BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c118068_g1_i1 len=107 path=[85:0-106]

Length=107
                                                                      Score     E

ref|XP_010313950.1|  PREDICTED: cellulose synthase-like protein E...  67.8    9e-12   
ref|XP_010313949.1|  PREDICTED: cellulose synthase-like protein E...  67.8    9e-12   
emb|CDP13703.1|  unnamed protein product                              67.0    2e-11   
ref|XP_009624029.1|  PREDICTED: cellulose synthase-like protein E6    67.0    2e-11   
gb|AAZ32787.1|  cellulose synthase-like protein CslE                  67.0    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_009396291.1|  PREDICTED: cellulose synthase-like protein E6    66.6    3e-11   
ref|XP_006344955.1|  PREDICTED: cellulose synthase-like protein E...  66.2    4e-11   
ref|XP_011095564.1|  PREDICTED: cellulose synthase-like protein E6    65.9    5e-11   
emb|CBI39755.3|  unnamed protein product                              64.3    1e-10   
ref|XP_010644596.1|  PREDICTED: cellulose synthase-like protein E1    64.3    1e-10   
ref|XP_006380865.1|  hypothetical protein POPTR_0006s00610g           64.3    2e-10   
ref|XP_011002350.1|  PREDICTED: cellulose synthase-like protein E6    64.3    2e-10   
ref|XP_010552366.1|  PREDICTED: cellulose synthase-like protein E1    64.3    2e-10   
ref|XP_007020466.1|  Cellulose synthase like E1, putative isoform 2   63.2    3e-10   
ref|XP_006344956.1|  PREDICTED: cellulose synthase-like protein E...  63.5    4e-10   
ref|XP_007020465.1|  Cellulose synthase like E1, putative isoform 1   63.2    4e-10   
ref|XP_009796259.1|  PREDICTED: cellulose synthase-like protein E6    62.4    8e-10   
ref|XP_010252798.1|  PREDICTED: cellulose synthase-like protein E...  62.0    9e-10   
gb|KDO59153.1|  hypothetical protein CISIN_1g006553mg                 62.0    9e-10   
ref|XP_011002349.1|  PREDICTED: cellulose synthase-like protein E6    62.0    9e-10   
ref|XP_002307850.1|  hypothetical protein POPTR_0006s00620g           62.0    9e-10   Populus trichocarpa [western balsam poplar]
gb|AFZ78595.1|  cellulose synthase-like protein                       62.0    9e-10   
ref|XP_006452622.1|  hypothetical protein CICLE_v10007653mg           62.0    9e-10   
ref|XP_010252797.1|  PREDICTED: cellulose synthase-like protein E...  62.0    1e-09   
ref|XP_002522779.1|  cellulose synthase, putative                     62.0    1e-09   Ricinus communis
dbj|BAD12923.1|  putative cellulose synthase-like protein OsCslE2     61.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004296325.1|  PREDICTED: cellulose synthase-like protein E...  61.6    1e-09   
gb|EEC73919.1|  hypothetical protein OsI_08762                        61.6    1e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001047983.1|  Os02g0725300                                     61.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAL25130.1|AF432501_1  cellulose synthase-like protein OsCslE2     61.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010092349.1|  Cellulose synthase-like protein E6               61.6    2e-09   
gb|KDO59154.1|  hypothetical protein CISIN_1g009753mg                 61.2    2e-09   
ref|XP_006474871.1|  PREDICTED: transmembrane emp24 domain-contai...  61.6    2e-09   
ref|XP_011097754.1|  PREDICTED: cellulose synthase-like protein E6    61.2    2e-09   
ref|XP_002522778.1|  coated vesicle membrane protein, putative        61.6    2e-09   Ricinus communis
ref|XP_006474852.1|  PREDICTED: cellulose synthase-like protein E...  61.2    2e-09   
ref|XP_006474851.1|  PREDICTED: cellulose synthase-like protein E...  61.2    2e-09   
ref|XP_008218336.1|  PREDICTED: cellulose synthase-like protein E6    61.2    2e-09   
ref|XP_006857766.1|  hypothetical protein AMTR_s00061p00200560        60.8    2e-09   
ref|XP_007020463.1|  Cellulose synthase like E1                       61.2    2e-09   
ref|XP_010928136.1|  PREDICTED: cellulose synthase-like protein E1    60.5    2e-09   
ref|XP_003635524.1|  PREDICTED: cellulose synthase-like protein E6    60.1    3e-09   
ref|XP_006474853.1|  PREDICTED: cellulose synthase-like protein E...  60.8    3e-09   
ref|XP_003576648.2|  PREDICTED: cellulose synthase-like protein E6    60.5    3e-09   
ref|XP_006495176.1|  PREDICTED: cellulose synthase-like protein E...  60.5    3e-09   
ref|XP_008805495.1|  PREDICTED: cellulose synthase-like protein E...  60.5    4e-09   
ref|XP_010647486.1|  PREDICTED: cellulose synthase-like protein E...  60.5    4e-09   
ref|XP_003635559.1|  PREDICTED: cellulose synthase-like protein E...  60.5    4e-09   
gb|EEE57722.1|  hypothetical protein OsJ_08209                        60.5    4e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EYU27448.1|  hypothetical protein MIMGU_mgv1a001968mg              60.1    4e-09   
emb|CBI29575.3|  unnamed protein product                              60.5    4e-09   
gb|KHF97453.1|  Cellulose synthase-like protein E6                    59.7    4e-09   
dbj|BAJ85551.1|  predicted protein                                    60.1    5e-09   
emb|CBI23547.3|  unnamed protein product                              59.3    5e-09   
gb|EMT18146.1|  Cellulose synthase-like protein E6                    59.7    5e-09   
ref|XP_008783292.1|  PREDICTED: cellulose synthase-like protein E6    60.1    5e-09   
ref|XP_010092347.1|  Cellulose synthase-like protein E1               59.7    5e-09   
ref|XP_003576649.1|  PREDICTED: cellulose synthase-like protein E6    59.7    6e-09   
gb|EMT33243.1|  Cellulose synthase-like protein E6                    59.7    7e-09   
gb|KHG20199.1|  Cellulose synthase-like protein E6                    59.7    7e-09   
emb|CBI39757.3|  unnamed protein product                              59.7    7e-09   
emb|CAN62860.1|  hypothetical protein VITISV_036212                   59.7    7e-09   Vitis vinifera
ref|XP_002266273.1|  PREDICTED: cellulose synthase-like protein E6    59.7    8e-09   Vitis vinifera
ref|XP_006452614.1|  hypothetical protein CICLE_v10007585mg           59.7    8e-09   
emb|CBI23490.3|  unnamed protein product                              59.3    8e-09   
emb|CBI29437.3|  unnamed protein product                              59.3    8e-09   
emb|CBI29435.3|  unnamed protein product                              59.3    8e-09   
gb|KDP39305.1|  hypothetical protein JCGZ_01062                       59.3    8e-09   
ref|XP_002462534.1|  hypothetical protein SORBIDRAFT_02g027570        59.3    8e-09   Sorghum bicolor [broomcorn]
ref|XP_004957121.1|  PREDICTED: cellulose synthase-like protein E...  59.3    8e-09   
ref|XP_004957122.1|  PREDICTED: cellulose synthase-like protein E...  59.3    8e-09   
emb|CBI23494.3|  unnamed protein product                              59.3    8e-09   
gb|KCW70464.1|  hypothetical protein EUGRSUZ_F03681                   59.3    9e-09   
ref|XP_004957118.1|  PREDICTED: cellulose synthase-like protein E...  59.3    9e-09   
ref|XP_004957117.1|  PREDICTED: cellulose synthase-like protein E...  59.3    9e-09   
ref|XP_003635328.1|  PREDICTED: cellulose synthase-like protein E6    59.3    9e-09   
ref|XP_010646988.1|  PREDICTED: cellulose synthase-like protein E6    59.3    9e-09   
ref|XP_003635361.2|  PREDICTED: cellulose synthase-like protein E6    59.3    9e-09   
ref|XP_002274290.2|  PREDICTED: cellulose synthase-like protein E6    59.3    9e-09   Vitis vinifera
ref|XP_010252429.1|  PREDICTED: uncharacterized protein LOC104594007  59.7    9e-09   
ref|XP_010063253.1|  PREDICTED: cellulose synthase-like protein E...  59.3    1e-08   
ref|XP_002522780.1|  cellulose synthase, putative                     58.9    1e-08   Ricinus communis
ref|XP_010252795.1|  PREDICTED: cellulose synthase-like protein E6    58.9    1e-08   
ref|XP_010252796.1|  PREDICTED: cellulose synthase-like protein E6    58.9    1e-08   
gb|EMS61953.1|  Cellulose synthase-like protein E6                    58.9    1e-08   
ref|NP_001147894.1|  CSLE6 - cellulose synthase-like family E         58.9    1e-08   Zea mays [maize]
gb|ACN32031.1|  unknown                                               58.9    1e-08   Zea mays [maize]
ref|XP_010928076.1|  PREDICTED: cellulose synthase-like protein E...  58.9    1e-08   
gb|KDP39303.1|  hypothetical protein JCGZ_01060                       58.9    1e-08   
ref|XP_010928075.1|  PREDICTED: cellulose synthase-like protein E...  58.9    1e-08   
ref|XP_010928073.1|  PREDICTED: cellulose synthase-like protein E...  58.9    1e-08   
ref|XP_008805493.1|  PREDICTED: cellulose synthase-like protein E6    58.9    1e-08   
emb|CBI29434.3|  unnamed protein product                              58.5    1e-08   
ref|XP_004296326.1|  PREDICTED: cellulose synthase-like protein E...  58.5    2e-08   
ref|XP_002300383.1|  cellulose synthase family protein                58.5    2e-08   Populus trichocarpa [western balsam poplar]
gb|AFZ78594.1|  cellulose synthase-like protein                       58.5    2e-08   
ref|XP_011038831.1|  PREDICTED: cellulose synthase-like protein E1    58.5    2e-08   
gb|EYU33712.1|  hypothetical protein MIMGU_mgv1a001906mg              58.5    2e-08   
ref|XP_010928072.1|  PREDICTED: cellulose synthase-like protein E...  58.2    2e-08   
ref|XP_010928077.1|  PREDICTED: cellulose synthase-like protein E...  58.2    2e-08   
gb|EEE69911.1|  hypothetical protein OsJ_29757                        58.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
sp|Q651X6.1|CSLE6_ORYSJ  RecName: Full=Cellulose synthase-like pr...  58.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09494.1|  hypothetical protein OsI_31767                        58.2    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010087673.1|  Cellulose synthase-like protein E6               58.2    2e-08   
gb|EMS68034.1|  Cellulose synthase-like protein E2                    58.2    2e-08   
gb|KDO59145.1|  hypothetical protein CISIN_1g009524mg                 57.8    2e-08   
ref|XP_006661352.1|  PREDICTED: cellulose synthase-like protein E...  58.2    2e-08   
emb|CBI23493.3|  unnamed protein product                              57.4    2e-08   
ref|XP_010092016.1|  Cellulose synthase-like protein E6               58.2    2e-08   
ref|XP_008366099.1|  PREDICTED: cellulose synthase-like protein E...  58.2    2e-08   
ref|XP_010646989.1|  PREDICTED: cellulose synthase-like protein E6    57.8    2e-08   
ref|XP_006661350.1|  PREDICTED: cellulose synthase-like protein E...  58.2    2e-08   
ref|XP_006661351.1|  PREDICTED: cellulose synthase-like protein E...  58.2    2e-08   
ref|XP_007207930.1|  hypothetical protein PRUPE_ppa018204mg           58.2    2e-08   
ref|XP_010928137.1|  PREDICTED: cellulose synthase-like protein E6    57.4    3e-08   
ref|XP_008366098.1|  PREDICTED: cellulose synthase-like protein E...  58.2    3e-08   
ref|XP_006452623.1|  hypothetical protein CICLE_v10007586mg           57.8    3e-08   
ref|XP_002454361.1|  hypothetical protein SORBIDRAFT_04g029420        58.2    3e-08   Sorghum bicolor [broomcorn]
gb|KHG12106.1|  Cellulose synthase-like protein E6                    57.8    3e-08   
emb|CBI29436.3|  unnamed protein product                              57.4    3e-08   
gb|EYU33711.1|  hypothetical protein MIMGU_mgv1a001960mg              57.8    3e-08   
ref|XP_006474867.1|  PREDICTED: cellulose synthase-like protein E...  57.8    3e-08   
ref|XP_006452624.1|  hypothetical protein CICLE_v10007586mg           57.8    3e-08   
ref|XP_007206429.1|  hypothetical protein PRUPE_ppa001936mg           57.8    3e-08   
emb|CDP13705.1|  unnamed protein product                              57.4    4e-08   
ref|XP_007020460.1|  Cellulose synthase like E1 isoform 2             57.4    4e-08   
ref|XP_002462535.1|  hypothetical protein SORBIDRAFT_02g027610        57.4    4e-08   Sorghum bicolor [broomcorn]
ref|XP_004139857.1|  PREDICTED: cellulose synthase-like protein E...  57.4    4e-08   
ref|XP_004168176.1|  PREDICTED: cellulose synthase-like protein E...  57.4    4e-08   
ref|XP_009349150.1|  PREDICTED: uncharacterized protein LOC103940710  57.8    4e-08   
ref|XP_009419218.1|  PREDICTED: cellulose synthase-like protein E6    57.4    5e-08   
ref|XP_007020459.1|  Cellulose synthase like E1 isoform 1             57.4    5e-08   
gb|EMT33244.1|  Cellulose synthase-like protein E6                    57.4    5e-08   
ref|XP_007030084.1|  Cellulose synthase like E1, putative             57.0    5e-08   
ref|XP_009787708.1|  PREDICTED: cellulose synthase-like protein E...  57.0    5e-08   
ref|XP_007142430.1|  hypothetical protein PHAVU_008G279800g           57.0    5e-08   
gb|KCW75083.1|  hypothetical protein EUGRSUZ_E038472                  54.3    5e-08   
ref|XP_009787706.1|  PREDICTED: cellulose synthase-like protein E...  57.0    5e-08   
ref|XP_008219399.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.4    5e-08   
ref|XP_010647070.1|  PREDICTED: cellulose synthase-like protein E...  57.0    6e-08   
ref|XP_003635360.1|  PREDICTED: cellulose synthase-like protein E...  57.0    6e-08   
ref|XP_002269728.2|  PREDICTED: cellulose synthase-like protein E6    57.0    6e-08   Vitis vinifera
ref|XP_009606342.1|  PREDICTED: cellulose synthase-like protein E...  57.0    6e-08   
ref|XP_004296327.1|  PREDICTED: cellulose synthase-like protein E...  57.0    6e-08   
gb|EMT27736.1|  Cellulose synthase-like protein E2                    57.0    6e-08   
ref|XP_004295183.1|  PREDICTED: cellulose synthase-like protein E...  57.0    7e-08   
ref|XP_010501211.1|  PREDICTED: cellulose synthase-like protein E...  56.6    7e-08   
ref|XP_010088430.1|  Cellulose synthase-like protein E1               57.0    7e-08   
ref|XP_008805496.1|  PREDICTED: cellulose synthase-like protein E...  56.6    7e-08   
emb|CAN62859.1|  hypothetical protein VITISV_036211                   57.0    7e-08   Vitis vinifera
ref|XP_008218356.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  56.6    7e-08   
ref|XP_007208168.1|  hypothetical protein PRUPE_ppa001941mg           56.6    7e-08   
emb|CBI29433.3|  unnamed protein product                              56.6    7e-08   
emb|CBI23489.3|  unnamed protein product                              57.0    7e-08   
ref|XP_010928074.1|  PREDICTED: cellulose synthase-like protein E...  56.6    8e-08   
ref|XP_006452619.1|  hypothetical protein CICLE_v10007571mg           56.6    8e-08   
ref|XP_008805494.1|  PREDICTED: cellulose synthase-like protein E...  56.6    8e-08   
gb|KDP39304.1|  hypothetical protein JCGZ_01061                       56.6    8e-08   
ref|XP_010057780.1|  PREDICTED: cellulose synthase-like protein E1    56.6    8e-08   
ref|XP_008463016.1|  PREDICTED: cellulose synthase-like protein E6    56.6    9e-08   
ref|XP_007020467.1|  Cellulose synthase like E1 isoform 3             56.2    9e-08   
ref|XP_010676068.1|  PREDICTED: uncharacterized protein LOC104891977  56.6    9e-08   
ref|XP_004148922.1|  PREDICTED: cellulose synthase-like protein E...  56.2    9e-08   
gb|KGN44039.1|  hypothetical protein Csa_7G129380                     56.2    9e-08   
ref|XP_004165447.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  56.2    9e-08   
gb|KCW75092.1|  hypothetical protein EUGRSUZ_E03849                   56.2    9e-08   
ref|XP_004295190.1|  PREDICTED: cellulose synthase-like protein E...  56.2    1e-07   
ref|XP_004296328.1|  PREDICTED: cellulose synthase-like protein E...  56.2    1e-07   
emb|CAN71809.1|  hypothetical protein VITISV_043855                   56.6    1e-07   Vitis vinifera
gb|KCW75081.1|  hypothetical protein EUGRSUZ_E038472                  53.5    1e-07   
ref|XP_007208061.1|  hypothetical protein PRUPE_ppa001952mg           56.2    1e-07   
ref|XP_004148930.1|  PREDICTED: cellulose synthase-like protein E...  56.2    1e-07   
ref|XP_009793109.1|  PREDICTED: cellulose synthase-like protein E...  56.2    1e-07   
ref|XP_008463012.1|  PREDICTED: cellulose synthase-like protein E...  56.2    1e-07   
ref|XP_008463011.1|  PREDICTED: cellulose synthase-like protein E...  56.2    1e-07   
ref|XP_007146656.1|  hypothetical protein PHAVU_006G0586001g          55.8    1e-07   
ref|XP_002891856.1|  hypothetical protein ARALYDRAFT_337666           55.8    1e-07   
ref|NP_175981.2|  cellulose synthase-like protein E1                  55.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303808.1|  hypothetical protein CARUB_v10012240mg           55.8    1e-07   
ref|XP_010057783.1|  PREDICTED: cellulose synthase-like protein E6    55.8    1e-07   
ref|XP_007146654.1|  hypothetical protein PHAVU_006G058400g           55.8    1e-07   
ref|XP_008447771.1|  PREDICTED: cellulose synthase-like protein E6    55.8    1e-07   
ref|XP_010088429.1|  Cellulose synthase-like protein E1               55.8    1e-07   
ref|XP_004975624.1|  PREDICTED: cellulose synthase-like protein H...  55.8    2e-07   
ref|XP_004975623.1|  PREDICTED: cellulose synthase-like protein H...  55.8    2e-07   
ref|XP_004975622.1|  PREDICTED: cellulose synthase-like protein H...  55.8    2e-07   
ref|XP_008646188.1|  PREDICTED: cellulose synthase-like protein E...  55.8    2e-07   
ref|XP_008646187.1|  PREDICTED: cellulose synthase-like protein E...  55.8    2e-07   
emb|CDY42390.1|  BnaA08g00240D                                        55.5    2e-07   
ref|XP_006857764.1|  hypothetical protein AMTR_s00061p00199750        55.5    2e-07   
ref|XP_009107029.1|  PREDICTED: cellulose synthase-like protein E1    55.5    2e-07   
ref|XP_006474029.1|  PREDICTED: cellulose synthase A catalytic su...  55.5    2e-07   
gb|EMT26547.1|  Cellulose synthase-like protein H1                    55.5    2e-07   
ref|XP_008646189.1|  PREDICTED: cellulose synthase-like protein E...  55.5    2e-07   
ref|XP_007030087.1|  Cellulose synthase like E1                       55.5    2e-07   
ref|XP_006586145.1|  PREDICTED: cellulose synthase-like protein E...  55.5    2e-07   
ref|XP_006453580.1|  hypothetical protein CICLE_v10010165mg           55.5    2e-07   
ref|XP_007030086.1|  Cellulose synthase like E1                       55.5    2e-07   
ref|XP_007030088.1|  Cellulose synthase like E1                       55.5    2e-07   
ref|XP_006474030.1|  PREDICTED: cellulose synthase A catalytic su...  55.5    2e-07   
gb|KDO62271.1|  hypothetical protein CISIN_1g039678mg                 55.5    2e-07   
ref|XP_008349391.1|  PREDICTED: cellulose synthase-like protein E2    54.7    2e-07   
emb|CBI33250.3|  unnamed protein product                              54.7    2e-07   
ref|XP_010647166.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  54.7    3e-07   
ref|XP_008811269.1|  PREDICTED: cellulose synthase-like protein E...  55.1    3e-07   
ref|XP_008811268.1|  PREDICTED: cellulose synthase-like protein E...  55.1    3e-07   
gb|EEC84759.1|  hypothetical protein OsI_31766                        55.1    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006647822.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  55.1    3e-07   
gb|KCW75080.1|  hypothetical protein EUGRSUZ_E038461                  54.7    3e-07   
gb|KCW75082.1|  hypothetical protein EUGRSUZ_E038472                  52.4    3e-07   
ref|XP_010057782.1|  PREDICTED: cellulose synthase-like protein E1    54.7    3e-07   
ref|XP_003570469.1|  PREDICTED: cellulose synthase-like protein E2    55.1    3e-07   
gb|KCW75079.1|  hypothetical protein EUGRSUZ_E038461                  54.7    3e-07   
ref|XP_006392596.1|  hypothetical protein EUTSA_v10011262mg           55.1    3e-07   
ref|XP_010942702.1|  PREDICTED: cellulose synthase-like protein E6    54.7    3e-07   
ref|XP_003540290.1|  PREDICTED: cellulose synthase-like protein H...  54.7    3e-07   
ref|XP_006452617.1|  hypothetical protein CICLE_v10010783mg           54.7    4e-07   
ref|XP_010042774.1|  PREDICTED: cellulose synthase-like protein E6    53.9    4e-07   
ref|XP_010659594.1|  PREDICTED: cellulose synthase-like protein G3    54.7    4e-07   
ref|XP_004487957.1|  PREDICTED: cellulose synthase A catalytic su...  54.7    4e-07   
dbj|BAD46390.1|  putative cellulose synthase-like protein OsCslE1     54.3    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011097753.1|  PREDICTED: cellulose synthase-like protein E1    54.3    4e-07   
gb|AAL25129.1|AF432500_1  cellulose synthase-like protein OsCslE1     54.3    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063469.1|  Os09g0478100                                     54.3    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AFR39127.1|  cellulose synthase                                    51.6    5e-07   
ref|XP_003600348.1|  Cellulose synthase-like protein E1               54.3    5e-07   
ref|XP_003600349.1|  Cellulose synthase-like protein E1               54.3    5e-07   
ref|XP_007138849.1|  hypothetical protein PHAVU_009G242700g           54.3    5e-07   
gb|AFR39104.1|  cellulose synthase                                    51.6    5e-07   
gb|AII73573.1|  cellulose synthase 4                                  54.3    5e-07   
ref|XP_003594882.1|  Cellulose synthase                               54.3    5e-07   
gb|AES65133.2|  cellulose synthase-like protein                       54.3    5e-07   
ref|XP_011091159.1|  PREDICTED: cellulose synthase-like protein G3    54.3    5e-07   
emb|CDY10526.1|  BnaC03g70880D                                        54.3    6e-07   
ref|XP_002529323.1|  transferase, putative                            53.9    6e-07   Ricinus communis
ref|XP_007144119.1|  hypothetical protein PHAVU_007G130400g           54.3    6e-07   
gb|AFR39119.1|  cellulose synthase                                    51.2    6e-07   
ref|XP_006293591.1|  hypothetical protein CARUB_v10022538mg           54.3    6e-07   
gb|KHN47729.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...  54.3    6e-07   
ref|XP_010058305.1|  PREDICTED: cellulose synthase-like protein G2    53.9    6e-07   
ref|XP_010647485.1|  PREDICTED: cellulose synthase-like protein E6    53.1    7e-07   
ref|XP_003600351.1|  Cellulose synthase-like protein E1               53.9    7e-07   
gb|KEH34084.1|  cellulose synthase E1-like protein                    53.5    7e-07   
ref|XP_003533679.1|  PREDICTED: cellulose synthase A catalytic su...  53.9    7e-07   
gb|EYU32979.1|  hypothetical protein MIMGU_mgv1a019371mg              53.9    7e-07   
gb|AFR39117.1|  cellulose synthase                                    50.8    7e-07   
gb|EMS55737.1|  Cellulose synthase-like protein H1                    53.9    7e-07   
gb|AFR39101.1|  cellulose synthase                                    50.8    7e-07   
gb|AFR39120.1|  cellulose synthase                                    50.8    7e-07   
gb|EPS62612.1|  hypothetical protein M569_12177                       53.5    7e-07   
ref|XP_004953755.1|  PREDICTED: cellulose synthase-like protein E...  53.9    7e-07   
ref|XP_003600354.1|  Cellulose synthase-like protein E1               53.9    8e-07   
ref|XP_003600356.1|  Cellulose synthase-like protein E1               53.9    8e-07   
gb|AFR39114.1|  cellulose synthase                                    50.8    8e-07   
gb|KEH19939.1|  cellulose synthase-like protein                       53.9    8e-07   
ref|XP_007146658.1|  hypothetical protein PHAVU_006G058700g           53.9    8e-07   
gb|AFR38857.1|  cellulose synthase                                    50.8    8e-07   
gb|ADK60831.1|  cellulose synthase                                    50.4    8e-07   
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...  53.5    9e-07   
gb|AFR38848.1|  cellulose synthase                                    50.8    9e-07   
gb|AFR39118.1|  cellulose synthase                                    50.8    9e-07   
gb|KHN23836.1|  Cellulose synthase-like protein E6                    53.5    9e-07   
ref|XP_003545093.1|  PREDICTED: cellulose synthase-like protein E...  53.5    9e-07   
gb|AFR38858.1|  cellulose synthase                                    50.8    1e-06   
gb|KHG13946.1|  Cellulose synthase-like protein E6                    53.1    1e-06   
ref|XP_009614242.1|  PREDICTED: cellulose synthase-like protein G3    53.5    1e-06   
gb|AFR38855.1|  cellulose synthase                                    50.8    1e-06   
gb|AFR38838.1|  cellulose synthase                                    50.8    1e-06   
ref|XP_004505391.1|  PREDICTED: cellulose synthase-like protein G...  53.5    1e-06   
ref|XP_003600355.1|  Cellulose synthase-like protein E1               53.1    1e-06   
ref|XP_010480143.1|  PREDICTED: cellulose synthase-like protein E1    53.5    1e-06   
ref|XP_008383612.1|  PREDICTED: cellulose synthase A catalytic su...  53.5    1e-06   
gb|ADH04381.1|  cellulose synthase 1B                                 53.1    1e-06   
ref|XP_008383611.1|  PREDICTED: cellulose synthase A catalytic su...  53.5    1e-06   
ref|XP_008225322.1|  PREDICTED: cellulose synthase A catalytic su...  53.5    1e-06   
ref|XP_007214446.1|  hypothetical protein PRUPE_ppa024725mg           53.5    1e-06   
ref|XP_009352735.1|  PREDICTED: cellulose synthase A catalytic su...  53.5    1e-06   
ref|XP_011091168.1|  PREDICTED: cellulose synthase-like protein E1    53.5    1e-06   
gb|KCW72365.1|  hypothetical protein EUGRSUZ_E00820                   53.1    1e-06   
gb|AFR38868.1|  cellulose synthase                                    50.4    1e-06   
ref|XP_007030085.1|  Cellulose synthase like E1, putative             53.1    1e-06   
gb|KCW72364.1|  hypothetical protein EUGRSUZ_E00820                   53.1    1e-06   
emb|CDP12843.1|  unnamed protein product                              53.5    1e-06   
gb|KFK35563.1|  hypothetical protein AALP_AA4G007100                  53.1    1e-06   
gb|KFK35562.1|  hypothetical protein AALP_AA4G007000                  53.1    1e-06   
gb|AFR38875.1|  cellulose synthase                                    50.4    1e-06   
gb|AFR38850.1|  cellulose synthase                                    50.4    1e-06   
ref|XP_009144733.1|  PREDICTED: cellulose synthase-like protein E1    53.1    1e-06   
gb|AFR38854.1|  cellulose synthase                                    50.4    1e-06   
emb|CDY26085.1|  BnaC06g11110D                                        53.1    1e-06   
emb|CDY08263.1|  BnaA05g13560D                                        53.1    1e-06   
gb|KCW45018.1|  hypothetical protein EUGRSUZ_L013922                  52.8    1e-06   
ref|XP_009351521.1|  PREDICTED: cellulose synthase A catalytic su...  53.5    1e-06   
ref|XP_009351513.1|  PREDICTED: cellulose synthase A catalytic su...  53.5    1e-06   
ref|XP_011030536.1|  PREDICTED: cellulose synthase-like protein G2    53.1    1e-06   
ref|XP_003628669.1|  Cellulose synthase                               53.5    1e-06   
gb|AAY43216.1|  cellulose synthase BoCesA8                            53.5    1e-06   
ref|XP_010672125.1|  PREDICTED: cellulose synthase-like protein G2    53.1    1e-06   
gb|ADH04378.1|  cellulose synthase 7B                                 52.8    1e-06   
ref|XP_010324247.1|  PREDICTED: cellulose synthase-like protein E1    53.1    1e-06   
ref|XP_010040670.1|  PREDICTED: cellulose synthase-like protein E1    53.1    1e-06   
ref|XP_009791849.1|  PREDICTED: cellulose synthase-like protein G3    53.1    1e-06   
ref|XP_010055813.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    1e-06   
ref|XP_010055814.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    1e-06   
ref|XP_009418093.1|  PREDICTED: cellulose synthase-like protein E6    53.1    1e-06   
ref|XP_007035024.1|  Cellulose synthase like G2, putative isoform 2   53.1    1e-06   
dbj|BAJ98234.1|  predicted protein                                    53.1    1e-06   
gb|AES70607.2|  cellulose synthase E1-like protein                    53.1    1e-06   
ref|XP_002533503.1|  Cellulose synthase A catalytic subunit 6 [UD...  53.1    1e-06   
ref|XP_003610282.1|  Cellulose synthase catalytic subunit             53.1    1e-06   
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    1e-06   
gb|AAF89963.1|AF200527_1  cellulose synthase-3                        53.1    1e-06   
ref|XP_004506255.1|  PREDICTED: cellulose synthase-like protein H...  53.1    1e-06   
ref|XP_004506254.1|  PREDICTED: cellulose synthase-like protein H...  53.1    1e-06   
ref|XP_002524299.1|  Cellulose synthase A catalytic subunit 6 [UD...  53.1    1e-06   
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    1e-06   
gb|KEH29713.1|  cellulose synthase H1-like protein                    53.1    1e-06   
ref|XP_008356063.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    1e-06   
ref|XP_008392524.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  52.8    1e-06   
ref|XP_006354555.1|  PREDICTED: cellulose synthase-like protein G...  52.8    1e-06   
ref|XP_004495306.1|  PREDICTED: cellulose synthase-like protein E...  52.8    1e-06   
gb|ADH04382.1|  cellulose synthase 1A                                 52.4    1e-06   
gb|KDO57137.1|  hypothetical protein CISIN_1g001369mg                 53.1    1e-06   
ref|XP_006427904.1|  hypothetical protein CICLE_v10024766mg           53.1    1e-06   
gb|ADH04377.1|  cellulose synthase 7A                                 52.4    1e-06   
gb|AHX74221.1|  cellulose synthase                                    53.1    1e-06   
ref|XP_009412253.1|  PREDICTED: cellulose synthase-like protein G...  52.8    2e-06   
ref|XP_009412252.1|  PREDICTED: cellulose synthase-like protein G...  52.8    2e-06   
gb|AII73574.1|  cellulose synthase 7-A                                53.1    2e-06   
gb|AAR29965.1|  putative cellulose synthase catalytic subunit         53.1    2e-06   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    2e-06   
ref|XP_004253345.2|  PREDICTED: cellulose synthase-like protein G1    52.8    2e-06   
ref|XP_006833044.1|  hypothetical protein AMTR_s00170p00012630        53.1    2e-06   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    2e-06   
gb|EAZ13547.1|  hypothetical protein OsJ_03463                        53.1    2e-06   
ref|XP_010274921.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    2e-06   
ref|XP_004969957.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    2e-06   
gb|EMT23140.1|  Cellulose synthase A catalytic subunit 4 (UDP-for...  53.1    2e-06   
ref|XP_007151999.1|  hypothetical protein PHAVU_004G093300g           53.1    2e-06   
ref|XP_002456361.1|  hypothetical protein SORBIDRAFT_03g034680        53.1    2e-06   
ref|XP_009416421.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  53.1    2e-06   
emb|CDM84183.1|  unnamed protein product                              53.1    2e-06   
tpg|DAA36974.1|  TPA: putative cellulose synthase family protein      53.1    2e-06   
ref|XP_003569818.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    2e-06   
dbj|BAJ96282.1|  predicted protein                                    53.1    2e-06   
sp|A2WV32.2|CESA4_ORYSI  RecName: Full=Cellulose synthase A catal...  53.1    2e-06   
ref|NP_001044252.1|  Os01g0750300                                     53.1    2e-06   
ref|XP_006646324.1|  PREDICTED: cellulose synthase A catalytic su...  53.1    2e-06   
emb|CBH32503.1|  cellulose synthase, expressed                        53.1    2e-06   
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...  52.8    2e-06   
ref|XP_002315722.1|  hypothetical protein POPTR_0010s08560g           52.8    2e-06   
gb|AFV94634.1|  cellulose synthase                                    52.8    2e-06   
ref|XP_008669185.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  52.8    2e-06   
ref|NP_001105236.1|  cellulose synthase 11                            52.8    2e-06   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g           52.8    2e-06   
gb|KEH42689.1|  cellulose synthase-like protein D3                    52.8    2e-06   
gb|KHN00756.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...  52.8    2e-06   
ref|XP_003518592.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
ref|XP_009406777.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
gb|KHN21212.1|  Cellulose synthase-like protein H1                    52.8    2e-06   
emb|CDO99186.1|  unnamed protein product                              52.8    2e-06   
gb|AAX18647.1|  cellulose synthase catalytic subunit                  52.8    2e-06   
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
gb|KHG24504.1|  putative cellulose synthase A catalytic subunit 1...  52.4    2e-06   
ref|XP_003548102.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
ref|XP_006592368.1|  PREDICTED: uncharacterized LOC100500469 isof...  52.8    2e-06   
ref|XP_002325122.1|  cellulose synthase family protein                52.8    2e-06   
gb|AFZ78551.1|  cellulose synthase                                    52.8    2e-06   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...  52.8    2e-06   
dbj|BAG90397.1|  unnamed protein product                              52.8    2e-06   
ref|XP_010927397.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
ref|XP_010501210.1|  PREDICTED: cellulose synthase-like protein E...  52.8    2e-06   
gb|AFM37965.1|  cellulose synthase catalytic subunit                  52.8    2e-06   
ref|XP_007035023.1|  Cellulose synthase, putative isoform 1           52.8    2e-06   
tpg|DAA39507.1|  TPA: hypothetical protein ZEAMMB73_844715            52.4    2e-06   
ref|XP_002308412.1|  cellulose synthase family protein                52.8    2e-06   
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
gb|AGX27238.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27235.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27233.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27231.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27229.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27223.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27222.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27219.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27216.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27212.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27211.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27206.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27203.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27202.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27199.1|  cellulose synthase 7                                  52.8    2e-06   
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g           52.8    2e-06   
gb|AFZ78559.1|  cellulose synthase                                    52.8    2e-06   
gb|AGX27214.1|  cellulose synthase 7                                  52.8    2e-06   
ref|XP_011090445.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
gb|ADH04386.1|  cellulose synthase 6F                                 52.0    2e-06   
gb|ADH04385.1|  cellulose synthase 6F                                 52.0    2e-06   
gb|AGX27236.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27220.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27215.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27207.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27205.1|  cellulose synthase 7                                  52.8    2e-06   
gb|AGX27201.1|  cellulose synthase 7                                  52.8    2e-06   
gb|ADZ16119.1|  cellulose synthase A3                                 52.8    2e-06   
gb|ACT16001.1|  cellulose synthase                                    52.8    2e-06   
ref|XP_010541595.1|  PREDICTED: cellulose synthase A catalytic su...  52.8    2e-06   
gb|AGT16647.1|  cellulose synthase                                    52.8    2e-06   
tpg|DAA53225.1|  TPA: cellulose synthase3                             52.8    2e-06   
gb|AEP33550.1|  truncated cellulose synthase catalytic subunit        52.4    2e-06   
gb|AEP33542.1|  truncated cellulose synthase catalytic subunit        52.4    2e-06   
gb|ADZ16122.1|  truncated cellulose synthase A3                       52.4    2e-06   
gb|ADZ16118.1|  truncated cellulose synthase A3                       52.4    2e-06   
ref|XP_008673642.1|  PREDICTED: probable cellulose synthase A cat...  52.8    2e-06   
gb|AAY43219.2|  cellulose synthase BoCesA3                            52.8    2e-06   
ref|XP_004968377.1|  PREDICTED: probable cellulose synthase A cat...  52.8    2e-06   
gb|AAY43218.1|  cellulose synthase BoCesA2                            52.8    2e-06   
gb|ACZ82297.1|  cellulose synthase                                    52.8    2e-06   
ref|XP_009389939.1|  PREDICTED: probable cellulose synthase A cat...  52.8    2e-06   
ref|XP_010088737.1|  Isoxaben-resistant protein 2                     52.8    2e-06   
ref|XP_009781147.1|  PREDICTED: cellulose synthase-like protein H...  52.4    2e-06   
gb|EPS66740.1|  hypothetical protein M569_08032                       52.4    2e-06   
ref|XP_010238134.1|  PREDICTED: probable cellulose synthase A cat...  52.4    2e-06   
ref|XP_003562886.1|  PREDICTED: probable cellulose synthase A cat...  52.4    2e-06   
ref|XP_003536418.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    2e-06   
ref|XP_003536256.1|  PREDICTED: cellulose synthase-like protein G...  52.4    2e-06   
gb|AAY43225.1|  cellulose synthase BoCesA3                            52.4    2e-06   
ref|XP_010534646.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    2e-06   
ref|XP_007048203.1|  Cellulose synthase 6                             52.4    2e-06   
gb|AFG25776.1|  cellulose synthase 2                                  52.4    2e-06   
gb|AEE60896.1|  cellulose synthase                                    52.4    2e-06   
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    2e-06   
ref|XP_008651867.1|  PREDICTED: cellulose synthase-4 isoform X1       52.4    2e-06   
ref|XP_004498142.1|  PREDICTED: cellulose synthase-like protein E...  52.4    2e-06   
emb|CBI34512.3|  unnamed protein product                              51.2    2e-06   
ref|XP_010695250.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    2e-06   
ref|XP_010912005.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    2e-06   
ref|XP_006483337.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    2e-06   
gb|ACS88359.1|  cellulose synthase catalytic subunit                  52.4    2e-06   
gb|KDO39591.1|  hypothetical protein CISIN_1g006357mg                 52.4    2e-06   
dbj|BAJ97774.1|  predicted protein                                    52.4    2e-06   
gb|ABR16179.1|  unknown                                               52.0    2e-06   
ref|XP_007143558.1|  hypothetical protein PHAVU_007G081700g           52.4    2e-06   
dbj|BAJ85304.1|  predicted protein                                    52.4    2e-06   
gb|AEP33554.1|  cellulose synthase catalytic subunit                  52.4    2e-06   
gb|AEP33543.1|  cellulose synthase catalytic subunit                  52.4    2e-06   
ref|XP_010238067.1|  PREDICTED: probable cellulose synthase A cat...  52.4    2e-06   
ref|XP_010238033.1|  PREDICTED: probable cellulose synthase A cat...  52.4    2e-06   
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...  52.4    2e-06   
ref|XP_007018605.1|  Cellulose synthase 6                             52.4    2e-06   
emb|CDY22315.1|  BnaA06g36370D                                        52.4    2e-06   
gb|AEP33547.1|  cellulose synthase catalytic subunit                  52.4    2e-06   
gb|AAD39534.2|  cellulose synthase catalytic subunit                  52.4    2e-06   
gb|AEP33551.1|  cellulose synthase catalytic subunit                  52.4    2e-06   
gb|AEP33545.1|  cellulose synthase catalytic subunit                  52.4    2e-06   
gb|ADZ16123.1|  cellulose synthase A3                                 52.4    2e-06   
gb|ADZ16121.1|  cellulose synthase A3                                 52.4    2e-06   
ref|XP_011025442.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  52.4    2e-06   
dbj|BAG06272.1|  cellulose synthase Z632                              52.4    2e-06   
gb|EPS71230.1|  hypothetical protein M569_03522                       52.4    2e-06   
gb|AEP33541.1|  cellulose synthase catalytic subunit                  52.4    2e-06   
dbj|BAB09063.1|  cellulose synthase catalytic subunit-like protein    52.4    3e-06   
ref|NP_001104957.1|  cellulose synthase7                              52.4    3e-06   
ref|XP_011093547.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    3e-06   
gb|AAR29964.1|  putative cellulose synthase catalytic subunit         52.4    3e-06   
ref|XP_001775315.1|  predicted protein                                52.0    3e-06   
ref|XP_004981132.1|  PREDICTED: probable cellulose synthase A cat...  52.4    3e-06   
ref|XP_010481785.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    3e-06   
ref|XP_010441941.1|  PREDICTED: cellulose synthase A catalytic su...  52.4    3e-06   
ref|XP_010053163.1|  PREDICTED: cellulose synthase-like protein G3    52.4    3e-06   
gb|ACU87559.2|  cellulose synthase                                    52.4    3e-06   
gb|ABI78962.1|  cellulose synthase 10                                 52.0    3e-06   
gb|AFB18638.1|  CESA10                                                52.4    3e-06   
emb|CDO99183.1|  unnamed protein product                              52.4    3e-06   
ref|XP_002466137.1|  hypothetical protein SORBIDRAFT_01g002050        52.4    3e-06   
gb|EMS61952.1|  Cellulose synthase-like protein E6                    52.4    3e-06   
ref|XP_010228019.1|  PREDICTED: probable cellulose synthase A cat...  52.4    3e-06   
ref|XP_011048033.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  52.4    3e-06   
gb|KHG16921.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...  52.4    3e-06   
gb|AEP33538.1|  cellulose synthase catalytic subunit                  52.4    3e-06   
ref|XP_007148880.1|  hypothetical protein PHAVU_005G022100g           52.4    3e-06   
ref|NP_199216.2|  cellulose synthase A catalytic subunit 4 [UDP-f...  52.4    3e-06   
gb|AAO15532.1|AF458083_1  cellulose synthase                          52.4    3e-06   
ref|XP_006281455.1|  hypothetical protein CARUB_v10027534mg           52.4    3e-06   
ref|XP_006427905.1|  hypothetical protein CICLE_v10024766mg           52.4    3e-06   
ref|XP_007052527.1|  Cellulose synthase family protein isoform 3      52.4    3e-06   
gb|AEP33539.1|  cellulose synthase catalytic subunit                  52.4    3e-06   
gb|EMT20923.1|  Putative cellulose synthase A catalytic subunit 1...  52.4    3e-06   
ref|NP_001104956.1|  cellulose synthase6                              52.4    3e-06   
dbj|BAJ88271.1|  predicted protein                                    52.4    3e-06   
gb|ADZ16120.1|  cellulose synthase A3                                 52.4    3e-06   
ref|XP_002463687.1|  hypothetical protein SORBIDRAFT_01g004210        52.4    3e-06   
gb|KHN39939.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...  52.4    3e-06   
gb|ACU80553.2|  cellulose synthase                                    52.4    3e-06   
ref|XP_011020351.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  52.4    3e-06   
ref|XP_002865387.1|  hypothetical protein ARALYDRAFT_494593           52.4    3e-06   
gb|KHN19454.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...  52.4    3e-06   
ref|XP_009412927.1|  PREDICTED: cellulose synthase-like protein G3    52.0    3e-06   
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein      52.4    3e-06   
gb|KHM98952.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...  52.4    3e-06   



>ref|XP_010313950.1| PREDICTED: cellulose synthase-like protein E6 isoform X2 [Solanum 
lycopersicum]
Length=623

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY+SREKKP +PHNFKAGSM++LIRVS+
Sbjct  151  GNRLPTLVYMSREKKPNRPHNFKAGSMNSLIRVSS  185



>ref|XP_010313949.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Solanum 
lycopersicum]
Length=733

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY+SREKKP +PHNFKAGSM++LIRVS+
Sbjct  261  GNRLPTLVYMSREKKPNRPHNFKAGSMNSLIRVSS  295



>emb|CDP13703.1| unnamed protein product [Coffea canephora]
Length=677

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+QLPTLVYLSREK+P++PH+FKAGSM+ALIRVS+
Sbjct  204  GHQLPTLVYLSREKRPQRPHHFKAGSMNALIRVSS  238



>ref|XP_009624029.1| PREDICTED: cellulose synthase-like protein E6 [Nicotiana tomentosiformis]
Length=740

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY+SREKKP+ PHNFKAGSM++LIRVS+
Sbjct  270  GNRLPTLVYMSREKKPKWPHNFKAGSMNSLIRVSS  304



>gb|AAZ32787.1| cellulose synthase-like protein CslE [Nicotiana tabacum]
Length=740

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY+SREKKP+ PHNFKAGSM++LIRVS+
Sbjct  270  GNRLPTLVYMSREKKPKCPHNFKAGSMNSLIRVSS  304



>ref|XP_009396291.1| PREDICTED: cellulose synthase-like protein E6 [Musa acuminata 
subsp. malaccensis]
Length=728

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVYLSREK+PR PHNFKAG+++ALIRVS+
Sbjct  258  GNTLPTLVYLSREKRPRYPHNFKAGALNALIRVSS  292



>ref|XP_006344955.1| PREDICTED: cellulose synthase-like protein E6-like [Solanum tuberosum]
Length=794

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY+SREKKP  PHNFKAGSM++LIRVS+
Sbjct  321  GNRLPTLVYMSREKKPNLPHNFKAGSMNSLIRVSS  355



>ref|XP_011095564.1| PREDICTED: cellulose synthase-like protein E6 [Sesamum indicum]
Length=934

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVYLSREK+P  PHNFKAGSM++LIRVSA
Sbjct  265  GNRLPTLVYLSREKRPGWPHNFKAGSMNSLIRVSA  299



>emb|CBI39755.3| unnamed protein product [Vitis vinifera]
Length=710

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G++LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  235  GSKLPTLVYLAREKRPKHPHNFKAGAMNALIRVSS  269



>ref|XP_010644596.1| PREDICTED: cellulose synthase-like protein E1 [Vitis vinifera]
Length=732

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G++LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  257  GSKLPTLVYLAREKRPKHPHNFKAGAMNALIRVSS  291



>ref|XP_006380865.1| hypothetical protein POPTR_0006s00610g [Populus trichocarpa]
 gb|ERP58662.1| hypothetical protein POPTR_0006s00610g [Populus trichocarpa]
Length=718

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYLSREK+P+ PHNFKAG+M+ALIRVS+
Sbjct  259  GQRLPTLVYLSREKRPQYPHNFKAGAMNALIRVSS  293



>ref|XP_011002350.1| PREDICTED: cellulose synthase-like protein E6 [Populus euphratica]
Length=731

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYLSREK+P+ PHNFKAG+M+ALIRVS+
Sbjct  259  GQRLPTLVYLSREKRPQYPHNFKAGAMNALIRVSS  293



>ref|XP_010552366.1| PREDICTED: cellulose synthase-like protein E1 [Tarenaya hassleriana]
Length=714

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY+SREK+P+ PH+FKAG+M+ALIRVS+
Sbjct  246  GNELPTLVYMSREKRPQYPHHFKAGAMNALIRVSS  280



>ref|XP_007020466.1| Cellulose synthase like E1, putative isoform 2 [Theobroma cacao]
 gb|EOY11991.1| Cellulose synthase like E1, putative isoform 2 [Theobroma cacao]
Length=505

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  27   GSALPTLVYLAREKRPQHPHNFKAGAMNALIRVSS  61



>ref|XP_006344956.1| PREDICTED: cellulose synthase-like protein E6-like [Solanum tuberosum]
Length=769

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREKKP  PHNFKAGSM+ LIRVS+
Sbjct  300  GNRLPMLVYMSREKKPNLPHNFKAGSMNTLIRVSS  334



>ref|XP_007020465.1| Cellulose synthase like E1, putative isoform 1 [Theobroma cacao]
 gb|EOY11990.1| Cellulose synthase like E1, putative isoform 1 [Theobroma cacao]
Length=734

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  256  GSALPTLVYLAREKRPQHPHNFKAGAMNALIRVSS  290



>ref|XP_009796259.1| PREDICTED: cellulose synthase-like protein E6 [Nicotiana sylvestris]
Length=736

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY+SREKKP+  HNFKAGSM++LIRVS+
Sbjct  267  GNPLPTLVYMSREKKPKWTHNFKAGSMNSLIRVSS  301



>ref|XP_010252798.1| PREDICTED: cellulose synthase-like protein E6 isoform X2 [Nelumbo 
nucifera]
Length=637

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  162  GHALPTLVYLAREKRPQFPHNFKAGAMNALIRVSS  196



>gb|KDO59153.1| hypothetical protein CISIN_1g006553mg [Citrus sinensis]
Length=641

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+P  PHNFKAG+M+ALIRVS+
Sbjct  173  GCQLPTLVYMAREKRPECPHNFKAGAMNALIRVSS  207



>ref|XP_011002349.1| PREDICTED: cellulose synthase-like protein E6 [Populus euphratica]
Length=732

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  260  GQPLPTLVYLAREKRPQYPHNFKAGAMNALIRVSS  294



>ref|XP_002307850.1| hypothetical protein POPTR_0006s00620g [Populus trichocarpa]
 gb|EEE91373.1| hypothetical protein POPTR_0006s00620g [Populus trichocarpa]
Length=732

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  260  GQPLPTLVYLAREKRPQYPHNFKAGAMNALIRVSS  294



>gb|AFZ78595.1| cellulose synthase-like protein [Populus tomentosa]
Length=732

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  260  GQPLPTLVYLAREKRPQYPHNFKAGAMNALIRVSS  294



>ref|XP_006452622.1| hypothetical protein CICLE_v10007653mg [Citrus clementina]
 gb|ESR65862.1| hypothetical protein CICLE_v10007653mg [Citrus clementina]
Length=676

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+P  PHNFKAG+M+ALIRVS+
Sbjct  204  GCQLPTLVYMAREKRPECPHNFKAGAMNALIRVSS  238



>ref|XP_010252797.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Nelumbo 
nucifera]
Length=738

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  263  GHALPTLVYLAREKRPQFPHNFKAGAMNALIRVSS  297



>ref|XP_002522779.1| cellulose synthase, putative [Ricinus communis]
 gb|EEF39630.1| cellulose synthase, putative [Ricinus communis]
Length=728

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  260  GCALPTLVYLAREKRPQNPHNFKAGAMNALIRVSS  294



>dbj|BAD12923.1| putative cellulose synthase-like protein OsCslE2 [Oryza sativa 
Japonica Group]
 dbj|BAG99856.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REKKP+K H+FKAGS++ALIRVS+
Sbjct  57   GNALPTLVYMAREKKPQKQHHFKAGSLNALIRVSS  91



>ref|XP_004296325.1| PREDICTED: cellulose synthase-like protein E6-like [Fragaria 
vesca subsp. vesca]
Length=741

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPT+VY+SREK+P++PHNFKAG+M+AL+RVS+
Sbjct  269  GCRLPTIVYMSREKRPQQPHNFKAGAMNALLRVSS  303



>gb|EEC73919.1| hypothetical protein OsI_08762 [Oryza sativa Indica Group]
Length=745

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REKKP+K H+FKAGS++ALIRVS+
Sbjct  274  GNALPTLVYMAREKKPQKQHHFKAGSLNALIRVSS  308



>ref|NP_001047983.1| Os02g0725300 [Oryza sativa Japonica Group]
 sp|Q0DXZ1.1|CSLE2_ORYSJ RecName: Full=Cellulose synthase-like protein E2; AltName: Full=OsCslE2 
[Oryza sativa Japonica Group]
 dbj|BAF09897.1| Os02g0725300 [Oryza sativa Japonica Group]
 dbj|BAG95085.1| unnamed protein product [Oryza sativa Japonica Group]
Length=745

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REKKP+K H+FKAGS++ALIRVS+
Sbjct  274  GNALPTLVYMAREKKPQKQHHFKAGSLNALIRVSS  308



>gb|AAL25130.1|AF432501_1 cellulose synthase-like protein OsCslE2 [Oryza sativa]
Length=745

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REKKP+K H+FKAGS++ALIRVS+
Sbjct  274  GNALPTLVYMAREKKPQKQHHFKAGSLNALIRVSS  308



>ref|XP_010092349.1| Cellulose synthase-like protein E6 [Morus notabilis]
 gb|EXB51025.1| Cellulose synthase-like protein E6 [Morus notabilis]
Length=748

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G++LPTLVY++REK+P  PHNFKAG+M+ALIRVS+
Sbjct  276  GSRLPTLVYMAREKRPNWPHNFKAGAMNALIRVSS  310



>gb|KDO59154.1| hypothetical protein CISIN_1g009753mg [Citrus sinensis]
Length=526

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+P  PHNFKAG+M+ALIRVS+
Sbjct  57   GCQLPTLVYMAREKRPGCPHNFKAGAMNALIRVSS  91



>ref|XP_006474871.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Citrus sinensis]
Length=921

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVS  103
            G  LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS
Sbjct  259  GCSLPTLVYLAREKRPQHPHNFKAGAMNALIRVS  292



>ref|XP_011097754.1| PREDICTED: cellulose synthase-like protein E6 [Sesamum indicum]
Length=735

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVYLSREK+P   HNFKAGSM++LIRVS+
Sbjct  264  GNRLPTLVYLSREKRPGWAHNFKAGSMNSLIRVSS  298



>ref|XP_002522778.1| coated vesicle membrane protein, putative [Ricinus communis]
 gb|EEF39629.1| coated vesicle membrane protein, putative [Ricinus communis]
Length=938

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  269  GFALPTLVYLAREKRPQHPHNFKAGAMNALIRVSS  303



>ref|XP_006474852.1| PREDICTED: cellulose synthase-like protein E6-like isoform X2 
[Citrus sinensis]
Length=711

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+P  PHNFKAG+M+ALIRVS+
Sbjct  242  GCQLPTLVYMAREKRPGCPHNFKAGAMNALIRVSS  276



>ref|XP_006474851.1| PREDICTED: cellulose synthase-like protein E6-like isoform X1 
[Citrus sinensis]
Length=727

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+P  PHNFKAG+M+ALIRVS+
Sbjct  258  GCQLPTLVYMAREKRPGCPHNFKAGAMNALIRVSS  292



>ref|XP_008218336.1| PREDICTED: cellulose synthase-like protein E6 [Prunus mume]
 ref|XP_008218345.1| PREDICTED: cellulose synthase-like protein E6 [Prunus mume]
Length=737

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLP +VY+SREKKP++PHNFKAG+++AL+RVS+
Sbjct  265  GCQLPMMVYMSREKKPQQPHNFKAGALNALLRVSS  299



>ref|XP_006857766.1| hypothetical protein AMTR_s00061p00200560 [Amborella trichopoda]
 gb|ERN19233.1| hypothetical protein AMTR_s00061p00200560 [Amborella trichopoda]
Length=729

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK P +PHNFKAG+M+ALIRVS+
Sbjct  258  GVPLPTLVYLAREKTPERPHNFKAGAMNALIRVSS  292



>ref|XP_007020463.1| Cellulose synthase like E1 [Theobroma cacao]
 gb|EOY11988.1| Cellulose synthase like E1 [Theobroma cacao]
Length=1477

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
             G  LPTLVYL+REK+P+ PHNFKAG+M+ALIRVS+
Sbjct  1001  GCALPTLVYLAREKRPQYPHNFKAGAMNALIRVSS  1035


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+R+K+P+  HNFKAG+M+ALIR+S+
Sbjct  259  GCRLPTLVYLARQKRPQHFHNFKAGAMNALIRISS  293



>ref|XP_010928136.1| PREDICTED: cellulose synthase-like protein E1 [Elaeis guineensis]
Length=454

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  135  GNALPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  169



>ref|XP_003635524.1| PREDICTED: cellulose synthase-like protein E6, partial [Vitis 
vinifera]
Length=352

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  261  GQPLPTLVYLSREKRPKYAHNFKAGAMNALIRVSS  295



>ref|XP_006474853.1| PREDICTED: cellulose synthase-like protein E6-like [Citrus sinensis]
Length=724

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY +REK+P  PHNFKAG+M+ALIRVS+
Sbjct  255  GCQLPTLVYTAREKRPECPHNFKAGAMNALIRVSS  289



>ref|XP_003576648.2| PREDICTED: cellulose synthase-like protein E6 [Brachypodium distachyon]
Length=675

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  203  GNMLPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  237



>ref|XP_006495176.1| PREDICTED: cellulose synthase-like protein E1-like, partial [Citrus 
sinensis]
Length=548

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY +REK+P  PHNFKAG+M+ALIRVS+
Sbjct  255  GCQLPTLVYTAREKRPECPHNFKAGAMNALIRVSS  289



>ref|XP_008805495.1| PREDICTED: cellulose synthase-like protein E6 isoform X2 [Phoenix 
dactylifera]
Length=728

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  257  GNALPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  291



>ref|XP_010647486.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Vitis 
vinifera]
Length=687

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  214  GQPLPTLVYLSREKRPKYAHNFKAGAMNALIRVSS  248



>ref|XP_003635559.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Vitis 
vinifera]
Length=734

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  261  GQPLPTLVYLSREKRPKYAHNFKAGAMNALIRVSS  295



>gb|EEE57722.1| hypothetical protein OsJ_08209 [Oryza sativa Japonica Group]
Length=843

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REKKP+K H+FKAGS++ALIRVS+
Sbjct  372  GNALPTLVYMAREKKPQKQHHFKAGSLNALIRVSS  406



>gb|EYU27448.1| hypothetical protein MIMGU_mgv1a001968mg [Erythranthe guttata]
Length=732

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVYLSREKK    HNFKAGSM+AL+RVSA
Sbjct  260  GNKLPTLVYLSREKKTGCAHNFKAGSMNALLRVSA  294



>emb|CBI29575.3| unnamed protein product [Vitis vinifera]
Length=1035

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  261  GQPLPTLVYLSREKRPKYAHNFKAGAMNALIRVSS  295


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  2     GNQLPTLVYLSREKKPRKPHNFKAGSMDALIR  97
             G  LPTLVYLSREK+P+  HNFKAG+M+ALIR
Sbjct  1000  GQPLPTLVYLSREKRPKYHHNFKAGAMNALIR  1031



>gb|KHF97453.1| Cellulose synthase-like protein E6 [Gossypium arboreum]
Length=438

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVYL+REK+P+  H+FKAGSM+ALIRVS+
Sbjct  146  GNPLPTLVYLAREKRPQHHHHFKAGSMNALIRVSS  180



>dbj|BAJ85551.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95782.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92266.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  259  GNALPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  293



>emb|CBI23547.3| unnamed protein product [Vitis vinifera]
Length=392

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  274  GQPLPTLVYLSREKRPKYAHNFKAGAMNALIRVSS  308



>gb|EMT18146.1| Cellulose synthase-like protein E6 [Aegilops tauschii]
Length=607

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  134  GNVLPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  168



>ref|XP_008783292.1| PREDICTED: cellulose synthase-like protein E6 [Phoenix dactylifera]
Length=693

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAGSM+ALIR S+
Sbjct  257  GNALPTLVYMAREKRPQHHHNFKAGSMNALIRASS  291



>ref|XP_010092347.1| Cellulose synthase-like protein E1 [Morus notabilis]
 gb|EXB51023.1| Cellulose synthase-like protein E1 [Morus notabilis]
Length=577

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G++LPTLVY++REK+P  PHNFKAG+++ALIRVS+
Sbjct  247  GSRLPTLVYMAREKRPNWPHNFKAGAINALIRVSS  281



>ref|XP_003576649.1| PREDICTED: cellulose synthase-like protein E6 [Brachypodium distachyon]
Length=725

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  253  GNVLPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  287



>gb|EMT33243.1| Cellulose synthase-like protein E6 [Aegilops tauschii]
Length=733

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  256  GNVLPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  290



>gb|KHG20199.1| Cellulose synthase-like protein E6 [Gossypium arboreum]
Length=677

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVYL+REK+P+  H+FKAGSM+ALIRVS+
Sbjct  263  GNPLPTLVYLAREKRPQYHHHFKAGSMNALIRVSS  297



>emb|CBI39757.3| unnamed protein product [Vitis vinifera]
Length=675

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY++REK+P+  HNFKAGSM+AL RVS+
Sbjct  201  GNRLPTLVYIAREKRPQVHHNFKAGSMNALTRVSS  235



>emb|CAN62860.1| hypothetical protein VITISV_036212 [Vitis vinifera]
Length=718

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY++REK+P+  HNFKAGSM+AL RVS+
Sbjct  258  GNRLPTLVYIAREKRPQVHHNFKAGSMNALTRVSS  292



>ref|XP_002266273.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=736

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVY++REK+P+  HNFKAGSM+AL RVS+
Sbjct  262  GNRLPTLVYIAREKRPQVHHNFKAGSMNALTRVSS  296



>ref|XP_006452614.1| hypothetical protein CICLE_v10007585mg [Citrus clementina]
 gb|ESR65854.1| hypothetical protein CICLE_v10007585mg [Citrus clementina]
Length=727

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVS  103
            G  LPTLV+L+REK+P+ PHNFKAG+M+ALIRVS
Sbjct  259  GCSLPTLVHLAREKRPQHPHNFKAGAMNALIRVS  292



>emb|CBI23490.3| unnamed protein product [Vitis vinifera]
Length=619

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  207  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  241



>emb|CBI29437.3| unnamed protein product [Vitis vinifera]
Length=531

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  270  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  304



>emb|CBI29435.3| unnamed protein product [Vitis vinifera]
Length=642

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  207  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  241



>gb|KDP39305.1| hypothetical protein JCGZ_01062 [Jatropha curcas]
Length=731

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P+ PH+FKAG+++ALIRVS+
Sbjct  256  GCRLPTLVYLAREKRPKHPHHFKAGALNALIRVSS  290



>ref|XP_002462534.1| hypothetical protein SORBIDRAFT_02g027570 [Sorghum bicolor]
 gb|EER99055.1| hypothetical protein SORBIDRAFT_02g027570 [Sorghum bicolor]
Length=728

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  255  GNVLPTLVYMAREKRPQYHHNFKAGAMNALIRVSS  289



>ref|XP_004957121.1| PREDICTED: cellulose synthase-like protein E6-like isoform X1 
[Setaria italica]
Length=732

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  255  GNVLPTLVYMAREKRPQYHHNFKAGAMNALIRVSS  289



>ref|XP_004957122.1| PREDICTED: cellulose synthase-like protein E6-like isoform X2 
[Setaria italica]
Length=734

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  256  GNVLPTLVYMAREKRPQYHHNFKAGAMNALIRVSS  290



>emb|CBI23494.3| unnamed protein product [Vitis vinifera]
Length=682

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  270  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  304



>gb|KCW70464.1| hypothetical protein EUGRSUZ_F03681 [Eucalyptus grandis]
Length=739

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  273  GNALPTLVYMAREKRPQYFHNFKAGAMNALIRVSS  307



>ref|XP_004957118.1| PREDICTED: cellulose synthase-like protein E6-like isoform X2 
[Setaria italica]
Length=732

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  252  GNVLPTLVYMAREKRPQYHHNFKAGAMNALIRVSS  286



>ref|XP_004957117.1| PREDICTED: cellulose synthase-like protein E6-like isoform X1 
[Setaria italica]
Length=721

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  251  GNVLPTLVYMAREKRPQYHHNFKAGAMNALIRVSS  285



>ref|XP_003635328.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=735

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  263  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  297



>ref|XP_010646988.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=742

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  270  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  304



>ref|XP_003635361.2| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=742

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  270  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  304



>ref|XP_002274290.2| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=746

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M+ALIRVS+
Sbjct  274  GQPLPTLVYLSREKRPQYHHNFKAGAMNALIRVSS  308



>ref|XP_010252429.1| PREDICTED: uncharacterized protein LOC104594007 [Nelumbo nucifera]
Length=1240

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+P   HNFKAG+M+ALIRVS+
Sbjct  767  GKQLPTLVYMAREKRPNYHHNFKAGAMNALIRVSS  801


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+    HNFKAG+M+ALIRVS+
Sbjct  64   GKQLPTLVYMAREKRFHYHHNFKAGAMNALIRVSS  98



>ref|XP_010063253.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Eucalyptus 
grandis]
Length=956

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  295  GNALPTLVYMAREKRPQYFHNFKAGAMNALIRVSS  329



>ref|XP_002522780.1| cellulose synthase, putative [Ricinus communis]
 gb|EEF39631.1| cellulose synthase, putative [Ricinus communis]
Length=606

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G ++PTLVYL+REK+P+ PH+FKAG+M+ALIRVS+
Sbjct  136  GCRMPTLVYLAREKRPQYPHHFKAGAMNALIRVSS  170



>ref|XP_010252795.1| PREDICTED: cellulose synthase-like protein E6 [Nelumbo nucifera]
Length=728

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P   HNFKAG+M+ALIRVS+
Sbjct  256  GQRLPTLVYLAREKRPHHHHNFKAGAMNALIRVSS  290



>ref|XP_010252796.1| PREDICTED: cellulose synthase-like protein E6 [Nelumbo nucifera]
Length=739

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P   HNFKAG+M+ALIRVS+
Sbjct  267  GQRLPTLVYLAREKRPHHHHNFKAGAMNALIRVSS  301



>gb|EMS61953.1| Cellulose synthase-like protein E6 [Triticum urartu]
Length=761

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  284  GNVLPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  318



>ref|NP_001147894.1| CSLE6 - cellulose synthase-like family E [Zea mays]
 gb|ACG29048.1| CSLE6 - cellulose synthase-like family E [Zea mays]
Length=726

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  257  GNVLPTLVYVAREKRPQYHHNFKAGAMNALIRVSS  291



>gb|ACN32031.1| unknown [Zea mays]
 tpg|DAA61943.1| TPA: CSLE6-cellulose synthase-like family E [Zea mays]
Length=727

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  258  GNVLPTLVYVAREKRPQYHHNFKAGAMNALIRVSS  292



>ref|XP_010928076.1| PREDICTED: cellulose synthase-like protein E6 isoform X5 [Elaeis 
guineensis]
Length=676

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIR S+
Sbjct  204  GNALPTLVYMAREKRPQHHHNFKAGAMNALIRASS  238



>gb|KDP39303.1| hypothetical protein JCGZ_01060 [Jatropha curcas]
Length=740

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P  PH+FKAG+M+ALIRVS+
Sbjct  264  GCRLPTLVYLAREKRPHFPHHFKAGAMNALIRVSS  298



>ref|XP_010928075.1| PREDICTED: cellulose synthase-like protein E6 isoform X4 [Elaeis 
guineensis]
Length=725

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIR S+
Sbjct  253  GNALPTLVYMAREKRPQHHHNFKAGAMNALIRASS  287



>ref|XP_010928073.1| PREDICTED: cellulose synthase-like protein E6 isoform X2 [Elaeis 
guineensis]
Length=729

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIR S+
Sbjct  257  GNALPTLVYMAREKRPQHHHNFKAGAMNALIRASS  291



>ref|XP_008805493.1| PREDICTED: cellulose synthase-like protein E6 [Phoenix dactylifera]
Length=729

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIR S+
Sbjct  257  GNALPTLVYMAREKRPQHHHNFKAGAMNALIRASS  291



>emb|CBI29434.3| unnamed protein product [Vitis vinifera]
Length=632

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M++LIRVS+
Sbjct  185  GQSLPTLVYLSREKRPQYHHNFKAGAMNSLIRVSS  219



>ref|XP_004296326.1| PREDICTED: cellulose synthase-like protein E1-like [Fragaria 
vesca subsp. vesca]
Length=732

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAGSM+ALIRVS+
Sbjct  256  GCGLPTLVYLAREKRPQHHHNFKAGSMNALIRVSS  290



>ref|XP_002300383.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE85188.1| cellulose synthase family protein [Populus trichocarpa]
Length=736

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  262  GSALPTLVYLAREKRPQHFHNFKAGAMNALIRVSS  296



>gb|AFZ78594.1| cellulose synthase-like protein [Populus tomentosa]
Length=736

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  262  GSALPTLVYLAREKRPQHFHNFKAGAMNALIRVSS  296



>ref|XP_011038831.1| PREDICTED: cellulose synthase-like protein E1 [Populus euphratica]
Length=772

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  298  GSALPTLVYLAREKRPQHFHNFKAGAMNALIRVSS  332



>gb|EYU33712.1| hypothetical protein MIMGU_mgv1a001906mg [Erythranthe guttata]
Length=741

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LPTLVYLSREK+    HNFKAGSM+ALIRVS+
Sbjct  267  GNRLPTLVYLSREKRRGWQHNFKAGSMNALIRVSS  301



>ref|XP_010928072.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Elaeis 
guineensis]
Length=730

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  H+FKAG+M+ALIRVS+
Sbjct  257  GNALPTLVYMAREKRPQHHHHFKAGAMNALIRVSS  291



>ref|XP_010928077.1| PREDICTED: cellulose synthase-like protein E6 isoform X6 [Elaeis 
guineensis]
Length=634

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  H+FKAG+M+ALIRVS+
Sbjct  257  GNALPTLVYMAREKRPQHHHHFKAGAMNALIRVSS  291



>gb|EEE69911.1| hypothetical protein OsJ_29757 [Oryza sativa Japonica Group]
Length=698

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK P+  HNFKAG+++ALIRVSA
Sbjct  260  GNVLPTLVYMAREKSPQYHHNFKAGALNALIRVSA  294



>sp|Q651X6.1|CSLE6_ORYSJ RecName: Full=Cellulose synthase-like protein E6; AltName: Full=OsCslE6 
[Oryza sativa Japonica Group]
 dbj|BAD46391.1| putative cellulose synthase-like protein OsCslE1 [Oryza sativa 
Japonica Group]
Length=728

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK P+  HNFKAG+++ALIRVSA
Sbjct  260  GNVLPTLVYMAREKSPQYHHNFKAGALNALIRVSA  294



>gb|EAZ09494.1| hypothetical protein OsI_31767 [Oryza sativa Indica Group]
Length=728

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK P+  HNFKAG+++ALIRVSA
Sbjct  260  GNVLPTLVYMAREKSPQYHHNFKAGALNALIRVSA  294



>ref|XP_010087673.1| Cellulose synthase-like protein E6 [Morus notabilis]
 gb|EXB29566.1| Cellulose synthase-like protein E6 [Morus notabilis]
Length=660

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REKKP   HNFKAG+M+ALIRVS+
Sbjct  174  GKPLPTLVYLAREKKPHFHHNFKAGAMNALIRVSS  208



>gb|EMS68034.1| Cellulose synthase-like protein E2 [Triticum urartu]
Length=651

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LP LVY+SREK+P++ H+FKAGS++ALIRVS+
Sbjct  182  GNALPKLVYMSREKRPQEQHHFKAGSLNALIRVSS  216



>gb|KDO59145.1| hypothetical protein CISIN_1g009524mg [Citrus sinensis]
Length=532

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  57   GCALPTLVYLAREKRPQYSHNFKAGAMNALIRVSS  91



>ref|XP_006661352.1| PREDICTED: cellulose synthase-like protein E6-like [Oryza brachyantha]
Length=726

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LP+LVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  259  GNVLPSLVYMAREKRPQYHHNFKAGAMNALIRVSS  293



>emb|CBI23493.3| unnamed protein product [Vitis vinifera]
Length=352

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M++LIRVS+
Sbjct  186  GQSLPTLVYLSREKRPQYHHNFKAGAMNSLIRVSS  220



>ref|XP_010092016.1| Cellulose synthase-like protein E6 [Morus notabilis]
 gb|EXB49752.1| Cellulose synthase-like protein E6 [Morus notabilis]
Length=736

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REKKP   HNFKAG+M+ALIRVS+
Sbjct  263  GKPLPTLVYLAREKKPHFHHNFKAGAMNALIRVSS  297



>ref|XP_008366099.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Malus 
domestica]
Length=684

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  210  GCRLPTLVYLAREKRPQYHHNFKAGAMNALIRVSS  244



>ref|XP_010646989.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=449

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M++LIRVS+
Sbjct  263  GQSLPTLVYLSREKRPQYHHNFKAGAMNSLIRVSS  297



>ref|XP_006661350.1| PREDICTED: cellulose synthase-like protein E6-like [Oryza brachyantha]
Length=726

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G++LPTLVY++REK+P+  HNFKAG+++ALIRVS+
Sbjct  259  GHELPTLVYMAREKRPKYHHNFKAGALNALIRVSS  293



>ref|XP_006661351.1| PREDICTED: cellulose synthase-like protein E6-like [Oryza brachyantha]
Length=731

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G++LPTLVY++REK+P+  HNFKAG+++ALIRVS+
Sbjct  263  GHELPTLVYMAREKRPKYHHNFKAGALNALIRVSS  297



>ref|XP_007207930.1| hypothetical protein PRUPE_ppa018204mg [Prunus persica]
 gb|EMJ09129.1| hypothetical protein PRUPE_ppa018204mg [Prunus persica]
Length=733

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVSA
Sbjct  274  GCGLPTLVYLAREKRPQYHHNFKAGAMNALIRVSA  308



>ref|XP_010928137.1| PREDICTED: cellulose synthase-like protein E6 [Elaeis guineensis]
Length=408

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  HNFKAG+M+ALIR S+
Sbjct  135  GNALPTLVYVAREKRPQHHHNFKAGAMNALIRASS  169



>ref|XP_008366098.1| PREDICTED: cellulose synthase-like protein E1 isoform X1 [Malus 
domestica]
Length=731

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  257  GCRLPTLVYLAREKRPQYHHNFKAGAMNALIRVSS  291



>ref|XP_006452623.1| hypothetical protein CICLE_v10007586mg [Citrus clementina]
 gb|ESR65863.1| hypothetical protein CICLE_v10007586mg [Citrus clementina]
Length=526

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+   PHNFKAG+M+ALIRVS+
Sbjct  57   GCQLPTLVYMAREKRSGCPHNFKAGAMNALIRVSS  91



>ref|XP_002454361.1| hypothetical protein SORBIDRAFT_04g029420 [Sorghum bicolor]
 gb|EES07337.1| hypothetical protein SORBIDRAFT_04g029420 [Sorghum bicolor]
Length=708

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P++ H+FKAGS++ALIRVS+
Sbjct  270  GNVLPTLVYMAREKRPQEHHHFKAGSLNALIRVSS  304



>gb|KHG12106.1| Cellulose synthase-like protein E6 [Gossypium arboreum]
Length=730

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVYL+REK+P+  H+FKAG+M+ALIR+S+
Sbjct  256  GNPLPTLVYLAREKRPQYHHHFKAGAMNALIRISS  290



>emb|CBI29436.3| unnamed protein product [Vitis vinifera]
Length=459

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+P+  HNFKAG+M++LIRVS+
Sbjct  207  GQSLPTLVYLSREKRPQYHHNFKAGAMNSLIRVSS  241



>gb|EYU33711.1| hypothetical protein MIMGU_mgv1a001960mg [Erythranthe guttata]
Length=733

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  257  GCRLPTLVYLAREKRPQHFHNFKAGAMNALIRVSS  291



>ref|XP_006474867.1| PREDICTED: cellulose synthase-like protein E1-like [Citrus sinensis]
Length=758

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  283  GCALPTLVYLAREKRPQYSHNFKAGAMNALIRVSS  317



>ref|XP_006452624.1| hypothetical protein CICLE_v10007586mg [Citrus clementina]
 gb|ESR65864.1| hypothetical protein CICLE_v10007586mg [Citrus clementina]
Length=727

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLPTLVY++REK+   PHNFKAG+M+ALIRVS+
Sbjct  258  GCQLPTLVYMAREKRSGCPHNFKAGAMNALIRVSS  292



>ref|XP_007206429.1| hypothetical protein PRUPE_ppa001936mg [Prunus persica]
 gb|EMJ07628.1| hypothetical protein PRUPE_ppa001936mg [Prunus persica]
Length=739

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  263  GCKLPTLVYLAREKRPQCHHNFKAGAMNALIRVSS  297



>emb|CDP13705.1| unnamed protein product [Coffea canephora]
Length=675

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P   HNFKAG+M+ALIRVS+
Sbjct  201  GCKLPTLVYLAREKRPEHFHNFKAGAMNALIRVSS  235



>ref|XP_007020460.1| Cellulose synthase like E1 isoform 2 [Theobroma cacao]
 gb|EOY11985.1| Cellulose synthase like E1 isoform 2 [Theobroma cacao]
Length=536

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVY++REK+P  PH+FKAG+M+ALIRVS+
Sbjct  63   GCRLPTLVYMAREKRPGWPHHFKAGAMNALIRVSS  97



>ref|XP_002462535.1| hypothetical protein SORBIDRAFT_02g027610 [Sorghum bicolor]
 gb|EER99056.1| hypothetical protein SORBIDRAFT_02g027610 [Sorghum bicolor]
Length=755

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVY++REK+P   HNFKAG+M+ALIRVS+
Sbjct  270  GSMLPTLVYMAREKRPHYHHNFKAGAMNALIRVSS  304



>ref|XP_004139857.1| PREDICTED: cellulose synthase-like protein E1-like [Cucumis sativus]
 gb|KGN44128.1| hypothetical protein Csa_7G200810 [Cucumis sativus]
Length=733

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+AL+RVS+
Sbjct  257  GDMLPTLVYLAREKRPQYFHNFKAGAMNALLRVSS  291



>ref|XP_004168176.1| PREDICTED: cellulose synthase-like protein E1-like [Cucumis sativus]
Length=748

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+AL+RVS+
Sbjct  272  GDMLPTLVYLAREKRPQYFHNFKAGAMNALLRVSS  306



>ref|XP_009349150.1| PREDICTED: uncharacterized protein LOC103940710 [Pyrus x bretschneideri]
Length=1472

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
             G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  996   GCVLPTLVYLAREKRPKHHHNFKAGAMNALIRVSS  1030


 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +L T+VY+SREK+P++PH+FKAG+++AL+RVS+
Sbjct  267  GCRLATMVYVSREKRPQQPHHFKAGAVNALLRVSS  301



>ref|XP_009419218.1| PREDICTED: cellulose synthase-like protein E6 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419219.1| PREDICTED: cellulose synthase-like protein E6 [Musa acuminata 
subsp. malaccensis]
Length=730

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  258  GTVLPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  292



>ref|XP_007020459.1| Cellulose synthase like E1 isoform 1 [Theobroma cacao]
 gb|EOY11984.1| Cellulose synthase like E1 isoform 1 [Theobroma cacao]
Length=741

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVY++REK+P  PH+FKAG+M+ALIRVS+
Sbjct  268  GCRLPTLVYMAREKRPGWPHHFKAGAMNALIRVSS  302



>gb|EMT33244.1| Cellulose synthase-like protein E6 [Aegilops tauschii]
Length=652

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P+  HNFKAG+M+ALIRVS+
Sbjct  180  GKVLPTLVYMAREKRPQHHHNFKAGAMNALIRVSS  214



>ref|XP_007030084.1| Cellulose synthase like E1, putative [Theobroma cacao]
 gb|EOY10586.1| Cellulose synthase like E1, putative [Theobroma cacao]
Length=735

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+++ALIRVS+
Sbjct  261  GKPLPTLVYLAREKRPQHHHNFKAGALNALIRVSS  295



>ref|XP_009787708.1| PREDICTED: cellulose synthase-like protein E6 isoform X3 [Nicotiana 
sylvestris]
Length=663

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+ALIRVSA
Sbjct  258  GQILPTLVYLAREKRPQHHHHFKAGAMNALIRVSA  292



>ref|XP_007142430.1| hypothetical protein PHAVU_008G279800g [Phaseolus vulgaris]
 gb|ESW14424.1| hypothetical protein PHAVU_008G279800g [Phaseolus vulgaris]
Length=744

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVY++REK+P  PH+FKAG+++ALIRVS+
Sbjct  272  GYELPTLVYVAREKRPNHPHHFKAGAVNALIRVSS  306



>gb|KCW75083.1| hypothetical protein EUGRSUZ_E038472, partial [Eucalyptus grandis]
Length=148

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+P+  H+FKAG+M+ALIRVS+
Sbjct  25   LPTLVYLAREKRPQYNHHFKAGAMNALIRVSS  56



>ref|XP_009787706.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Nicotiana 
sylvestris]
Length=742

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+ALIRVSA
Sbjct  258  GQILPTLVYLAREKRPQHHHHFKAGAMNALIRVSA  292



>ref|XP_008219399.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103319617 
[Prunus mume]
Length=1508

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  263  GCALPTLVYLAREKRPQYNHNFKAGAMNALIRVSS  297


 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
             G  LPTLVYL+REK+P+  HNFK G+M+ALIRVSA
Sbjct  1031  GCGLPTLVYLAREKRPQYHHNFKGGAMNALIRVSA  1065



>ref|XP_010647070.1| PREDICTED: cellulose synthase-like protein E6 isoform X3 [Vitis 
vinifera]
Length=735

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  263  GQPLPTLVYLAREKRPQYHHNFKAGAMNSLIRVSS  297



>ref|XP_003635360.1| PREDICTED: cellulose synthase-like protein E6 isoform X2 [Vitis 
vinifera]
 ref|XP_010647069.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Vitis 
vinifera]
Length=735

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  263  GQPLPTLVYLAREKRPQYHHNFKAGAMNSLIRVSS  297



>ref|XP_002269728.2| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=735

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  263  GQPLPTLVYLAREKRPQYHHNFKAGAMNSLIRVSS  297



>ref|XP_009606342.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Nicotiana 
tomentosiformis]
Length=924

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  254  GVTLPTLVYLAREKRPQHFHNFKAGAMNALIRVSS  288



>ref|XP_004296327.1| PREDICTED: cellulose synthase-like protein E1-like [Fragaria 
vesca subsp. vesca]
Length=739

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  265  GCALPTLVYLAREKRPQIHHNFKAGAMNALIRVSS  299



>gb|EMT27736.1| Cellulose synthase-like protein E2 [Aegilops tauschii]
Length=711

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LP LVY++REK+P++ H+FKAGS++ALIRVS+
Sbjct  242  GNALPKLVYMAREKRPQEQHHFKAGSLNALIRVSS  276



>ref|XP_004295183.1| PREDICTED: cellulose synthase-like protein E1-like [Fragaria 
vesca subsp. vesca]
Length=940

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HN+KAGSM+ALIRVS+
Sbjct  263  GIALPTLVYLAREKRPQYHHNYKAGSMNALIRVSS  297



>ref|XP_010501211.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Camelina 
sativa]
Length=737

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    QLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            ++PTLVYLSREK+P+  HNFKAG+M+AL+RVS+
Sbjct  273  EIPTLVYLSREKRPQHHHNFKAGAMNALLRVSS  305



>ref|XP_010088430.1| Cellulose synthase-like protein E1 [Morus notabilis]
 gb|EXB36045.1| Cellulose synthase-like protein E1 [Morus notabilis]
Length=758

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P   HNFKAG+M+ALIRVS+
Sbjct  266  GCTLPTLVYLAREKRPHYHHNFKAGAMNALIRVSS  300



>ref|XP_008805496.1| PREDICTED: cellulose synthase-like protein E6 isoform X3 [Phoenix 
dactylifera]
Length=579

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTL Y++REK+P+  HNFKAG+M+ALIR S+
Sbjct  107  GNALPTLAYVAREKRPQHHHNFKAGAMNALIRASS  141



>emb|CAN62859.1| hypothetical protein VITISV_036211 [Vitis vinifera]
Length=1181

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRV  100
            G++LPTLVYL+REK+P+ PHNFKAG+M+AL  +
Sbjct  540  GSKLPTLVYLAREKRPKHPHNFKAGAMNALTAI  572



>ref|XP_008218356.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
E1 [Prunus mume]
Length=738

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  262  GCVLPTLVYLAREKRPQYHHNFKAGAMNALIRVSS  296



>ref|XP_007208168.1| hypothetical protein PRUPE_ppa001941mg [Prunus persica]
 gb|EMJ09367.1| hypothetical protein PRUPE_ppa001941mg [Prunus persica]
Length=738

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  262  GCVLPTLVYLAREKRPQYHHNFKAGAMNALIRVSS  296



>emb|CBI29433.3| unnamed protein product [Vitis vinifera]
Length=872

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  263  GQPLPTLVYLAREKRPQYHHNFKAGAMNSLIRVSS  297



>emb|CBI23489.3| unnamed protein product [Vitis vinifera]
Length=2148

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
             G  LPTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  1427  GQPLPTLVYLAREKRPQYHHNFKAGAMNSLIRVSS  1461


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
             G  LPTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  1676  GQPLPTLVYLAREKRPQYHHNFKAGAMNSLIRVSS  1710



>ref|XP_010928074.1| PREDICTED: cellulose synthase-like protein E6 isoform X3 [Elaeis 
guineensis]
Length=729

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+P+  H+FKAG+M+ALIR S+
Sbjct  257  GNALPTLVYMAREKRPQHHHHFKAGAMNALIRASS  291



>ref|XP_006452619.1| hypothetical protein CICLE_v10007571mg [Citrus clementina]
 gb|ESR65859.1| hypothetical protein CICLE_v10007571mg [Citrus clementina]
Length=742

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  267  GCALPTLVYLAREKRPQYFHNFKAGAMNALIRVSS  301



>ref|XP_008805494.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Phoenix 
dactylifera]
Length=729

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTL Y++REK+P+  HNFKAG+M+ALIR S+
Sbjct  257  GNALPTLAYVAREKRPQHHHNFKAGAMNALIRASS  291



>gb|KDP39304.1| hypothetical protein JCGZ_01061 [Jatropha curcas]
Length=737

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REKK + PH+FKAG+M+ALIRVS+
Sbjct  262  GFTLPTLVYLAREKKAQYPHHFKAGAMNALIRVSS  296



>ref|XP_010057780.1| PREDICTED: cellulose synthase-like protein E1 [Eucalyptus grandis]
Length=731

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+PR  H+FKAG+M+ALIRVS+
Sbjct  263  LPTLVYLAREKRPRYKHHFKAGAMNALIRVSS  294



>ref|XP_008463016.1| PREDICTED: cellulose synthase-like protein E6 [Cucumis melo]
Length=741

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LP LVY++REK+P  PH+FKAG+M+ALIRVS+
Sbjct  264  GGVLPKLVYMAREKRPHHPHHFKAGAMNALIRVSS  298



>ref|XP_007020467.1| Cellulose synthase like E1 isoform 3 [Theobroma cacao]
 gb|EOY11992.1| Cellulose synthase like E1 isoform 3 [Theobroma cacao]
Length=663

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALI  94
            G+ LPTLVYL+REK+P+ PHNFKAG+M+AL+
Sbjct  256  GSALPTLVYLAREKRPQHPHNFKAGAMNALV  286



>ref|XP_010676068.1| PREDICTED: uncharacterized protein LOC104891977 [Beta vulgaris 
subsp. vulgaris]
Length=1500

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G QLP LVYL+REK+P+  HNFKAG+M++L+RVS+
Sbjct  260  GYQLPKLVYLAREKRPQHSHNFKAGAMNSLLRVSS  294


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
             G  LP+LVYL+REK+P+  HNFKAG+++ALIRVS+
Sbjct  1028  GCTLPSLVYLAREKRPQHFHNFKAGALNALIRVSS  1062



>ref|XP_004148922.1| PREDICTED: cellulose synthase-like protein E6-like [Cucumis sativus]
Length=731

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LP LVY++REK+P  PH+FKAG+M+ALIRVS+
Sbjct  264  GGVLPKLVYMAREKRPNHPHHFKAGAMNALIRVSS  298



>gb|KGN44039.1| hypothetical protein Csa_7G129380 [Cucumis sativus]
Length=741

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LP LVY++REK+P  PH+FKAG+M+ALIRVS+
Sbjct  264  GGVLPKLVYMAREKRPNHPHHFKAGAMNALIRVSS  298



>ref|XP_004165447.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
E6-like [Cucumis sativus]
Length=757

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LP LVY++REK+P  PH+FKAG+M+ALIRVS+
Sbjct  264  GGVLPKLVYMAREKRPNHPHHFKAGAMNALIRVSS  298



>gb|KCW75092.1| hypothetical protein EUGRSUZ_E03849 [Eucalyptus grandis]
Length=742

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+PR  H+FKAG+M+ALIRVS+
Sbjct  274  LPTLVYLAREKRPRYKHHFKAGAMNALIRVSS  305



>ref|XP_004295190.1| PREDICTED: cellulose synthase-like protein E1-like [Fragaria 
vesca subsp. vesca]
Length=740

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  265  GCVLPTLVYLAREKRPQIHHNFKAGAMNALIRVSS  299



>ref|XP_004296328.1| PREDICTED: cellulose synthase-like protein E1-like [Fragaria 
vesca subsp. vesca]
Length=794

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  265  GCVLPTLVYLAREKRPQIHHNFKAGAMNALIRVSS  299



>emb|CAN71809.1| hypothetical protein VITISV_043855 [Vitis vinifera]
Length=1075

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  263  GQPLPTLVYLAREKRPQYHHNFKAGAMNSLIRVSS  297



>gb|KCW75081.1| hypothetical protein EUGRSUZ_E038472, partial [Eucalyptus grandis]
Length=183

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+P+  H+FKAG+M+ALIRVS+
Sbjct  60   LPTLVYLAREKRPQYNHHFKAGAMNALIRVSS  91



>ref|XP_007208061.1| hypothetical protein PRUPE_ppa001952mg [Prunus persica]
 gb|EMJ09260.1| hypothetical protein PRUPE_ppa001952mg [Prunus persica]
Length=737

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPT+VY+SREK+P++ HNFKAG+++AL+RVS+
Sbjct  265  GCRLPTMVYMSREKRPQQLHNFKAGALNALLRVSS  299



>ref|XP_004148930.1| PREDICTED: cellulose synthase-like protein E1-like [Cucumis sativus]
 ref|XP_004166388.1| PREDICTED: cellulose synthase-like protein E1-like [Cucumis sativus]
 gb|KGN44038.1| hypothetical protein Csa_7G127380 [Cucumis sativus]
Length=730

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+AL+RVS+
Sbjct  254  GSILPTLVYLAREKRPQYFHNFKAGAMNALLRVSS  288



>ref|XP_009793109.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Nicotiana 
sylvestris]
Length=927

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+P+  HNFKAG+M+ALIRVS+
Sbjct  260  LPTLVYLAREKRPQHFHNFKAGAMNALIRVSS  291



>ref|XP_008463012.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Cucumis 
melo]
Length=765

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+AL+RVS+
Sbjct  289  GSILPTLVYLAREKRPQYFHNFKAGAMNALLRVSS  323



>ref|XP_008463011.1| PREDICTED: cellulose synthase-like protein E1 isoform X1 [Cucumis 
melo]
Length=777

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+M+AL+RVS+
Sbjct  301  GSILPTLVYLAREKRPQYFHNFKAGAMNALLRVSS  335



>ref|XP_007146656.1| hypothetical protein PHAVU_006G0586001g, partial [Phaseolus vulgaris]
 gb|ESW18650.1| hypothetical protein PHAVU_006G0586001g, partial [Phaseolus vulgaris]
Length=528

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN +P LVYL+REK+P   HNFKAG+M++LIRVS+
Sbjct  62   GNVMPILVYLAREKRPHVAHNFKAGAMNSLIRVSS  96



>ref|XP_002891856.1| hypothetical protein ARALYDRAFT_337666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68115.1| hypothetical protein ARALYDRAFT_337666 [Arabidopsis lyrata subsp. 
lyrata]
Length=727

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYLSREK+P+  HNFKAG+M+AL+RVS+
Sbjct  269  IPTLVYLSREKRPQHHHNFKAGAMNALLRVSS  300



>ref|NP_175981.2| cellulose synthase-like protein E1 [Arabidopsis thaliana]
 sp|Q8VZK9.1|CSLE1_ARATH RecName: Full=Cellulose synthase-like protein E1; Short=AtCslE1 
[Arabidopsis thaliana]
 gb|AAL36396.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 dbj|BAE99166.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEE33308.1| cellulose synthase-like protein E1 [Arabidopsis thaliana]
 gb|AHL38901.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=729

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYLSREK+P+  HNFKAG+M+AL+RVS+
Sbjct  266  IPTLVYLSREKRPQHHHNFKAGAMNALLRVSS  297



>ref|XP_006303808.1| hypothetical protein CARUB_v10012240mg [Capsella rubella]
 gb|EOA36706.1| hypothetical protein CARUB_v10012240mg [Capsella rubella]
Length=732

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYLSREK+P+  HNFKAG+M+AL+RVS+
Sbjct  271  IPTLVYLSREKRPQHHHNFKAGAMNALLRVSS  302



>ref|XP_010057783.1| PREDICTED: cellulose synthase-like protein E6 [Eucalyptus grandis]
 gb|KCW75096.1| hypothetical protein EUGRSUZ_E03851 [Eucalyptus grandis]
Length=732

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTL YL+REK+P+  HNFKAG+M+ALIR+S+
Sbjct  260  GQPLPTLAYLAREKRPQYHHNFKAGAMNALIRISS  294



>ref|XP_007146654.1| hypothetical protein PHAVU_006G058400g [Phaseolus vulgaris]
 gb|ESW18648.1| hypothetical protein PHAVU_006G058400g [Phaseolus vulgaris]
Length=738

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN +P LVYL+REK+P   HNFKAG+M++LIRVS+
Sbjct  260  GNVMPILVYLAREKRPHVAHNFKAGAMNSLIRVSS  294



>ref|XP_008447771.1| PREDICTED: cellulose synthase-like protein E6 [Cucumis melo]
Length=550

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ LPTLVYL+REK+P+  HNFKAG+++AL+RVS+
Sbjct  256  GDMLPTLVYLAREKRPKYFHNFKAGALNALLRVSS  290



>ref|XP_010088429.1| Cellulose synthase-like protein E1 [Morus notabilis]
 gb|EXB36044.1| Cellulose synthase-like protein E1 [Morus notabilis]
Length=733

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P   HNFKAG+M+ALIRVS+
Sbjct  260  GYTLPTLVYLAREKRPFHFHNFKAGAMNALIRVSS  294



>ref|XP_004975624.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Setaria italica]
Length=811

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ +P+L+Y+SREK PR PH+FKAG+M+ L RVSA
Sbjct  267  GHGIPSLIYISREKGPRHPHHFKAGAMNVLTRVSA  301



>ref|XP_004975623.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Setaria italica]
Length=813

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ +P+L+Y+SREK PR PH+FKAG+M+ L RVSA
Sbjct  300  GHGIPSLIYISREKGPRHPHHFKAGAMNVLTRVSA  334



>ref|XP_004975622.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Setaria italica]
Length=844

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ +P+L+Y+SREK PR PH+FKAG+M+ L RVSA
Sbjct  300  GHGIPSLIYISREKGPRHPHHFKAGAMNVLTRVSA  334



>ref|XP_008646188.1| PREDICTED: cellulose synthase-like protein E2 isoform X2 [Zea 
mays]
 gb|AFW73218.1| hypothetical protein ZEAMMB73_369462 [Zea mays]
Length=740

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P++ H+FKAGS++ALIRVS+
Sbjct  269  GKVLPTLVYMAREKRPQEHHHFKAGSLNALIRVSS  303



>ref|XP_008646187.1| PREDICTED: cellulose synthase-like protein E2 isoform X1 [Zea 
mays]
Length=754

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P++ H+FKAGS++ALIRVS+
Sbjct  283  GKVLPTLVYMAREKRPQEHHHFKAGSLNALIRVSS  317



>emb|CDY42390.1| BnaA08g00240D [Brassica napus]
Length=487

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYLSREK+P   H+FKAGSM+ALIRVS+
Sbjct  269  VPTLVYLSREKRPEHHHHFKAGSMNALIRVSS  300



>ref|XP_006857764.1| hypothetical protein AMTR_s00061p00199750 [Amborella trichopoda]
 gb|ERN19231.1| hypothetical protein AMTR_s00061p00199750 [Amborella trichopoda]
Length=529

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK P + HNFKAG+M++LIRVS+
Sbjct  58   GIPLPTLVYLAREKNPNQHHNFKAGAMNSLIRVSS  92



>ref|XP_009107029.1| PREDICTED: cellulose synthase-like protein E1 [Brassica rapa]
Length=606

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYLSREK+P   H+FKAGSM+ALIRVS+
Sbjct  269  VPTLVYLSREKRPEHHHHFKAGSMNALIRVSS  300



>ref|XP_006474029.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1025

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P  PHN +AG+M+AL+RVS 
Sbjct  477  GNELPNLVYVSREKRPAFPHNKRAGAMNALVRVSG  511



>gb|EMT26547.1| Cellulose synthase-like protein H1 [Aegilops tauschii]
Length=717

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G + P LVYLSREK PR  HNFKAG+M+ L RVSA
Sbjct  247  GEEFPHLVYLSREKSPRHRHNFKAGAMNVLTRVSA  281



>ref|XP_008646189.1| PREDICTED: cellulose synthase-like protein E2 isoform X3 [Zea 
mays]
Length=641

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P++ H+FKAGS++ALIRVS+
Sbjct  170  GKVLPTLVYMAREKRPQEHHHFKAGSLNALIRVSS  204



>ref|XP_007030087.1| Cellulose synthase like E1 [Theobroma cacao]
 gb|EOY10589.1| Cellulose synthase like E1 [Theobroma cacao]
Length=721

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+ALIRVS+
Sbjct  248  GRPLPTLVYLAREKRPQFHHHFKAGAMNALIRVSS  282



>ref|XP_006586145.1| PREDICTED: cellulose synthase-like protein E1-like [Glycine max]
 gb|KHN11155.1| Cellulose synthase-like protein E1 [Glycine soja]
Length=738

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN +P LVYL+REK+P+  HNFKAG+M++L+RVS+
Sbjct  260  GNVMPILVYLAREKRPQVAHNFKAGAMNSLLRVSS  294



>ref|XP_006453580.1| hypothetical protein CICLE_v10010165mg [Citrus clementina]
 gb|ESR66820.1| hypothetical protein CICLE_v10010165mg [Citrus clementina]
Length=1015

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P  PHN +AG+M+AL+RVS 
Sbjct  467  GNELPNLVYVSREKRPAFPHNKRAGAMNALVRVSG  501



>ref|XP_007030086.1| Cellulose synthase like E1 [Theobroma cacao]
 gb|EOY10588.1| Cellulose synthase like E1 [Theobroma cacao]
Length=729

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+ALIRVS+
Sbjct  256  GRPLPTLVYLAREKRPQFHHHFKAGAMNALIRVSS  290



>ref|XP_007030088.1| Cellulose synthase like E1 [Theobroma cacao]
 gb|EOY10590.1| Cellulose synthase like E1 [Theobroma cacao]
Length=836

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+ALIRVS+
Sbjct  260  GRPLPTLVYLAREKRPQFHHHFKAGAMNALIRVSS  294



>ref|XP_006474030.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
Length=1015

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P  PHN +AG+M+AL+RVS 
Sbjct  467  GNELPNLVYVSREKRPAFPHNKRAGAMNALVRVSG  501



>gb|KDO62271.1| hypothetical protein CISIN_1g039678mg [Citrus sinensis]
Length=1015

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P  PHN +AG+M+AL+RVS 
Sbjct  467  GNELPNLVYVSREKRPAFPHNKRAGAMNALVRVSG  501



>ref|XP_008349391.1| PREDICTED: cellulose synthase-like protein E2 [Malus domestica]
Length=396

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+P+  HNFK G+M+ALIRVS+
Sbjct  257  GCRLPTLVYLAREKRPQYHHNFKGGAMNALIRVSS  291



>emb|CBI33250.3| unnamed protein product [Vitis vinifera]
Length=427

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+ +  HNFKAG+M+ LIRVS+
Sbjct  78   GQPLPTLVYLSREKRSKYHHNFKAGAMNTLIRVSS  112



>ref|XP_010647166.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
E1, partial [Vitis vinifera]
Length=439

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYLSREK+ +  HNFKAG+M+ LIRVS+
Sbjct  76   GQPLPTLVYLSREKRSKYHHNFKAGAMNTLIRVSS  110



>ref|XP_008811269.1| PREDICTED: cellulose synthase-like protein E6 isoform X2 [Phoenix 
dactylifera]
Length=740

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P + HNFKAG+M++L+RVS+
Sbjct  260  GFTLPTLVYMAREKRPYRHHNFKAGAMNSLVRVSS  294



>ref|XP_008811268.1| PREDICTED: cellulose synthase-like protein E6 isoform X1 [Phoenix 
dactylifera]
Length=741

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P + HNFKAG+M++L+RVS+
Sbjct  260  GFTLPTLVYMAREKRPYRHHNFKAGAMNSLVRVSS  294



>gb|EEC84759.1| hypothetical protein OsI_31766 [Oryza sativa Indica Group]
Length=737

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    NQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            N LPTLVY++REK+P+  HNFKAG+++ALIRVS+
Sbjct  266  NVLPTLVYVAREKRPQYHHNFKAGALNALIRVSS  299



>ref|XP_006647822.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
E2-like [Oryza brachyantha]
Length=744

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LPTLVY++REK+ ++ H+FKAGS++ALIRVS+
Sbjct  273  GNALPTLVYMAREKRHQEQHHFKAGSLNALIRVSS  307



>gb|KCW75080.1| hypothetical protein EUGRSUZ_E038461 [Eucalyptus grandis]
Length=494

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+A+IRVS+
Sbjct  23   GQPLPTLVYLAREKRPQFHHHFKAGAMNAMIRVSS  57



>gb|KCW75082.1| hypothetical protein EUGRSUZ_E038472, partial [Eucalyptus grandis]
Length=162

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+P+  H+FKAG+M+ALIRVS+
Sbjct  60   LPTLVYLAREKRPQYNHHFKAGAMNALIRVSS  91



>ref|XP_010057782.1| PREDICTED: cellulose synthase-like protein E1 [Eucalyptus grandis]
Length=528

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+A+IRVS+
Sbjct  57   GQPLPTLVYLAREKRPQFHHHFKAGAMNAMIRVSS  91



>ref|XP_003570469.1| PREDICTED: cellulose synthase-like protein E2 [Brachypodium distachyon]
Length=737

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN LP LVY++REK P++ H+FKAGS++ALIRVS+
Sbjct  268  GNALPKLVYMTREKIPQEQHHFKAGSLNALIRVSS  302



>gb|KCW75079.1| hypothetical protein EUGRSUZ_E038461, partial [Eucalyptus grandis]
Length=564

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  H+FKAG+M+A+IRVS+
Sbjct  93   GQPLPTLVYLAREKRPQFHHHFKAGAMNAMIRVSS  127



>ref|XP_006392596.1| hypothetical protein EUTSA_v10011262mg [Eutrema salsugineum]
 gb|ESQ29882.1| hypothetical protein EUTSA_v10011262mg [Eutrema salsugineum]
Length=734

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYLSREK+P+  H+FKAG+M+ALIRVS+
Sbjct  271  IPTLVYLSREKRPQHHHHFKAGAMNALIRVSS  302



>ref|XP_010942702.1| PREDICTED: cellulose synthase-like protein E6 [Elaeis guineensis]
Length=562

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVY++REK+P + HNFKAG+M++L+RVS+
Sbjct  380  GFTLPTLVYMAREKRPYRHHNFKAGAMNSLLRVSS  414



>ref|XP_003540290.1| PREDICTED: cellulose synthase-like protein H1-like isoformX1 
[Glycine max]
 gb|KHN44859.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=746

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    NQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +QLP L+Y+SREK+P+ PHN+KAG+M+ L RVS 
Sbjct  248  DQLPHLIYISREKRPQYPHNYKAGAMNVLTRVSG  281



>ref|XP_006452617.1| hypothetical protein CICLE_v10010783mg [Citrus clementina]
 gb|ESR65857.1| hypothetical protein CICLE_v10010783mg [Citrus clementina]
Length=735

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+P   HNFKAG+M+ALIRVS+
Sbjct  265  LPTLVYLAREKRPWHFHNFKAGAMNALIRVSS  296



>ref|XP_010042774.1| PREDICTED: cellulose synthase-like protein E6 [Eucalyptus grandis]
Length=352

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            LPTLVYL+REK+P+  H+FKAG+M+ALIRVS+
Sbjct  60   LPTLVYLAREKRPQYNHHFKAGAMNALIRVSS  91



>ref|XP_010659594.1| PREDICTED: cellulose synthase-like protein G3 [Vitis vinifera]
 emb|CBI34514.3| unnamed protein product [Vitis vinifera]
Length=726

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G+ +P LVY+SREK+P  PH+FKAG+++ LIRVSA
Sbjct  256  GHTMPNLVYVSREKRPGSPHHFKAGALNVLIRVSA  290



>ref|XP_004487957.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Cicer arietinum]
Length=1018

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP LVY+SREK+P  PH+ KAG+M+AL+RVSA
Sbjct  452  GKELPKLVYISREKRPGYPHHKKAGAMNALVRVSA  486



>dbj|BAD46390.1| putative cellulose synthase-like protein OsCslE1 [Oryza sativa 
Japonica Group]
 gb|EAZ45119.1| hypothetical protein OsJ_29756 [Oryza sativa Japonica Group]
 dbj|BAG96271.1| unnamed protein product [Oryza sativa Japonica Group]
Length=608

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    NQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            N LPT+VY++REK+P+  HNFKAG+++ALIRVS+
Sbjct  137  NVLPTMVYVAREKRPQYHHNFKAGALNALIRVSS  170



>ref|XP_011097753.1| PREDICTED: cellulose synthase-like protein E1 [Sesamum indicum]
Length=730

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LPTLVYL+REK+ +  HNFKAG+M+ALIRVS+
Sbjct  256  GCRLPTLVYLAREKRSQHFHNFKAGAMNALIRVSS  290



>gb|AAL25129.1|AF432500_1 cellulose synthase-like protein OsCslE1 [Oryza sativa]
Length=730

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    NQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            N LPT+VY++REK+P+  HNFKAG+++ALIRVS+
Sbjct  259  NVLPTMVYVAREKRPQYHHNFKAGALNALIRVSS  292



>ref|NP_001063469.1| Os09g0478100 [Oryza sativa Japonica Group]
 sp|Q651X7.2|CSLE1_ORYSJ RecName: Full=Cellulose synthase-like protein E1; AltName: Full=OsCslE1 
[Oryza sativa Japonica Group]
 dbj|BAD46389.1| putative cellulose synthase-like protein OsCslE1 [Oryza sativa 
Japonica Group]
 dbj|BAF25383.1| Os09g0478100 [Oryza sativa Japonica Group]
Length=737

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    NQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            N LPT+VY++REK+P+  HNFKAG+++ALIRVS+
Sbjct  266  NVLPTMVYVAREKRPQYHHNFKAGALNALIRVSS  299



>gb|AFR39127.1| cellulose synthase, partial [Populus fremontii]
Length=127

 Score = 51.6 bits (122),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P   H+ KAG+M+ALIRVSA
Sbjct  27   GNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSA  61



>ref|XP_003600348.1| Cellulose synthase-like protein E1 [Medicago truncatula]
 gb|AES70599.1| cellulose synthase-like protein [Medicago truncatula]
Length=732

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  +PTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  254  GFVMPTLVYLAREKRPQFQHNFKAGAMNSLIRVSS  288



>ref|XP_003600349.1| Cellulose synthase-like protein E1 [Medicago truncatula]
 gb|AES70600.1| cellulose synthase-like protein [Medicago truncatula]
Length=733

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  +PTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  255  GFVMPTLVYLAREKRPQFQHNFKAGAMNSLIRVSS  289



>ref|XP_007138849.1| hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris]
 gb|ESW10843.1| hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris]
Length=1048

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP LVY+SREK+P  PH+ KAG+M+AL+RVSA
Sbjct  465  GKELPRLVYISREKRPGYPHHKKAGAMNALVRVSA  499



>gb|AFR39104.1| cellulose synthase, partial [Populus trichocarpa]
Length=127

 Score = 51.6 bits (122),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P   H+ KAG+M+ALIRVSA
Sbjct  27   GNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSA  61



>gb|AII73573.1| cellulose synthase 4 [Medicago sativa]
Length=1039

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP LVY+SREK+P  PH+ KAG+M+AL+RVSA
Sbjct  457  GKELPKLVYISREKRPGYPHHKKAGAMNALVRVSA  491



>ref|XP_003594882.1| Cellulose synthase [Medicago truncatula]
Length=1039

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP LVY+SREK+P  PH+ KAG+M+AL+RVSA
Sbjct  457  GKELPKLVYISREKRPGYPHHKKAGAMNALVRVSA  491



>gb|AES65133.2| cellulose synthase-like protein [Medicago truncatula]
Length=1044

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP LVY+SREK+P  PH+ KAG+M+AL+RVSA
Sbjct  462  GKELPKLVYISREKRPGYPHHKKAGAMNALVRVSA  496



>ref|XP_011091159.1| PREDICTED: cellulose synthase-like protein G3 [Sesamum indicum]
Length=725

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    NQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            ++LP LVY+SREK+P +PH FKAG+++AL+RVS 
Sbjct  263  SKLPLLVYMSREKRPSRPHRFKAGALNALLRVSG  296



>emb|CDY10526.1| BnaC03g70880D [Brassica napus]
Length=731

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYLSREK+P   H+FKAG+M+ALIRVS+
Sbjct  269  VPTLVYLSREKRPEHHHHFKAGAMNALIRVSS  300



>ref|XP_002529323.1| transferase, putative [Ricinus communis]
 gb|EEF33092.1| transferase, putative [Ricinus communis]
Length=570

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    QLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            ++P LVY+SREK+P  PHNFKAG+++ L+RVSA
Sbjct  254  EMPLLVYVSREKRPSSPHNFKAGALNILLRVSA  286



>ref|XP_007144119.1| hypothetical protein PHAVU_007G130400g [Phaseolus vulgaris]
 gb|ESW16113.1| hypothetical protein PHAVU_007G130400g [Phaseolus vulgaris]
Length=741

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    QLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +LP LVY+SREKKP  PH+FKAG+++AL RVSA
Sbjct  252  KLPFLVYVSREKKPSHPHHFKAGALNALYRVSA  284



>gb|AFR39119.1| cellulose synthase, partial [Populus alba]
Length=110

 Score = 51.2 bits (121),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P   H+ KAG+M+ALIRVSA
Sbjct  10   GNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSA  44



>ref|XP_006293591.1| hypothetical protein CARUB_v10022538mg [Capsella rubella]
 gb|EOA26489.1| hypothetical protein CARUB_v10022538mg [Capsella rubella]
Length=1091

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP L+Y+SREK+P   HN KAG+M+ALIRVSA
Sbjct  530  GNELPRLIYVSREKRPGFQHNKKAGAMNALIRVSA  564



>gb|KHN47729.1| Cellulose synthase A catalytic subunit 4 [UDP-forming] [Glycine 
soja]
Length=1050

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP LVY+SREK+P  PH+ KAG+M+AL+RVSA
Sbjct  467  GKELPKLVYISREKRPGYPHHKKAGAMNALVRVSA  501



>ref|XP_010058305.1| PREDICTED: cellulose synthase-like protein G2 [Eucalyptus grandis]
Length=722

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  8    QLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            Q+P LVY+SREK+P  PHNFKAG+++ L+RVS 
Sbjct  220  QMPLLVYVSREKRPSYPHNFKAGALNVLLRVSG  252



>ref|XP_010647485.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera]
Length=305

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALI  94
            G  LPTLVYLSREK+P+  HNFKAG+M+AL+
Sbjct  261  GQPLPTLVYLSREKRPKYHHNFKAGAMNALV  291



>ref|XP_003600351.1| Cellulose synthase-like protein E1 [Medicago truncatula]
 gb|AES70602.1| cellulose synthase E1-like protein [Medicago truncatula]
Length=736

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  11   LPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            +PTLVYL+REK+P+  HNFKAG+M++LIRVS+
Sbjct  258  MPTLVYLAREKRPQFHHNFKAGAMNSLIRVSS  289



>gb|KEH34084.1| cellulose synthase E1-like protein [Medicago truncatula]
Length=455

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G  LPTLVYL+REK+P+  HN+KAG+M++L+RVS+
Sbjct  265  GFMLPTLVYLAREKRPQYHHNYKAGAMNSLLRVSS  299



>ref|XP_003533679.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Glycine max]
 gb|KHN26614.1| Cellulose synthase A catalytic subunit 4 [UDP-forming] [Glycine 
soja]
Length=1050

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP LVY+SREK+P  PH+ KAG+M+AL+RVSA
Sbjct  467  GKELPKLVYISREKRPGYPHHKKAGAMNALVRVSA  501



>gb|EYU32979.1| hypothetical protein MIMGU_mgv1a019371mg, partial [Erythranthe 
guttata]
Length=628

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    NQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            ++LP LVY+SREK+P +PH FKAG+++AL+RVS 
Sbjct  262  SKLPLLVYVSREKRPSRPHRFKAGALNALLRVSG  295



>gb|AFR39117.1| cellulose synthase, partial [Populus alba]
 gb|AFR39122.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39124.1| cellulose synthase, partial [Populus fremontii]
Length=125

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P   H+ KAG+M+ALIRVSA
Sbjct  25   GNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSA  59



>gb|EMS55737.1| Cellulose synthase-like protein H1 [Triticum urartu]
Length=687

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G   P LVYLSREK PR  HNFKAG+M+ L RVSA
Sbjct  209  GEGFPHLVYLSREKSPRHRHNFKAGAMNVLTRVSA  243



>gb|AFR39101.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39102.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39103.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39105.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39106.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39109.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39110.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39111.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39113.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR39115.1| cellulose synthase, partial [Populus alba]
 gb|AFR39116.1| cellulose synthase, partial [Populus alba]
 gb|AFR39121.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39123.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39125.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39128.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39129.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39130.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39131.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39132.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39133.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39134.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39135.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39136.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39137.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39138.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39139.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39140.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39141.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39142.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39143.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39144.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39145.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39146.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39147.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39148.1| cellulose synthase, partial [Populus nigra]
Length=127

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P   H+ KAG+M+ALIRVSA
Sbjct  27   GNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSA  61



>gb|AFR39120.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR39126.1| cellulose synthase, partial [Populus fremontii]
Length=124

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            GN+LP LVY+SREK+P   H+ KAG+M+ALIRVSA
Sbjct  24   GNELPRLVYVSREKRPGFSHHKKAGAMNALIRVSA  58



>gb|EPS62612.1| hypothetical protein M569_12177, partial [Genlisea aurea]
Length=425

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    GNQLPTLVYLSREKKPRKPHNFKAGSMDALIRVSA  106
            G +LP+LVYL+REK+P   HN+KAG+M+ALIRVS+
Sbjct  249  GFRLPSLVYLAREKRPEYFHNYKAGAMNALIRVSS  283



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525703048884