BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c117379_g1_i1 len=117 path=[1:0-116]

Length=117
                                                                      Score     E

ref|XP_006601654.1|  PREDICTED: uncharacterized protein LOC100791212  64.3    1e-10   
gb|KHN33899.1|  hypothetical protein glysoja_031761                   61.6    2e-10   
ref|XP_002534404.1|  conserved hypothetical protein                   60.5    5e-10   Ricinus communis
gb|KDO40369.1|  hypothetical protein CISIN_1g048241mg                 61.2    9e-10   
gb|KDO38897.1|  hypothetical protein CISIN_1g046520mg                 61.2    1e-09   
gb|KCW81645.1|  hypothetical protein EUGRSUZ_C03006                   57.4    5e-09   
gb|KDO37798.1|  hypothetical protein CISIN_1g046516mg                 55.1    3e-08   
gb|KHN07236.1|  hypothetical protein glysoja_045025                   54.3    9e-08   
ref|XP_006382338.1|  hypothetical protein POPTR_0005s01170g           55.1    1e-07   
ref|XP_006596845.1|  PREDICTED: uncharacterized protein At4g02000...  56.2    1e-07   
ref|XP_002516014.1|  conserved hypothetical protein                   55.1    3e-07   Ricinus communis
gb|KDO48120.1|  hypothetical protein CISIN_1g045413mg                 52.4    5e-07   
gb|KDO40094.1|  hypothetical protein CISIN_1g043661mg                 52.0    5e-07   
gb|KDO37843.1|  hypothetical protein CISIN_1g047084mg                 53.5    7e-07   
gb|KEH41789.1|  endonuclease/exonuclease/phosphatase family protein   53.9    8e-07   
gb|KDO37533.1|  hypothetical protein CISIN_1g048335mg                 50.8    1e-06   
ref|XP_003604996.1|  hypothetical protein MTR_4g022640                52.8    2e-06   
ref|XP_003630108.1|  hypothetical protein MTR_8g091870                52.4    2e-06   
gb|KDO58401.1|  hypothetical protein CISIN_1g046952mg                 52.4    2e-06   
gb|KHN04242.1|  hypothetical protein glysoja_041006                   50.1    2e-06   
ref|XP_009770156.1|  PREDICTED: uncharacterized protein LOC104220886  51.6    2e-06   
gb|KHN25996.1|  hypothetical protein glysoja_046925                   49.3    3e-06   
ref|XP_006375872.1|  hypothetical protein POPTR_0013s04890g           49.7    3e-06   
gb|KDO43811.1|  hypothetical protein CISIN_1g044430mg                 50.8    4e-06   
ref|XP_003609254.1|  hypothetical protein MTR_4g113700                51.2    5e-06   
dbj|BAE79383.1|  unnamed protein product                              50.8    8e-06   Ipomoea batatas [batate]
gb|KDO38231.1|  hypothetical protein CISIN_1g041269mg                 50.4    1e-05   
gb|KDO74197.1|  hypothetical protein CISIN_1g037882mg                 50.1    1e-05   
ref|XP_003603988.1|  hypothetical protein MTR_3g117300                47.4    2e-05   
emb|CCA66008.1|  hypothetical protein                                 50.1    2e-05   
dbj|BAE79381.1|  unnamed protein product                              49.7    2e-05   Ipomoea batatas [batate]
gb|KDO39120.1|  hypothetical protein CISIN_1g048696mg                 48.5    2e-05   
ref|XP_002317857.1|  hypothetical protein POPTR_0012s00280g           48.5    2e-05   Populus trichocarpa [western balsam poplar]
gb|KDO70278.1|  hypothetical protein CISIN_1g046866mg                 49.3    3e-05   
gb|KDO44000.1|  hypothetical protein CISIN_1g046515mg                 49.3    3e-05   
emb|CAB78007.1|  putative protein                                     48.9    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32345.1|  DUF4283 domain protein                                49.3    3e-05   
ref|XP_003592894.1|  hypothetical protein MTR_2g005460                48.9    3e-05   
ref|XP_010681547.1|  PREDICTED: uncharacterized protein LOC104896496  47.8    3e-05   
gb|KDO69928.1|  hypothetical protein CISIN_1g039478mg                 46.2    4e-05   
gb|KHN24218.1|  hypothetical protein glysoja_037052                   46.2    5e-05   
ref|XP_009607026.1|  PREDICTED: uncharacterized protein LOC104101282  45.8    7e-05   
gb|KHN28554.1|  hypothetical protein glysoja_021375                   45.1    8e-05   
gb|KHN29850.1|  hypothetical protein glysoja_034094                   45.4    8e-05   
gb|KCW60820.1|  hypothetical protein EUGRSUZ_H03558                   45.4    9e-05   
ref|XP_008778450.1|  PREDICTED: uncharacterized protein LOC103698238  47.4    9e-05   
gb|KDO38287.1|  hypothetical protein CISIN_1g044376mg                 47.8    1e-04   
gb|KDO39032.1|  hypothetical protein CISIN_1g043150mg                 47.8    1e-04   
ref|XP_010667256.1|  PREDICTED: uncharacterized protein LOC104884318  46.6    1e-04   
ref|XP_009787638.1|  PREDICTED: uncharacterized protein LOC104235548  46.6    1e-04   
gb|KHN04954.1|  hypothetical protein glysoja_013861                   46.6    1e-04   
ref|XP_009757725.1|  PREDICTED: uncharacterized protein LOC104210511  46.6    2e-04   
ref|XP_008780257.1|  PREDICTED: uncharacterized protein LOC103700060  45.4    2e-04   
ref|XP_010680872.1|  PREDICTED: uncharacterized protein LOC104895924  45.4    2e-04   
ref|XP_010690660.1|  PREDICTED: uncharacterized protein LOC104904165  46.6    2e-04   
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085  47.0    2e-04   
gb|KHN27519.1|  hypothetical protein glysoja_018631                   44.7    2e-04   
gb|KDO36602.1|  hypothetical protein CISIN_1g037725mg                 45.8    3e-04   
gb|KHN35462.1|  hypothetical protein glysoja_032217                   43.9    3e-04   
ref|XP_010666462.1|  PREDICTED: uncharacterized protein LOC104883615  45.8    3e-04   
gb|KDO50220.1|  hypothetical protein CISIN_1g0394272mg                43.1    4e-04   
gb|KHN18973.1|  hypothetical protein glysoja_039897                   43.1    4e-04   
ref|XP_010684971.1|  PREDICTED: uncharacterized protein LOC104899471  45.1    4e-04   
ref|XP_010520311.1|  PREDICTED: uncharacterized protein LOC104799464  45.8    4e-04   
ref|XP_010689461.1|  PREDICTED: uncharacterized protein LOC104903161  45.4    5e-04   
emb|CCA65996.1|  hypothetical protein                                 45.8    5e-04   
ref|XP_006606936.1|  PREDICTED: uncharacterized protein LOC102668273  44.7    6e-04   
gb|KDO35980.1|  hypothetical protein CISIN_1g037800mg                 45.1    6e-04   
ref|XP_007204051.1|  hypothetical protein PRUPE_ppa026737mg           43.1    7e-04   
ref|XP_007206580.1|  hypothetical protein PRUPE_ppa020297mg           45.1    7e-04   
ref|XP_010681595.1|  PREDICTED: uncharacterized protein LOC104896537  44.7    7e-04   
ref|XP_009779035.1|  PREDICTED: uncharacterized protein LOC104228289  45.1    8e-04   
ref|XP_006387180.1|  hypothetical protein POPTR_1595s00200g           45.1    8e-04   
ref|XP_006382318.1|  hypothetical protein POPTR_0005s00970g           42.7    9e-04   
ref|XP_010412659.1|  PREDICTED: uncharacterized protein At4g02000...  42.7    9e-04   
ref|XP_006385484.1|  hypothetical protein POPTR_0003s05680g           44.3    0.001   
ref|XP_006295777.1|  hypothetical protein CARUB_v10024899mg           44.7    0.001   
ref|XP_008780476.1|  PREDICTED: uncharacterized protein LOC103700307  43.9    0.001   



>ref|XP_006601654.1| PREDICTED: uncharacterized protein LOC100791212 [Glycine max]
Length=484

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GGPWM+FDHYLT+Q W P+F + + K++K + W+RFPS
Sbjct  148  GGPWMIFDHYLTIQTWTPDFISPTAKIDKTMVWVRFPS  185



>gb|KHN33899.1| hypothetical protein glysoja_031761, partial [Glycine soja]
Length=212

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GGPWM+FDHYLT+Q W P+F + + K++K + W+RFPS
Sbjct  79   GGPWMIFDHYLTIQTWTPDFISPTAKIDKTMVWVRFPS  116



>ref|XP_002534404.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27982.1| conserved hypothetical protein [Ricinus communis]
Length=181

 Score = 60.5 bits (145),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPWMV DHYLTV+ W PNFDT  D +E+LL W+R P 
Sbjct  135  GPWMVVDHYLTVRRWYPNFDTTQDTVEQLLVWVRLPC  171



>gb|KDO40369.1| hypothetical protein CISIN_1g048241mg, partial [Citrus sinensis]
Length=354

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +F HYLTVQ+W P FD  SDK+E ++AWIR P
Sbjct  98   GPWTIFGHYLTVQKWSPTFDCLSDKIETIVAWIRLP  133



>gb|KDO38897.1| hypothetical protein CISIN_1g046520mg [Citrus sinensis]
Length=369

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +F HYLTVQ+W P+FD  SDK+E ++AWIR P
Sbjct  68   GPWTIFGHYLTVQKWSPSFDCLSDKIETVVAWIRLP  103



>gb|KCW81645.1| hypothetical protein EUGRSUZ_C03006 [Eucalyptus grandis]
 gb|KCW82547.1| hypothetical protein EUGRSUZ_C03949 [Eucalyptus grandis]
Length=139

 Score = 57.4 bits (137),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPWM+FDHYL +++W PNFD    K++++ AW+RFP+
Sbjct  59   GPWMIFDHYLAIRKWEPNFDPTEAKIDRVTAWVRFPN  95



>gb|KDO37798.1| hypothetical protein CISIN_1g046516mg, partial [Citrus sinensis]
Length=157

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW+V  HYLTVQ W P+FD+ ++K+  ++AWIR P
Sbjct  105  GPWIVLGHYLTVQLWSPHFDSANEKISSIVAWIRLP  140



>gb|KHN07236.1| hypothetical protein glysoja_045025, partial [Glycine soja]
Length=212

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPWM+F HYLTVQ W P+F + + K++K + W+ FP
Sbjct  79   GGPWMIFYHYLTVQTWTPDFISPTTKIDKTMVWVCFP  115



>ref|XP_006382338.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa]
 gb|ERP60135.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa]
Length=270

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPWMV DHYLT++ W PNFD     +EK+  WIR P
Sbjct  131  GGPWMVADHYLTMRSWHPNFDPNVATIEKVAVWIRLP  167



>ref|XP_006596845.1| PREDICTED: uncharacterized protein At4g02000-like [Glycine max]
Length=546

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPWM+F HYLTVQ W P+F + + K++K + W+ FP
Sbjct  168  GGPWMIFYHYLTVQTWTPDFISPTTKIDKTMVWVCFP  204



>ref|XP_002516014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46434.1| conserved hypothetical protein [Ricinus communis]
Length=753

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPW+VF HYLTVQ W P+F   S  + K++AWI FP
Sbjct  50   GGPWVVFGHYLTVQSWAPSFRASSAVLSKVIAWIHFP  86



>gb|KDO48120.1| hypothetical protein CISIN_1g045413mg, partial [Citrus sinensis]
Length=212

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  PWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            PW+V  HYLTVQ W P+FD+ ++K++K+ A IR PS
Sbjct  1    PWIVSGHYLTVQLWSPHFDSSNEKIDKITALIRLPS  36



>gb|KDO40094.1| hypothetical protein CISIN_1g043661mg [Citrus sinensis]
Length=192

 Score = 52.0 bits (123),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW+V  HYLTVQ W P+FD+  +K+  ++AW+R P
Sbjct  128  GPWIVLGHYLTVQLWSPHFDSAKEKISSIVAWMRLP  163



>gb|KDO37843.1| hypothetical protein CISIN_1g047084mg, partial [Citrus sinensis]
Length=437

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW++F HYLTVQ W P FD+ +  ++  + WIR P
Sbjct  270  GPWVIFGHYLTVQPWTPQFDSTTTDLDSAIVWIRLP  305



>gb|KEH41789.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=1456

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GGPWM+FDHYL   +W P F+  +  ++K +AWIR PS
Sbjct  380  GGPWMIFDHYLAFCQWSPTFNAATATIDKTMAWIRIPS  417



>gb|KDO37533.1| hypothetical protein CISIN_1g048335mg, partial [Citrus sinensis]
Length=187

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW+V  H+L VQ W P+FD+ ++K++K++AWIRF
Sbjct  152  GPWLVSGHFLIVQLWSPHFDSSNEKIDKIIAWIRF  186



>ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago truncatula]
Length=513

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPWM+FDH L V  W P F +   ++E+ + W+RFP
Sbjct  142  GGPWMIFDHCLAVTHWSPEFASPEARVERTVVWVRFP  178



>ref|XP_003630108.1| hypothetical protein MTR_8g091870 [Medicago truncatula]
Length=423

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPWM+FDH + V  W P F + + K+E+ + W+RFP
Sbjct  93   GGPWMIFDHCMVVAHWSPEFASPNAKVERTVVWVRFP  129



>gb|KDO58401.1| hypothetical protein CISIN_1g046952mg, partial [Citrus sinensis]
Length=428

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW V  HYL+VQ+W P FD  ++K+++++AWIR 
Sbjct  103  GPWTVLGHYLSVQQWTPKFDVVNNKIDRIVAWIRL  137



>gb|KHN04242.1| hypothetical protein glysoja_041006, partial [Glycine soja]
Length=136

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW+++DHYL V+EW PNF   S+ +EK++  +RF
Sbjct  62   GPWLIYDHYLVVREWMPNFHPSSEALEKVVVRVRF  96



>ref|XP_009770156.1| PREDICTED: uncharacterized protein LOC104220886 [Nicotiana sylvestris]
Length=339

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +F H+L+VQ+W PNF     K+ K   WIR P
Sbjct  2    GPWFIFGHFLSVQKWEPNFLASEAKISKTAVWIRLP  37



>gb|KHN25996.1| hypothetical protein glysoja_046925 [Glycine soja]
Length=134

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GP MVFDHYLT+Q W P F + +  ++K + WIRFP 
Sbjct  4    GPLMVFDHYLTMQLWSPEFASPTTTIDKKMVWIRFPG  40



>ref|XP_006375872.1| hypothetical protein POPTR_0013s04890g, partial [Populus trichocarpa]
 gb|ERP53669.1| hypothetical protein POPTR_0013s04890g, partial [Populus trichocarpa]
Length=171

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            G PWMV DHYLTV++W PNF+     ++K+  W+R P
Sbjct  21   GSPWMVADHYLTVRQWHPNFNPDEATIDKVALWMRLP  57



>gb|KDO43811.1| hypothetical protein CISIN_1g044430mg, partial [Citrus sinensis]
Length=281

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW V   YL VQ+W P+FD  ++K+EK++AWIR 
Sbjct  32   GPWTVMGQYLIVQQWSPSFDVATNKIEKIVAWIRL  66



>ref|XP_003609254.1| hypothetical protein MTR_4g113700 [Medicago truncatula]
Length=484

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPW++FDH L V  W P F + + K+++ + W+RFP
Sbjct  145  GGPWLIFDHCLAVTHWSPEFASPNAKVDRTVVWVRFP  181



>dbj|BAE79383.1| unnamed protein product [Ipomoea batatas]
Length=532

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +FD+YL  Q W PNF+ R+ K +K+  W+R P
Sbjct  159  GPWKIFDNYLITQRWVPNFEPRTAKFQKMAVWVRLP  194



>gb|KDO38231.1| hypothetical protein CISIN_1g041269mg [Citrus sinensis]
Length=578

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPW +  HYL VQ+W P+FD  ++K+++++AWIR  S
Sbjct  150  GPWTIMGHYLFVQQWTPDFDATTNKVDRIVAWIRLSS  186



>gb|KDO74197.1| hypothetical protein CISIN_1g037882mg, partial [Citrus sinensis]
Length=396

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW V  HYLTVQ+W  +FD  ++K++ ++AWIR 
Sbjct  59   GPWTVIGHYLTVQQWSSDFDIATNKIDHIVAWIRL  93



>ref|XP_003603988.1| hypothetical protein MTR_3g117300 [Medicago truncatula]
Length=94

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  104  MVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            M+FDHYLTVQ W   F +  +K+EK + WIRFP
Sbjct  1    MIFDHYLTVQSWSAEFASPFEKIEKTMVWIRFP  33



>emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=678

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW++ D YLT+++W PNF +  + ++KL AW+R P
Sbjct  195  GPWLIGDSYLTIRKWVPNFVSDQEPIKKLTAWVRIP  230



>dbj|BAE79381.1| unnamed protein product [Ipomoea batatas]
Length=532

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +FD+YL  Q W PNF  R+ K +K+  W+R P
Sbjct  159  GPWKIFDNYLITQRWVPNFKPRTAKFQKMAVWVRLP  194



>gb|KDO39120.1| hypothetical protein CISIN_1g048696mg [Citrus sinensis]
Length=248

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +  HYLTVQ W   F++ ++ ++ ++AWIR P
Sbjct  47   GPWTILGHYLTVQPWHLRFESSTETIDSIIAWIRLP  82



>ref|XP_002317857.1| hypothetical protein POPTR_0012s00280g [Populus trichocarpa]
 gb|EEE96077.1| hypothetical protein POPTR_0012s00280g [Populus trichocarpa]
Length=288

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPWM+ DHYLTV+ W P+F + + K++  L W R P
Sbjct  159  GGPWMILDHYLTVRTWSPSFVSTTAKIDWTLVWARIP  195



>gb|KDO70278.1| hypothetical protein CISIN_1g046866mg, partial [Citrus sinensis]
Length=583

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW V  HYL+VQ+W P+FD  ++K+  ++AWIR 
Sbjct  153  GPWTVMGHYLSVQKWSPDFDVVNNKINHIVAWIRL  187



>gb|KDO44000.1| hypothetical protein CISIN_1g046515mg, partial [Citrus sinensis]
Length=495

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW +  HYL+VQ+W P+FD  ++K+++++AWIR 
Sbjct  104  GPWTLMGHYLSVQKWSPDFDVVNNKIDRIVAWIRL  138



>emb|CAB78007.1| putative protein [Arabidopsis thaliana]
 emb|CAB82118.1| putative protein [Arabidopsis thaliana]
Length=404

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GGPW VF +YL VQ+W PNFD   D +     W+R 
Sbjct  82   GGPWRVFGNYLMVQDWSPNFDPLRDDIVTTPVWVRL  117



>gb|KEH32345.1| DUF4283 domain protein [Medicago truncatula]
Length=530

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            G WM+FDHYLTV +W   F + + K+EK + W+RFP
Sbjct  16   GLWMIFDHYLTVAKWSLEFVSSTAKIEKTMVWVRFP  51



>ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula]
 gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula]
Length=504

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPW++FDH L V  W P F + + K+++ + W+RFP
Sbjct  145  GGPWLIFDHCLAVTHWTPEFASPNAKVDRTVVWVRFP  181



>ref|XP_010681547.1| PREDICTED: uncharacterized protein LOC104896496 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPW + DHYL + +W+PNF    +   KL+ WI  P
Sbjct  129  GGPWYILDHYLMLNQWQPNFRPNQNPFNKLVVWIHLP  165



>gb|KDO69928.1| hypothetical protein CISIN_1g039478mg, partial [Citrus sinensis]
Length=136

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPW V  HY  +Q+W    D+ S+K++ ++AWIR PS
Sbjct  58   GPWTVLGHYFIIQQWTLYLDSTSEKIDSMVAWIRLPS  94



>gb|KHN24218.1| hypothetical protein glysoja_037052, partial [Glycine soja]
Length=141

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIR  12
            GPWMV DHYL VQ W P F   +  ++ ++ WIR
Sbjct  14   GPWMVEDHYLVVQRWYPFFPMNAKALKNIVVWIR  47



>ref|XP_009607026.1| PREDICTED: uncharacterized protein LOC104101282 [Nicotiana tomentosiformis]
Length=162

 Score = 45.8 bits (107),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +F H+L+VQ W P+F + + K      WIR P
Sbjct  8    GPWFIFGHFLSVQRWEPDFVSSTAKQTFTAIWIRLP  43



>gb|KHN28554.1| hypothetical protein glysoja_021375, partial [Glycine soja]
Length=77

 Score = 45.1 bits (105),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  PWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            PWM+F++YL V  W P F      ++K L WIRFPS
Sbjct  1    PWMMFNYYLMVHPWTPKFVVTEATIDKTLVWIRFPS  36



>gb|KHN29850.1| hypothetical protein glysoja_034094, partial [Glycine soja]
Length=111

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIR  12
            GPWMV DHYL VQ W P F T  +KM+ +  W++
Sbjct  17   GPWMVVDHYLIVQRWLPFFLTNVEKMKNVAVWLK  50



>gb|KCW60820.1| hypothetical protein EUGRSUZ_H03558 [Eucalyptus grandis]
Length=131

 Score = 45.4 bits (106),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  PWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            PWM+FDHYL ++ W P F+     ++++  W++FP+
Sbjct  83   PWMIFDHYLAIRRWHPGFEPNEPTIDRVAIWVKFPN  118



>ref|XP_008778450.1| PREDICTED: uncharacterized protein LOC103698238 [Phoenix dactylifera]
 ref|XP_008778518.1| PREDICTED: uncharacterized protein LOC103698300 [Phoenix dactylifera]
Length=333

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GGPW+V    LT++ WRPNF T ++++ + + W+R PS
Sbjct  130  GGPWLVAGQLLTMERWRPNFVTETNQLCRTVVWLRLPS  167



>gb|KDO38287.1| hypothetical protein CISIN_1g044376mg [Citrus sinensis]
Length=578

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW +  HYL VQ+W P FD  ++++++++AWIR 
Sbjct  150  GPWTIMGHYLFVQQWTPEFDATTNRVDRIVAWIRL  184



>gb|KDO39032.1| hypothetical protein CISIN_1g043150mg, partial [Citrus sinensis]
Length=588

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GPW V   YL+VQ+W P+FD  ++K+++++AWIR 
Sbjct  154  GPWTVMGQYLSVQKWTPDFDVVNNKIDRIVAWIRL  188



>ref|XP_010667256.1| PREDICTED: uncharacterized protein LOC104884318 [Beta vulgaris 
subsp. vulgaris]
Length=236

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPWM+ DHYLT+++W PNF      ++ L AW+R P+
Sbjct  147  GPWMIEDHYLTIRKWIPNFIPDEAPIKVLTAWVRIPN  183



>ref|XP_009787638.1| PREDICTED: uncharacterized protein LOC104235548 [Nicotiana sylvestris]
Length=284

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +  HYL++ +WRPNF    +K+   + WIR P
Sbjct  158  GPWFINGHYLSITKWRPNFVANKEKLTVSVVWIRLP  193



>gb|KHN04954.1| hypothetical protein glysoja_013861, partial [Glycine soja]
Length=243

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  110  PWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            PWM+FD+YL V+ W P+F +    + K + WIRFP
Sbjct  120  PWMIFDNYLIVELWTPDFISPVASINKTMVWIRFP  154



>ref|XP_009757725.1| PREDICTED: uncharacterized protein LOC104210511 [Nicotiana sylvestris]
Length=312

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +F H+L++Q W+PNF     K   +  WIR P
Sbjct  146  GPWFIFGHFLSIQRWKPNFVATEIKSSLIAIWIRSP  181



>ref|XP_008780257.1| PREDICTED: uncharacterized protein LOC103700060, partial [Phoenix 
dactylifera]
Length=204

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GGPW+V    LT++ WRPNF   ++K+ + + W+R PS
Sbjct  141  GGPWLVAGQLLTMERWRPNFVPGTNKLCRTVVWLRLPS  178



>ref|XP_010680872.1| PREDICTED: uncharacterized protein LOC104895924 [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPWM+ D YLT+++W PNF      M  L AW+R P+
Sbjct  132  GPWMIGDTYLTIRKWIPNFTADKAPMRHLTAWVRIPN  168



>ref|XP_010690660.1| PREDICTED: uncharacterized protein LOC104904165 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            G PW + +HYL + +W+P+F   S   +K++ WIRFP
Sbjct  184  GSPWFILNHYLMLTKWKPDFRPSSSSFDKIMVWIRFP  220



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW++  HYLTVQ+W P FD++    + +  WIR P
Sbjct  163  GPWIILGHYLTVQQWTPEFDSKVTDFDYVNVWIRLP  198



>gb|KHN27519.1| hypothetical protein glysoja_018631, partial [Glycine soja]
Length=165

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            G WMV DHY+ VQ WR  F   ++   KL  WIR P
Sbjct  58   GSWMVVDHYILVQRWRSFFLANTNVARKLAMWIRVP  93



>gb|KDO36602.1| hypothetical protein CISIN_1g037725mg, partial [Citrus sinensis]
Length=276

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +  HYLTVQ W   F++ +  ++ ++AWIR P
Sbjct  111  GPWTILGHYLTVQPWHLRFESSTKTIDSIIAWIRLP  146



>gb|KHN35462.1| hypothetical protein glysoja_032217, partial [Glycine soja]
Length=141

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  PWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            PWM+FDHYLTV+ W  +  ++  K++  +  IRFP 
Sbjct  56   PWMIFDHYLTVRAWSADLISQEAKIDTTMVCIRFPG  91



>ref|XP_010666462.1| PREDICTED: uncharacterized protein LOC104883615 [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPWM+ D+YLT+++W PNF    +  + L AW+R P+
Sbjct  52   GPWMIDDNYLTIRKWVPNFILDDNPPKILTAWVRIPN  88



>gb|KDO50220.1| hypothetical protein CISIN_1g0394272mg, partial [Citrus sinensis]
Length=92

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW + +HYL V+ W  +FD   ++ + ++AWIR P
Sbjct  57   GPWTIMEHYLIVRPWTQHFDNLKEECDSVIAWIRLP  92



>gb|KHN18973.1| hypothetical protein glysoja_039897, partial [Glycine soja]
Length=92

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLA  21
            G PWM+FDHYLT+  W P F T   K++K+LA
Sbjct  61   GEPWMIFDHYLTILPWDPYFLTLESKVDKILA  92



>ref|XP_010684971.1| PREDICTED: uncharacterized protein LOC104899471 [Beta vulgaris 
subsp. vulgaris]
Length=243

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPWM+ + YLT++ W PNF      ++ L AW+R P
Sbjct  66   GPWMIGESYLTIRRWVPNFIADEAPIKTLTAWVRIP  101



>ref|XP_010520311.1| PREDICTED: uncharacterized protein LOC104799464 [Tarenaya hassleriana]
Length=548

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPW++   YLTVQ W P+F     K   ++AWIRFP+
Sbjct  155  GPWVILGAYLTVQCWSPDFVPSQAKPSHVVAWIRFPA  191



>ref|XP_010689461.1| PREDICTED: uncharacterized protein LOC104903161 [Beta vulgaris 
subsp. vulgaris]
Length=353

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPWM+ D YLT+++W PNF +    ++ L AW+R P
Sbjct  180  GPWMIGDSYLTIRKWTPNFVSDEAPIKTLTAWVRIP  215



>emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=744

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPW + +HYL +  W+P+F       +K++ WIRFP
Sbjct  180  GGPWFILNHYLMLTRWKPDFRPSQSVFDKIMVWIRFP  216



>ref|XP_006606936.1| PREDICTED: uncharacterized protein LOC102668273 [Glycine max]
Length=280

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  PWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            PWM+FD+YL V+ W P+F +    + K + WIRFP 
Sbjct  130  PWMIFDNYLIVELWTPDFISPVASINKTMVWIRFPG  165



>gb|KDO35980.1| hypothetical protein CISIN_1g037800mg [Citrus sinensis]
Length=402

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GPW +  HYL VQ W P FD+  ++ + ++ WIR P
Sbjct  8    GPWTLMGHYLIVQLWSPQFDSSKEECDSVIVWIRLP  43



>ref|XP_007204051.1| hypothetical protein PRUPE_ppa026737mg, partial [Prunus persica]
 gb|EMJ05250.1| hypothetical protein PRUPE_ppa026737mg, partial [Prunus persica]
Length=147

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GGPW +   Y+  Q+W+P F+ + +K+  + AW+R 
Sbjct  78   GGPWQIAGQYVVTQQWKPRFNAKEEKITHMTAWVRI  113



>ref|XP_007206580.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
 gb|EMJ07779.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
Length=346

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIR  12
            GGPW +   YL  Q+W+P F+ + +++  + AW+R
Sbjct  80   GGPWQIAGQYLVTQQWKPGFNLKEERVTHMTAWVR  114



>ref|XP_010681595.1| PREDICTED: uncharacterized protein LOC104896537 [Beta vulgaris 
subsp. vulgaris]
Length=302

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPW V +HYL + +W+PNF    +  ++L+ W+  P
Sbjct  130  GGPWYVLNHYLMLNQWQPNFRLTQNPFDRLVIWVHIP  166



>ref|XP_009779035.1| PREDICTED: uncharacterized protein LOC104228289 [Nicotiana sylvestris]
Length=444

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 14/37 (38%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGPW V +H+L+V++W P F     ++     W+R P
Sbjct  131  GGPWFVLNHFLSVRQWEPKFKASETQLTSSAIWLRLP  167



>ref|XP_006387180.1| hypothetical protein POPTR_1595s00200g, partial [Populus trichocarpa]
 gb|ERP46094.1| hypothetical protein POPTR_1595s00200g, partial [Populus trichocarpa]
Length=447

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -2

Query  104  MVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            MV +HYLTV+ W PNFD     ++K+  W+R P
Sbjct  1    MVTNHYLTVRTWHPNFDPFEATIDKVAVWVRLP  33



>ref|XP_006382318.1| hypothetical protein POPTR_0005s00970g [Populus trichocarpa]
 gb|ERP60115.1| hypothetical protein POPTR_0005s00970g [Populus trichocarpa]
Length=163

 Score = 42.7 bits (99),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFD  54
            GGPWMV DHYLT++ W PNFD
Sbjct  131  GGPWMVADHYLTMRSWHPNFD  151



>ref|XP_010412659.1| PREDICTED: uncharacterized protein At4g02000-like [Camelina sativa]
Length=155

 Score = 42.7 bits (99),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GGPW  F  YL VQ W P FD   D++   L WIR 
Sbjct  16   GGPWRAFGSYLMVQAWTPEFDPLVDEIMTTLVWIRL  51



>ref|XP_006385484.1| hypothetical protein POPTR_0003s05680g [Populus trichocarpa]
 gb|ERP63281.1| hypothetical protein POPTR_0003s05680g [Populus trichocarpa]
Length=328

 Score = 44.3 bits (103),  Expect = 0.001, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFP  6
            GGP M+FDHYL V+ W P F +   K+ + + W+  P
Sbjct  16   GGPSMLFDHYLAVRNWSPEFVSSITKINRAMVWVWIP  52



>ref|XP_006295777.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
 gb|EOA28675.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
Length=451

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -2

Query  116  GGPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRF  9
            GGPW VF +YL VQ+W PNFD   D +     W+R 
Sbjct  135  GGPWRVFGNYLMVQQWSPNFDPLKDDIVTTPVWVRL  170



>ref|XP_008780476.1| PREDICTED: uncharacterized protein LOC103700307, partial [Phoenix 
dactylifera]
Length=278

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  GPWMVFDHYLTVQEWRPNFDTRSDKMEKLLAWIRFPS  3
            GPWMV    L ++ WRPNF T +  + +++ W+R PS
Sbjct  142  GPWMVAGQLLAMERWRPNFSTGAGGVGRVVLWLRLPS  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684