BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11720_g1_i1 len=1087 path=[41:0-667 40:668-1086]

Length=1087
                                                                      Score     E

ref|XP_006340259.1|  PREDICTED: transcriptional regulator ATRX ho...    191   5e-55   
ref|XP_004251187.1|  PREDICTED: uncharacterized protein LOC101249523    186   5e-53   
ref|XP_009603734.1|  PREDICTED: uncharacterized protein LOC104098655    180   5e-51   
ref|XP_009801168.1|  PREDICTED: uncharacterized protein LOC104246950    179   1e-50   
emb|CDP08150.1|  unnamed protein product                                164   7e-45   
ref|XP_006450686.1|  hypothetical protein CICLE_v10009557mg             152   3e-40   
ref|XP_007012128.1|  Translation initiation factor IF-2                 151   5e-40   
ref|XP_003522710.1|  PREDICTED: uncharacterized protein LOC100812528    150   1e-39   
ref|XP_002283869.1|  PREDICTED: uncharacterized protein LOC100262893    149   3e-39   Vitis vinifera
ref|NP_001242254.1|  uncharacterized protein LOC100786782               149   3e-39   
ref|XP_003545610.1|  PREDICTED: uncharacterized protein DDB_G0284...    148   7e-39   
ref|XP_011081788.1|  PREDICTED: uncharacterized protein LOC105164743    148   1e-38   
gb|KDP34149.1|  hypothetical protein JCGZ_07720                         147   1e-38   
ref|XP_007137219.1|  hypothetical protein PHAVU_009G109500g             148   5e-38   
gb|ACU23417.1|  unknown                                                 146   5e-38   Glycine max [soybeans]
gb|AFK34002.1|  unknown                                                 146   1e-37   
ref|XP_010102389.1|  hypothetical protein L484_010701                   145   1e-37   
gb|KHN06668.1|  hypothetical protein glysoja_046606                     145   1e-37   
ref|XP_003526489.1|  PREDICTED: uncharacterized protein LOC100527341    144   2e-37   
gb|KEH36062.1|  hypothetical protein MTR_3g110202                       144   3e-37   
ref|XP_011004729.1|  PREDICTED: uncharacterized protein LOC105111...    143   6e-37   
ref|XP_011004730.1|  PREDICTED: uncharacterized protein LOC105111...    143   7e-37   
ref|XP_009367459.1|  PREDICTED: uncharacterized protein LOC103957097    142   1e-36   
ref|XP_011004728.1|  PREDICTED: uncharacterized protein LOC105111...    143   1e-36   
ref|XP_011004727.1|  PREDICTED: uncharacterized protein LOC105111...    142   7e-36   
ref|XP_008393871.1|  PREDICTED: uncharacterized protein LOC103456025    140   8e-36   
ref|XP_008357409.1|  PREDICTED: uncharacterized protein LOC103421152    139   3e-35   
ref|XP_004501159.1|  PREDICTED: DNA topoisomerase 1-like                139   3e-35   
ref|XP_002324800.1|  hypothetical protein POPTR_0018s00280g             138   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004150287.1|  PREDICTED: uncharacterized protein LOC101205...    140   5e-35   
ref|XP_004150288.1|  PREDICTED: uncharacterized protein LOC101205...    137   1e-34   
ref|XP_008445018.1|  PREDICTED: neurofilament heavy polypeptide         137   1e-34   
ref|XP_004168744.1|  PREDICTED: uncharacterized LOC101205851 isof...    138   2e-34   
gb|EYU20437.1|  hypothetical protein MIMGU_mgv1a013792mg                136   2e-34   
ref|XP_002516501.1|  conserved hypothetical protein                     134   2e-33   Ricinus communis
ref|XP_010917830.1|  PREDICTED: uncharacterized protein LOC105042355    132   5e-33   
ref|XP_004291183.1|  PREDICTED: uncharacterized protein LOC101302896    130   3e-32   
ref|XP_011019618.1|  PREDICTED: uncharacterized protein LOC105122284    128   2e-31   
ref|XP_008220076.1|  PREDICTED: myb-like protein V                      127   5e-31   
ref|XP_009415223.1|  PREDICTED: uncharacterized protein LOC103996114    125   1e-30   
ref|XP_002309545.1|  hypothetical protein POPTR_0006s25520g             126   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_007159786.1|  hypothetical protein PHAVU_002G267100g             125   2e-30   
ref|XP_008793089.1|  PREDICTED: uncharacterized protein LOC103709...    124   4e-30   
ref|XP_006450685.1|  hypothetical protein CICLE_v10009557mg             122   9e-30   
ref|XP_007223948.1|  hypothetical protein PRUPE_ppa011151mg             124   1e-29   
ref|XP_010668358.1|  PREDICTED: uncharacterized protein LOC104885...    123   2e-29   
ref|XP_010049107.1|  PREDICTED: uncharacterized protein LOC104437779    121   5e-29   
ref|NP_001143557.1|  uncharacterized protein LOC100276253               121   5e-29   Zea mays [maize]
ref|XP_010519888.1|  PREDICTED: uncharacterized protein LOC104799194    121   8e-29   
gb|AFK44954.1|  unknown                                                 122   9e-29   
ref|XP_009410913.1|  PREDICTED: uncharacterized protein LOC103992792    120   1e-28   
gb|KCW81568.1|  hypothetical protein EUGRSUZ_C02926                     121   1e-28   
ref|XP_010249580.1|  PREDICTED: uncharacterized protein LOC104592...    120   2e-28   
gb|AAV59389.1|  unknown protein                                         117   6e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441646.1|  hypothetical protein SORBIDRAFT_09g030890          117   8e-28   Sorghum bicolor [broomcorn]
ref|XP_004960967.1|  PREDICTED: protein AF-9-like                       116   3e-27   
ref|XP_010249581.1|  PREDICTED: uncharacterized protein LOC104592...    117   3e-27   
ref|XP_010924557.1|  PREDICTED: uncharacterized protein LOC105047348    117   3e-27   
ref|XP_004498467.1|  PREDICTED: uncharacterized protein LOC101503732    115   3e-27   
emb|CDY71261.1|  BnaCnng72080D                                          115   1e-26   
ref|XP_002873523.1|  hypothetical protein ARALYDRAFT_487997             115   2e-26   
ref|XP_010419735.1|  PREDICTED: uncharacterized protein LOC104705427    114   7e-26   
ref|XP_010453207.1|  PREDICTED: uncharacterized protein LOC104735174    113   1e-25   
ref|NP_196721.1|  uncharacterized protein                               112   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59810.1|  hypothetical protein M569_14995                         107   5e-25   
ref|XP_006289046.1|  hypothetical protein CARUB_v10002438mg             110   7e-25   
ref|XP_003567772.1|  PREDICTED: uncharacterized protein LOC100836865    108   1e-24   
ref|XP_009125820.1|  PREDICTED: uncharacterized protein LOC103850785    108   6e-24   
emb|CDY69985.1|  BnaAnng32230D                                          107   7e-24   
ref|XP_006399667.1|  hypothetical protein EUTSA_v10014651mg             107   7e-24   
gb|KEH39707.1|  hypothetical protein MTR_1g006605                       106   1e-23   
ref|XP_010668353.1|  PREDICTED: uncharacterized protein LOC104885...    106   3e-23   
gb|KFK25420.1|  hypothetical protein AALP_AA8G112700                    104   1e-22   
gb|EMS66909.1|  hypothetical protein TRIUR3_27901                       105   4e-22   
ref|XP_009394185.1|  PREDICTED: uncharacterized protein LOC103979725    102   4e-22   
ref|XP_003588370.1|  Casein kinase I isoform delta-like protein         104   8e-22   
ref|XP_010254456.1|  PREDICTED: uncharacterized protein LOC104595423    101   2e-21   
ref|NP_001056519.1|  Os05g0596200                                     97.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006853626.1|  hypothetical protein AMTR_s00056p00067330        98.6    1e-20   
ref|XP_010249583.1|  PREDICTED: uncharacterized protein LOC104592...  97.1    2e-20   
gb|ABK22114.1|  unknown                                               90.9    6e-18   Picea sitchensis
ref|XP_002993612.1|  hypothetical protein SELMODRAFT_431684           92.8    1e-17   
dbj|BAE99910.1|  hypothetical protein                                 85.9    8e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG07932.1|  Acyl transferase                                      84.7    1e-16   
gb|AFW81366.1|  hypothetical protein ZEAMMB73_530524                  82.8    8e-16   
ref|XP_010104456.1|  hypothetical protein L484_016055                 85.5    9e-16   
ref|XP_006416444.1|  hypothetical protein EUTSA_v10008450mg           85.1    1e-15   
gb|ADE77275.1|  unknown                                               84.3    2e-15   
ref|XP_004291358.1|  PREDICTED: uncharacterized protein LOC101306296  84.7    2e-15   
ref|XP_006649747.1|  PREDICTED: transcriptional regulator ATRX ho...  85.5    2e-15   
ref|XP_010920238.1|  PREDICTED: uncharacterized protein DDB_G0286...  84.3    2e-15   
emb|CDY44198.1|  BnaC05g15550D                                        84.3    2e-15   
ref|XP_010061070.1|  PREDICTED: protein IWS1 homolog A                85.1    3e-15   
ref|XP_010533812.1|  PREDICTED: nucleolin                             84.0    3e-15   
ref|XP_002275494.2|  PREDICTED: nucleolar protein 58 isoform X1       83.2    4e-15   Vitis vinifera
ref|XP_006596188.1|  PREDICTED: uncharacterized protein DDB_G0284...  81.6    4e-15   
ref|XP_010664814.1|  PREDICTED: ABC transporter F family member 4...  82.8    5e-15   
ref|XP_010498428.1|  PREDICTED: uncharacterized protein DDB_G0283697  83.2    5e-15   
ref|XP_010459679.1|  PREDICTED: uncharacterized protein DDB_G0283...  82.8    6e-15   
gb|KFK44125.1|  hypothetical protein AALP_AA1G218900                  82.8    9e-15   
ref|XP_011045086.1|  PREDICTED: nucleolin-like isoform X1             82.8    1e-14   
ref|XP_011045087.1|  PREDICTED: nuclear ubiquitous casein and cyc...  82.8    1e-14   
emb|CDY29377.1|  BnaA06g14190D                                        82.4    1e-14   
dbj|BAG88351.1|  unnamed protein product                              79.7    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001759125.1|  predicted protein                                83.6    2e-14   
ref|XP_007226727.1|  hypothetical protein PRUPE_ppa019607mg           82.4    2e-14   
ref|XP_003527642.1|  PREDICTED: DNA ligase 1-like                     81.3    2e-14   
ref|XP_011074685.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  81.6    2e-14   
ref|XP_006383742.1|  hypothetical protein POPTR_0005s26110g           82.0    2e-14   
ref|NP_001049564.1|  Os03g0249900                                     82.4    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002306929.1|  hypothetical protein POPTR_0005s26110g           82.0    2e-14   Populus trichocarpa [western balsam poplar]
gb|EAY89268.1|  hypothetical protein OsI_10766                        82.4    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_011074684.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  81.3    2e-14   
gb|ABK92449.1|  unknown                                               82.0    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008780158.1|  PREDICTED: uncharacterized protein LOC103699949  78.6    2e-14   
gb|KGN60039.1|  hypothetical protein Csa_3G872700                     81.6    3e-14   
ref|XP_007017806.1|  Uncharacterized protein isoform 1                81.3    3e-14   
gb|KHN09087.1|  hypothetical protein glysoja_034272                   80.9    3e-14   
ref|XP_010268173.1|  PREDICTED: DNA ligase 1                          80.9    3e-14   
ref|XP_008377143.1|  PREDICTED: nucleolar protein 58                  81.6    3e-14   
gb|KHN45926.1|  hypothetical protein glysoja_023149                   80.1    4e-14   
ref|XP_010477225.1|  PREDICTED: DNA topoisomerase 1-like              81.3    4e-14   
ref|XP_002890362.1|  hypothetical protein ARALYDRAFT_312926           83.2    4e-14   
ref|XP_008466483.1|  PREDICTED: transcriptional regulator ATRX ho...  80.9    4e-14   
gb|ADE75838.1|  unknown                                               80.9    5e-14   
ref|XP_004162563.1|  PREDICTED: uncharacterized LOC101214860          81.3    5e-14   
gb|ACJ85477.1|  unknown                                               80.5    6e-14   Medicago truncatula
ref|NP_173428.1|  uncharacterized protein                             80.1    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149495.1|  PREDICTED: DNA ligase 1                          80.5    6e-14   
ref|XP_003603764.1|  hypothetical protein MTR_3g113940                80.1    6e-14   
ref|XP_004500939.1|  PREDICTED: nucleolar protein 58-like             80.1    7e-14   
ref|XP_009618876.1|  PREDICTED: uncharacterized protein DDB_G0283697  80.1    7e-14   
ref|XP_008658394.1|  PREDICTED: uncharacterized protein LOC100276...  80.5    7e-14   
ref|NP_001144040.1|  uncharacterized protein LOC100276864             80.1    7e-14   Zea mays [maize]
ref|XP_009383985.1|  PREDICTED: ABC transporter F family member 4     80.1    8e-14   
gb|EYU38807.1|  hypothetical protein MIMGU_mgv1a012284mg              79.7    8e-14   
ref|XP_001751402.1|  predicted protein                                77.4    9e-14   
ref|XP_006852056.1|  hypothetical protein AMTR_s00041p00224610        79.3    1e-13   
gb|AFW88980.1|  hypothetical protein ZEAMMB73_727468                  80.1    1e-13   
ref|XP_006342054.1|  PREDICTED: nucleolar protein 58-like             79.7    1e-13   
emb|CDP07396.1|  unnamed protein product                              79.0    1e-13   
ref|XP_004238361.1|  PREDICTED: probable replication factor C sub...  79.3    1e-13   
ref|XP_003558344.2|  PREDICTED: uncharacterized protein DDB_G0286299  80.1    2e-13   
ref|XP_002510538.1|  conserved hypothetical protein                   79.3    2e-13   Ricinus communis
gb|KDP36920.1|  hypothetical protein JCGZ_08211                       79.3    2e-13   
ref|XP_003523549.1|  PREDICTED: DNA ligase 1-like                     79.3    2e-13   
ref|XP_011083557.1|  PREDICTED: transcriptional regulator ATRX ho...  78.2    2e-13   
ref|XP_004984997.1|  PREDICTED: DNA ligase 1-like                     79.0    3e-13   
ref|XP_011083558.1|  PREDICTED: transcriptional regulator ATRX ho...  78.2    3e-13   
ref|XP_008807599.1|  PREDICTED: ABC transporter F family member 4...  78.6    3e-13   
gb|ACU23187.1|  unknown                                               77.8    3e-13   Glycine max [soybeans]
ref|XP_008221257.1|  PREDICTED: nucleolar protein 58                  79.0    3e-13   
ref|XP_008807600.1|  PREDICTED: FACT complex subunit SSRP1-A-like...  77.8    3e-13   
ref|XP_002468171.1|  hypothetical protein SORBIDRAFT_01g041010        77.4    3e-13   Sorghum bicolor [broomcorn]
ref|XP_009757789.1|  PREDICTED: uncharacterized protein DDB_G0283697  77.8    4e-13   
ref|XP_007136092.1|  hypothetical protein PHAVU_009G017100g           77.4    4e-13   
ref|XP_009335009.1|  PREDICTED: uncharacterized protein LOC103927784  73.9    7e-13   
gb|AAF79914.1|AC022472_23  Contains a weak similarity to Rap8 (Ra...  79.7    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001768911.1|  predicted protein                                78.6    9e-13   
ref|XP_006305349.1|  hypothetical protein CARUB_v10009729mg           77.8    9e-13   
ref|XP_007017807.1|  Uncharacterized protein isoform 2                77.0    1e-12   
ref|XP_002301977.1|  hypothetical protein POPTR_0002s02360g           75.5    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002502047.1|  predicted protein                                75.1    2e-12   Micromonas commoda
ref|XP_008776806.1|  PREDICTED: muscle M-line assembly protein un...  73.6    5e-12   
ref|XP_006435185.1|  hypothetical protein CICLE_v10002221mg           74.7    5e-12   
ref|XP_006473663.1|  PREDICTED: transcriptional regulator ATRX ho...  74.3    6e-12   
ref|XP_001767724.1|  predicted protein                                76.3    7e-12   
ref|XP_006435184.1|  hypothetical protein CICLE_v10002221mg           74.3    7e-12   
ref|XP_008793090.1|  PREDICTED: uncharacterized protein LOC103709...  72.0    8e-12   
ref|XP_006473662.1|  PREDICTED: transcriptional regulator ATRX ho...  73.9    9e-12   
ref|XP_006473661.1|  PREDICTED: transcriptional regulator ATRX ho...  73.9    9e-12   
ref|XP_010691867.1|  PREDICTED: neurofilament heavy polypeptide i...  73.2    2e-11   
gb|EPS64253.1|  hypothetical protein M569_10528                       69.7    4e-11   
ref|XP_002973442.1|  hypothetical protein SELMODRAFT_59603            68.6    8e-11   
emb|CDY43421.1|  BnaC07g14880D                                        68.9    5e-10   
dbj|BAK01071.1|  predicted protein                                    67.8    7e-10   
ref|XP_003057485.1|  predicted protein                                68.9    1e-09   
ref|XP_001416105.1|  predicted protein                                66.6    1e-09   Ostreococcus lucimarinus CCE9901
emb|CEG01130.1|  unnamed product                                      63.5    1e-08   
gb|KHG25219.1|  E3 ISG15--protein ligase HERC5                        61.2    2e-07   
emb|CDW81819.1|  UNKNOWN                                              59.3    6e-07   
ref|XP_010691868.1|  PREDICTED: DNA topoisomerase 1 isoform X2        58.2    9e-07   
ref|XP_007514082.1|  predicted protein                                59.3    1e-06   
gb|KFM28259.1|  hypothetical protein F751_1538                        58.5    2e-06   
ref|XP_005848198.1|  hypothetical protein CHLNCDRAFT_145630           58.2    3e-06   
ref|XP_008801507.1|  PREDICTED: uncharacterized protein LOC103715602  57.0    4e-06   
gb|KDO84874.1|  hypothetical protein CISIN_1g042570mg                 56.2    4e-06   
gb|EJY77918.1|  hypothetical protein OXYTRI_00440                     56.6    6e-06   
ref|XP_001032072.1|  hypothetical protein TTHERM_00704020             57.8    1e-05   Tetrahymena thermophila
ref|XP_001694269.1|  hypothetical protein CHLREDRAFT_95055            52.8    1e-05   Chlamydomonas reinhardtii
ref|XP_005642675.1|  hypothetical protein COCSUDRAFT_55002            53.9    3e-05   
ref|XP_005534846.1|  hypothetical protein, conserved                  52.4    7e-05   
gb|EMS60292.1|  hypothetical protein TRIUR3_07110                     52.8    3e-04   
ref|XP_002181495.1|  predicted protein                                48.5    0.001   Phaeodactylum tricornutum CCAP 1055/1



>ref|XP_006340259.1| PREDICTED: transcriptional regulator ATRX homolog [Solanum tuberosum]
Length=207

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 172/211 (82%), Gaps = 11/211 (5%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKT---I  435
            MAT TKSSVV+ KPS  +   S SSKP+FDSS  V KK+ ++ISS K S D+KGK+   +
Sbjct  1    MATETKSSVVKGKPSSNNQVGS-SSKPKFDSS--VIKKKVIQISS-KPSADSKGKSAINV  56

Query  436  SKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            SKTEV  K TS+SSKTV KT T+TR KKVYSL GQKFDVPEEREPLRLFYESLSKQIPSS
Sbjct  57   SKTEVKGKTTSTSSKTVTKTQTKTRVKKVYSLAGQKFDVPEEREPLRLFYESLSKQIPSS  116

Query  616  EMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKS-PTRPV--SVGSSKQPQQVS  786
            EMAEFWLMEHGLL P+++KKAFEKKQRKQKQ+R GTPIKS P RP      SSK+PQQ S
Sbjct  117  EMAEFWLMEHGLLSPERSKKAFEKKQRKQKQIRMGTPIKSPPPRPFISKAESSKKPQQAS  176

Query  787  KNGDIKAKKRLN-NdsdddddFILSPKRRKG  876
            KNGDIKAKKRL  + SDDDD+FILSPKRRKG
Sbjct  177  KNGDIKAKKRLKSDSSDDDDEFILSPKRRKG  207



>ref|XP_004251187.1| PREDICTED: uncharacterized protein LOC101249523 [Solanum lycopersicum]
Length=208

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 169/212 (80%), Gaps = 12/212 (6%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKT---I  435
            MAT TKSSVV+VK +  +     SSKP+ DSS  V KK+ ++IS+ K S D+KGK+   +
Sbjct  1    MATETKSSVVKVK-ANSNNQVGSSSKPKIDSS--VIKKKVIQISA-KPSADSKGKSAINV  56

Query  436  SKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +KTEV  K TS+SSKTV KT T+TR KKVYSL GQKFDVPEEREPLRLFYESLSKQIPSS
Sbjct  57   TKTEVKGKTTSTSSKTVTKTQTKTRVKKVYSLAGQKFDVPEEREPLRLFYESLSKQIPSS  116

Query  616  EMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKS-PTRPV--SVGSSKQPQQVS  786
            EMAEFWLMEHGLL P+++KKAFEKKQRKQKQ+R GTPIKS P RP      SSK+PQQ S
Sbjct  117  EMAEFWLMEHGLLSPERSKKAFEKKQRKQKQIRMGTPIKSPPPRPFISKAESSKKPQQAS  176

Query  787  KNGDIKAKKRLN--NdsdddddFILSPKRRKG  876
            KNGDIKAKKRL   +  DDDD+FILSPKRRKG
Sbjct  177  KNGDIKAKKRLKSDSSDDDDDEFILSPKRRKG  208



>ref|XP_009603734.1| PREDICTED: uncharacterized protein LOC104098655 [Nicotiana tomentosiformis]
Length=206

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 173/210 (82%), Gaps = 10/210 (5%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKT-IS-  438
            MAT +KSSVV+VKPS  +   S SSKP+FDSS  + KK+ ++ISS KQS D KGK+ IS 
Sbjct  1    MATESKSSVVKVKPSSSNQVGS-SSKPKFDSS--IIKKKVIQISS-KQSADLKGKSAISV  56

Query  439  KTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSE  618
            KTEV  K TSSSSKTV KT T+TR KKVYSL GQK+DVPEEREPLRLFYESLSKQIPSSE
Sbjct  57   KTEVKGKTTSSSSKTVTKTQTKTRVKKVYSLAGQKYDVPEEREPLRLFYESLSKQIPSSE  116

Query  619  MAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKS-PTRPV--SVGSSKQPQQVSK  789
            MAEFWLMEHGLL P+++KKAFEKKQRKQKQ+R G PIKS P RP+     SSK+ QQVSK
Sbjct  117  MAEFWLMEHGLLSPERSKKAFEKKQRKQKQIRMGIPIKSPPPRPLLNKAESSKKQQQVSK  176

Query  790  NGDIKAKKRLN-NdsdddddFILSPKRRKG  876
            NGD+KAKKRL  + SDDDDDFILSPKRRKG
Sbjct  177  NGDVKAKKRLKSDSSDDDDDFILSPKRRKG  206



>ref|XP_009801168.1| PREDICTED: uncharacterized protein LOC104246950 [Nicotiana sylvestris]
Length=206

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 174/210 (83%), Gaps = 10/210 (5%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKT-IS-  438
            MAT +KSSVV+VKPS  +   S SSKP+FDSS  + KK+ ++ISS KQS D KGK+ IS 
Sbjct  1    MATESKSSVVKVKPSSSNQVGS-SSKPKFDSS--LIKKKVIQISS-KQSADLKGKSAISV  56

Query  439  KTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSE  618
            KTEV  K TSSSSKTV KT T+TR KKVYSL GQK+DVPEEREPLRLFYESLSKQIPSSE
Sbjct  57   KTEVKGKTTSSSSKTVTKTQTKTRVKKVYSLAGQKYDVPEEREPLRLFYESLSKQIPSSE  116

Query  619  MAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKS-PTRPV--SVGSSKQPQQVSK  789
            MAEFWLMEHGLL P+++KKAFEKKQRKQKQ+R GTPIKS P RP+     SSK+ QQVSK
Sbjct  117  MAEFWLMEHGLLSPERSKKAFEKKQRKQKQIRMGTPIKSPPPRPLISKPESSKKQQQVSK  176

Query  790  NGDIKAKKRLN-NdsdddddFILSPKRRKG  876
            NGD+KAKKRL  + SDDDDDFILSPKRRKG
Sbjct  177  NGDVKAKKRLKSDSSDDDDDFILSPKRRKG  206



>emb|CDP08150.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 166/215 (77%), Gaps = 12/215 (6%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGD--GSTSLSSKPRF---DSSSSVTKKRTVEISSHKQSVDAKGK  429
            MAT TKS+VV+VKPSGG+  GS+S+SS          SS+ KK+  E SS KQS DAK K
Sbjct  1    MATETKSNVVKVKPSGGNQLGSSSISSSSSLAKEKGESSMIKKKAAESSSSKQSADAKQK  60

Query  430  ----TISKTEVNAKAtssssktvkktvtrtrekkv--YSLPGQKFDVPEEREPLRLFYES  591
                TISK+E  AK TSSSSK V K  T T+ ++   YSLPGQKFDVPEEREPLR+FYES
Sbjct  61   SLSSTISKSEAKAKGTSSSSKAVTKRKTVTKTREKKVYSLPGQKFDVPEEREPLRIFYES  120

Query  592  LSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQ  771
            LS QIPSSEMAEFWLMEHG+L P+KA+KAFEKKQ+KQKQLRTGTPIKSP       SSK+
Sbjct  121  LSHQIPSSEMAEFWLMEHGMLSPEKARKAFEKKQKKQKQLRTGTPIKSPPPSKPE-SSKK  179

Query  772  PQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            PQQ SKNG++K KKR+ +DSDDDDDF+LS KRRKG
Sbjct  180  PQQASKNGEVKTKKRIIDDSDDDDDFVLSHKRRKG  214



>ref|XP_006450686.1| hypothetical protein CICLE_v10009557mg [Citrus clementina]
 ref|XP_006476040.1| PREDICTED: uncharacterized protein DDB_G0284459-like [Citrus 
sinensis]
 gb|ESR63926.1| hypothetical protein CICLE_v10009557mg [Citrus clementina]
 gb|KDO79819.1| hypothetical protein CISIN_1g029232mg [Citrus sinensis]
Length=197

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 161/206 (78%), Gaps = 11/206 (5%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTISKT  444
            MAT +K+SV +VK S    + + SSK + DSSS   KK    I    +S  A    ++KT
Sbjct  1    MATESKASVGKVKSS----NQASSSKGKPDSSSLNKKKIDSSIKQPPKSSSA----LTKT  52

Query  445  EVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMA  624
            EV +K TSSSSKT+ KT T+ REKKV++LPGQKFD PEEREPLR+FYESLSKQIP+SEMA
Sbjct  53   EVKSKTTSSSSKTITKTTTKVREKKVFTLPGQKFDPPEEREPLRIFYESLSKQIPTSEMA  112

Query  625  EFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVG--SSKQPQQVSKNGD  798
            EFW+MEHGLL P++AKKA+EKKQRKQKQ+R GTP KSP  P+S    SS++ QQ SKNGD
Sbjct  113  EFWMMEHGLLSPERAKKAYEKKQRKQKQVRMGTPNKSP-HPLSNKPESSQKQQQGSKNGD  171

Query  799  IKAKKRLNNdsdddddFILSPKRRKG  876
            IKAK+R++ND+DDDDDFILSPKRRKG
Sbjct  172  IKAKRRVSNDADDDDDFILSPKRRKG  197



>ref|XP_007012128.1| Translation initiation factor IF-2 [Theobroma cacao]
 gb|EOY29747.1| Translation initiation factor IF-2 [Theobroma cacao]
Length=202

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 163/209 (78%), Gaps = 12/209 (6%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTIS--  438
            M T T+S++V+VK SG DGS    SK +FD++ +   ++ +E SS +  VD+K K++S  
Sbjct  1    MTTETRSNLVKVKTSGQDGS----SKGKFDAAMN---RKKIESSSKQAPVDSKQKSVSTV  53

Query  439  --KTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPS  612
              KT+V +KA+SSSSKT   T T+ REKKVY+LPGQK D PEEREPLR+FYESLSKQIP+
Sbjct  54   ITKTQVKSKASSSSSKTTATTKTKVREKKVYTLPGQKHDPPEEREPLRIFYESLSKQIPT  113

Query  613  SEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQVSKN  792
            SEMAEFW+MEHGLL P+KA+KA+EKKQR+ K+LRTGTPIKS        SS++ Q  SKN
Sbjct  114  SEMAEFWMMEHGLLSPEKARKAYEKKQRRLKELRTGTPIKSSKPSSKPESSQKHQLASKN  173

Query  793  GDIKAKKRLNNdsdddddF-ILSPKRRKG  876
            GD+KAKKR+NND DDDDD+ ILSPKRRKG
Sbjct  174  GDVKAKKRINNDIDDDDDYLILSPKRRKG  202



>ref|XP_003522710.1| PREDICTED: uncharacterized protein LOC100812528 [Glycine max]
 gb|KHN10196.1| hypothetical protein glysoja_017800 [Glycine soja]
Length=208

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 153/215 (71%), Gaps = 20/215 (9%)
 Frame = +1

Query  265  MATNTKSSVVR-VKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK----  429
            MAT TKS++V+ VK    D    +SSKP+ DS + + KK    I   K   D+K K    
Sbjct  1    MATYTKSTMVKGVKSIAQD----VSSKPKIDSLA-LKKKLNTSI---KHPPDSKLKFVTT  52

Query  430  TISKTEVNAK------AtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYES  591
            T++K+EV +K      A+S +      T T+ REKKVYSLPGQK D PE++EPLR+FYES
Sbjct  53   TVTKSEVKSKPVTTSSASSKTITKTTTTKTKVREKKVYSLPGQKHDPPEQKEPLRIFYES  112

Query  592  LSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQ  771
            LSKQIP+SEMAEFWLMEHGLL P+KAKKAFEK+QRKQK+LRTGTP+K    P    +S++
Sbjct  113  LSKQIPTSEMAEFWLMEHGLLSPEKAKKAFEKRQRKQKELRTGTPVKLSKPPTKTATSQK  172

Query  772  PQQVSKNGDIKAKKRL-NNdsdddddFILSPKRRK  873
             QQVSKNGDIKAKKR+ N   DDDDDFILS KRRK
Sbjct  173  QQQVSKNGDIKAKKRIVNESDDDDDDFILSHKRRK  207



>ref|XP_002283869.1| PREDICTED: uncharacterized protein LOC100262893 [Vitis vinifera]
 emb|CBI20854.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y+LPGQK D PEEREPLR+FYESLSKQIPSSEMAEFW+MEHGLL P+KAKKA+EKKQR+Q
Sbjct  77   YTLPGQKHDPPEEREPLRIFYESLSKQIPSSEMAEFWMMEHGLLSPEKAKKAYEKKQRRQ  136

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            KQ+R GTP+KSP  P    SS++PQQ SKNGDIKAKKR+ NDSDDDDDFILSPK+RK 
Sbjct  137  KQIRMGTPVKSPKPPSRPESSQRPQQTSKNGDIKAKKRITNDSDDDDDFILSPKKRKA  194



>ref|NP_001242254.1| uncharacterized protein LOC100786782 [Glycine max]
 gb|ACU17731.1| unknown [Glycine max]
Length=198

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 162/208 (78%), Gaps = 14/208 (7%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---TI  435
            MAT T  S V++K S  DG     SK + DSS+ V KK  VE SS K   D+K K   T+
Sbjct  1    MATETIRSSVKLKSSAPDGP----SKGKIDSSA-VRKK--VE-SSSKLPADSKMKSVSTV  52

Query  436  SKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +K+EV +K+TSS SKTV KT T+ REKKVYSLPGQK D PE++EPLR+FYESLSKQIP+S
Sbjct  53   TKSEVKSKSTSSPSKTVTKTTTKVREKKVYSLPGQKHDPPEQKEPLRVFYESLSKQIPTS  112

Query  616  EMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVS-VGSSKQPQQVSKN  792
            EMAEFWLMEHGLL P++AK+AFEKKQRKQKQLRTGTP+K P++P +   +S++ QQ SKN
Sbjct  113  EMAEFWLMEHGLLSPERAKRAFEKKQRKQKQLRTGTPVK-PSKPATKTETSQKQQQTSKN  171

Query  793  GDIKAKKRLNNdsdddddFILSPKRRKG  876
            GDIKAKKR+   SDDDDDFILS KRRKG
Sbjct  172  GDIKAKKRIVE-SDDDDDFILSHKRRKG  198



>ref|XP_003545610.1| PREDICTED: uncharacterized protein DDB_G0284459-like isoform 
X1 [Glycine max]
 gb|KHN15833.1| hypothetical protein glysoja_045731 [Glycine soja]
Length=199

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 162/208 (78%), Gaps = 13/208 (6%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---TI  435
            MAT TKSS V++K    DGS    SK + DSS+ V KK  VE SS K   D+K K   T+
Sbjct  1    MATETKSSTVKLKSRAPDGS----SKGKIDSSA-VRKK--VE-SSSKLPADSKMKSVSTV  52

Query  436  SKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +K+EV +K+TSSSSKTV +T T+ REKKVYSLPGQK D PE++EPLR+FYESLSKQIP+S
Sbjct  53   TKSEVKSKSTSSSSKTVTQTTTKAREKKVYSLPGQKHDPPEQKEPLRVFYESLSKQIPTS  112

Query  616  EMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRP-VSVGSSKQPQQVSKN  792
            EMAEFWLMEHGLL P++AK+AFEKKQRKQKQLRTGTP+KS  +P     +S++ QQ SKN
Sbjct  113  EMAEFWLMEHGLLSPERAKRAFEKKQRKQKQLRTGTPVKSSRQPETKTETSQKQQQTSKN  172

Query  793  GDIKAKKRLNNdsdddddFILSPKRRKG  876
            GDIKAKKR+   SDDDDDFILS KRRK 
Sbjct  173  GDIKAKKRIVE-SDDDDDFILSHKRRKA  199



>ref|XP_011081788.1| PREDICTED: uncharacterized protein LOC105164743 [Sesamum indicum]
 ref|XP_011081789.1| PREDICTED: uncharacterized protein LOC105164743 [Sesamum indicum]
Length=205

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 147/214 (69%), Gaps = 21/214 (10%)
 Frame = +1

Query  265  MATNTKSS-VVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKG-----  426
            MA +TKSS +++ KPS   G +S  SKP+ DSS+S   K+ VE S    + DAK      
Sbjct  1    MAADTKSSNLMKSKPSTAGGLSS--SKPKIDSSAS--NKKAVEGSIKNSAADAKNGSSSN  56

Query  427  --KTISKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSK  600
              KTI KT   +KA + +    ++          YSLPGQK+DVPEEREPLRLFYESLSK
Sbjct  57   ASKTIKKTSSQSKADTKTVPKTREKKV-------YSLPGQKYDVPEEREPLRLFYESLSK  109

Query  601  QIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGT--PIKSPTRPVSVGSSKQP  774
            QIPSSEMAEFWLMEHGLL  +KAKKA+EKKQRKQKQLRTGT      P+      SS++P
Sbjct  110  QIPSSEMAEFWLMEHGLLSLEKAKKAYEKKQRKQKQLRTGTPIKSPPPSTSSRPESSRKP  169

Query  775  QQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            Q V KNG+ KAKKR+ NDSDDDDDF+LS KRRKG
Sbjct  170  QPVPKNGEPKAKKRITNDSDDDDDFVLSHKRRKG  203



>gb|KDP34149.1| hypothetical protein JCGZ_07720 [Jatropha curcas]
Length=188

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 155/204 (76%), Gaps = 18/204 (9%)
 Frame = +1

Query  265  MATNTKSSVVRVKPS-GGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTISK  441
            MAT +K +V +VK S   DGS    SK + DSS    K + +E SS+K+ V     T++K
Sbjct  1    MATESKQTVAKVKSSIHQDGS----SKIKVDSS---LKNKKIE-SSNKKPVS----TVTK  48

Query  442  TEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSEM  621
            TEV +K  S++SKT  KT TR REKKVYSLPGQK+D PEEREPLR+FYESLSKQIPSSEM
Sbjct  49   TEVKSKTASTTSKTTTKTTTRVREKKVYSLPGQKYDPPEEREPLRIFYESLSKQIPSSEM  108

Query  622  AEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDI  801
            AEFW+MEHGLL P++AKKA+EKKQRKQK  R GTPIKS T+P    SS++ QQ SKNGD+
Sbjct  109  AEFWMMEHGLLSPERAKKAYEKKQRKQKMQRLGTPIKS-TKP---ESSQKQQQASKNGDL  164

Query  802  KAKKRLNNdsdddddFILSPKRRK  873
            K+KKR   + +DDDDF+LSPKRRK
Sbjct  165  KSKKR-IINDNDDDDFVLSPKRRK  187



>ref|XP_007137219.1| hypothetical protein PHAVU_009G109500g [Phaseolus vulgaris]
 gb|ESW09213.1| hypothetical protein PHAVU_009G109500g [Phaseolus vulgaris]
Length=264

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 158/211 (75%), Gaps = 14/211 (7%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKG--KTIS  438
            MAT  KS+++R K SG D    +SSKP+ DS +   KK+ +  S H      K    T++
Sbjct  59   MATEIKSTMMRAKSSGQD----VSSKPKIDSLA--LKKKVISSSKHTPVSKMKSVTTTVT  112

Query  439  KTEVNAKAtssssktv----kktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQI  606
            K+EV +K T++SS +     KKT ++ REKKVYSLPGQK D PE++EPLR+FYESLSKQI
Sbjct  113  KSEVKSKPTTTSSASSKTIIKKTTSKVREKKVYSLPGQKHDPPEQKEPLRIFYESLSKQI  172

Query  607  PSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIK-SPTRPVSVGSSKQPQQ-  780
            P+SEMAEFWLMEHGLL P+KAKKAFEKKQRKQK+LRTGTP+K S   P +  S KQ QQ 
Sbjct  173  PTSEMAEFWLMEHGLLSPEKAKKAFEKKQRKQKELRTGTPVKISKPPPKTATSQKQQQQP  232

Query  781  VSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            +SKNGDIKAKKR+ N+SDDDDDFILS KRRK
Sbjct  233  ISKNGDIKAKKRIVNESDDDDDFILSHKRRK  263



>gb|ACU23417.1| unknown [Glycine max]
Length=208

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 152/215 (71%), Gaps = 20/215 (9%)
 Frame = +1

Query  265  MATNTKSSVVR-VKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK----  429
            MAT TKS++V+ VK    D    +SSKP+ DS + + KK    I   K   D+K K    
Sbjct  1    MATYTKSTMVKGVKSIAQD----VSSKPKIDSLA-LKKKLNTSI---KHPPDSKLKFVTN  52

Query  430  TISKTEVNAK------AtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYES  591
            T++K+EV +K      A+S +      T T+ REKKVYSLPGQK D PE++EPLR+FYES
Sbjct  53   TVTKSEVKSKPVTTSSASSKTITKTTTTKTKVREKKVYSLPGQKHDPPEQKEPLRIFYES  112

Query  592  LSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQ  771
            LSKQIP+S+MAEFWLMEHGL  P+KAKKAFEK+QRKQK+LRTGTP+K    P    +S++
Sbjct  113  LSKQIPTSDMAEFWLMEHGLQSPEKAKKAFEKRQRKQKELRTGTPVKLSKPPTKTATSQK  172

Query  772  PQQVSKNGDIKAKKRL-NNdsdddddFILSPKRRK  873
             QQVSKNGDIKAKKR+ N   DDDDDFILS KRRK
Sbjct  173  QQQVSKNGDIKAKKRIVNESDDDDDDFILSHKRRK  207



>gb|AFK34002.1| unknown [Medicago truncatula]
Length=223

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 164/226 (73%), Gaps = 32/226 (14%)
 Frame = +1

Query  277  TKSSVVRVKPSGGDGSTSLSSKPRF-DSSSSVTKKRTVEISSHKQSVDAKGK------TI  435
            TKS++V++KP+  +    + SKP+  DS+SS+ KK  +  SS K   D+K K      T+
Sbjct  4    TKSTMVKIKPNPQN----VPSKPKITDSNSSLNKK--LNTSSTKHPPDSKMKSVTTNTTV  57

Query  436  SKTEVNAKAtssssktvkktvtrt-------------rekkvYSLPGQKFDVPEEREPLR  576
            +K+EV +K T++ S +  KT+++T             RE+KVYSLPGQK D PEEREPLR
Sbjct  58   TKSEVKSKPTTTMSASSSKTISKTKTKTKTKTTTTKVRERKVYSLPGQKHDPPEEREPLR  117

Query  577  LFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVS-  753
            +FYESLSKQIP+SEMAEFWLMEHGLL P KAKKAFEKKQRKQK+LRTGTPIKS ++P S 
Sbjct  118  IFYESLSKQIPTSEMAEFWLMEHGLLSPQKAKKAFEKKQRKQKELRTGTPIKSSSKPPSR  177

Query  754  VGSSKQPQQVSKNGDIKAKKRL-----NNdsdddddFILSPKRRKG  876
             G+S++PQ  S NGDIKAK+++     ++D DDDDDFILS KRRKG
Sbjct  178  TGTSQKPQPKSNNGDIKAKRKIDTDSHDDDDDDDDDFILSHKRRKG  223



>ref|XP_010102389.1| hypothetical protein L484_010701 [Morus notabilis]
 gb|EXB93374.1| hypothetical protein L484_010701 [Morus notabilis]
Length=213

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 154/224 (69%), Gaps = 31/224 (14%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKG----KT  432
            MAT TK++VV++KPS   GS    SK + DSS+    K+ +E SS KQ  D+       T
Sbjct  1    MATETKTAVVKLKPSNLSGS----SKGKLDSSAI---KKKIE-SSSKQITDSSRPKFVST  52

Query  433  ISKTEV--NAKAtssssk-------------tvkktvtrtrekkvYSLPGQKFDVPEERE  567
            I K+E+  N K  S ++              T K + T+ ++KKVY+LPGQK+D PEERE
Sbjct  53   IVKSEIAENVKVKSKTTSGSSKAATTTTTTKTTKTSTTKVKQKKVYTLPGQKYDPPEERE  112

Query  568  PLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRP  747
            PLR+FYESLSKQIP+SEMAEFW+MEHGLL P+KAKKA+E+KQRKQKQ+R GTPIK P +P
Sbjct  113  PLRIFYESLSKQIPTSEMAEFWMMEHGLLSPEKAKKAYERKQRKQKQIRMGTPIK-PLKP  171

Query  748  VSVGSSKQPQ-QVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
             S   S Q Q Q SKNGD+K K+R+ N  D DDDFILSPKRRK 
Sbjct  172  PSKPESSQKQLQASKNGDVKVKRRIVN--DSDDDFILSPKRRKA  213



>gb|KHN06668.1| hypothetical protein glysoja_046606 [Glycine soja]
Length=198

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 164/208 (79%), Gaps = 14/208 (7%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---TI  435
            MAT T  S V++K S  DGS    SK + DSS+ V KK  VE SS K   D+K K   T+
Sbjct  1    MATETIRSSVKLKSSAPDGS----SKGKIDSSA-VRKK--VE-SSSKLPADSKMKSVSTV  52

Query  436  SKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +K+EV +K+TSSSSKTV KT T+ REKKVYSLPGQK D PE++EPLR+FYESLSKQIP+S
Sbjct  53   TKSEVKSKSTSSSSKTVTKTTTKVREKKVYSLPGQKHDPPEQKEPLRVFYESLSKQIPTS  112

Query  616  EMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVS-VGSSKQPQQVSKN  792
            EMAEFWLMEHGLL P++AK+AFEKKQRKQKQLRTGTP+K P++P +   +S++ QQ SKN
Sbjct  113  EMAEFWLMEHGLLSPERAKRAFEKKQRKQKQLRTGTPVK-PSKPATKTETSQKQQQTSKN  171

Query  793  GDIKAKKRLNNdsdddddFILSPKRRKG  876
            GDIKAKKR+   SDDDDDFILS KRRKG
Sbjct  172  GDIKAKKRIVE-SDDDDDFILSHKRRKG  198



>ref|XP_003526489.1| PREDICTED: uncharacterized protein LOC100527341 [Glycine max]
 gb|ACU16415.1| unknown [Glycine max]
 gb|KHN18170.1| hypothetical protein glysoja_025060 [Glycine soja]
Length=207

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 154/214 (72%), Gaps = 19/214 (9%)
 Frame = +1

Query  265  MATNTKSSVVR-VKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEI----SSHKQSVDAKGK  429
            MAT TKS++V+ VK S  D    +SSKP+ DS + + KK    I     S+ +SV     
Sbjct  1    MATYTKSTIVKGVKSSAQD----VSSKPKIDSLA-LKKKLNTSIKRPPDSNLKSVTT---  52

Query  430  TISKTEVNAK------AtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYES  591
            T++K+EV +K      A+S +  T   T T+ REKKVYSLPGQK D PE++EPLR+FYES
Sbjct  53   TVTKSEVKSKPVTASSASSKTITTTTTTKTKVREKKVYSLPGQKHDPPEQKEPLRIFYES  112

Query  592  LSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQ  771
            LSKQ+P+SEMAEFWLMEHGLL P+KAKKAFEKKQRKQK+LRTGTP+K    P     S++
Sbjct  113  LSKQMPTSEMAEFWLMEHGLLSPEKAKKAFEKKQRKQKELRTGTPVKVSKPPTKTAMSQK  172

Query  772  PQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
             QQVSKN DIKA KR+ ++SDDDDDF+LS KRRK
Sbjct  173  QQQVSKNSDIKANKRIVDESDDDDDFVLSHKRRK  206



>gb|KEH36062.1| hypothetical protein MTR_3g110202 [Medicago truncatula]
Length=223

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 164/226 (73%), Gaps = 32/226 (14%)
 Frame = +1

Query  277  TKSSVVRVKPSGGDGSTSLSSKPRF-DSSSSVTKKRTVEISSHKQSVDAKGK------TI  435
            TKS++V++KP+  +    + SKP+  DS+SS+ KK  +  SS K   D+K K      T+
Sbjct  4    TKSTMVKIKPNPQN----VPSKPKITDSNSSLNKK--LNTSSTKHPPDSKMKSVTTNTTV  57

Query  436  SKTEVNAKAtssssktvkktvtrtr-------------ekkvYSLPGQKFDVPEEREPLR  576
            +K+EV +K T++ S +  KT+++T+             E+KVYSLPGQK D PEE+EPLR
Sbjct  58   TKSEVKSKPTTTMSASSSKTISKTKTKTKTKTTTTKVRERKVYSLPGQKHDPPEEKEPLR  117

Query  577  LFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVS-  753
            +FYESLSKQIP+SEMAEFWLMEHGLL P KAKKAFEKKQRKQK+LRTGTPIKS ++P S 
Sbjct  118  IFYESLSKQIPTSEMAEFWLMEHGLLSPQKAKKAFEKKQRKQKELRTGTPIKSSSKPPSK  177

Query  754  VGSSKQPQQVSKNGDIKAKKRL-----NNdsdddddFILSPKRRKG  876
             G+S++PQ  S NGDIKAK+++     ++D DDDDDFILS KRRKG
Sbjct  178  TGTSQKPQPKSNNGDIKAKRKIDTDSHDDDDDDDDDFILSHKRRKG  223



>ref|XP_011004729.1| PREDICTED: uncharacterized protein LOC105111150 isoform X3 [Populus 
euphratica]
Length=208

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 152/216 (70%), Gaps = 23/216 (11%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGG--DGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTIS  438
            MAT +K SVV+VKPS G  DGS     K + +SS    K  +      +  VD+K K+IS
Sbjct  1    MATESKQSVVKVKPSSGNFDGS-----KGKIESSMKAKKIESSNTQQQQSVVDSKDKSIS  55

Query  439  ---KTEVNAKAtssssktvkktvtrtrekkv-YSLPGQKFDVPEEREPLRLFYESLSKQI  606
               +TEV +K+  SSSKT   T T    +K  YSLPGQ++D PEEREPLR+FYESLSKQI
Sbjct  56   VVTQTEVKSKSAPSSSKTTTTTTTTRVRQKKVYSLPGQRYDPPEEREPLRIFYESLSKQI  115

Query  607  PSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQ---  777
            P+SEMAEFW+MEHGLL P++AKKA+EKKQRKQK  R GTPIKS T+P    S+ +P+   
Sbjct  116  PTSEMAEFWMMEHGLLSPERAKKAYEKKQRKQKMQRFGTPIKS-TKP----STSKPESSQ  170

Query  778  ---QVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
               Q SKNGD+KAK++++N   DDDDFILSPKRRKG
Sbjct  171  KQQQSSKNGDLKAKRKISN-DSDDDDFILSPKRRKG  205



>ref|XP_011004730.1| PREDICTED: uncharacterized protein LOC105111150 isoform X4 [Populus 
euphratica]
Length=205

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 152/216 (70%), Gaps = 23/216 (11%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGG--DGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTIS  438
            MAT +K SVV+VKPS G  DGS     K + +SS    K  +      +  VD+K K+IS
Sbjct  1    MATESKQSVVKVKPSSGNFDGS-----KGKIESSMKAKKIESSNTQQQQSVVDSKDKSIS  55

Query  439  ---KTEVNAKAtssssktvkktvtrtrekkv-YSLPGQKFDVPEEREPLRLFYESLSKQI  606
               +TEV +K+  SSSKT   T T    +K  YSLPGQ++D PEEREPLR+FYESLSKQI
Sbjct  56   VVTQTEVKSKSAPSSSKTTTTTTTTRVRQKKVYSLPGQRYDPPEEREPLRIFYESLSKQI  115

Query  607  PSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQ---  777
            P+SEMAEFW+MEHGLL P++AKKA+EKKQRKQK  R GTPIKS T+P    S+ +P+   
Sbjct  116  PTSEMAEFWMMEHGLLSPERAKKAYEKKQRKQKMQRFGTPIKS-TKP----STSKPESSQ  170

Query  778  ---QVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
               Q SKNGD+KAK++++N   DDDDFILSPKRRKG
Sbjct  171  KQQQSSKNGDLKAKRKISN-DSDDDDFILSPKRRKG  205



>ref|XP_009367459.1| PREDICTED: uncharacterized protein LOC103957097 [Pyrus x bretschneideri]
Length=200

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 137/176 (78%), Gaps = 5/176 (3%)
 Frame = +1

Query  364  SVTKKRTVEISSHKQSVDAKGK---TISKTEVNAKAtssssktvkktvtrtrekkvYSLP  534
            SVTKK+    SS +Q  D+K K   T++KTEV +K  S S    KKT T+ REKKVY+L 
Sbjct  25   SVTKKKIESSSSKQQVADSKQKSVQTVTKTEVKSKLNSVSKTITKKTTTKVREKKVYTLA  84

Query  535  GQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLR  714
            GQKFD PEEREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++++KA+EKKQ KQKQLR
Sbjct  85   GQKFDPPEEREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERSRKAYEKKQGKQKQLR  144

Query  715  TGTPIKS-PTRPVSVGSSKQPQ-QVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
             GTPIKS P  P    SS++PQ Q SKNGD+KA KR+  +SDDDDDFILSPKRR+ 
Sbjct  145  LGTPIKSTPKPPSKPESSQRPQLQASKNGDVKAMKRVIKESDDDDDFILSPKRRRA  200



>ref|XP_011004728.1| PREDICTED: uncharacterized protein LOC105111150 isoform X2 [Populus 
euphratica]
Length=224

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 159/235 (68%), Gaps = 31/235 (13%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGG--DGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTIS  438
            MAT +K SVV+VKPS G  DGS     K + +SS    K  +      +  VD+K K+IS
Sbjct  1    MATESKQSVVKVKPSSGNFDGS-----KGKIESSMKAKKIESSNTQQQQSVVDSKDKSIS  55

Query  439  ---KTEVNAKAtssssktvkktvtrtrekkv-YSLPGQKFDVPEEREPLRLFYESLSKQI  606
               +TEV +K+  SSSKT   T T    +K  YSLPGQ++D PEEREPLR+FYESLSKQI
Sbjct  56   VVTQTEVKSKSAPSSSKTTTTTTTTRVRQKKVYSLPGQRYDPPEEREPLRIFYESLSKQI  115

Query  607  PSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQ---  777
            P+SEMAEFW+MEHGLL P++AKKA+EKKQRKQK  R GTPIKS T+P    S+ +P+   
Sbjct  116  PTSEMAEFWMMEHGLLSPERAKKAYEKKQRKQKMQRFGTPIKS-TKP----STSKPESSQ  170

Query  778  ---QVSKNGDIKAKKRLNNdsdddddFILSPKRRKG*EEMPLKL*F*RNCTPQII  933
               Q SKNGD+KAK++++N   DDDDFILSPKRRKG E +         C P+++
Sbjct  171  KQQQSSKNGDLKAKRKISN-DSDDDDFILSPKRRKGIEGL--------ICRPKVL  216



>ref|XP_011004727.1| PREDICTED: uncharacterized protein LOC105111150 isoform X1 [Populus 
euphratica]
Length=266

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 152/216 (70%), Gaps = 23/216 (11%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGG--DGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTIS  438
            MAT +K SVV+VKPS G  DGS     K + +SS    K  +      +  VD+K K+IS
Sbjct  1    MATESKQSVVKVKPSSGNFDGS-----KGKIESSMKAKKIESSNTQQQQSVVDSKDKSIS  55

Query  439  ---KTEVNAKAtssssktvkktvtrtrekkv-YSLPGQKFDVPEEREPLRLFYESLSKQI  606
               +TEV +K+  SSSKT   T T    +K  YSLPGQ++D PEEREPLR+FYESLSKQI
Sbjct  56   VVTQTEVKSKSAPSSSKTTTTTTTTRVRQKKVYSLPGQRYDPPEEREPLRIFYESLSKQI  115

Query  607  PSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQ---  777
            P+SEMAEFW+MEHGLL P++AKKA+EKKQRKQK  R GTPIKS T+P    S+ +P+   
Sbjct  116  PTSEMAEFWMMEHGLLSPERAKKAYEKKQRKQKMQRFGTPIKS-TKP----STSKPESSQ  170

Query  778  ---QVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
               Q SKNGD+KAK++++N   DDDDFILSPKRRKG
Sbjct  171  KQQQSSKNGDLKAKRKISN-DSDDDDFILSPKRRKG  205



>ref|XP_008393871.1| PREDICTED: uncharacterized protein LOC103456025 [Malus domestica]
Length=200

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 137/176 (78%), Gaps = 5/176 (3%)
 Frame = +1

Query  364  SVTKKRTVEISSHKQSVDAKGK---TISKTEVNAKAtssssktvkktvtrtrekkvYSLP  534
            SVTKK+    SS +Q+ D + K   T++KTEV +   S S    KKT T+ REKKVY+L 
Sbjct  25   SVTKKKIESSSSKQQAADFRQKSVQTVTKTEVKSNLNSVSKTITKKTTTKVREKKVYTLA  84

Query  535  GQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLR  714
            GQKFD PEEREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++++KA+EKKQRKQKQLR
Sbjct  85   GQKFDPPEEREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERSRKAYEKKQRKQKQLR  144

Query  715  TGTPIKS-PTRPVSVGSSKQP-QQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
             GTPIKS P  P    SS++P QQ SKNGD+KA KR+  +SDDDDDFILSPKRR+ 
Sbjct  145  LGTPIKSTPKPPSKPESSQRPQQQASKNGDVKAMKRVIKESDDDDDFILSPKRRRA  200



>ref|XP_008357409.1| PREDICTED: uncharacterized protein LOC103421152 [Malus domestica]
Length=199

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 127/162 (78%), Gaps = 5/162 (3%)
 Frame = +1

Query  406  QSVDAKGK---TISKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLR  576
            Q+ D K K   T++KTEV +K  S+S    KKT T+ REKKVY+L GQKFD PEEREPLR
Sbjct  38   QAADYKQKSVQTVTKTEVKSKPNSASKTITKKTTTKVREKKVYTLAGQKFDPPEEREPLR  97

Query  577  LFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSV  756
            +FYESLSKQIP+SEMAEFW+MEHGLL  ++++KA+EKKQRKQKQLR GTP+KS  +P S 
Sbjct  98   IFYESLSKQIPTSEMAEFWMMEHGLLSSERSRKAYEKKQRKQKQLRLGTPLKSTPKPASK  157

Query  757  GSSKQ--PQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
              S Q   QQ SKNGD+KAKKR+  +SDDDDDFILS KRR+ 
Sbjct  158  PESSQRPQQQASKNGDVKAKKRVIKESDDDDDFILSSKRRRA  199



>ref|XP_004501159.1| PREDICTED: DNA topoisomerase 1-like [Cicer arietinum]
Length=215

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 156/220 (71%), Gaps = 26/220 (12%)
 Frame = +1

Query  271  TNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKT---ISK  441
            T TKS+ V++KP+  +      SK +FD+SSS+ KK     SS +   D+K K+   ++K
Sbjct  4    TETKSATVKIKPNPQNAP----SKSKFDNSSSLNKKLG---SSTRNPPDSKMKSATILTK  56

Query  442  TEVNAK--------------AtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRL  579
            +E+ +K               T++  KT   T T+ RE+KVYSLPGQK D PE++EPLR+
Sbjct  57   SEIKSKPTTISSSSSKTISKTTTTKKKTTTTTTTKVRERKVYSLPGQKHDPPEQKEPLRI  116

Query  580  FYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTR-PVSV  756
            FYESLSKQIP+SEMAEFWLMEHGLL P+KAKKAFEKKQRKQK+LRTGTP+K  ++ P   
Sbjct  117  FYESLSKQIPTSEMAEFWLMEHGLLSPEKAKKAFEKKQRKQKELRTGTPVKPSSKPPTKT  176

Query  757  GSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            G+S++ QQ S NGDIKAKKR++N   DDDDFILS KRR+G
Sbjct  177  GTSQKQQQRSNNGDIKAKKRIDN-DSDDDDFILSHKRRRG  215



>ref|XP_002324800.1| hypothetical protein POPTR_0018s00280g [Populus trichocarpa]
 gb|EEF03365.1| hypothetical protein POPTR_0018s00280g [Populus trichocarpa]
Length=205

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 154/219 (70%), Gaps = 29/219 (13%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGG--DGSTSLSSKPRFDSSSSVTKKRTVEISSHKQS---VDAKGK  429
            MAT +K SVV+VKPS    DGS     K + +SS    K + +E S+ +Q    VD+K K
Sbjct  1    MATESKQSVVKVKPSSSNFDGS-----KGKIESS---MKAKKIESSNKQQQQSVVDSKDK  52

Query  430  TIS---KTEVNAKAtssssktvkktvtrtrekkv-YSLPGQKFDVPEEREPLRLFYESLS  597
            +IS   KTEV +K+  SSSKT   T T    +K  YSLPGQ++D PEEREPLR+FYESLS
Sbjct  53   SISVVTKTEVKSKSAPSSSKTTTTTTTTRVRQKKVYSLPGQRYDPPEEREPLRIFYESLS  112

Query  598  KQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQ  777
            KQIP+SEMAEFW+MEHGLL P++AKKA EKKQRKQK  R GTPIKS T+P    S+ +P+
Sbjct  113  KQIPTSEMAEFWMMEHGLLSPERAKKAHEKKQRKQKMQRFGTPIKS-TKP----STSKPE  167

Query  778  ------QVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
                  Q SKNGD+KAK++++N   DDDDFILS KRRKG
Sbjct  168  SSQKQQQSSKNGDLKAKRKISN-DSDDDDFILSSKRRKG  205



>ref|XP_004150287.1| PREDICTED: uncharacterized protein LOC101205851 isoform 1 [Cucumis 
sativus]
Length=271

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 156/215 (73%), Gaps = 5/215 (2%)
 Frame = +1

Query  238  INQLKQLVGMATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQ-SV  414
            +N  K+   M ++ KS++ ++KP GG      SS  +    SS+  K ++  S HK  S+
Sbjct  58   LNHEKKKTIMVSDPKSTLSKLKPDGGSRLKLESSDHKKKIDSSI--KNSIPSSKHKSVSL  115

Query  415  DAKGKTISKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESL  594
              K +  SKT  ++  T++ + T      + REKKV++LPGQK+D PEEREPLR+FYESL
Sbjct  116  VTKAEVKSKTISSSSKTTTKTTTTTTATAKVREKKVFNLPGQKYDPPEEREPLRIFYESL  175

Query  595  SKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPT-RPVSV-GSSK  768
            SKQIP+SEMAEFW+MEHG+L P+KAKKA+EKK R+QK+ RTGTPIKS + +P+S   SS+
Sbjct  176  SKQIPASEMAEFWMMEHGMLSPEKAKKAYEKKLRRQKEQRTGTPIKSASAKPLSRPESSQ  235

Query  769  QPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            +PQ  SKNGDIKAKK++ NDSDDDDDFILSPKRRK
Sbjct  236  RPQPPSKNGDIKAKKKIVNDSDDDDDFILSPKRRK  270



>ref|XP_004150288.1| PREDICTED: uncharacterized protein LOC101205851 isoform 2 [Cucumis 
sativus]
 ref|XP_004168745.1| PREDICTED: uncharacterized LOC101205851 isoform 2 [Cucumis sativus]
 gb|KGN62818.1| hypothetical protein Csa_2G374600 [Cucumis sativus]
Length=205

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQ-SVDAKGKTISK  441
            M ++ KS++ ++KP GG      SS  +    SS+  K ++  S HK  S+  K +  SK
Sbjct  1    MVSDPKSTLSKLKPDGGSRLKLESSDHKKKIDSSI--KNSIPSSKHKSVSLVTKAEVKSK  58

Query  442  TEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSEM  621
            T  ++  T++ + T      + REKKV++LPGQK+D PEEREPLR+FYESLSKQIP+SEM
Sbjct  59   TISSSSKTTTKTTTTTTATAKVREKKVFNLPGQKYDPPEEREPLRIFYESLSKQIPASEM  118

Query  622  AEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPT-RPVSV-GSSKQPQQVSKNG  795
            AEFW+MEHG+L P+KAKKA+EKK R+QK+ RTGTPIKS + +P+S   SS++PQ  SKNG
Sbjct  119  AEFWMMEHGMLSPEKAKKAYEKKLRRQKEQRTGTPIKSASAKPLSRPESSQRPQPPSKNG  178

Query  796  DIKAKKRLNNdsdddddFILSPKRRK  873
            DIKAKK++ NDSDDDDDFILSPKRRK
Sbjct  179  DIKAKKKIVNDSDDDDDFILSPKRRK  204



>ref|XP_008445018.1| PREDICTED: neurofilament heavy polypeptide [Cucumis melo]
Length=205

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQ-SVDAKGKTISK  441
            M ++ KS++ ++KP GG      SS  +    SS+  K ++  S HK  S+  K +  SK
Sbjct  1    MVSDPKSTLSKLKPDGGSRLKLESSDHKKKIDSSI--KNSIPSSKHKSVSLVTKSEVKSK  58

Query  442  TEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSEM  621
            T  ++  T++ + T      + REKK+++LPGQK+D PEEREPLR+FYESLSKQIP+SEM
Sbjct  59   TISSSSKTTTKTTTTTTATAKVREKKIFNLPGQKYDPPEEREPLRIFYESLSKQIPASEM  118

Query  622  AEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPT-RPVSV-GSSKQPQQVSKNG  795
            AEFW+MEHG+L P+KAKKA+EKK R+QK+ RTGTPIKS + +P+S   SS++PQ  SKNG
Sbjct  119  AEFWMMEHGMLSPEKAKKAYEKKLRRQKEQRTGTPIKSASAKPLSRPESSQRPQPPSKNG  178

Query  796  DIKAKKRLNNdsdddddFILSPKRRK  873
            DIKAKK++ NDSDDDDDFILSPKRRK
Sbjct  179  DIKAKKKIMNDSDDDDDFILSPKRRK  204



>ref|XP_004168744.1| PREDICTED: uncharacterized LOC101205851 isoform 1 [Cucumis sativus]
Length=270

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 157/215 (73%), Gaps = 6/215 (3%)
 Frame = +1

Query  238  INQLKQLVGMATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQ-SV  414
            +N  K+ + M ++ KS++ ++KP GG      SS  +    SS+  K ++  S HK  S+
Sbjct  58   LNHEKKTI-MVSDPKSTLSKLKPDGGSRLKLESSDHKKKIDSSI--KNSIPSSKHKSVSL  114

Query  415  DAKGKTISKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESL  594
              K +  SKT  ++  T++ + T      + REKKV++LPGQK+D PEEREPLR+FYESL
Sbjct  115  VTKAEVKSKTISSSSKTTTKTTTTTTATAKVREKKVFNLPGQKYDPPEEREPLRIFYESL  174

Query  595  SKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPT-RPVSV-GSSK  768
            SKQIP+SEMAEFW+MEHG+L P+KAKKA+EKK R+QK+ RTGTPIKS + +P+S   SS+
Sbjct  175  SKQIPASEMAEFWMMEHGMLSPEKAKKAYEKKLRRQKEQRTGTPIKSASAKPLSRPESSQ  234

Query  769  QPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            +PQ  SKNGDIKAKK++ NDSDDDDDFILSPKRRK
Sbjct  235  RPQPPSKNGDIKAKKKIVNDSDDDDDFILSPKRRK  269



>gb|EYU20437.1| hypothetical protein MIMGU_mgv1a013792mg [Erythranthe guttata]
Length=210

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 8/124 (6%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSL GQKFDVPEEREPLR+FYESLSKQIPSSEMAEFWLMEHG+L PD+AKKA+EKKQRKQ
Sbjct  89   YSLAGQKFDVPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGMLSPDRAKKAYEKKQRKQ  148

Query  703  kqLRTGTPIKS-----PTRPVSVGSSKQPQQVSKNGDIKAKKR-LNNdsdddddFILSPK  864
            KQ+R GTPIKS     P +P S  S + P  V KNG++KAKKR +N+  D+DDDF+LS K
Sbjct  149  KQIRMGTPIKSPPPYVPNKPES--SKRAPPPVPKNGEVKAKKRIMNDSDDEDDDFVLSHK  206

Query  865  RRKG  876
            RRKG
Sbjct  207  RRKG  210



>ref|XP_002516501.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45842.1| conserved hypothetical protein [Ricinus communis]
Length=213

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 157/218 (72%), Gaps = 21/218 (10%)
 Frame = +1

Query  265  MATNTKSSVV-RVKPSGG-DGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---  429
            MAT TK SVV RVKPS   DGS+S SS  +  ++ + + K+    +S     D+K K   
Sbjct  1    MATETKQSVVARVKPSNCQDGSSSSSSIKKKINNFNTSSKQQQPPAS-----DSKPKSAS  55

Query  430  TISKTEVNAKAtssssktvkktvtrt----------rekkvYSLPGQKFDVPEEREPLRL  579
            T++KTEV +K T+SSSKT   + ++T          REKKV+SLPGQ++D PEEREPLR+
Sbjct  56   TVTKTEVKSKTTTSSSKTTTTSSSKTTTTTTTKTRVREKKVFSLPGQRYDPPEEREPLRI  115

Query  580  FYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVG  759
            FYESLSKQIPSSEMAEFW+MEHGLL PDKAK+A+EKKQRKQK  R GTP+KS   P    
Sbjct  116  FYESLSKQIPSSEMAEFWMMEHGLLSPDKAKRAYEKKQRKQKMQRMGTPMKSAKPPSKPE  175

Query  760  SSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            SS++ QQ SKNG++K KKR+ +  +DDDDF+LSPKRRK
Sbjct  176  SSQKQQQASKNGELKPKKRIID-DNDDDDFVLSPKRRK  212



>ref|XP_010917830.1| PREDICTED: uncharacterized protein LOC105042355 [Elaeis guineensis]
Length=192

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 3/118 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQK+D PEEREPLR+FYESLSKQIPSSEMAEFW+MEHGLL P++AKKA+E+KQ++Q
Sbjct  78   YSLPGQKYDPPEEREPLRIFYESLSKQIPSSEMAEFWMMEHGLLSPERAKKAYERKQKRQ  137

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            +QLR GTPIKS T+     SSK+P QV KNGD+KAKKR+ N +DDD DFI+  K+ KG
Sbjct  138  QQLRMGTPIKS-TKQERPESSKKP-QVLKNGDVKAKKRV-NYNDDDGDFIVKQKKSKG  192



>ref|XP_004291183.1| PREDICTED: uncharacterized protein LOC101302896 [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 132/197 (67%), Gaps = 36/197 (18%)
 Frame = +1

Query  364  SVTKKRTVEISSHKQSVDAKGK---TISKTEVNAKAtssssktvkktvtrtrekkvYSLP  534
            SVTK + +  SS K   D+K K   T++KTEV +K T+  + T +           +SL 
Sbjct  23   SVTKNK-IGSSSTKPGADSKLKSVQTVTKTEVKSKVTTKRTTTTRVKKV-------FSLA  74

Query  535  GQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLR  714
            GQK+D PEEREPLR+FYESLSKQIPSSEMAEFW+MEHGLL P++++KAFEKKQRKQKQ+R
Sbjct  75   GQKYDPPEEREPLRIFYESLSKQIPSSEMAEFWMMEHGLLSPERSRKAFEKKQRKQKQIR  134

Query  715  TGTPIKSPTRPVSVG-----------------------SSKQPQQVSKNGDIKAKKRLNN  825
            +G PIKSP  P+                          SS++ QQ SKNGD+KAKKR+  
Sbjct  135  SGIPIKSP--PIRSPPLRSPPLRSPPPKPVSKPPSKPESSQRQQQASKNGDVKAKKRVVA  192

Query  826  dsdddddFILSPKRRKG  876
            +SDDDDDFILSPKRR+G
Sbjct  193  ESDDDDDFILSPKRRRG  209



>ref|XP_011019618.1| PREDICTED: uncharacterized protein LOC105122284 [Populus euphratica]
Length=204

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 144/212 (68%), Gaps = 19/212 (9%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQ-SVDAKGKTIS-  438
            MAT +K S V++KP   +   S     R    SS+   R    S  KQ  VD+K K+++ 
Sbjct  1    MATESKQSAVKMKPRSSNFDAS-----RGKIESSMKFMRIDSSSKQKQPVVDSKNKSVTA  55

Query  439  ---KTEVNAKAtssssktvkktvtrtrekkv-YSLPGQKFDVPEEREPLRLFYESLSKQI  606
               KTEV +K+ SSSS+T   T T    +K  +SLPGQ+ D PEEREPLR+FYESLS+QI
Sbjct  56   VAIKTEVKSKSASSSSRTTTTTTTTRVRQKKVFSLPGQRCDPPEEREPLRIFYESLSRQI  115

Query  607  PSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIK----SPTRPVSVGSSKQP  774
            P+SEMAEFW+MEHGLLP ++AKKA E+KQRKQK  R GTPIK    S +RP    SS++ 
Sbjct  116  PTSEMAEFWMMEHGLLPLERAKKAHERKQRKQKMQRLGTPIKSINPSTSRP---KSSQKQ  172

Query  775  QQVSKNGDIKAKKRLNNdsdddddFILSPKRR  870
            QQ+SKNGD+KAK++++    DDDDFILS KR+
Sbjct  173  QQISKNGDLKAKRKIST-DSDDDDFILSHKRK  203



>ref|XP_008220076.1| PREDICTED: myb-like protein V [Prunus mume]
Length=212

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 103/128 (80%), Gaps = 10/128 (8%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y+L GQKFD PEEREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++++KAFEKKQRKQ
Sbjct  85   YTLAGQKFDPPEEREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERSRKAFEKKQRKQ  144

Query  703  kqLRTGTPIKS---PTRPVSVGSSKQPQ-------QVSKNGDIKAKKRLNNdsdddddFI  852
            KQLR GTPIKS   P++P S     +P+       Q SKNGD+K KKR+  +SDDDDDFI
Sbjct  145  KQLRLGTPIKSTKPPSKPESTKPPSKPESSQRQQQQASKNGDVKGKKRVIKESDDDDDFI  204

Query  853  LSPKRRKG  876
            LSPKRR+ 
Sbjct  205  LSPKRRRA  212



>ref|XP_009415223.1| PREDICTED: uncharacterized protein LOC103996114 [Musa acuminata 
subsp. malaccensis]
Length=190

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 6/119 (5%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQK+D PEEREPLR+FYESLS QIPSSEMAE W+MEHGLL P++AKKA+E+KQR+Q
Sbjct  76   YSLPGQKYDPPEEREPLRIFYESLSGQIPSSEMAEIWMMEHGLLSPERAKKAYERKQRRQ  135

Query  703  kqLRTGTPIKS--PTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            +Q R GTPIKS    RP    SSK+P QVSKNGD+KAKKR+N+  DDDDDFI+  K+ K
Sbjct  136  QQQRLGTPIKSNKQERP---ESSKKP-QVSKNGDVKAKKRVNHSDDDDDDFIVKSKKAK  190



>ref|XP_002309545.1| hypothetical protein POPTR_0006s25520g [Populus trichocarpa]
 gb|EEE93068.1| hypothetical protein POPTR_0006s25520g [Populus trichocarpa]
Length=226

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 150/238 (63%), Gaps = 46/238 (19%)
 Frame = +1

Query  265  MATNTKSSVVRVKP--SGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQS--VDAKGKT  432
            MAT +K S V++KP  S  DGS     K + +SS  V +   +EISS ++   VD+K K+
Sbjct  1    MATESKQSAVKMKPRSSIFDGS-----KGKIESSMKVKR---IEISSKQKQPVVDSKNKS  52

Query  433  IS----KTEVN----------------------AKAtssssktvkktvtrtrekkvYSLP  534
            +S    KTEV                          +SSS  T     TR R+KKV+SLP
Sbjct  53   VSAVTIKTEVRELISFWGSTFSGFLMGLVLVKSKSPSSSSRTTTTTKTTRVRQKKVFSLP  112

Query  535  GQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLR  714
            GQ+ D PEEREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++AKKA E+KQRKQK  R
Sbjct  113  GQRCDPPEEREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERAKKAHERKQRKQKMQR  172

Query  715  TGTPIK----SPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
             GTPIK    S +RP    SS+  QQ+SKNGD+KAK++  +   DDDDFILS KR KG
Sbjct  173  LGTPIKSTNPSTSRP---KSSQMQQQISKNGDLKAKRK-ISIDSDDDDFILSHKRSKG  226



>ref|XP_007159786.1| hypothetical protein PHAVU_002G267100g [Phaseolus vulgaris]
 gb|ESW31780.1| hypothetical protein PHAVU_002G267100g [Phaseolus vulgaris]
Length=184

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y L GQK D PE++EPLR+FYESLSKQIP+SEMAEFWLMEHGLL P+ AKKAFEKKQRKQ
Sbjct  68   YILLGQKHDPPEQKEPLRVFYESLSKQIPTSEMAEFWLMEHGLLSPESAKKAFEKKQRKQ  127

Query  703  kqLRTGTPIKSPTRP-VSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            K+LR   P+K P++P     +S++ QQ SKNGDIKAKKR+   SDDDD+FILS KRRKG
Sbjct  128  KELRAAIPVK-PSKPGTKTETSQKQQQASKNGDIKAKKRIVE-SDDDDEFILSHKRRKG  184



>ref|XP_008793089.1| PREDICTED: uncharacterized protein LOC103709498 isoform X1 [Phoenix 
dactylifera]
Length=196

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 7/120 (6%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQK D PEEREPLR+FYESLSKQIPSSEMAE W+MEHGLL P++AKKA+E+KQ++Q
Sbjct  82   YSLPGQKHDPPEEREPLRIFYESLSKQIPSSEMAEVWMMEHGLLSPERAKKAYERKQKRQ  141

Query  703  kqLRTGTPIKSPT--RPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            +QLR GTPIKS T  RP    SSK+P QVSKNG +K KKR+ + SD+DDDFI+  K+ KG
Sbjct  142  QQLRMGTPIKSTTQERP---ESSKKP-QVSKNGVVKTKKRV-DFSDNDDDFIVKHKKSKG  196



>ref|XP_006450685.1| hypothetical protein CICLE_v10009557mg [Citrus clementina]
 gb|ESR63925.1| hypothetical protein CICLE_v10009557mg [Citrus clementina]
Length=159

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 97/108 (90%), Gaps = 3/108 (3%)
 Frame = +1

Query  559  EREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSP  738
            EREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++AKKA+EKKQRKQKQ+R GTP KSP
Sbjct  53   EREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERAKKAYEKKQRKQKQVRMGTPNKSP  112

Query  739  TRPVSVG--SSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
              P+S    SS++ QQ SKNGDIKAK+R++ND+DDDDDFILSPKRRKG
Sbjct  113  -HPLSNKPESSQKQQQGSKNGDIKAKRRVSNDADDDDDFILSPKRRKG  159



>ref|XP_007223948.1| hypothetical protein PRUPE_ppa011151mg [Prunus persica]
 gb|EMJ25147.1| hypothetical protein PRUPE_ppa011151mg [Prunus persica]
Length=221

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 102/137 (74%), Gaps = 19/137 (14%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y+L GQKFD PEEREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++++KAFEKKQRKQ
Sbjct  85   YTLAGQKFDPPEEREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERSRKAFEKKQRKQ  144

Query  703  kqLRTGTPIKS---PTRPVSVGSSKQPQQV----------------SKNGDIKAKKRLNN  825
            KQLR GTPIKS   P++P S     +P+                  SKNGD+K KKR+  
Sbjct  145  KQLRLGTPIKSTKPPSKPESTKPPSKPESTKPPSKPESSQRQQQQASKNGDVKGKKRVIK  204

Query  826  dsdddddFILSPKRRKG  876
            +SDDDDDFILSPKRR+ 
Sbjct  205  ESDDDDDFILSPKRRRA  221



>ref|XP_010668358.1| PREDICTED: uncharacterized protein LOC104885354 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=192

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 129/201 (64%), Gaps = 16/201 (8%)
 Frame = +1

Query  283  SSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTI----SKTEV  450
            SS V+VKP   + +T  SSKP       + KK+   I+ H  + D K K+I    +K+E 
Sbjct  3    SSAVKVKPINRNQATPSSSKP-------ILKKKIEIINKHPSASDTKNKSIPVKSAKSEE  55

Query  451  NAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEF  630
              K    ++          REKKVYSL GQK+D PEEREPLR+FYESLSKQIP+SEMAEF
Sbjct  56   KGK---KAAPATPVKKATKREKKVYSLAGQKYDPPEEREPLRIFYESLSKQIPTSEMAEF  112

Query  631  WLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAK  810
            WLMEHGLL  +KAKKA E+KQRKQKQ + GTPIKSP       SS + + VSKNG++K K
Sbjct  113  WLMEHGLLSSEKAKKAHERKQRKQKQQKMGTPIKSPPSYSKPESSNRQKLVSKNGNLKVK  172

Query  811  KRLNNdsdddddFILSPKRRK  873
            KR     D DD+ I  PKRRK
Sbjct  173  KRF--VEDSDDEVIGIPKRRK  191



>ref|XP_010049107.1| PREDICTED: uncharacterized protein LOC104437779 [Eucalyptus grandis]
Length=189

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 125/174 (72%), Gaps = 14/174 (8%)
 Frame = +1

Query  379  RTVEISSHKQSVDAKGK---TISKTEVNAKAt------ssssktvkktvtrtrekkvYSL  531
            R +E SS + SV  K +    + KTEV +KA        + + T   T T+ REKKV++L
Sbjct  20   RKMESSSSRDSVAPKHRPASAVVKTEVKSKAMPSSSKTVARTTTTTTTATKVREKKVFNL  79

Query  532  PGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqL  711
            PGQK D PEEREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++AK+A+EKKQ+KQKQ+
Sbjct  80   PGQKHDPPEEREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERAKRAYEKKQKKQKQM  139

Query  712  RTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            RTGTP+KS   P S   S Q QQ SKNGD++A KR+  DS+D+    LS KRRK
Sbjct  140  RTGTPVKSSYTP-SKPESSQKQQASKNGDLRANKRIIQDSNDN----LSHKRRK  188



>ref|NP_001143557.1| uncharacterized protein LOC100276253 [Zea mays]
 gb|ACG33072.1| hypothetical protein [Zea mays]
Length=178

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 6/120 (5%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFWLMEHG+L P++A+KA+E+KQ++Q
Sbjct  63   YSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGMLSPERARKAYERKQKRQ  122

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNG--DIKAKKRLNNdsdddddFILSPKRRKG  876
            +Q+R GTPIKS     +V    +P+   K G  D KAK+R++   DDDDDFI+  KR +G
Sbjct  123  QQVRMGTPIKS----CAVRKDNKPESSKKPGIMDSKAKRRVDYSDDDDDDFIVKMKRSRG  178



>ref|XP_010519888.1| PREDICTED: uncharacterized protein LOC104799194 [Tarenaya hassleriana]
Length=215

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQK+DVPEEREPLR+FYESLSKQIP SEMAEFWLMEHG+L P++AK+A+EKKQRKQ
Sbjct  99   YSLPGQKYDVPEEREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSPERAKRAYEKKQRKQ  158

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSK-NGDIKAKKRLNNdsdddddFILSPKRRK  873
            KQ+R GTPIK P    S         VSK N D + KK+L    DDDDDFILSPKRRK
Sbjct  159  KQIRMGTPIKPPPTSSSKPGISHKTSVSKSNLDARTKKKL--IVDDDDDFILSPKRRK  214



>gb|AFK44954.1| unknown [Lotus japonicus]
Length=243

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 160/245 (65%), Gaps = 45/245 (18%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSS----------------------SVTK-  375
            MAT +K + V++K S     ++  SKP+FDSS+                      +VTK 
Sbjct  1    MATESKITAVKLKSSAQQHVSA--SKPKFDSSALKKKIDSTSTRNPPDSKVKSVTTVTKS  58

Query  376  ----KRTVEISSHKQSVDAKGK----TISKTEVNAKAtssssktvkktvtrtr--ekkvY  525
                K     +  K + D+K K    T++K+EV +KAT+SSSKT+ K  T T+  E+KVY
Sbjct  59   PNDSKMKSVTAVTKSTTDSKIKSATTTVTKSEVKSKATASSSKTITKKTTTTKVRERKVY  118

Query  526  SLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqk  705
            +LPGQK D PE++EPLR+FYESLSKQIP+SEMAEFWLMEHGLL PDKAKKAFEKKQRKQK
Sbjct  119  NLPGQKHDPPEQKEPLRVFYESLSKQIPTSEMAEFWLMEHGLLSPDKAKKAFEKKQRKQK  178

Query  706  qLRT-GTPIKSPTRPVSVGSS-------KQPQQVSKNGDIKAKKRL-NNdsdddddFILS  858
             L T GTP+KS ++P +   +       KQ  Q SKNGDIKAKK++ +   DDDDDFILS
Sbjct  179  GLWTGGTPVKS-SKPSTSTKTKTETLVRKQLPQGSKNGDIKAKKKIVSESDDDDDDFILS  237

Query  859  PKRRK  873
             KRRK
Sbjct  238  HKRRK  242



>ref|XP_009410913.1| PREDICTED: uncharacterized protein LOC103992792 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410915.1| PREDICTED: uncharacterized protein LOC103992792 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 86/102 (84%), Gaps = 6/102 (6%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y+LPGQK+D+PEEREPLR+FYESLSKQIPSSEMAEFW+MEHGLL P++AKKA+E+KQ++Q
Sbjct  72   YALPGQKYDIPEEREPLRIFYESLSKQIPSSEMAEFWMMEHGLLSPERAKKAYERKQKRQ  131

Query  703  kqLRTGTPIKSPT--RPVSVGSSKQPQQVSKNGDIKAKKRLN  822
            +QLRTGTPIKS    RP   GSSK   Q S+N    ++KR+N
Sbjct  132  QQLRTGTPIKSSKQDRP---GSSKS-LQASRNEGFTSRKRIN  169



>gb|KCW81568.1| hypothetical protein EUGRSUZ_C02926 [Eucalyptus grandis]
Length=245

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 5/117 (4%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            ++LPGQK D PEEREPLR+FYESLSKQIP+SEMAEFW+MEHGLL P++AK+A+EKKQ+KQ
Sbjct  133  FNLPGQKHDPPEEREPLRIFYESLSKQIPTSEMAEFWMMEHGLLSPERAKRAYEKKQKKQ  192

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            KQ+RTGTP+KS   P S   S Q QQ SKNGD++A KR+  DS+D+    LS KRRK
Sbjct  193  KQMRTGTPVKSSYTP-SKPESSQKQQASKNGDLRANKRIIQDSNDN----LSHKRRK  244



>ref|XP_010249580.1| PREDICTED: uncharacterized protein LOC104592097 isoform X1 [Nelumbo 
nucifera]
Length=202

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 139/209 (67%), Gaps = 19/209 (9%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---TI  435
            MAT  K  V++ KP   DGS+      +    S + KK+ V  SS K + D+K K   T+
Sbjct  1    MATEIKVHVLKAKP-NQDGSS------KVKGLSPLNKKKVV--SSSKHTPDSKQKSVSTL  51

Query  436  SKTEVNAKAtssssktvkktvtrtrekkv-----YSLPGQKFDVPEEREPLRLFYESLSK  600
            +K+EV AK TS++S + K     T  K       Y+LPGQK+D PE REPLR+FYESLSK
Sbjct  52   TKSEVKAKTTSTTSSSSKSVSKTTAVKVKSKKKVYTLPGQKYDPPEVREPLRIFYESLSK  111

Query  601  QIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQ  780
            QIPSSEMAEFW+MEHGLL P++AKKA+E+KQR+Q+QLR GTPIKS        S KQ + 
Sbjct  112  QIPSSEMAEFWMMEHGLLSPERAKKAYERKQRRQQQLRMGTPIKSLKLDKPESSQKQ-KH  170

Query  781  VSKNGDIKAKKRLNNdsdddddFILSPKR  867
             SKN D+K KKR+ N  +DDDDFI+ PK+
Sbjct  171  ASKNSDLKTKKRIIN-ENDDDDFIVRPKK  198



>gb|AAV59389.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAW57795.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG98327.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79805.1| hypothetical protein OsI_21244 [Oryza sativa Indica Group]
 gb|EEE69762.1| hypothetical protein OsJ_29468 [Oryza sativa Japonica Group]
Length=164

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFWLMEHGLL P++AKKA+EKKQ++Q
Sbjct  49   YSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGLLSPERAKKAYEKKQKRQ  108

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            +Q+R+GTPIK   +     SSK+P   + + D KAKKR++  SDDDDDFI+  KR +G
Sbjct  109  QQIRSGTPIKPSVKKDKPESSKKPSSYN-SSDSKAKKRVDY-SDDDDDFIVKLKRSRG  164



>ref|XP_002441646.1| hypothetical protein SORBIDRAFT_09g030890 [Sorghum bicolor]
 gb|EES20076.1| hypothetical protein SORBIDRAFT_09g030890 [Sorghum bicolor]
Length=174

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (81%), Gaps = 6/119 (5%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFWLMEHGLL P++AKKA+E+KQ++Q
Sbjct  61   YSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGLLSPERAKKAYERKQKRQ  120

Query  703  kqLRTGTPIK-SPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            +Q+R GTPIK S  R     SSK+P  +    D KAK+R+ + SDDD+DFI+  KR KG
Sbjct  121  QQVRMGTPIKSSAVRKDKPESSKKPSTM----DSKAKRRV-DYSDDDNDFIVKMKRSKG  174



>ref|XP_004960967.1| PREDICTED: protein AF-9-like [Setaria italica]
Length=172

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 97/121 (80%), Gaps = 8/121 (7%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFWLMEHGLL P++AKKA+E+KQ++Q
Sbjct  57   YSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGLLSPERAKKAYERKQKRQ  116

Query  703  kqLRTGTPIK---SPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
            +Q+R GTPIK   S  RP    SSK+P   S N D KAKKR+   S+DDD+FI+  KR +
Sbjct  117  QQVRMGTPIKPSGSKDRPE---SSKKP-VASSNMDSKAKKRV-YYSNDDDEFIVKMKRSR  171

Query  874  G  876
            G
Sbjct  172  G  172



>ref|XP_010249581.1| PREDICTED: uncharacterized protein LOC104592097 isoform X2 [Nelumbo 
nucifera]
Length=201

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 139/209 (67%), Gaps = 20/209 (10%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---TI  435
            MAT  K  V++ KP   DGS+      +    S + KK+ V  SS K + D+K K   T+
Sbjct  1    MATEIKVHVLKAKP-NQDGSS------KVKGLSPLNKKKVV--SSSKHTPDSKQKSVSTL  51

Query  436  SKTEVNAKAtssssktvkktvtrtrekkv-----YSLPGQKFDVPEEREPLRLFYESLSK  600
            +K+EV AK TS++S + K     T  K       Y+LPGQK+D P EREPLR+FYESLSK
Sbjct  52   TKSEVKAKTTSTTSSSSKSVSKTTAVKVKSKKKVYTLPGQKYD-PPEREPLRIFYESLSK  110

Query  601  QIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQ  780
            QIPSSEMAEFW+MEHGLL P++AKKA+E+KQR+Q+QLR GTPIKS        S KQ + 
Sbjct  111  QIPSSEMAEFWMMEHGLLSPERAKKAYERKQRRQQQLRMGTPIKSLKLDKPESSQKQ-KH  169

Query  781  VSKNGDIKAKKRLNNdsdddddFILSPKR  867
             SKN D+K KKR+ N  +DDDDFI+ PK+
Sbjct  170  ASKNSDLKTKKRIIN-ENDDDDFIVRPKK  197



>ref|XP_010924557.1| PREDICTED: uncharacterized protein LOC105047348 [Elaeis guineensis]
Length=197

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 3/118 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQK D PEEREPLR+FYESLSKQIPSSEMAEFW+MEHGLL P++AKKA+E+KQR+Q
Sbjct  83   YSLPGQKHDPPEEREPLRIFYESLSKQIPSSEMAEFWMMEHGLLSPERAKKAYERKQRRQ  142

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            +QLR GTPIKS T+     SSK+P QV KNG +K KKR+ + SD+DDDFI+  K+ KG
Sbjct  143  QQLRMGTPIKS-TKQEKPESSKKP-QVWKNGVVKIKKRV-DFSDNDDDFIVKYKKSKG  197



>ref|XP_004498467.1| PREDICTED: uncharacterized protein LOC101503732 [Cicer arietinum]
Length=162

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 6/147 (4%)
 Frame = +1

Query  376  KRTVEISSHKQSVDAKGKTISKTEVNAKAt-ssssktvkktvtrtrekkvYSLPGQKFDV  552
            KR V+  S  +S+     T+ K+EV +K T SSS  T   T T+ REKKVY+LPGQK D 
Sbjct  13   KRKVQADSKMRSIT----TVKKSEVKSKTTPSSSKTTKISTSTKVREKKVYTLPGQKHDP  68

Query  553  PEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIK  732
            PE++EPLR+FYESLSKQIP+SEMAEFWLMEHG+L P+KAK+AFEKKQRKQK+LR G P+K
Sbjct  69   PEQKEPLRIFYESLSKQIPTSEMAEFWLMEHGMLSPEKAKRAFEKKQRKQKELRIGNPVK  128

Query  733  SPTRPVSVGSSKQPQQVSKNGDIKAKK  813
             P+ P +   +   QQ S NGDIKAKK
Sbjct  129  -PSNPPTKTETSHKQQPSTNGDIKAKK  154



>emb|CDY71261.1| BnaCnng72080D, partial [Brassica napus]
Length=222

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 144/224 (64%), Gaps = 22/224 (10%)
 Frame = +1

Query  253  QLVGMATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKT  432
            Q + MAT T+ S V+ +P   DGS+SL+S+ + D S     K+ +  +S     D K ++
Sbjct  3    QDLLMATQTRPSSVKNEPR--DGSSSLASRAKIDPS--FKDKKKIATTSKPIMSDTKPRS  58

Query  433  -ISKTEVNAKAtssssktvkktv------------trtrekkvYSLPGQKFDVPEEREPL  573
             +S   V ++A   S+ +  K+                REKKVYSL GQK+D PEEREPL
Sbjct  59   SVSTVTVKSEAKPKSAVSSVKSTATTSAAASLAKGKVKREKKVYSLAGQKYDPPEEREPL  118

Query  574  RLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVS  753
            R+FYESLSKQIP SEMAEFWLMEHG+L P+KAK+A EKK RK KQ+R GTP+K PT   S
Sbjct  119  RIFYESLSKQIPGSEMAEFWLMEHGMLSPEKAKRAHEKKLRKMKQIRMGTPVK-PTPSYS  177

Query  754  VG---SSKQPQQVSKNG-DIKAKKRLNNdsdddddFILSPKRRK  873
                 SS++P     NG D + KK++ +D+DDDDDFILSPKRRK
Sbjct  178  KSKPESSQRPTASKNNGSDARKKKKVVDDNDDDDDFILSPKRRK  221



>ref|XP_002873523.1| hypothetical protein ARALYDRAFT_487997 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49782.1| hypothetical protein ARALYDRAFT_487997 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 134/231 (58%), Gaps = 30/231 (13%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSS-----VTKKRTVEISSHKQS----VD  417
            MAT  + S  + +P   DGS+SLSS+ + D S       VT  R +   S  +S    V 
Sbjct  1    MATQARPSSAKSEPR--DGSSSLSSRVKIDPSIKDKKKIVTSNRPIMSDSKPRSSVSTVT  58

Query  418  AKGKTISKTEVN----------------AKAtssssktvkktvtrtrekkvYSLPGQKFD  549
            AK +   K  VN                 KA ++ +          REKKVYSLPGQKFD
Sbjct  59   AKSEAKPKVPVNLVKSTATTSAAASLAKGKAKTTPAAASLVKGKAKREKKVYSLPGQKFD  118

Query  550  VPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPI  729
             PEEREPLR+FYESLSKQIP SEMAEFWLMEHG+L PDKAK+AFEKKQRK KQ+R GTP 
Sbjct  119  PPEEREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSPDKAKRAFEKKQRKMKQIRMGTPT  178

Query  730  KSPTRPVSVGSSKQPQQVSKNGDIKAK---KRLNNdsdddddFILSPKRRK  873
            K      S   S Q     KN  + A+   K +++D DDDDDFILS KRRK
Sbjct  179  KPAPTFTSKAESSQKTSAPKNNGLDARKKKKVVDDDDDDDDDFILSHKRRK  229



>ref|XP_010419735.1| PREDICTED: uncharacterized protein LOC104705427 [Camelina sativa]
Length=232

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQKFD+PEEREPLR+FYESLSKQIP SEMAEFWLMEHG+L PDKAK+AFEKKQRK 
Sbjct  111  YSLPGQKFDIPEEREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSPDKAKRAFEKKQRKM  170

Query  703  kqLRTGTPIK-SPTRPVSVGSSKQPQQVSKNGDIKAK---KRLNNdsdddddFILSPKRR  870
            KQ+R GTP K +PT      SS++    +KN  +  +   K +++D DDDDDFILS KRR
Sbjct  171  KQIRMGTPTKPAPTFTSKAESSQRTSASTKNSGLDPRKKKKVVDDDDDDDDDFILSHKRR  230

Query  871  K  873
            K
Sbjct  231  K  231



>ref|XP_010453207.1| PREDICTED: uncharacterized protein LOC104735174 [Camelina sativa]
Length=232

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQKFD+PEEREPLR+FYESLSKQIP SEMAEFWLMEHG+L PDKAK+AFEKKQRK 
Sbjct  111  YSLPGQKFDIPEEREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSPDKAKRAFEKKQRKM  170

Query  703  kqLRTGTPIK-SPTRPVSVGSSKQPQQVSKNGDI---KAKKRLNNdsdddddFILSPKRR  870
            KQ+R GTP K +PT      SS++    +KN  +   K KK + +D DDDDDFILS KRR
Sbjct  171  KQIRMGTPTKPAPTFTSKAESSQKTSASTKNSGLDPRKKKKVVRDDDDDDDDFILSHKRR  230

Query  871  K  873
            K
Sbjct  231  K  231



>ref|NP_196721.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87720.1| putative protein [Arabidopsis thaliana]
 gb|AAS65948.1| At5g11600 [Arabidopsis thaliana]
 gb|AAS88788.1| At5g11600 [Arabidopsis thaliana]
 gb|AED91699.1| uncharacterized protein AT5G11600 [Arabidopsis thaliana]
Length=242

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSL GQKFD PEEREPLR+FYESLSKQIP SEMAEFWLMEHG+L P+KAK+AFEKKQRK 
Sbjct  122  YSLAGQKFDPPEEREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSPEKAKRAFEKKQRKM  181

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAK---KRLNNdsdddddFILSPKRRK  873
            KQ+R GTP KS     S   S Q    SKN  + A+   K +++D DDDDDFILS KRRK
Sbjct  182  KQIRMGTPSKSAPTFSSKAESSQRTSASKNNGLDARKKKKVVDDDDDDDDDFILSHKRRK  241



>gb|EPS59810.1| hypothetical protein M569_14995, partial [Genlisea aurea]
Length=92

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQK+DVPEEREPLR+FYESLSKQIPSSEMAEFWLMEHG+L  ++A+KA+E+KQRKQ
Sbjct  22   YSLPGQKYDVPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGMLSAERARKAYERKQRKQ  81

Query  703  kqLRTGTPIKS  735
            K++R+GTP+KS
Sbjct  82   KEIRSGTPMKS  92



>ref|XP_006289046.1| hypothetical protein CARUB_v10002438mg [Capsella rubella]
 gb|EOA21944.1| hypothetical protein CARUB_v10002438mg [Capsella rubella]
Length=210

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQKFD PEEREPLR+FYESLSKQI  SEMAEFWLMEHG+L PDKAK+AFEKKQRK 
Sbjct  91   YSLPGQKFDPPEEREPLRIFYESLSKQITGSEMAEFWLMEHGMLSPDKAKRAFEKKQRKM  150

Query  703  kqLRTGTPIKSPTRPVSVGSSKQPQQVSKNG--DIKAKKRLNNdsdddddFILSPKRRK  873
            KQ+R GTP K      S   S Q    SKN   D + KK++ ++ DDDDDFILS KRRK
Sbjct  151  KQIRMGTPTKPAPTYTSKAESSQRTYASKNSGLDPRKKKKVVDEEDDDDDFILSHKRRK  209



>ref|XP_003567772.1| PREDICTED: uncharacterized protein LOC100836865 [Brachypodium 
distachyon]
Length=176

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            +SLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFWLMEHGLL P+KA+KA+++KQ++Q
Sbjct  54   FSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGLLSPEKARKAYDRKQKRQ  113

Query  703  kqLRTGTPIKS  735
            +Q+R+GTPIKS
Sbjct  114  QQIRSGTPIKS  124



>ref|XP_009125820.1| PREDICTED: uncharacterized protein LOC103850785 [Brassica rapa]
Length=215

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSL GQK+D PEEREPLR+FYESLSKQIP SEMAEFWLMEHG+L  +KAK+A EKK RK 
Sbjct  96   YSLAGQKYDPPEEREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSSEKAKRAHEKKLRKM  155

Query  703  kqLRTGTPIK-SPTRPVSVGSSKQPQQVSKNGDIKAK-KRLNNdsdddddFILSPKRRK  873
            KQ+R GTP+K +P+   S   S Q    SKN    A+ K+  +DSDDDDDFILSPKRRK
Sbjct  156  KQIRMGTPVKPTPSYSKSKPESSQRPSASKNSGSDARKKKKVDDSDDDDDFILSPKRRK  214



>emb|CDY69985.1| BnaAnng32230D, partial [Brassica napus]
Length=218

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSL GQK+D PEEREPLR+FYESLSKQIP SEMAEFWLMEHG+L  +KAK+A EKK RK 
Sbjct  99   YSLAGQKYDPPEEREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSSEKAKRAHEKKLRKM  158

Query  703  kqLRTGTPIK-SPTRPVSVGSSKQPQQVSKNGDIKAK-KRLNNdsdddddFILSPKRRK  873
            KQ+R GTP+K +P+   S   S Q    SKN    A+ K+  +DSDDDDDFILSPKRRK
Sbjct  159  KQIRMGTPVKPTPSYSKSKPESSQRPSASKNSGSDARKKKKVDDSDDDDDFILSPKRRK  217



>ref|XP_006399667.1| hypothetical protein EUTSA_v10014651mg [Eutrema salsugineum]
 gb|ESQ41120.1| hypothetical protein EUTSA_v10014651mg [Eutrema salsugineum]
Length=215

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 135/216 (63%), Gaps = 15/216 (7%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKK-----RTVEISSHKQS----VD  417
            MAT T+ S V  K    DGS+SL+S+ + D S    KK     R +   +  +S    V 
Sbjct  1    MATQTRPSSV--KSESRDGSSSLASRVKIDPSFKDKKKIASSSRPIMSDTKPRSAVSTVT  58

Query  418  AKGKTISKTEVNA--KAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYES  591
            AK +   K  VN+     ++S+          REKKVY LPGQK+D PEEREPLR+FYES
Sbjct  59   AKSEAKPKIPVNSVKSTATTSAAATLAKGKAKREKKVYPLPGQKYDPPEEREPLRIFYES  118

Query  592  LSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIK-SPTRPVSVGSSK  768
            LSKQIP SEMAEFWLMEHG+L P+KAK+A EKK RK KQ+R GTP K +P+      SS+
Sbjct  119  LSKQIPGSEMAEFWLMEHGMLSPEKAKRAHEKKLRKMKQIRMGTPSKPTPSYSSKPESSQ  178

Query  769  QPQQVSKNG-DIKAKKRLNNdsdddddFILSPKRRK  873
            +P      G D + KK++ +D DDDD+FILS KRRK
Sbjct  179  RPSTSKNIGLDARKKKKVVDDDDDDDNFILSHKRRK  214



>gb|KEH39707.1| hypothetical protein MTR_1g006605 [Medicago truncatula]
Length=195

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 136/212 (64%), Gaps = 27/212 (13%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAK-GKTISK  441
            MAT TK+S+V++K +  D S +  + P       + KK+    +S+K   D+K  K+++K
Sbjct  1    MATETKTSIVKLKSNDPDESFNGKNDPL------IVKKKLA--TSNKVPTDSKMKKSVTK  52

Query  442  TEVNAKAtssssktvkktvtrtr--ekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +EV +K TSSSS       T T+  EKKVYSLPGQK D PEE+EPLR+FYESLSKQIP+S
Sbjct  53   SEVKSKTTSSSSSKTTSKTTTTKVREKKVYSLPGQKHDPPEEKEPLRIFYESLSKQIPTS  112

Query  616  EMAEFWLMEHGLL-PPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQVSKN  792
            EMAEFWLMEHG+L P    K   +K+++KQK+LR G  I   +           +Q SKN
Sbjct  113  EMAEFWLMEHGMLSPEKAKKAFEKKQKKKQKELRAGNSIAETSN----------KQESKN  162

Query  793  GDIKAKKRL-----NNdsdddddFILSPKRRK  873
            GDIKAKK +     ++  DDDDD ILS KRRK
Sbjct  163  GDIKAKKIVVENDGDDVDDDDDDVILSSKRRK  194



>ref|XP_010668353.1| PREDICTED: uncharacterized protein LOC104885354 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=224

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 129/233 (55%), Gaps = 48/233 (21%)
 Frame = +1

Query  283  SSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTI----SKTEV  450
            SS V+VKP   + +T  SSKP       + KK+   I+ H  + D K K+I    +K+E 
Sbjct  3    SSAVKVKPINRNQATPSSSKP-------ILKKKIEIINKHPSASDTKNKSIPVKSAKSEE  55

Query  451  NAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEF  630
              K    ++          REKKVYSL GQK+D PEEREPLR+FYESLSKQIP+SEMAEF
Sbjct  56   KGK---KAAPATPVKKATKREKKVYSLAGQKYDPPEEREPLRIFYESLSKQIPTSEMAEF  112

Query  631  --------------------------------WLMEHGLLPPDkakkafekkqrkqkqLR  714
                                            WLMEHGLL  +KAKKA E+KQRKQKQ +
Sbjct  113  CFCRITSEKQTFLEAWPNIPLVPLAPINCIVSWLMEHGLLSSEKAKKAHERKQRKQKQQK  172

Query  715  TGTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRK  873
             GTPIKSP       SS + + VSKNG++K KKR     D DD+ I  PKRRK
Sbjct  173  MGTPIKSPPSYSKPESSNRQKLVSKNGNLKVKKRF--VEDSDDEVIGIPKRRK  223



>gb|KFK25420.1| hypothetical protein AALP_AA8G112700 [Arabis alpina]
Length=230

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 132/233 (57%), Gaps = 34/233 (15%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKTISKT  444
            MAT TK S  ++ P   DGS+SL+S+ + D S     K+ +  S+     D K ++++ T
Sbjct  1    MATQTKPSSSKIVPR--DGSSSLASRVKIDPS--FKDKKKIATSTRPIMSDTKPRSVTST  56

Query  445  EVNAKAtssssktvkktvtrtrekkv----------------------------YSLPGQ  540
             V AK+ +     V    + T   KV                            YSL GQ
Sbjct  57   TVTAKSEAKPKTPVNSVKSTTTTSKVPVNSVKSTATTSAAASLAKGKVKREKKVYSLAGQ  116

Query  541  KFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTG  720
            KFD PEEREPLR+FYESLSKQ P SEMAEFWLMEHG+L  +KAK+A EKK RK KQ+R G
Sbjct  117  KFDPPEEREPLRIFYESLSKQRPGSEMAEFWLMEHGMLSAEKAKRAHEKKLRKMKQIRMG  176

Query  721  TPIK-SPTRPVSVGSSKQPQQVSKNG-DIKAKKRLNNdsdddddFILSPKRRK  873
            TP K +P+      SS++      NG D + KK++ +D DDDDDFILS KRRK
Sbjct  177  TPAKPAPSYSSKPESSQRTSMSKSNGLDARKKKKVVDDDDDDDDFILSHKRRK  229



>gb|EMS66909.1| hypothetical protein TRIUR3_27901 [Triticum urartu]
Length=371

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            +SL GQKFD PEEREPLR+FYESLSKQIPSS+MAEFWLMEHGLL P++AKKA+++K ++Q
Sbjct  225  FSLTGQKFDTPEEREPLRIFYESLSKQIPSSDMAEFWLMEHGLLSPERAKKAYDRKLKRQ  284

Query  703  kqLRTGTPIKSPT  741
            +Q+++GTPIKSP 
Sbjct  285  QQIKSGTPIKSPN  297



>ref|XP_009394185.1| PREDICTED: uncharacterized protein LOC103979725 [Musa acuminata 
subsp. malaccensis]
Length=188

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 6/102 (6%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSLPGQK+D+PEEREPLR+FYESL +QIPSSEMAE W+MEHGLL P++AKKA+E+KQ++Q
Sbjct  75   YSLPGQKYDIPEEREPLRMFYESLLEQIPSSEMAESWMMEHGLLSPERAKKAYERKQKRQ  134

Query  703  kqLRTGTPIKSP--TRPVSVGSSKQPQQVSKNGDIKAKKRLN  822
            +QLR  TPIKS    RP    ++ Q  + SK+ D ++KKR+N
Sbjct  135  QQLRRRTPIKSTRQERP----ATSQELKASKSVDPRSKKRIN  172



>ref|XP_003588370.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
Length=361

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 120/187 (64%), Gaps = 22/187 (12%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAK-GKTISK  441
            MAT TK+S+V++K +  D S +  + P       + KK+    +S+K   D+K  K+++K
Sbjct  1    MATETKTSIVKLKSNDPDESFNGKNDPL------IVKKKLA--TSNKVPTDSKMKKSVTK  52

Query  442  TEVNAKAtssssktvkktvtrtre--kkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +EV +K TSSSS       T T+   KKVYSLPGQK D PEE+EPLR+FYESLSKQIP+S
Sbjct  53   SEVKSKTTSSSSSKTTSKTTTTKVREKKVYSLPGQKHDPPEEKEPLRIFYESLSKQIPTS  112

Query  616  EMAEFWLMEHGLL-PPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQVSKN  792
            EMAEFWLMEHG+L P    K   +K+++KQK+LR G  I   +           +Q SKN
Sbjct  113  EMAEFWLMEHGMLSPEKAKKAFEKKQKKKQKELRAGNSIAETSN----------KQESKN  162

Query  793  GDIKAKK  813
            GDIKAKK
Sbjct  163  GDIKAKK  169



>ref|XP_010254456.1| PREDICTED: uncharacterized protein LOC104595423 [Nelumbo nucifera]
Length=240

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  559  EREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSP  738
            EREPLR+FYESLSKQIPSSEMAEFW+MEHGLL P++AKKA+EKKQ++Q+QLR GTP+KS 
Sbjct  138  EREPLRIFYESLSKQIPSSEMAEFWMMEHGLLSPERAKKAYEKKQKRQQQLRMGTPVKSL  197

Query  739  TRPVSVGSSKQPQQVSKNGDIKAKKRL  819
                   S KQ QQVSKN D K KKR+
Sbjct  198  NSDKPESSQKQ-QQVSKNSDSKVKKRI  223



>ref|NP_001056519.1| Os05g0596200 [Oryza sativa Japonica Group]
 dbj|BAF18433.1| Os05g0596200, partial [Oryza sativa Japonica Group]
Length=101

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            YSLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFWLMEHGLL P+
Sbjct  49   YSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWLMEHGLLSPE  95



>ref|XP_006853626.1| hypothetical protein AMTR_s00056p00067330 [Amborella trichopoda]
 gb|ERN15093.1| hypothetical protein AMTR_s00056p00067330 [Amborella trichopoda]
Length=209

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 3/116 (3%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y+LPGQ++D PEEREPLR+FYESL KQIPSSEMAE W+MEHGLL P++AKKA E+KQR+ 
Sbjct  92   YTLPGQRYDPPEEREPLRIFYESLLKQIPSSEMAEVWMMEHGLLSPERAKKAHERKQRRL  151

Query  703  kqLRT-GTPIKSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKR  867
            +Q R  GTPIKSP +   V  S Q    SKNG++K KKR +   D+DDDF L PK+
Sbjct  152  QQQRLGGTPIKSPVK-REVSQSSQKPSSSKNGELKPKKR-SLYYDEDDDFTLKPKK  205



>ref|XP_010249583.1| PREDICTED: uncharacterized protein LOC104592097 isoform X3 [Nelumbo 
nucifera]
Length=182

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 128/204 (63%), Gaps = 29/204 (14%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---TI  435
            MAT  K  V++ KP   DGS+      +    S + KK+ V  SS K + D+K K   T+
Sbjct  1    MATEIKVHVLKAKP-NQDGSS------KVKGLSPLNKKKVV--SSSKHTPDSKQKSVSTL  51

Query  436  SKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +K+EV AK TS++S + K     T                 +REPLR+FYESLSKQIPSS
Sbjct  52   TKSEVKAKTTSTTSSSSKSVSKTTAV---------------KREPLRIFYESLSKQIPSS  96

Query  616  EMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVGSSKQPQQVSKNG  795
            EMAEFW+MEHGLL P++AKKA+E+KQR+Q+QLR GTPIKS        S KQ +  SKN 
Sbjct  97   EMAEFWMMEHGLLSPERAKKAYERKQRRQQQLRMGTPIKSLKLDKPESSQKQ-KHASKNS  155

Query  796  DIKAKKRLNNdsdddddFILSPKR  867
            D+K KKR+ N  +DDDDFI+ PK+
Sbjct  156  DLKTKKRIIN-ENDDDDFIVRPKK  178



>gb|ABK22114.1| unknown [Picea sitchensis]
Length=226

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            YSL GQK D PEER+PLR+FY+SL +QIP+SEMA  W+MEHGLLPP+KAKKA+E+KQRKQ
Sbjct  114  YSLTGQKHDPPEERDPLRIFYQSLYEQIPTSEMATIWMMEHGLLPPEKAKKAYERKQRKQ  173

Query  703  kqLRTGTPIKSPT  741
            +Q +TGTP+K P 
Sbjct  174  QQQKTGTPVKFPV  186



>ref|XP_002993612.1| hypothetical protein SELMODRAFT_431684 [Selaginella moellendorffii]
 gb|EFJ05304.1| hypothetical protein SELMODRAFT_431684 [Selaginella moellendorffii]
Length=384

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            + LPGQK+++PEER+PLR+FYES  +QIP+SEMAE WLMEHGLLP D+AK AF+K+ +++
Sbjct  134  FDLPGQKYEIPEERDPLRIFYESTREQIPTSEMAEIWLMEHGLLPEDEAKAAFDKRNQQK  193

Query  703  kqLRTGTPIK--SPTRPVSVGSSK  768
            K  +  TP+K  S + PV   ++K
Sbjct  194  KSKQPSTPVKGASTSTPVKGAAAK  217



>dbj|BAE99910.1| hypothetical protein [Arabidopsis thaliana]
Length=133

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 81/108 (75%), Gaps = 3/108 (3%)
 Frame = +1

Query  559  EREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSP  738
            +REPLR+FYESLSKQIP SEMAEFWLMEHG+L P+KAK+AFEKKQRK KQ+R GTP KS 
Sbjct  25   QREPLRIFYESLSKQIPGSEMAEFWLMEHGMLSPEKAKRAFEKKQRKMKQIRMGTPSKSA  84

Query  739  TRPVSVGSSKQPQQVSKNGDIKAK---KRLNNdsdddddFILSPKRRK  873
                S   S Q    SKN  + A+   K +++D DDDDDFILS KRRK
Sbjct  85   PTFSSKAESSQRTSASKNNGLDARKKKKVVDDDDDDDDDFILSHKRRK  132



>gb|KHG07932.1| Acyl transferase [Gossypium arboreum]
Length=115

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 90/123 (73%), Gaps = 9/123 (7%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGKT-ISK  441
            M T TK+++V++KPSG  GS    SK +FD++ +   KR +E SS KQ V AK K+  +K
Sbjct  1    MRTETKANLVKMKPSGQHGS----SKGKFDTAMN---KRKLE-SSSKQPVGAKQKSATTK  52

Query  442  TEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSSEM  621
             +V +K +SSSSKT   T  + REKKVY+LPGQK D PEEREPLR+FYESL KQIP+SEM
Sbjct  53   AKVKSKTSSSSSKTSTTTKAKVREKKVYTLPGQKHDPPEEREPLRIFYESLLKQIPTSEM  112

Query  622  AEF  630
            AEF
Sbjct  113  AEF  115



>gb|AFW81366.1| hypothetical protein ZEAMMB73_530524, partial [Zea mays]
Length=124

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            YSLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFW     L  PD
Sbjct  63   YSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWYALCFLPSPD  109



>ref|XP_010104456.1| hypothetical protein L484_016055 [Morus notabilis]
 gb|EXC00989.1| hypothetical protein L484_016055 [Morus notabilis]
Length=256

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y+LPGQK D PEER+PLR+FYE+L KQIP SEMA+FW+ME GLLP
Sbjct  121  YNLPGQKRDTPEERDPLRIFYETLYKQIPHSEMAQFWMMESGLLP  165



>ref|XP_006416444.1| hypothetical protein EUTSA_v10008450mg [Eutrema salsugineum]
 gb|ESQ34797.1| hypothetical protein EUTSA_v10008450mg [Eutrema salsugineum]
Length=274

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+PLR+FYESL KQ+P+SEMA+ WLME GLLP
Sbjct  143  YDLPGQKRDTPEERDPLRIFYESLHKQVPTSEMAQIWLMESGLLP  187



>gb|ADE77275.1| unknown [Picea sitchensis]
Length=239

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYE+L +Q P+SEMAEFW+MEHGLL P+
Sbjct  158  YELPGQKHDPPEERDPLRIFYETLYEQRPTSEMAEFWMMEHGLLSPE  204



>ref|XP_004291358.1| PREDICTED: uncharacterized protein LOC101306296 [Fragaria vesca 
subsp. vesca]
Length=283

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D PEER+PLR+FYE+L +Q+P+SEMA+ WLME GLLP ++AKK FEKKQ+ +
Sbjct  129  YDLPGQKRDAPEERDPLRIFYETLYEQVPNSEMAQVWLMESGLLPKEEAKKVFEKKQKSR  188

Query  703  kqLRTGTPIKSPTRPVSVG  759
            +  R    + SP++PV+ G
Sbjct  189  QLQR----VSSPSKPVASG  203



>ref|XP_006649747.1| PREDICTED: transcriptional regulator ATRX homolog [Oryza brachyantha]
Length=330

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D P+ER+PLR+FYESL +Q+P+SEMA  WLME GLLPPD
Sbjct  197  YDLPGQKHDPPQERDPLRIFYESLYEQVPTSEMAATWLMEWGLLPPD  243



>ref|XP_010920238.1| PREDICTED: uncharacterized protein DDB_G0286299-like [Elaeis 
guineensis]
Length=265

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D PEER+PLR+FYE+L +Q+P+SEMA FW+ME GLLP ++AKK +EKK +K 
Sbjct  139  YDLPGQKHDPPEERDPLRIFYETLYQQVPNSEMAAFWMMEWGLLPLEEAKKVYEKKLKKA  198

Query  703  kqLRTGTPIK--SPTRPVSVGSSKQPQQVSKNGDIKAKKR  816
               + G+P+K  S  +  ++   K+ + VSK      KKR
Sbjct  199  HYQKLGSPVKTVSVKKTATISVKKKKETVSKTAVKVIKKR  238



>emb|CDY44198.1| BnaC05g15550D [Brassica napus]
Length=278

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+PLR+FYESL KQ+P+SEMA+ WLME GLLP
Sbjct  135  YDLPGQKRDQPEERDPLRIFYESLHKQVPTSEMAKIWLMESGLLP  179



>ref|XP_010061070.1| PREDICTED: protein IWS1 homolog A [Eucalyptus grandis]
 gb|KCW67966.1| hypothetical protein EUGRSUZ_F01662 [Eucalyptus grandis]
Length=313

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL KQ+P SEMA+FW+ME GLLP D
Sbjct  175  YDLPGQKRDPPEERDPLRIFYESLHKQVPRSEMAQFWMMESGLLPKD  221



>ref|XP_010533812.1| PREDICTED: nucleolin [Tarenaya hassleriana]
Length=262

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+PLR+FYESL KQIP+SEMA+ W+ME GLLP
Sbjct  132  YDLPGQKRDQPEERDPLRIFYESLYKQIPTSEMAQIWMMESGLLP  176



>ref|XP_002275494.2| PREDICTED: nucleolar protein 58 isoform X1 [Vitis vinifera]
 emb|CBI19866.3| unnamed protein product [Vitis vinifera]
Length=223

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYE+L +Q+P SEMA FW+ME GLLP D
Sbjct  96   YDLPGQKRDTPEERDPLRIFYETLFEQVPGSEMAAFWMMESGLLPKD  142



>ref|XP_006596188.1| PREDICTED: uncharacterized protein DDB_G0284459-like isoform 
X2 [Glycine max]
Length=149

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 95/127 (75%), Gaps = 11/127 (9%)
 Frame = +1

Query  265  MATNTKSSVVRVKPSGGDGSTSLSSKPRFDSSSSVTKKRTVEISSHKQSVDAKGK---TI  435
            MAT TKSS V++K    DGS    SK + DSS+ V KK  VE SS K   D+K K   T+
Sbjct  1    MATETKSSTVKLKSRAPDGS----SKGKIDSSA-VRKK--VE-SSSKLPADSKMKSVSTV  52

Query  436  SKTEVNAKAtssssktvkktvtrtrekkvYSLPGQKFDVPEEREPLRLFYESLSKQIPSS  615
            +K+EV +K+TSSSSKTV +T T+ REKKVYSLPGQK D PE++EPLR+FYESLSKQIP+S
Sbjct  53   TKSEVKSKSTSSSSKTVTQTTTKAREKKVYSLPGQKHDPPEQKEPLRVFYESLSKQIPTS  112

Query  616  EMAEFWL  636
            EMAEF L
Sbjct  113  EMAEFCL  119



>ref|XP_010664814.1| PREDICTED: ABC transporter F family member 4 isoform X2 [Vitis 
vinifera]
Length=221

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYE+L +Q+P SEMA FW+ME GLLP D
Sbjct  94   YDLPGQKRDTPEERDPLRIFYETLFEQVPGSEMAAFWMMESGLLPKD  140



>ref|XP_010498428.1| PREDICTED: uncharacterized protein DDB_G0283697 [Camelina sativa]
Length=250

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL KQIP+S+MA+ WLME GLLP +
Sbjct  111  YDLPGQKRDQPEERDPLRIFYESLYKQIPTSDMAQIWLMESGLLPAE  157



>ref|XP_010459679.1| PREDICTED: uncharacterized protein DDB_G0283697-like [Camelina 
sativa]
Length=248

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+PLR+FYESL KQIP+S+MA+ WLME GLLP
Sbjct  111  YDLPGQKRDQPEERDPLRIFYESLYKQIPTSDMAQIWLMESGLLP  155



>gb|KFK44125.1| hypothetical protein AALP_AA1G218900 [Arabis alpina]
Length=275

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL  Q+P+SEMA+ WLME GLLP D
Sbjct  135  YDLPGQKRDQPEERDPLRIFYESLYMQVPTSEMAQIWLMESGLLPAD  181



>ref|XP_011045086.1| PREDICTED: nucleolin-like isoform X1 [Populus euphratica]
Length=301

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y  PGQK D PEER+PLR+FYE+L +QIP SEMA+FWLME GLLP
Sbjct  152  YDFPGQKRDPPEERDPLRIFYETLYEQIPESEMAQFWLMESGLLP  196



>ref|XP_011045087.1| PREDICTED: nuclear ubiquitous casein and cyclin-dependent kinase 
substrate 1-like isoform X2 [Populus euphratica]
Length=299

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y  PGQK D PEER+PLR+FYE+L +QIP SEMA+FWLME GLLP
Sbjct  150  YDFPGQKRDPPEERDPLRIFYETLYEQIPESEMAQFWLMESGLLP  194



>emb|CDY29377.1| BnaA06g14190D [Brassica napus]
Length=275

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D P+ER+PLR+FYESL KQ+P+SEMA+ WLME GLLP
Sbjct  140  YDLPGQKRDQPDERDPLRIFYESLHKQVPTSEMAKIWLMESGLLP  184



>dbj|BAG88351.1| unnamed protein product [Oryza sativa Japonica Group]
Length=129

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLME  642
            YSLPGQKFD PEEREPLR+FYESLSKQIPSSEMAEFW  +
Sbjct  49   YSLPGQKFDPPEEREPLRIFYESLSKQIPSSEMAEFWYAQ  88



>ref|XP_001759125.1| predicted protein [Physcomitrella patens]
 gb|EDQ76194.1| predicted protein [Physcomitrella patens]
Length=387

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            +SLPGQ+F+ PEER+ LRLFYESL +QIP+S+MA  WLMEHGLL  D
Sbjct  282  FSLPGQRFETPEERDALRLFYESLHRQIPTSDMANIWLMEHGLLEAD  328



>ref|XP_007226727.1| hypothetical protein PRUPE_ppa019607mg [Prunus persica]
 gb|EMJ27926.1| hypothetical protein PRUPE_ppa019607mg [Prunus persica]
Length=302

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 77/113 (68%), Gaps = 13/113 (12%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D P+ER+PLR+FYE+L +Q+P SEMA+FWLME GLL  ++AK+ FEKKQ++ 
Sbjct  164  YDLPGQKRDPPDERDPLRIFYETLYEQVPKSEMAQFWLMECGLLSKEEAKRVFEKKQKRS  223

Query  703  kqLRTGTPIKS------PTRPVSVG-------SSKQPQQVSKNGDIKAKKRLN  822
            +Q   G+P+K+       T+ V+V        S+++   VSK+   ++KKR N
Sbjct  224  QQQNLGSPMKAVASVKKSTQSVTVKKPSTPVPSNQKKSTVSKDASTQSKKRKN  276



>ref|XP_003527642.1| PREDICTED: DNA ligase 1-like [Glycine max]
Length=236

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEE++PLR+FYE+L KQ+PSSEM++ WLME GLLP D
Sbjct  92   YDLPGQKRDPPEEKDPLRIFYETLFKQVPSSEMSQIWLMESGLLPKD  138



>ref|XP_011074685.1| PREDICTED: UPF0329 protein ECU05_1680/ECU11_0050-like isoform 
X2 [Sesamum indicum]
Length=253

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 20/135 (15%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            + LPGQK D PEER+PLR+FYE+L KQ+P+SEMA  W+ME GLLP ++AKK F++KQ+K 
Sbjct  116  FDLPGQKRDPPEERDPLRIFYETLYKQVPASEMAAIWMMESGLLPTEEAKKIFDRKQKKA  175

Query  703  kqLRTGTPI-----------------KSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNd-  828
            +Q +  +P+                 KS T PVS    K P   SK    ++KKR ++  
Sbjct  176  QQQKLSSPMKTVVNVKKKAGSITIEKKSATSPVSTQKKKTPD--SKLATNQSKKRKSDAG  233

Query  829  sdddddFILSPKRRK  873
            S +DDDF+L PKR K
Sbjct  234  SSEDDDFVLDPKRSK  248



>ref|XP_006383742.1| hypothetical protein POPTR_0005s26110g [Populus trichocarpa]
 gb|ERP61539.1| hypothetical protein POPTR_0005s26110g [Populus trichocarpa]
Length=301

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y  PGQK D PEER+PLR+FYE+L +QIP SEMA+FWLME GLLP
Sbjct  152  YDFPGQKRDPPEERDPLRIFYETLYEQIPESEMAQFWLMESGLLP  196



>ref|NP_001049564.1| Os03g0249900 [Oryza sativa Japonica Group]
 gb|ABF94981.1| Rap8, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11478.1| Os03g0249900 [Oryza sativa Japonica Group]
 gb|EAZ26281.1| hypothetical protein OsJ_10150 [Oryza sativa Japonica Group]
 dbj|BAG86676.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D P+ER+PLR+FYESL +Q+P+SEMA  WLME GLLP D
Sbjct  187  YDLPGQKHDPPQERDPLRIFYESLYEQVPTSEMAAIWLMEWGLLPVD  233



>ref|XP_002306929.1| hypothetical protein POPTR_0005s26110g [Populus trichocarpa]
 gb|EEE93925.1| hypothetical protein POPTR_0005s26110g [Populus trichocarpa]
Length=299

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y  PGQK D PEER+PLR+FYE+L +QIP SEMA+FWLME GLLP
Sbjct  150  YDFPGQKRDPPEERDPLRIFYETLYEQIPESEMAQFWLMESGLLP  194



>gb|EAY89268.1| hypothetical protein OsI_10766 [Oryza sativa Indica Group]
Length=317

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D P+ER+PLR+FYESL +Q+P+SEMA  WLME GLLP D
Sbjct  186  YDLPGQKHDPPQERDPLRIFYESLYEQVPTSEMAAIWLMEWGLLPVD  232



>ref|XP_011074684.1| PREDICTED: UPF0329 protein ECU05_1680/ECU11_0050-like isoform 
X1 [Sesamum indicum]
Length=255

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 20/135 (15%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            + LPGQK D PEER+PLR+FYE+L KQ+P+SEMA  W+ME GLLP ++AKK F++KQ+K 
Sbjct  118  FDLPGQKRDPPEERDPLRIFYETLYKQVPASEMAAIWMMESGLLPTEEAKKIFDRKQKKA  177

Query  703  kqLRTGTPI-----------------KSPTRPVSVGSSKQPQQVSKNGDIKAKKRLNNd-  828
            +Q +  +P+                 KS T PVS    K P   SK    ++KKR ++  
Sbjct  178  QQQKLSSPMKTVVNVKKKAGSITIEKKSATSPVSTQKKKTPD--SKLATNQSKKRKSDAG  235

Query  829  sdddddFILSPKRRK  873
            S +DDDF+L PKR K
Sbjct  236  SSEDDDFVLDPKRSK  250



>gb|ABK92449.1| unknown [Populus trichocarpa]
Length=301

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y  PGQK D PEER+PLR+FYE+L +QIP SEMA+FWLME GLLP
Sbjct  152  YDFPGQKRDPPEERDPLRIFYETLYEQIPESEMAQFWLMESGLLP  196



>ref|XP_008780158.1| PREDICTED: uncharacterized protein LOC103699949, partial [Phoenix 
dactylifera]
Length=115

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFW  633
            YSL GQK+D PEEREPLR+FYESLSKQIPSSEMAEFW
Sbjct  79   YSLAGQKYDPPEEREPLRIFYESLSKQIPSSEMAEFW  115



>gb|KGN60039.1| hypothetical protein Csa_3G872700 [Cucumis sativus]
Length=275

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y LPGQK D PEER+PLR+FYESL KQ+P SEMA+FW+ME+GLL
Sbjct  136  YDLPGQKRDPPEERDPLRIFYESLHKQLPHSEMAQFWMMEYGLL  179



>ref|XP_007017806.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY15031.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=268

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y+LPGQK D PE+R+PLR+FYE++ KQIP SEMA+FW+ME GLLP
Sbjct  144  YNLPGQKRDPPEQRDPLRIFYETMYKQIPKSEMAQFWMMESGLLP  188



>gb|KHN09087.1| hypothetical protein glysoja_034272 [Glycine soja]
Length=235

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEE++PLR+FYE+L KQ+PSSEM++ WLME GLLP D
Sbjct  92   YDLPGQKRDPPEEKDPLRIFYETLFKQVPSSEMSQIWLMESGLLPKD  138



>ref|XP_010268173.1| PREDICTED: DNA ligase 1 [Nelumbo nucifera]
Length=240

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            + LPGQ+ + PEER+PLR+FYESL +QIP+SEMA FW+ME GLLP + AKK +EKK ++ 
Sbjct  103  FDLPGQRRETPEERDPLRIFYESLYQQIPNSEMAAFWMMESGLLPLEVAKKVYEKKLKRN  162

Query  703  kqLRTGTPIKS  735
            +  + G+P+K+
Sbjct  163  QLQKLGSPVKT  173



>ref|XP_008377143.1| PREDICTED: nucleolar protein 58 [Malus domestica]
Length=309

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQ+ D PE+++PLR FYESL +QIPSSEMA+FW+ME+GLLP
Sbjct  151  YDLPGQRKDPPEKKDPLRQFYESLHQQIPSSEMAQFWMMEYGLLP  195



>gb|KHN45926.1| hypothetical protein glysoja_023149 [Glycine soja]
Length=225

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEE++PLR+FYE+L KQ+PSSEM++ WLME GLLP D
Sbjct  83   YDLPGQKRDPPEEKDPLRIFYETLFKQVPSSEMSQIWLMESGLLPKD  129



>ref|XP_010477225.1| PREDICTED: DNA topoisomerase 1-like [Camelina sativa]
Length=305

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D P+ER+PLR+FYESL KQIP+S+MA+ WLME GLLP
Sbjct  166  YDLPGQKRDQPQERDPLRIFYESLYKQIPTSDMAQIWLMESGLLP  210



>ref|XP_002890362.1| hypothetical protein ARALYDRAFT_312926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66621.1| hypothetical protein ARALYDRAFT_312926 [Arabidopsis lyrata subsp. 
lyrata]
Length=656

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL KQIP+S+MA+ WLME GLLP +
Sbjct  518  YDLPGQKRDQPEERDPLRIFYESLYKQIPTSDMAQIWLMESGLLPAE  564



>ref|XP_008466483.1| PREDICTED: transcriptional regulator ATRX homolog [Cucumis melo]
Length=276

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y LPGQK D PEER+PLR+FYESL KQ+P SEMA+FW+ME GLL
Sbjct  136  YDLPGQKRDPPEERDPLRIFYESLHKQLPHSEMAQFWMMESGLL  179



>gb|ADE75838.1| unknown [Picea sitchensis]
Length=280

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEE +PLR+FYE+L +Q P+SEMAEFW+MEHGLL P+
Sbjct  158  YELPGQKHDPPEEGDPLRIFYETLYEQRPTSEMAEFWMMEHGLLSPE  204



>ref|XP_004162563.1| PREDICTED: uncharacterized LOC101214860 [Cucumis sativus]
Length=294

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y LPGQK D PEER+PLR+FYESL KQ+P SEMA+FW+ME+GLL
Sbjct  136  YDLPGQKRDPPEERDPLRIFYESLHKQLPHSEMAQFWMMEYGLL  179



>gb|ACJ85477.1| unknown [Medicago truncatula]
Length=263

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+P R+FYE+L +QIP+SEMA+ WLME GLLP
Sbjct  120  YDLPGQKRDPPEERDPSRVFYETLHEQIPTSEMAQIWLMESGLLP  164



>ref|NP_173428.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE29920.1| uncharacterized protein AT1G19990 [Arabidopsis thaliana]
Length=251

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK + P+ER+PLR+FYESL KQIP+S+MA+ WLME GLLP
Sbjct  115  YDLPGQKREQPDERDPLRIFYESLYKQIPTSDMAQIWLMESGLLP  159



>ref|XP_009149495.1| PREDICTED: DNA ligase 1 [Brassica rapa]
Length=273

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D P+ER+PLR+FYESL  Q+P+SEMA+ WLME GLLP
Sbjct  137  YDLPGQKRDQPDERDPLRIFYESLHNQVPTSEMAKIWLMESGLLP  181



>ref|XP_003603764.1| hypothetical protein MTR_3g113940 [Medicago truncatula]
 gb|AES74015.1| hypothetical protein MTR_3g113940 [Medicago truncatula]
Length=263

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+P R+FYE+L +QIP+SEMA+ WLME GLLP
Sbjct  120  YDLPGQKRDPPEERDPSRVFYETLHEQIPTSEMAQIWLMESGLLP  164



>ref|XP_004500939.1| PREDICTED: nucleolar protein 58-like [Cicer arietinum]
Length=255

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+PLR+FYE+L +QIP+SEM++ WLME GLLP
Sbjct  119  YDLPGQKRDPPEERDPLRVFYETLYEQIPTSEMSQIWLMETGLLP  163



>ref|XP_009618876.1| PREDICTED: uncharacterized protein DDB_G0283697 [Nicotiana tomentosiformis]
Length=259

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D PEER+PLR+FYESL +Q+P+SE+A  W+ME GLLP D AKK  EKKQ+K 
Sbjct  118  YDLPGQKRDPPEERDPLRIFYESLYQQVPNSELAAIWMMESGLLPKDLAKKVLEKKQKKV  177

Query  703  kqLRTGTPIKS  735
            +Q + G+P+K+
Sbjct  178  QQQKLGSPMKT  188



>ref|XP_008658394.1| PREDICTED: uncharacterized protein LOC100276864 isoform X1 [Zea 
mays]
 gb|ACN29320.1| unknown [Zea mays]
 gb|AFW88979.1| hypothetical protein ZEAMMB73_727468 [Zea mays]
Length=295

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL +Q+P+S+MA  WLME GLLP D
Sbjct  165  YGLPGQKHDPPEERDPLRIFYESLYEQVPTSDMAATWLMEWGLLPVD  211



>ref|NP_001144040.1| uncharacterized protein LOC100276864 [Zea mays]
 gb|ACG37402.1| hypothetical protein [Zea mays]
Length=271

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 8/78 (10%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D PEER+PLR+FYESL +Q+P+S+MA  WLME GLLP D A+K FEK     
Sbjct  165  YGLPGQKHDPPEERDPLRIFYESLYEQVPTSDMAATWLMEWGLLPVDVARKCFEK-----  219

Query  703  kqLRTGTPIKSPTRPVSV  756
               + G  +KSP + ++ 
Sbjct  220  ---KQGQKVKSPVKAITA  234



>ref|XP_009383985.1| PREDICTED: ABC transporter F family member 4 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEER+PLR+FYE+L  Q+P SEMA FW+ME GLLP
Sbjct  156  YDLPGQKHDPPEERDPLRIFYETLYDQVPESEMAAFWMMEWGLLP  200



>gb|EYU38807.1| hypothetical protein MIMGU_mgv1a012284mg [Erythranthe guttata]
Length=255

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + LPGQK D PEER+PLR+FYE+L KQ+P SEMA  W+ME GLLP D
Sbjct  114  FDLPGQKKDPPEERDPLRIFYETLHKQVPGSEMAAIWMMESGLLPKD  160



>ref|XP_001751402.1| predicted protein [Physcomitrella patens]
 gb|EDQ83719.1| predicted protein [Physcomitrella patens]
Length=135

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D PEER+ LR+FY +L +QIP SEMAE WLMEHGLL   +A+KAFE+KQ++ 
Sbjct  9    YDLPGQKHDPPEERDALRIFYSTLREQIPESEMAEIWLMEHGLLSHAEAQKAFERKQKRG  68

Query  703  kqLRTGTPIKSPTRP--VSVGSS  765
            +  + GT I  P+ P  VS GSS
Sbjct  69   QSSKHGT-ISKPSTPSRVSNGSS  90



>ref|XP_006852056.1| hypothetical protein AMTR_s00041p00224610 [Amborella trichopoda]
 gb|ERN13523.1| hypothetical protein AMTR_s00041p00224610 [Amborella trichopoda]
Length=250

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y  PGQ+ D PEER+PLR+FYE+L +Q+P SEMA FWLME GLLP
Sbjct  113  YDFPGQRHDPPEERDPLRIFYETLYEQVPDSEMAAFWLMERGLLP  157



>gb|AFW88980.1| hypothetical protein ZEAMMB73_727468 [Zea mays]
Length=286

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL +Q+P+S+MA  WLME GLLP D
Sbjct  156  YGLPGQKHDPPEERDPLRIFYESLYEQVPTSDMAATWLMEWGLLPVD  202



>ref|XP_006342054.1| PREDICTED: nucleolar protein 58-like [Solanum tuberosum]
Length=258

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL +Q+P SE+A  W+ME GLLP D
Sbjct  116  YDLPGQKRDAPEERDPLRIFYESLYQQVPESELAAIWMMESGLLPKD  162



>emb|CDP07396.1| unnamed protein product [Coffea canephora]
Length=244

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQ+ D PEER+PLR+FYE+L +Q+P+SEMA  W+ME GLLP
Sbjct  103  YDLPGQRRDPPEERDPLRIFYETLYEQVPNSEMAAIWMMESGLLP  147



>ref|XP_004238361.1| PREDICTED: probable replication factor C subunit 1 [Solanum lycopersicum]
Length=259

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+PLR+FYESL +Q+P SE+A  W+ME GLLP D
Sbjct  116  YDLPGQKRDAPEERDPLRIFYESLYQQVPESELAAIWMMESGLLPKD  162



>ref|XP_003558344.2| PREDICTED: uncharacterized protein DDB_G0286299 [Brachypodium 
distachyon]
Length=328

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 8/78 (10%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D P ER+PLR+FYESL +Q+PSS+MA  WLME GLLP D+A++   K     
Sbjct  198  YELPGQKHDPPPERDPLRIFYESLYEQVPSSDMAATWLMEWGLLPEDEAREVLRK-----  252

Query  703  kqLRTGTPIKSPTRPVSV  756
               + G  +KSP + VS 
Sbjct  253  ---KQGQKLKSPVKTVSA  267



>ref|XP_002510538.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52725.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y LPGQK D PEER+PLR+FYE+L KQ+P+SEMA+ W+ME GLL
Sbjct  134  YDLPGQKRDPPEERDPLRIFYETLYKQLPNSEMAQIWMMESGLL  177



>gb|KDP36920.1| hypothetical protein JCGZ_08211 [Jatropha curcas]
Length=276

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y LPGQK D PEER+P+R+FYESL KQ+P SEMA+ W+ME GLL
Sbjct  139  YDLPGQKRDPPEERDPIRIFYESLYKQLPKSEMAQIWMMESGLL  182



>ref|XP_003523549.1| PREDICTED: DNA ligase 1-like [Glycine max]
Length=295

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEE++PLR+FYE+L KQ+PSSEM++ WLME GLLP D
Sbjct  153  YDLPGQKRDPPEEKDPLRIFYETLFKQVPSSEMSQIWLMESGLLPKD  199



>ref|XP_011083557.1| PREDICTED: transcriptional regulator ATRX homolog isoform X1 
[Sesamum indicum]
Length=246

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            + LPGQK D PEER+PLR+FYE+L KQ+P+SEMA  W+ME GLLP
Sbjct  110  FDLPGQKRDPPEERDPLRIFYETLFKQVPASEMAAIWMMESGLLP  154



>ref|XP_004984997.1| PREDICTED: DNA ligase 1-like [Setaria italica]
Length=291

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D P ER+PLR+FYESL +Q+P+S+MA  WLME GLLP D
Sbjct  163  YDLPGQKHDPPTERDPLRIFYESLYEQVPTSDMAATWLMEWGLLPLD  209



>ref|XP_011083558.1| PREDICTED: transcriptional regulator ATRX homolog isoform X2 
[Sesamum indicum]
Length=244

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            + LPGQK D PEER+PLR+FYE+L KQ+P+SEMA  W+ME GLLP
Sbjct  108  FDLPGQKRDPPEERDPLRIFYETLFKQVPASEMAAIWMMESGLLP  152



>ref|XP_008807599.1| PREDICTED: ABC transporter F family member 4-like isoform X1 
[Phoenix dactylifera]
Length=268

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y  PGQK + PEER+PLR+FYE+L +Q+P+SEMA FW+ME GLL  ++AK+ +EKK +K 
Sbjct  142  YDFPGQKHNPPEERDPLRIFYETLYQQVPNSEMAAFWMMEWGLLSLEEAKEVYEKKLKKA  201

Query  703  kqLRTGTPIKSPTRPVSV  756
            +Q + G+P+K    PVSV
Sbjct  202  RQQKLGSPVK----PVSV  215



>gb|ACU23187.1| unknown [Glycine max]
Length=236

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK   PEE++PLR+FYE+L KQ+PSSEM++ WLME GLLP D
Sbjct  92   YDLPGQKRGPPEEKDPLRIFYETLFKQVPSSEMSQIWLMESGLLPKD  138



>ref|XP_008221257.1| PREDICTED: nucleolar protein 58 [Prunus mume]
Length=292

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 17/113 (15%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y LPGQK D P+ER+PLR+FYE+L +Q+P SEMA+FWLME GLL  ++AK+ FEKKQ++ 
Sbjct  154  YDLPGQKRDPPDERDPLRIFYETLYEQVPKSEMAQFWLMECGLLSKEEAKRVFEKKQKRS  213

Query  703  kqLRTGTPIKS---------------PTRPVSVGSSKQPQQVSKNGDIKAKKR  816
            +Q + G+P+K+               P+ PV   S+++   VSK+   ++KKR
Sbjct  214  QQQKLGSPMKAVASVKKSTESVTVKKPSTPVP--SNQKKSTVSKDASTQSKKR  264



>ref|XP_008807600.1| PREDICTED: FACT complex subunit SSRP1-A-like isoform X2 [Phoenix 
dactylifera]
Length=239

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkq  702
            Y  PGQK + PEER+PLR+FYE+L +Q+P+SEMA FW+ME GLL  ++AK+ +EKK +K 
Sbjct  113  YDFPGQKHNPPEERDPLRIFYETLYQQVPNSEMAAFWMMEWGLLSLEEAKEVYEKKLKKA  172

Query  703  kqLRTGTPIKSPTRPVSV  756
            +Q + G+P+K    PVSV
Sbjct  173  RQQKLGSPVK----PVSV  186



>ref|XP_002468171.1| hypothetical protein SORBIDRAFT_01g041010 [Sorghum bicolor]
 gb|EER95169.1| hypothetical protein SORBIDRAFT_01g041010 [Sorghum bicolor]
Length=215

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D P ER+PLR+FYESL +Q+P+S+MA  WLME GLLP D
Sbjct  84   YELPGQKHDPPAERDPLRIFYESLYEQVPTSDMAATWLMEWGLLPLD  130



>ref|XP_009757789.1| PREDICTED: uncharacterized protein DDB_G0283697 [Nicotiana sylvestris]
Length=259

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEER+P+R+FYESL +Q+P+SE+A  W+ME GLLP D
Sbjct  118  YDLPGQKRDPPEERDPIRIFYESLYQQVPNSELAAIWMMESGLLPKD  164



>ref|XP_007136092.1| hypothetical protein PHAVU_009G017100g [Phaseolus vulgaris]
 gb|ESW08086.1| hypothetical protein PHAVU_009G017100g [Phaseolus vulgaris]
Length=241

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PEE++PLR+FYESL  QIP SEM++ WLME GLLP
Sbjct  102  YDLPGQKRDPPEEKDPLRIFYESLYTQIPHSEMSQIWLMESGLLP  146



>ref|XP_009335009.1| PREDICTED: uncharacterized protein LOC103927784 [Pyrus x bretschneideri]
Length=89

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D PE+++PLR FYESL +QI SSE+A+FW+MEHGLLP
Sbjct  30   YDLPGQKKDPPEKKDPLRQFYESLHQQILSSEIAQFWMMEHGLLP  74



>gb|AAF79914.1|AC022472_23 Contains a weak similarity to Rap8 (Rac-3-1) gene from Rhynchosciara 
americana gb|U69899 [Arabidopsis thaliana]
Length=651

 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK + P+ER+PLR+FYESL KQIP+S+MA+ WLME GLLP +
Sbjct  515  YDLPGQKREQPDERDPLRIFYESLYKQIPTSDMAQIWLMESGLLPAE  561



>ref|XP_001768911.1| predicted protein [Physcomitrella patens]
 gb|EDQ66265.1| predicted protein [Physcomitrella patens]
Length=369

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK + PEER+ LR+FY +L +QIP SEMAE WLMEHGLL  D
Sbjct  239  YDLPGQKHEPPEERDALRVFYSTLREQIPESEMAEIWLMEHGLLLHD  285



>ref|XP_006305349.1| hypothetical protein CARUB_v10009729mg [Capsella rubella]
 gb|EOA38247.1| hypothetical protein CARUB_v10009729mg [Capsella rubella]
Length=326

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK   PEER+PLR+FYESL KQIP+S+MA+ WLME GLLP
Sbjct  187  YDLPGQKRPQPEERDPLRIFYESLYKQIPTSDMAQIWLMESGLLP  231



>ref|XP_007017807.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY15032.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=269

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +1

Query  523  YSLPGQKFDVPEE-REPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y+LPGQK D PE+ R+PLR+FYE++ KQIP SEMA+FW+ME GLLP
Sbjct  144  YNLPGQKRDPPEQQRDPLRIFYETMYKQIPKSEMAQFWMMESGLLP  189



>ref|XP_002301977.1| hypothetical protein POPTR_0002s02360g, partial [Populus trichocarpa]
 gb|EEE81250.1| hypothetical protein POPTR_0002s02360g, partial [Populus trichocarpa]
Length=212

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y  PGQK D  EER+PLR+FYE+L +QIP SEMA+FWLME GLL
Sbjct  148  YDFPGQKRDPHEERDPLRIFYETLYEQIPDSEMAQFWLMESGLL  191



>ref|XP_002502047.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63305.1| predicted protein [Micromonas sp. RCC299]
Length=208

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D PEE E LR FY SL KQIP S MAE WLMEHGLLP D
Sbjct  72   YDLPGQKKDTPEEGESLRKFYVSLRKQIPESVMAEQWLMEHGLLPAD  118



>ref|XP_008776806.1| PREDICTED: muscle M-line assembly protein unc-89-like [Phoenix 
dactylifera]
Length=176

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            Y LPGQK D P+ER+PLR+F+E L +Q+P +E+A  W+ME GLLPP+
Sbjct  51   YDLPGQKHDTPDERDPLRIFFEMLYRQLPDNELAASWMMEWGLLPPE  97



>ref|XP_006435185.1| hypothetical protein CICLE_v10002221mg [Citrus clementina]
 gb|ESR48425.1| hypothetical protein CICLE_v10002221mg [Citrus clementina]
Length=257

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + LPGQK + PEER+PLR+FYE+L KQ+P SEMA+ W+ME GLL  D
Sbjct  121  FDLPGQKREPPEERDPLRIFYETLYKQVPHSEMAQLWMMESGLLSFD  167



>ref|XP_006473663.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Citrus sinensis]
Length=255

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + LPGQK + PEER+PLR+FYE+L KQ+P SEMA+ W+ME GLL  D
Sbjct  119  FDLPGQKREPPEERDPLRIFYETLYKQVPHSEMAQLWMMESGLLSFD  165



>ref|XP_001767724.1| predicted protein [Physcomitrella patens]
 gb|EDQ67475.1| predicted protein [Physcomitrella patens]
Length=418

 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            +SLPGQ+F+ PEER+ L LFY SL +QIP+S+MA  WLMEHGLL  D
Sbjct  313  FSLPGQRFEPPEERDALTLFYGSLHRQIPTSDMANIWLMEHGLLESD  359



>ref|XP_006435184.1| hypothetical protein CICLE_v10002221mg [Citrus clementina]
 gb|ESR48424.1| hypothetical protein CICLE_v10002221mg [Citrus clementina]
Length=255

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + LPGQK + PEER+PLR+FYE+L KQ+P SEMA+ W+ME GLL  D
Sbjct  119  FDLPGQKREPPEERDPLRIFYETLYKQVPHSEMAQLWMMESGLLSFD  165



>ref|XP_008793090.1| PREDICTED: uncharacterized protein LOC103709498 isoform X2 [Phoenix 
dactylifera]
Length=128

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 3/42 (7%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAE---FWLM  639
            YSLPGQK D PEEREPLR+FYESLSKQIPSSEMAE    W +
Sbjct  82   YSLPGQKHDPPEEREPLRIFYESLSKQIPSSEMAEVCRLWFL  123



>ref|XP_006473662.1| PREDICTED: transcriptional regulator ATRX homolog isoform X2 
[Citrus sinensis]
Length=256

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + LPGQK + PEER+PLR+FYE+L KQ+P SEMA+ W+ME GLL  D
Sbjct  120  FDLPGQKREPPEERDPLRIFYETLYKQVPHSEMAQLWMMESGLLSFD  166



>ref|XP_006473661.1| PREDICTED: transcriptional regulator ATRX homolog isoform X1 
[Citrus sinensis]
Length=257

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + LPGQK + PEER+PLR+FYE+L KQ+P SEMA+ W+ME GLL  D
Sbjct  121  FDLPGQKREPPEERDPLRIFYETLYKQVPHSEMAQLWMMESGLLSFD  167



>ref|XP_010691867.1| PREDICTED: neurofilament heavy polypeptide isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=249

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y  PGQK D PE+R+PLR+FYE+L +Q P+SE+A  W+ME GLLP
Sbjct  106  YDFPGQKRDPPEQRDPLRIFYETLYQQKPTSELAAVWMMESGLLP  150



>gb|EPS64253.1| hypothetical protein M569_10528, partial [Genlisea aurea]
Length=128

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK   PEER+PLR+FYESL +Q P SEMA  W+ME GLLP
Sbjct  46   YDLPGQKRQPPEERDPLRIFYESLYEQSPESEMAAIWMMESGLLP  90



>ref|XP_002973442.1| hypothetical protein SELMODRAFT_59603, partial [Selaginella moellendorffii]
 gb|EFJ25816.1| hypothetical protein SELMODRAFT_59603, partial [Selaginella moellendorffii]
Length=100

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  550  VPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPI  729
             P +R+PLR+FYES  +QIP+SEMAE WLMEHGLLP D+AK AF+K+ +++K  +  TP+
Sbjct  1    CPSQRDPLRIFYESTREQIPTSEMAEIWLMEHGLLPEDEAKAAFDKRNQQKKSKQPSTPV  60

Query  730  K  732
            K
Sbjct  61   K  61



>emb|CDY43421.1| BnaC07g14880D [Brassica napus]
Length=255

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  535  GQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
             QK D P+ER+PLR+FYE+L KQ+P+SEMA+ WLME GLLP
Sbjct  57   NQKRDQPDERDPLRIFYETLHKQLPTSEMAKIWLMESGLLP  97



>dbj|BAK01071.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=210

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = +1

Query  559  EREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSP  738
            ER+PLR+FYESL +Q+P SEMA FWLME GLLP D       +   K++ L+  +P+K P
Sbjct  1    ERDPLRIFYESLYEQVPDSEMAAFWLMEWGLLPLD----VATEVFAKRQALKLKSPVKPP  56

Query  739  TRPVSVGSSKQPQQVSKNGDIK  804
            + P    S   P +V   GD K
Sbjct  57   SAPRRASS---PTKVRLLGDKK  75



>ref|XP_003057485.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59130.1| predicted protein [Micromonas pusilla CCMP1545]
Length=323

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            Y LPGQK D P+E + LR FY SL  Q P SEMAE WLMEHGLLP
Sbjct  171  YELPGQKRDTPDEADSLRKFYVSLRTQKPESEMAETWLMEHGLLP  215



>ref|XP_001416105.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94397.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=174

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y L GQK D P+E +PLR FY SL +Q P S MAE WLMEHGLL
Sbjct  57   YELHGQKRDAPDETDPLRKFYASLRRQNPKSVMAEVWLMEHGLL  100



>emb|CEG01130.1| unnamed product [Ostreococcus tauri]
Length=166

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y L GQK D P+E +PLR FY SL  Q P S MAE WLMEHGLL
Sbjct  54   YDLLGQKRDAPDESDPLRKFYTSLRTQNPKSTMAEIWLMEHGLL  97



>gb|KHG25219.1| E3 ISG15--protein ligase HERC5 [Gossypium arboreum]
Length=231

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEF  630
            Y LPGQK D PEER+PLR+FYE++ +QIP SEMA+F
Sbjct  111  YDLPGQKRDPPEERDPLRIFYETMYQQIPHSEMAQF  146



>emb|CDW81819.1| UNKNOWN [Stylonychia lemnae]
Length=232

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + +PGQ    P++ E +R+FYESL +Q P+S+MAE WL+ HGLL  D
Sbjct  168  FDMPGQVKQAPDDGEGIRVFYESLYQQKPNSKMAELWLLRHGLLQFD  214



>ref|XP_010691868.1| PREDICTED: DNA topoisomerase 1 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=179

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLM  639
            Y  PGQK D PE+R+PLR+FYE+L +Q P+SE+A  W++
Sbjct  106  YDFPGQKRDPPEQRDPLRIFYETLYQQKPTSELAAVWML  144



>ref|XP_007514082.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15519.1| predicted protein [Bathycoccus prasinos]
Length=249

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y   GQK D P+E + LR FY SL  Q P S MAE WLMEHGLL
Sbjct  93   YEFAGQKRDPPDEEDSLRKFYVSLRAQRPDSIMAEVWLMEHGLL  136



>gb|KFM28259.1| hypothetical protein F751_1538 [Auxenochlorella protothecoides]
Length=259

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            Y LPGQ  D P+E +PLR FY SL  Q P+S+MA  W + HGLL
Sbjct  86   YGLPGQTRDTPDEADPLRKFYTSLLVQRPASDMARKWCVMHGLL  129



>ref|XP_005848198.1| hypothetical protein CHLNCDRAFT_145630 [Chlorella variabilis]
 gb|EFN56096.1| hypothetical protein CHLNCDRAFT_145630 [Chlorella variabilis]
Length=290

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            + +PGQ  D P E + LR FY SL +Q P SEMA  W + HGLLP
Sbjct  140  FDMPGQTRDTPPEVDALRRFYSSLKEQRPGSEMATRWCVHHGLLP  184



>ref|XP_008801507.1| PREDICTED: uncharacterized protein LOC103715602 [Phoenix dactylifera]
Length=213

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 74/99 (75%), Gaps = 8/99 (8%)
 Frame = +1

Query  580  FYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqLRTGTPIKSPTRPVSVG  759
            ++ S S+ +P S    + +MEHGLL P++AKKA+E+KQ++Q+QLR GTPIKS T+     
Sbjct  123  YFFSNSQILPFST---YRMMEHGLLSPERAKKAYERKQKRQQQLRMGTPIKS-TKQERPE  178

Query  760  SSKQPQQVSKNGDIKAKKRLNNdsdddddFILSPKRRKG  876
            SSK+PQ VSKNGD+KAKKR+N    DDDDFI+  K+ +G
Sbjct  179  SSKKPQ-VSKNGDVKAKKRVN---YDDDDFIVKQKKSRG  213



>gb|KDO84874.1| hypothetical protein CISIN_1g042570mg, partial [Citrus sinensis]
Length=179

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  562  REPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            R+PLR+FYE+L KQ+P SEMA+ W+ME GLL  D
Sbjct  56   RDPLRIFYETLYKQVPHSEMAQLWMMESGLLSFD  89



>gb|EJY77918.1| hypothetical protein OXYTRI_00440 [Oxytricha trifallax]
Length=236

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            + +PGQ  + P+E + LR FYE+L +Q P S MAE ++++HGLLP D
Sbjct  173  FDIPGQTKETPDEGDGLRAFYETLHQQKPQSIMAEQYMLKHGLLPFD  219



>ref|XP_001032072.1| hypothetical protein TTHERM_00704020 [Tetrahymena thermophila]
Length=892

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  529  LPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLL  654
            LPGQKF  P+E   LR+FYE+L++Q PSSEMA  + ME+GLL
Sbjct  94   LPGQKFVTPDEDNGLRVFYETLNRQKPSSEMALKYCMENGLL  135



>ref|XP_001694269.1| hypothetical protein CHLREDRAFT_95055 [Chlamydomonas reinhardtii]
 gb|EDP02702.1| predicted protein [Chlamydomonas reinhardtii]
Length=63

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  529  LPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPD  663
            +PGQ  + P E + LR FY SL +QIP SEMA+ W ++HGLL  D
Sbjct  1    MPGQTREAPPETDSLRKFYTSLLEQIPESEMAKKWCLQHGLLSRD  45



>ref|XP_005642675.1| hypothetical protein COCSUDRAFT_55002 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18131.1| hypothetical protein COCSUDRAFT_55002 [Coccomyxa subellipsoidea 
C-169]
Length=190

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  529  LPGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLP  657
            +PGQ  + P+E +PLR FY SL +Q P S +A+ WL++ GLLP
Sbjct  1    MPGQTRETPDETDPLRKFYTSLKEQRPDSAIAKKWLLQTGLLP  43



>ref|XP_005534846.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80239.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=176

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 5/49 (10%)
 Frame = +1

Query  523  YSLPGQKFDVPEEREPLRLFY-----ESLSKQIPSSEMAEFWLMEHGLL  654
            Y+LPGQ+ D P E +PLR+FY     E L K   SS +A+ WLM HGLL
Sbjct  104  YALPGQRRDPPPENDPLRIFYTTMREEKLRKYGRSSVLADEWLMVHGLL  152



>gb|EMS60292.1| hypothetical protein TRIUR3_07110 [Triticum urartu]
Length=388

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 47/90 (52%), Gaps = 30/90 (33%)
 Frame = +1

Query  562  REPLRLFYESLSKQIPSSEMAEFW------------------------------LMEHGL  651
            R+PLR+FYESL +Q+P SEMA FW                              LME GL
Sbjct  208  RDPLRIFYESLYEQVPDSEMAAFWLYASALYLSIVVMKQVLLAAEVHFSWVNMRLMEWGL  267

Query  652  LPPDkakkafekkqrkqkqLRTGTPIKSPT  741
            LP D A + F +KQ +++ L+  +P+K+P+
Sbjct  268  LPLDVATEVFARKQGQKQVLKLRSPVKTPS  297



>ref|XP_002181495.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46709.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=112

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +1

Query  532  PGQKFDVPEEREPLRLFYESLSKQIPSSEMAEFWLMEHGLLPPDkakkafekkqrkqkqL  711
            PGQKF  P      R+FYE+L +Q P S MA+ W + +G+LP D+A++  +K   +++Q+
Sbjct  7    PGQKFPTPTPGFGDRVFYETLLRQRPDSIMAQEWCVSYGVLPHDEAERLHKKVTDRKRQM  66

Query  712  RT--GTPIKSPTRPVSVGSSKQ  771
            R   G+   SP R  SV + K+
Sbjct  67   RLGGGSAATSPARKTSVKAKKR  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2557218196608