits (242),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  287  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  334



>ref|XP_006406336.1| hypothetical protein EUTSA_v10021932mg [Eutrema salsugineum]
 gb|ESQ47789.1| hypothetical protein EUTSA_v10021932mg [Eutrema salsugineum]
Length=364

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  277  THYKRKHGARPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  324



>ref|XP_006354269.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Solanum tuberosum]
Length=347

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  257  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  304



>ref|XP_010928863.1| PREDICTED: zinc finger protein WIP2-like [Elaeis guineensis]
Length=336

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  245  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  292



>ref|XP_010913946.1| PREDICTED: zinc finger protein WIP2-like [Elaeis guineensis]
Length=342

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  251  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  298



>ref|XP_003541613.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
Length=357

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K + CRKCGKAFAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  269  THYKRKHGIKPYMCRKCGKAFAVKGDWRTHEKNCGKIWYCLCGSDFKH  316



>ref|XP_010672755.1| PREDICTED: zinc finger protein WIP2 [Beta vulgaris subsp. vulgaris]
Length=382

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  289  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  336



>emb|CDX88959.1| BnaA04g02270D [Brassica napus]
Length=364

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  277  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  324



>ref|XP_004173674.1| PREDICTED: protein TRANSPARENT TESTA 1-like, partial [Cucumis 
sativus]
Length=181

 Score = 95.1 bits (235),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  94   THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  141



>gb|KHN37611.1| Protein TRANSPARENT TESTA 1 [Glycine soja]
Length=342

 Score = 97.4 bits (241),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K + CRKCGKAFAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  254  THYKRKHGIKPYMCRKCGKAFAVKGDWRTHEKNCGKIWYCLCGSDFKH  301



>ref|XP_009763748.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nicotiana sylvestris]
Length=323

 Score = 97.1 bits (240),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  232  THYKRKHGVKPFMCRKCGKPFAVKGDWRTHEKNCGKIWYCICGSDFKH  279



>gb|AAO64176.1| putative zinc finger protein [Arabidopsis thaliana]
 dbj|BAF00501.1| zinc finger like protein [Arabidopsis thaliana]
Length=383

 Score = 97.4 bits (241),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  290  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  337



>ref|XP_004250873.1| PREDICTED: protein TRANSPARENT TESTA 1 [Solanum lycopersicum]
Length=347

 Score = 97.4 bits (241),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  255  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  302



>ref|NP_191326.1| transcription factor NO TRANSMITTING TRACT [Arabidopsis thaliana]
 sp|Q9SVY1.1|ZWIP2_ARATH RecName: Full=Zinc finger protein WIP2; AltName: Full=Protein 
NO TRANSMITTING TRACT; AltName: Full=WIP-domain protein 2; 
Short=AtWIP2 [Arabidopsis thaliana]
 gb|AAL55722.1|AF254447_1 WIP2 protein [Arabidopsis thaliana]
 emb|CAB41188.1| zinc finger-like protein [Arabidopsis thaliana]
 gb|AAX12859.1| At3g57670 [Arabidopsis thaliana]
 gb|AEE79685.1| C2H2-type zinc finger protein [Arabidopsis thaliana]
Length=383

 Score = 97.4 bits (241),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  290  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  337



>ref|XP_009599843.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Nicotiana tomentosiformis]
Length=319

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  228  THYKRKHGVKPFMCRKCGKPFAVKGDWRTHEKNCGKIWYCICGSDFKH  275



>ref|XP_002876430.1| hypothetical protein ARALYDRAFT_486217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52689.1| hypothetical protein ARALYDRAFT_486217 [Arabidopsis lyrata subsp. 
lyrata]
Length=384

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  291  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  338



>dbj|BAK04496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  249  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  296



>ref|XP_009104073.1| PREDICTED: protein TRANSPARENT TESTA 1-like isoform X2 [Brassica 
rapa]
Length=374

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  281  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  328



>ref|XP_008798774.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Phoenix dactylifera]
Length=336

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C+CGSDFKH
Sbjct  245  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCVCGSDFKH  292



>gb|KDP32686.1| hypothetical protein JCGZ_14750 [Jatropha curcas]
Length=338

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  250  THYKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCICGSDFKH  297



>ref|XP_002523788.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
 gb|EEF38514.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis]
Length=343

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  253  THYKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKH  300



>emb|CDY35565.1| BnaC05g27160D [Brassica napus]
Length=339

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  244  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  291



>ref|XP_008782901.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Phoenix dactylifera]
Length=148

 Score = 94.0 bits (232),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  57   THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  104



>ref|XP_010427649.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Camelina sativa]
Length=383

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  290  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  337



>ref|XP_006402857.1| hypothetical protein EUTSA_v10006035mg [Eutrema salsugineum]
 gb|ESQ44310.1| hypothetical protein EUTSA_v10006035mg [Eutrema salsugineum]
Length=383

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  290  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  337



>ref|XP_006291292.1| hypothetical protein CARUB_v10017428mg [Capsella rubella]
 gb|EOA24190.1| hypothetical protein CARUB_v10017428mg [Capsella rubella]
Length=382

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  289  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  336



>ref|XP_010516391.1| PREDICTED: protein TRANSPARENT TESTA 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010516392.1| PREDICTED: protein TRANSPARENT TESTA 1-like isoform X2 [Camelina 
sativa]
Length=379

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  286  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  333



>ref|XP_004957169.1| PREDICTED: zinc finger and BTB domain-containing protein 17-like 
[Setaria italica]
Length=433

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CR+CGKAFAV+GDW+THEKNCGRLW+C+CGS+FKH
Sbjct  322  THYKRKHGLKPFLCRRCGKAFAVKGDWRTHEKNCGRLWYCLCGSEFKH  369



>ref|XP_003539640.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
 gb|KHN19445.1| Protein TRANSPARENT TESTA 1 [Glycine soja]
Length=352

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K + CRKCGKAFAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  264  THYKRKHGIKPYMCRKCGKAFAVKGDWRTHEKNCGKIWYCLCGSDFKH  311



>ref|XP_009387483.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  240  THYKRKHGIKPFMCRKCGKAFAVKGDWRTHEKNCGKLWYCICGSDFKH  287



>ref|XP_010504701.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Camelina sativa]
Length=380

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  287  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  334



>ref|XP_004231115.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Solanum lycopersicum]
Length=298

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  212  THYKRKHGAKPFMCRKCGKPFAVKGDWRTHEKNCGKIWYCICGSDFKH  259



>ref|XP_004239423.1| PREDICTED: protein TRANSPARENT TESTA 1 [Solanum lycopersicum]
Length=286

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  194  THYKRKHGTKPFKCRKCGKNFAVRGDWRTHEKNCGKLWFCICGSDFKH  241



>emb|CDY57608.1| BnaC06g42710D [Brassica napus]
Length=240

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  147  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  194



>ref|XP_002981844.1| hypothetical protein SELMODRAFT_57114, partial [Selaginella moellendorffii]
 ref|XP_002982811.1| hypothetical protein SELMODRAFT_57106, partial [Selaginella moellendorffii]
 gb|EFJ16056.1| hypothetical protein SELMODRAFT_57106, partial [Selaginella moellendorffii]
 gb|EFJ16937.1| hypothetical protein SELMODRAFT_57114, partial [Selaginella moellendorffii]
Length=151

 Score = 94.0 bits (232),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  89   THYKRKHGIKPFPCRKCGKPFAVRGDWRTHEKNCGKLWYCICGSDFKH  136



>ref|NP_175533.1| WIP domain protein 5 [Arabidopsis thaliana]
 sp|Q8W031.1|ZWIP5_ARATH RecName: Full=Zinc finger protein WIP5; AltName: Full=WIP-domain 
protein 5; Short=AtWIP5 [Arabidopsis thaliana]
 emb|CAC86167.1| WIP5 protein [Arabidopsis thaliana]
 gb|AEE32638.1| WIP domain protein 5 [Arabidopsis thaliana]
Length=337

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG+K FACR CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  251  THYKRKHGSKPFACRMCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  298



>ref|XP_002979166.1| hypothetical protein SELMODRAFT_110681 [Selaginella moellendorffii]
 ref|XP_002988536.1| hypothetical protein SELMODRAFT_128378 [Selaginella moellendorffii]
 gb|EFJ10332.1| hypothetical protein SELMODRAFT_128378 [Selaginella moellendorffii]
 gb|EFJ19574.1| hypothetical protein SELMODRAFT_110681 [Selaginella moellendorffii]
Length=206

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  103  THYKRKHGAKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCSCGSDFKH  150



>ref|XP_011011045.1| PREDICTED: zinc finger protein WIP2-like [Populus euphratica]
Length=327

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  240  THYKRKHGIKPFMCRKCGKPFAVKGDWRTHEKNCGKIWYCICGSDFKH  287



>gb|EYU27068.1| hypothetical protein MIMGU_mgv1a026475mg [Erythranthe guttata]
Length=309

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK FACRKCGK FAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  219  THYKRKHGAKPFACRKCGKPFAVKGDWRTHEKNCGKIWYCVCGSDFKH  266



>ref|XP_010088245.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
 gb|EXB32797.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
Length=317

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  229  THYKRKHGVKPFMCRKCGKPFAVKGDWRTHEKNCGKIWYCVCGSDFKH  276



>emb|CDX67704.1| BnaA07g17440D [Brassica napus]
Length=246

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  153  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  200



>ref|XP_002894301.1| zinc finger protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70560.1| zinc finger protein [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  243  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  290



>gb|EYU30485.1| hypothetical protein MIMGU_mgv1a024792mg, partial [Erythranthe 
guttata]
Length=253

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKC K FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  137  THYKRKHGAKPFECRKCSKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  184



>ref|XP_002298437.2| hypothetical protein POPTR_0001s27490g [Populus trichocarpa]
 gb|EEE83242.2| hypothetical protein POPTR_0001s27490g [Populus trichocarpa]
Length=335

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  248  THYKRKHGIKPFMCRKCGKPFAVKGDWRTHEKNCGKIWYCICGSDFKH  295



>gb|EYU40863.1| hypothetical protein MIMGU_mgv1a018051mg [Erythranthe guttata]
Length=313

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKC K FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  210  THYKRKHGAKPFECRKCSKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  257



>gb|ACX85637.1| WIP1 [Cucumis melo]
 gb|ACX85639.1| WIP1 [Cucumis melo]
Length=353

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW C CGSDFKH
Sbjct  263  THYKRKHGMKPFTCRKCGKAFAVRGDWRTHEKNCGKLWHCTCGSDFKH  310



>ref|XP_004298304.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Fragaria vesca subsp. 
vesca]
Length=289

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  179  THYKRKHGTKPFCCRKCGKPFAVRGDWRTHEKNCGKLWFCICGSDFKH  226



>ref|XP_006661103.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Oryza brachyantha]
Length=225

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  123  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  170



>emb|CDY29624.1| BnaA05g15460D [Brassica napus]
Length=340

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  245  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  292



>ref|XP_009144966.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Brassica rapa]
Length=340

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG++ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  245  THYKRKHGSRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  292



>ref|XP_003627702.1| Zinc finger-like protein [Medicago truncatula]
Length=340

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K + CRKCGK+FAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  252  THYKRKHGIKPYMCRKCGKSFAVKGDWRTHEKNCGKIWYCLCGSDFKH  299



>ref|XP_010031820.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Eucalyptus grandis]
 gb|KCW51203.1| hypothetical protein EUGRSUZ_J00788 [Eucalyptus grandis]
Length=368

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  275  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCSCGSDFKH  322



>ref|XP_007145633.1| hypothetical protein PHAVU_007G255500g [Phaseolus vulgaris]
 gb|ESW17627.1| hypothetical protein PHAVU_007G255500g [Phaseolus vulgaris]
Length=362

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK+FAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  277  THYKRKHGIKPFMCRKCGKSFAVRGDWRTHEKNCGKLWYCICGSDFKH  324



>ref|XP_009364992.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Pyrus x bretschneideri]
Length=388

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  4    HYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            HYKRKHG + F C++CGKAFAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  295  HYKRKHGVRSFMCKRCGKAFAVKGDWRTHEKNCGKIWYCICGSDFKH  341



>ref|XP_004496311.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cicer arietinum]
Length=252

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  157  THYKRKHGGKSFECRKCRKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  204



>ref|XP_004510958.1| PREDICTED: protein TRANSPARENT TESTA 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004510959.1| PREDICTED: protein TRANSPARENT TESTA 1-like isoform X2 [Cicer 
arietinum]
Length=347

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K + CRKCGK+FAV+GDW+THEKNCG++W+C+CGSDFKH
Sbjct  259  THYKRKHGIKPYMCRKCGKSFAVKGDWRTHEKNCGKIWYCLCGSDFKH  306



>ref|XP_007140559.1| hypothetical protein PHAVU_008G122800g [Phaseolus vulgaris]
 gb|ESW12553.1| hypothetical protein PHAVU_008G122800g [Phaseolus vulgaris]
Length=262

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LWFCICGSDFKH
Sbjct  177  THYKRKHGGKPFECRKCRKAFAVRGDWRTHEKNCGKLWFCICGSDFKH  224



>ref|XP_003576402.1| PREDICTED: protein TRANSPARENT TESTA 1 [Brachypodium distachyon]
Length=345

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  239  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  286



>ref|XP_004295197.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Fragaria vesca subsp. 
vesca]
Length=343

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  254  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  301



>emb|CDX72006.1| BnaC08g28680D [Brassica napus]
Length=373

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  281  THYKRKHGIKPFMCRKCGKVFAVRGDWRTHEKNCGKLWYCICGSDFKH  328



>ref|XP_009139023.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Brassica rapa]
Length=364

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY RKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  277  THYNRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  324



>gb|EMS56204.1| Protein TRANSPARENT TESTA 1 [Triticum urartu]
Length=215

 Score = 94.7 bits (234),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  110  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  157



>ref|XP_002460014.1| hypothetical protein SORBIDRAFT_02g020840 [Sorghum bicolor]
 gb|EER96535.1| hypothetical protein SORBIDRAFT_02g020840 [Sorghum bicolor]
Length=370

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  260  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  307



>ref|XP_008352513.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Malus domestica]
Length=357

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  269  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  316



>ref|XP_006345504.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Solanum tuberosum]
Length=300

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAV+GDW+THEKNCG++W+CICGSDFKH
Sbjct  214  THYKRKHGAKPFMCRKCGKPFAVKGDWRTHEKNCGKIWYCICGSDFKH  261



>ref|XP_006347241.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Solanum tuberosum]
Length=326

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F+CRKCGK FAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  233  THYKRKHGTKSFSCRKCGKTFAVKGDWRTHEKNCGKLWYCICGSDFKH  280



>emb|CDY06083.1| BnaA09g36970D [Brassica napus]
Length=374

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  282  THYKRKHGIKPFMCRKCGKVFAVRGDWRTHEKNCGKLWYCICGSDFKH  329



>ref|XP_009795232.1| PREDICTED: protein TRANSPARENT TESTA 1 [Nicotiana sylvestris]
Length=349

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F+CRKCGK FAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  262  THYKRKHGTKAFSCRKCGKTFAVKGDWRTHEKNCGKLWYCICGSDFKH  309



>ref|XP_004493528.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cicer arietinum]
Length=349

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  264  THYKRKHGIKPFMCRKCSKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  311



>gb|EPS74449.1| hypothetical protein M569_00308, partial [Genlisea aurea]
Length=132

 Score = 92.4 bits (228),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  58   THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  105



>ref|XP_002304767.2| hypothetical protein POPTR_0003s20400g [Populus trichocarpa]
 gb|EEE79746.2| hypothetical protein POPTR_0003s20400g [Populus trichocarpa]
Length=336

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  246  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  293



>gb|EMT27915.1| Protein TRANSPARENT TESTA 1 [Aegilops tauschii]
Length=304

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  199  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  246



>ref|XP_008392201.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Malus domestica]
Length=342

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  254  THYKRKHGIKPFTCRKCXKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  301



>ref|XP_004136115.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus]
 gb|KGN45138.1| hypothetical protein Csa_7G428260 [Cucumis sativus]
Length=293

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAV+GDW+THEKNCG++W+C CGSDFKH
Sbjct  203  THYKRKHGIKPFTCRKCTKAFAVKGDWRTHEKNCGKIWYCFCGSDFKH  250



>ref|XP_011042088.1| PREDICTED: zinc finger protein WIP2-like [Populus euphratica]
Length=336

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  246  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  293



>ref|XP_001776296.1| predicted protein [Physcomitrella patens]
 gb|EDQ58929.1| predicted protein [Physcomitrella patens]
Length=233

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LWFC CGSDFKH
Sbjct  142  THYKRKHGIKPFMCRKCSKAFAVRGDWRTHEKNCGKLWFCTCGSDFKH  189



>ref|XP_004241317.1| PREDICTED: protein TRANSPARENT TESTA 1 [Solanum lycopersicum]
Length=315

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F+CRKCGK FAV+GDW+THEKNCG+LW+C+CGSDFKH
Sbjct  226  THYKRKHGTKSFSCRKCGKTFAVKGDWRTHEKNCGKLWYCVCGSDFKH  273



>gb|KFK39406.1| hypothetical protein AALP_AA3G240700 [Arabis alpina]
Length=363

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG + FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  276  THYKRKHGVRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  323



>ref|XP_008351586.1| PREDICTED: protein TRANSPARENT TESTA 1-like, partial [Malus domestica]
Length=274

 Score = 94.7 bits (234),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  186  THYKRKHGIKPFTCRKCXKAFAVRGDWRTHEKNCGKLWYCICGSDFKH  233



>ref|NP_001150708.1| zinc finger, C2H2 type family protein [Zea mays]
 gb|ACG40094.1| zinc finger, C2H2 type family protein [Zea mays]
 tpg|DAA60971.1| TPA: zinc finger, C2H2 type family protein [Zea mays]
Length=376

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  270  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  317



>gb|EYU46275.1| hypothetical protein MIMGU_mgv1a019930mg, partial [Erythranthe 
guttata]
Length=366

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  278  THYKRKHGIKPFLCRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  325



>dbj|BAD36700.1| putative WIP1 protein [Oryza sativa Japonica Group]
 gb|EAZ44167.1| hypothetical protein OsJ_28788 [Oryza sativa Japonica Group]
Length=385

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  268  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  315



>gb|EAZ08540.1| hypothetical protein OsI_30809 [Oryza sativa Indica Group]
Length=382

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCG+LWFC+CGSDFKH
Sbjct  265  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGKLWFCVCGSDFKH  312



>ref|XP_006482890.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Citrus sinensis]
Length=327

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGK FAV+GDW+THEKNCGR+W+C+CGSDFKH
Sbjct  239  THYKRKHGIKPFMCRKCGKPFAVKGDWRTHEKNCGRIWYCVCGSDFKH  286



>ref|XP_010227506.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Brachypodium distachyon]
Length=376

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  258  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCACGSDFKH  305



>emb|CDY27556.1| BnaC01g32390D [Brassica napus]
Length=358

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  272  THYKRKHGARPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  319



>ref|XP_009110075.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Brassica rapa]
Length=359

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  272  THYKRKHGARPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  319



>ref|XP_009415409.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415410.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=324

 Score = 94.7 bits (234),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            TH+KRKHG K F CRKCGKA AVRGDW+THEKNCG+LW+CICGSDFKH
Sbjct  233  THFKRKHGIKPFVCRKCGKALAVRGDWRTHEKNCGKLWYCICGSDFKH  280



>emb|CDY57920.1| BnaA01g36760D [Brassica napus]
Length=359

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGA+ FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  272  THYKRKHGARPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  319



>ref|XP_004158240.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus]
Length=293

 Score = 94.7 bits (234),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAV+GDW+THEKNCG++W+C CGSDFKH
Sbjct  203  THYKRKHGIKPFTCRKCTKAFAVKGDWRTHEKNCGKIWYCFCGSDFKH  250



>emb|CDP20881.1| unnamed protein product [Coffea canephora]
Length=352

 Score = 94.7 bits (234),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK+FAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  263  THYKRKHGAKPFNCRKCGKSFAVKGDWRTHEKNCGKLWYCTCGSDFKH  310



>ref|XP_010089843.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
 gb|EXB38459.1| Protein TRANSPARENT TESTA 1 [Morus notabilis]
Length=351

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F+CRKCGK FAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  260  THYKRKHGAKPFSCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKH  307



>ref|XP_002976646.1| hypothetical protein SELMODRAFT_36986, partial [Selaginella moellendorffii]
 gb|EFJ22315.1| hypothetical protein SELMODRAFT_36986, partial [Selaginella moellendorffii]
Length=171

 Score = 92.8 bits (229),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  105  THYKRKHGIKPFPCRKCGKAFAVRGDWRTHEKNCGKLWYCSCGSDFKH  152



>ref|XP_002973204.1| hypothetical protein SELMODRAFT_36987, partial [Selaginella moellendorffii]
 gb|EFJ25578.1| hypothetical protein SELMODRAFT_36987, partial [Selaginella moellendorffii]
Length=171

 Score = 92.8 bits (229),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  105  THYKRKHGIKPFPCRKCGKAFAVRGDWRTHEKNCGKLWYCSCGSDFKH  152



>gb|ACU19877.1| unknown [Glycine max]
Length=345

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  256  THYKRKHGIKPFMCRKCCKAFAVRGDWRTHEKNCGKLWYCSCGSDFKH  303



>ref|NP_188724.2| WIP domain protein 4 [Arabidopsis thaliana]
 sp|Q8W030.1|ZWIP4_ARATH RecName: Full=Zinc finger protein WIP4; AltName: Full=WIP-domain 
protein 4; Short=AtWIP4 [Arabidopsis thaliana]
 emb|CAC86168.1| WIP4 protein [Arabidopsis thaliana]
 gb|AEE76435.1| WIP domain protein 4 [Arabidopsis thaliana]
Length=412

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG + FACR+CGKAFAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  329  THYKRKHGVRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKH  376



>tpg|DAA39869.1| TPA: zinc finger, C2H2 type family protein [Zea mays]
Length=379

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCGRLWFC CGSDFKH
Sbjct  272  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGRLWFCACGSDFKH  319



>gb|EYU18350.1| hypothetical protein MIMGU_mgv1a023897mg [Erythranthe guttata]
Length=391

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  295  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCACGSDFKH  342



>dbj|BAK01075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  261  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCACGSDFKH  308



>ref|XP_003547110.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max]
Length=345

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  256  THYKRKHGIKPFMCRKCCKAFAVRGDWRTHEKNCGKLWYCSCGSDFKH  303



>ref|XP_009395241.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=346

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  4    HYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            HYKRKHG K F CRKCGKAFAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  252  HYKRKHGIKPFMCRKCGKAFAVKGDWRTHEKNCGKLWYCICGSDFKH  298



>ref|XP_008349934.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Malus domestica]
Length=365

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  4    HYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            HYKRKHG + F C++CGKAF+V+GDW+THEKNCG++W+CICGSDFKH
Sbjct  292  HYKRKHGVRSFMCKRCGKAFSVKGDWRTHEKNCGKIWYCICGSDFKH  338



>ref|XP_004513647.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cicer arietinum]
Length=358

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C+C SDFKH
Sbjct  270  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCLCRSDFKH  317



>ref|XP_006446092.1| hypothetical protein CICLE_v10017716mg [Citrus clementina]
 ref|XP_006470583.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Citrus sinensis]
 gb|ESR59332.1| hypothetical protein CICLE_v10017716mg [Citrus clementina]
 gb|KDO61304.1| hypothetical protein CISIN_1g019587mg [Citrus sinensis]
Length=338

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKC KAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  247  THYKRKHGIKPFMCRKCSKAFAVRGDWRTHEKNCGKLWYCTCGSDFKH  294



>ref|XP_002277045.1| PREDICTED: zinc finger protein WIP3 [Vitis vinifera]
 emb|CAN64917.1| hypothetical protein VITISV_027337 [Vitis vinifera]
Length=347

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHGAK F CRKCGK FAV+GDW+THEKNCG+LW+C CGSDFKH
Sbjct  259  THYKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKH  306



>ref|XP_009395527.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Musa acuminata subsp. 
malaccensis]
Length=345

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHG K FACRKCGKA AVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  253  THYRRKHGVKPFACRKCGKALAVRGDWRTHEKNCGKLWYCTCGSDFKH  300



>ref|NP_001150040.1| zinc finger, C2H2 type family protein [Zea mays]
 gb|ACG37600.1| zinc finger, C2H2 type family protein [Zea mays]
Length=374

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THY+RKHGA+ +ACR+CGK FAVRGDW+THEKNCGRLWFC CGSDFKH
Sbjct  265  THYRRKHGARPYACRRCGKRFAVRGDWRTHEKNCGRLWFCACGSDFKH  312



>gb|EMS54305.1| Protein TRANSPARENT TESTA 1 [Triticum urartu]
Length=261

 Score = 94.0 bits (232),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            THYKRKHG K F CRKCGKAFAVRGDW+THEKNCG+LW+C CGSDFKH
Sbjct  153  THYKRKHGIKPFMCRKCGKAFAVRGDWRTHEKNCGKLWYCACGSDFKH  200



>ref|XP_010686027.1| PREDICTED: zinc finger protein WIP3 [Beta vulgaris subsp. vulgaris]
Length=366

 Score = 94.7 bits (234),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    THYKRKHGAKQFACRKCGKAFAVRGDWKTHEKNCGRLWFCICGSDFKH  144
            TH+KRKHG K F CRKC KAFAV+GDW+THEKNCG+LW+CICGSDFKH
Sbjct  279  THFKRKHGIKGFMCRKCSKAFAVKGDWRTHEKNCGKLWYCICGSDFKH  326



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506149393984