BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c117048_g1_i1 len=406 path=[384:0-405]

Length=406
                                                                      Score     E

ref|XP_009762786.1|  PREDICTED: WD repeat-containing protein 11 i...    227   1e-66   
ref|XP_009762788.1|  PREDICTED: WD repeat-containing protein 11 i...    227   1e-66   
ref|XP_009617309.1|  PREDICTED: WD repeat-containing protein 11-l...    221   9e-66   
ref|XP_009617310.1|  PREDICTED: WD repeat-containing protein 11-l...    219   8e-65   
ref|XP_009762787.1|  PREDICTED: WD repeat-containing protein 11 i...    222   9e-65   
ref|XP_010323299.1|  PREDICTED: WD repeat-containing protein 11 i...    223   1e-64   
ref|XP_010323297.1|  PREDICTED: WD repeat-containing protein 11 i...    223   2e-64   
ref|XP_006358290.1|  PREDICTED: WD repeat-containing protein 11-like    222   4e-64   
emb|CDP10435.1|  unnamed protein product                                212   2e-60   
ref|XP_009368877.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    203   3e-57   
ref|XP_008337272.1|  PREDICTED: WD repeat-containing protein 11-l...    202   4e-57   
ref|XP_008337271.1|  PREDICTED: WD repeat-containing protein 11-l...    202   5e-57   
ref|XP_008337270.1|  PREDICTED: WD repeat-containing protein 11-l...    202   6e-57   
ref|XP_008337269.1|  PREDICTED: WD repeat-containing protein 11-l...    202   6e-57   
ref|XP_007204676.1|  hypothetical protein PRUPE_ppa000324mg             202   7e-57   
ref|XP_008242799.1|  PREDICTED: WD repeat-containing protein 11         201   1e-56   
ref|XP_009364003.1|  PREDICTED: WD repeat-containing protein 11-l...    201   1e-56   
ref|XP_009364004.1|  PREDICTED: WD repeat-containing protein 11-l...    201   1e-56   
ref|XP_011017794.1|  PREDICTED: WD repeat-containing protein 11 i...    200   4e-56   
ref|XP_011017793.1|  PREDICTED: WD repeat-containing protein 11 i...    200   4e-56   
ref|XP_007013497.1|  Transducin family protein / WD-40 repeat fam...    198   9e-56   
ref|XP_007013495.1|  Transducin family protein / WD-40 repeat fam...    199   1e-55   
ref|XP_007013496.1|  Transducin family protein / WD-40 repeat fam...    198   1e-55   
ref|XP_002325208.1|  hypothetical protein POPTR_0018s12850g             197   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002875574.1|  transducin family protein                          195   2e-54   
gb|EYU34987.1|  hypothetical protein MIMGU_mgv1a0003443mg               191   2e-54   
gb|KDP30267.1|  hypothetical protein JCGZ_17049                         195   2e-54   
ref|XP_006475888.1|  PREDICTED: WD repeat-containing protein 11-l...    194   4e-54   
gb|KDO80184.1|  hypothetical protein CISIN_1g000703mg                   194   4e-54   
ref|XP_006475886.1|  PREDICTED: WD repeat-containing protein 11-l...    194   4e-54   
ref|XP_006475887.1|  PREDICTED: WD repeat-containing protein 11-l...    194   4e-54   
ref|XP_004288789.1|  PREDICTED: uncharacterized protein LOC101293525    194   5e-54   
ref|XP_006450880.1|  hypothetical protein CICLE_v10007259mg             194   5e-54   
gb|KHG28159.1|  WD repeat-containing 11                                 193   8e-54   
ref|XP_010103723.1|  hypothetical protein L484_016638                   192   1e-53   
emb|CBI28216.3|  unnamed protein product                                191   3e-53   
ref|XP_010656441.1|  PREDICTED: WD repeat-containing protein 11 i...    191   4e-53   
ref|XP_010656440.1|  PREDICTED: WD repeat-containing protein 11 i...    191   4e-53   
ref|NP_189790.2|  transducin/WD40 domain-containing protein             191   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010656442.1|  PREDICTED: WD repeat-containing protein 11 i...    191   4e-53   
ref|NP_001154659.1|  transducin/WD40 domain-containing protein          191   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010656443.1|  PREDICTED: WD repeat-containing protein 11 i...    191   4e-53   
gb|AAF03461.1|AC009992_3  unknown protein                               191   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190004.1|  transducin/WD40 domain-containing protein          191   5e-53   
ref|XP_010535861.1|  PREDICTED: WD repeat-containing protein 11         190   8e-53   
ref|XP_008385402.1|  PREDICTED: WD repeat-containing protein 11-like    190   1e-52   
gb|AES91569.2|  transducin family protein/WD-40 repeat protein          189   1e-52   
ref|XP_003609372.1|  WD repeat-containing protein                       189   2e-52   
gb|KCW82889.1|  hypothetical protein EUGRSUZ_C04259                     188   3e-52   
emb|CDY54259.1|  BnaCnng26570D                                          188   3e-52   
ref|XP_010050050.1|  PREDICTED: WD repeat-containing protein 11 i...    188   4e-52   
ref|XP_010050048.1|  PREDICTED: WD repeat-containing protein 11 i...    188   5e-52   
emb|CDY63491.1|  BnaAnng18960D                                          187   7e-52   
gb|KHN22115.1|  WD repeat-containing protein 11                         187   7e-52   
ref|XP_009124119.1|  PREDICTED: WD repeat-containing protein 11         186   2e-51   
ref|XP_004508475.1|  PREDICTED: WD repeat-containing protein 11-like    186   2e-51   
ref|XP_010496533.1|  PREDICTED: WD repeat-containing protein 11-like    186   2e-51   
ref|XP_010425785.1|  PREDICTED: WD repeat-containing protein 11-like    185   5e-51   
ref|XP_006594234.1|  PREDICTED: WD repeat-containing protein 11-l...    185   7e-51   
ref|XP_006594235.1|  PREDICTED: WD repeat-containing protein 11-l...    185   8e-51   
ref|XP_006279362.1|  hypothetical protein CARUB_v10008020mg             184   1e-50   
gb|KFK33847.1|  hypothetical protein AALP_AA5G067600                    184   1e-50   
ref|XP_010412480.1|  PREDICTED: WD repeat-containing protein 11-like    183   2e-50   
ref|XP_007155027.1|  hypothetical protein PHAVU_003G167000g             177   3e-50   
ref|XP_006392568.1|  hypothetical protein EUTSA_v10011188mg             182   7e-50   
ref|XP_004172171.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    172   3e-48   
ref|XP_004150033.1|  PREDICTED: WD repeat-containing protein 11-like    174   5e-47   
ref|XP_011078394.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    168   4e-45   
ref|XP_002527186.1|  nucleotide binding protein, putative               168   4e-45   Ricinus communis
ref|XP_008443973.1|  PREDICTED: WD repeat-containing protein 11         168   5e-45   
ref|XP_010250155.1|  PREDICTED: WD repeat-containing protein 11         164   2e-43   
gb|EPS68588.1|  hypothetical protein M569_06178                         160   2e-42   
ref|XP_010533145.1|  PREDICTED: WD repeat-containing protein 11 i...    160   3e-42   
ref|XP_010533146.1|  PREDICTED: WD repeat-containing protein 11 i...    160   3e-42   
ref|XP_008809225.1|  PREDICTED: WD repeat-containing protein 11 i...    156   9e-41   
ref|XP_008809224.1|  PREDICTED: WD repeat-containing protein 11 i...    156   9e-41   
ref|XP_010922121.1|  PREDICTED: WD repeat-containing protein 11         154   4e-40   
ref|XP_010247604.1|  PREDICTED: WD repeat-containing protein 11-like    151   1e-39   
ref|XP_010687946.1|  PREDICTED: WD repeat-containing protein 11         151   6e-39   
ref|XP_010417809.1|  PREDICTED: WD repeat-containing protein 11-like    149   2e-38   
ref|XP_006296211.1|  hypothetical protein CARUB_v10025376mg             148   4e-38   
ref|XP_010510887.1|  PREDICTED: WD repeat-containing protein 11-l...    146   3e-37   
ref|XP_010510886.1|  PREDICTED: WD repeat-containing protein 11-l...    146   3e-37   
ref|XP_010510885.1|  PREDICTED: WD repeat-containing protein 11-l...    146   3e-37   
ref|NP_850083.1|  uncharacterized protein                               145   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878992.1|  hypothetical protein ARALYDRAFT_481528             142   4e-36   
ref|XP_006842045.1|  hypothetical protein AMTR_s00078p00015380          141   1e-35   
gb|KGN65342.1|  hypothetical protein Csa_1G351950                       140   4e-35   
ref|XP_010473047.1|  PREDICTED: WD repeat-containing protein 11-l...    139   6e-35   
ref|XP_010473046.1|  PREDICTED: WD repeat-containing protein 11-l...    139   7e-35   
ref|XP_010473044.1|  PREDICTED: WD repeat-containing protein 11-l...    139   7e-35   
ref|XP_009381634.1|  PREDICTED: WD repeat-containing protein 11-like    133   8e-33   
ref|XP_002451504.1|  hypothetical protein SORBIDRAFT_04g002960          133   1e-32   Sorghum bicolor [broomcorn]
gb|AFW70064.1|  hypothetical protein ZEAMMB73_820023                    131   5e-32   
ref|XP_008681199.1|  PREDICTED: uncharacterized protein LOC100193...    131   5e-32   
ref|XP_004951954.1|  PREDICTED: WD repeat-containing protein 11-like    126   3e-30   
gb|AAC14509.1|  unknown protein                                         122   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133929.1|  PREDICTED: WD repeat-containing protein 11         119   8e-28   
emb|CDX83244.1|  BnaA03g22620D                                          119   8e-28   
gb|EMS63946.1|  WD repeat-containing protein 11                         117   2e-27   
dbj|BAJ97189.1|  predicted protein                                      117   3e-27   
ref|XP_003574282.1|  PREDICTED: WD repeat-containing protein 11-like    117   3e-27   
gb|EMT08578.1|  hypothetical protein F775_10973                         117   3e-27   
gb|EEE56264.1|  hypothetical protein OsJ_05300                          115   2e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CDY38532.1|  BnaC03g26650D                                          112   2e-25   
ref|XP_006646857.1|  PREDICTED: WD repeat-containing protein 11-l...    104   5e-23   
ref|XP_001771311.1|  predicted protein                                  101   9e-22   
ref|XP_001758093.1|  predicted protein                                92.4    1e-18   
ref|XP_002966240.1|  hypothetical protein SELMODRAFT_407617           84.0    1e-15   
ref|XP_002982312.1|  hypothetical protein SELMODRAFT_268579           83.2    2e-15   
ref|XP_008809226.1|  PREDICTED: WD repeat-containing protein 11 i...  81.6    6e-15   
gb|AFW70065.1|  hypothetical protein ZEAMMB73_820023                  79.0    4e-14   
ref|XP_002521541.1|  hypothetical protein RCOM_0534980                55.8    8e-08   Ricinus communis



>ref|XP_009762786.1| PREDICTED: WD repeat-containing protein 11 isoform X1 [Nicotiana 
sylvestris]
Length=920

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD+NIEVLYCAHLDGK STWRRK+GEQVH MCAMEEL+PSIGTSVPSPS
Sbjct  293  PRGCGKFLEVLPDSNIEVLYCAHLDGKISTWRRKDGEQVHTMCAMEELMPSIGTSVPSPS  352

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA VISHSD+ +QNI KLYSD H S+  D DNP+D CDESLV+SKT LISISDDG +WK
Sbjct  353  ILAAVISHSDAALQNIGKLYSDAHHSVDVDFDNPFDFCDESLVLSKTRLISISDDGKVWK  412

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  413  WLLTAEGSLDVQKD  426



>ref|XP_009762788.1| PREDICTED: WD repeat-containing protein 11 isoform X3 [Nicotiana 
sylvestris]
Length=906

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD+NIEVLYCAHLDGK STWRRK+GEQVH MCAMEEL+PSIGTSVPSPS
Sbjct  293  PRGCGKFLEVLPDSNIEVLYCAHLDGKISTWRRKDGEQVHTMCAMEELMPSIGTSVPSPS  352

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA VISHSD+ +QNI KLYSD H S+  D DNP+D CDESLV+SKT LISISDDG +WK
Sbjct  353  ILAAVISHSDAALQNIGKLYSDAHHSVDVDFDNPFDFCDESLVLSKTRLISISDDGKVWK  412

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  413  WLLTAEGSLDVQKD  426



>ref|XP_009617309.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Nicotiana 
tomentosiformis]
Length=622

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD+NIEVLYCAHLDGK STWRRK+ EQVH MCAMEEL+PSIGTSVPSPS
Sbjct  293  PRGCGKFLEVLPDSNIEVLYCAHLDGKLSTWRRKDREQVHTMCAMEELMPSIGTSVPSPS  352

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA VISHSD+ +QNI KLYSD H S+  D DN +D CDESLV+SKT LISISDDG +WK
Sbjct  353  ILAAVISHSDAALQNIGKLYSDAHHSVDVDFDNLFDFCDESLVLSKTRLISISDDGKVWK  412

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  413  WLLTAEGSVDVQKD  426



>ref|XP_009617310.1| PREDICTED: WD repeat-containing protein 11-like isoform X2 [Nicotiana 
tomentosiformis]
Length=621

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD+NIEVLYCAHLDGK STWRRKE EQVH MCAMEEL+PSIGTSVPSPS
Sbjct  293  PRGCGKFLEVLPDSNIEVLYCAHLDGKLSTWRRKE-EQVHTMCAMEELMPSIGTSVPSPS  351

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA VISHSD+ +QNI KLYSD H S+  D DN +D CDESLV+SKT LISISDDG +WK
Sbjct  352  ILAAVISHSDAALQNIGKLYSDAHHSVDVDFDNLFDFCDESLVLSKTRLISISDDGKVWK  411

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  412  WLLTAEGSVDVQKD  425



>ref|XP_009762787.1| PREDICTED: WD repeat-containing protein 11 isoform X2 [Nicotiana 
sylvestris]
Length=919

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD+NIEVLYCAHLDGK STWRRKE EQVH MCAMEEL+PSIGTSVPSPS
Sbjct  293  PRGCGKFLEVLPDSNIEVLYCAHLDGKISTWRRKE-EQVHTMCAMEELMPSIGTSVPSPS  351

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA VISHSD+ +QNI KLYSD H S+  D DNP+D CDESLV+SKT LISISDDG +WK
Sbjct  352  ILAAVISHSDAALQNIGKLYSDAHHSVDVDFDNPFDFCDESLVLSKTRLISISDDGKVWK  411

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  412  WLLTAEGSLDVQKD  425



>ref|XP_010323299.1| PREDICTED: WD repeat-containing protein 11 isoform X2 [Solanum 
lycopersicum]
Length=1099

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD+NIEVLYCAHLDGK STWRRK+GEQVH MCAMEEL+PSIGT++PSPS
Sbjct  287  PRGCGKFLEVLPDSNIEVLYCAHLDGKLSTWRRKDGEQVHTMCAMEELMPSIGTTIPSPS  346

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA VISHSD+  Q I KLYSD H S   D DNP+D CDESLV+SKT LI+ISDDG +WK
Sbjct  347  ILAAVISHSDAAFQTIGKLYSDAHHSADVDFDNPFDFCDESLVLSKTRLITISDDGKVWK  406

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  407  WLLTAEGSVDIQKD  420



>ref|XP_010323297.1| PREDICTED: WD repeat-containing protein 11 isoform X1 [Solanum 
lycopersicum]
Length=1314

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD+NIEVLYCAHLDGK STWRRK+GEQVH MCAMEEL+PSIGT++PSPS
Sbjct  287  PRGCGKFLEVLPDSNIEVLYCAHLDGKLSTWRRKDGEQVHTMCAMEELMPSIGTTIPSPS  346

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA VISHSD+  Q I KLYSD H S   D DNP+D CDESLV+SKT LI+ISDDG +WK
Sbjct  347  ILAAVISHSDAAFQTIGKLYSDAHHSADVDFDNPFDFCDESLVLSKTRLITISDDGKVWK  406

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  407  WLLTAEGSVDIQKD  420



>ref|XP_006358290.1| PREDICTED: WD repeat-containing protein 11-like [Solanum tuberosum]
Length=1314

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLE+LPD+NIEVLYCAHLDGK STWRRK+GEQVH MCAMEEL+PSIGT+VPSPS
Sbjct  287  PRGCGKFLELLPDSNIEVLYCAHLDGKLSTWRRKDGEQVHTMCAMEELMPSIGTAVPSPS  346

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LA V+SHSD+  Q I KLYSD H S+  D DNP+D CDESLV+SKT LI+ISDDG +WK
Sbjct  347  ILAAVVSHSDAAFQTIGKLYSDAHHSVDVDFDNPFDFCDESLVLSKTRLITISDDGKVWK  406

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  407  WLLTAEGSVDIQKD  420



>emb|CDP10435.1| unnamed protein product [Coffea canephora]
Length=1330

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VL D+N+EV YCAH+DGK STWRRK GEQVH+MC MEEL+PS+GT VPSPS
Sbjct  295  PRGCGKFLDVLADSNMEVFYCAHVDGKVSTWRRKGGEQVHIMCMMEELMPSVGTPVPSPS  354

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LAVV+S +DST+QNISKL SD H S   D +NP+D CDESLVISKT +ISISDDG +WK
Sbjct  355  ILAVVVSQTDSTLQNISKLCSDVHSSFAVDFNNPFDFCDESLVISKTNMISISDDGKIWK  414

Query  46   WLLTAEGSGDEQKNA  2
            WLLTAEG GD   N+
Sbjct  415  WLLTAEGFGDGSTNS  429



>ref|XP_009368877.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
11-like [Pyrus x bretschneideri]
Length=1344

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKEG QVH+MC+MEEL+PSIGTSVPSP 
Sbjct  299  PRGCGKFLDVLPDPNYEFLYCAHLDGKLSTWRRKEGGQVHIMCSMEELMPSIGTSVPSPL  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLY--ADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA+VIS SDST+QNI KLYSD   S +   D DNP+D CDE L++SKT LISISDDG +
Sbjct  359  VLALVISQSDSTLQNIGKLYSDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGKI  418

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  D +K+
Sbjct  419  WNWLLTAEGLEDNRKD  434



>ref|XP_008337272.1| PREDICTED: WD repeat-containing protein 11-like isoform X4 [Malus 
domestica]
Length=1127

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 111/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKEG QVH+MC+MEEL+PSIGTSVPSP 
Sbjct  300  PRGCGKFLDVLPDPNYEFLYCAHLDGKLSTWRRKEGGQVHIMCSMEELMPSIGTSVPSPL  359

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLY--ADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA VIS SDST+QNI KLYSD   S +   D DNP+D CDE L++SKT LISISDDG +
Sbjct  360  VLAXVISQSDSTLQNIGKLYSDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGKI  419

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  D +K+
Sbjct  420  WNWLLTAEGLEDNRKD  435



>ref|XP_008337271.1| PREDICTED: WD repeat-containing protein 11-like isoform X3 [Malus 
domestica]
Length=1335

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 111/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKEG QVH+MC+MEEL+PSIGTSVPSP 
Sbjct  300  PRGCGKFLDVLPDPNYEFLYCAHLDGKLSTWRRKEGGQVHIMCSMEELMPSIGTSVPSPL  359

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLY--ADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA VIS SDST+QNI KLYSD   S +   D DNP+D CDE L++SKT LISISDDG +
Sbjct  360  VLAXVISQSDSTLQNIGKLYSDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGKI  419

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  D +K+
Sbjct  420  WNWLLTAEGLEDNRKD  435



>ref|XP_008337270.1| PREDICTED: WD repeat-containing protein 11-like isoform X2 [Malus 
domestica]
Length=1345

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 111/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKEG QVH+MC+MEEL+PSIGTSVPSP 
Sbjct  300  PRGCGKFLDVLPDPNYEFLYCAHLDGKLSTWRRKEGGQVHIMCSMEELMPSIGTSVPSPL  359

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLY--ADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA VIS SDST+QNI KLYSD   S +   D DNP+D CDE L++SKT LISISDDG +
Sbjct  360  VLAXVISQSDSTLQNIGKLYSDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGKI  419

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  D +K+
Sbjct  420  WNWLLTAEGLEDNRKD  435



>ref|XP_008337269.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Malus 
domestica]
Length=1346

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 111/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKEG QVH+MC+MEEL+PSIGTSVPSP 
Sbjct  300  PRGCGKFLDVLPDPNYEFLYCAHLDGKLSTWRRKEGGQVHIMCSMEELMPSIGTSVPSPL  359

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLY--ADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA VIS SDST+QNI KLYSD   S +   D DNP+D CDE L++SKT LISISDDG +
Sbjct  360  VLAXVISQSDSTLQNIGKLYSDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGKI  419

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  D +K+
Sbjct  420  WNWLLTAEGLEDNRKD  435



>ref|XP_007204676.1| hypothetical protein PRUPE_ppa000324mg [Prunus persica]
 gb|EMJ05875.1| hypothetical protein PRUPE_ppa000324mg [Prunus persica]
Length=1286

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKE EQVH+MC+MEELIPSIGTSVPSP 
Sbjct  299  PRGCGKFLDVLPDPNHEYLYCAHLDGKLSTWRRKEREQVHIMCSMEELIPSIGTSVPSPL  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLY--ADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LA+VIS SDST+QN+SKLYSD   S +   D DNP+D CDE L++SKT LISISDDG +
Sbjct  359  LLALVISQSDSTLQNVSKLYSDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGKI  418

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG+ D  K+
Sbjct  419  WDWLLTAEGAEDNPKD  434



>ref|XP_008242799.1| PREDICTED: WD repeat-containing protein 11 [Prunus mume]
Length=1337

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKE EQVH+MC+MEELIPSIGTSVPSP 
Sbjct  299  PRGCGKFLDVLPDPNHEYLYCAHLDGKLSTWRRKEREQVHIMCSMEELIPSIGTSVPSPL  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLY--ADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LA+VIS SDST QN+SKLYSD   S +   D DNP+D CDE L++SKT LISISDDG +
Sbjct  359  LLALVISQSDSTFQNVSKLYSDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGKI  418

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG+ D  K+
Sbjct  419  WDWLLTAEGAEDNPKD  434



>ref|XP_009364003.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Pyrus 
x bretschneideri]
Length=1344

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGK L+VLPD N E LYCAHLDGK STWRRKEGEQVH+MC+MEEL+PSIGTSVPSPS
Sbjct  299  PRGCGKLLDVLPDPNHEFLYCAHLDGKLSTWRRKEGEQVHIMCSMEELMPSIGTSVPSPS  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHP-SLY--ADPDNPYDSCDESLVISKTPLISISDDGI  56
            +LA+VIS SDST+QN+ K+YSD  P S +   D DNP+D CDE L++SKT LISISDDG 
Sbjct  359  LLALVISQSDSTLQNVGKIYSDDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGK  418

Query  55   LWKWLLTAEGSGDEQKN  5
            +W WLLTAEG  D +K+
Sbjct  419  IWNWLLTAEGLEDNRKD  435



>ref|XP_009364004.1| PREDICTED: WD repeat-containing protein 11-like isoform X2 [Pyrus 
x bretschneideri]
Length=1343

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGK L+VLPD N E LYCAHLDGK STWRRKEGEQVH+MC+MEEL+PSIGTSVPSPS
Sbjct  299  PRGCGKLLDVLPDPNHEFLYCAHLDGKLSTWRRKEGEQVHIMCSMEELMPSIGTSVPSPS  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHP-SLY--ADPDNPYDSCDESLVISKTPLISISDDGI  56
            +LA+VIS SDST+QN+ K+YSD  P S +   D DNP+D CDE L++SKT LISISDDG 
Sbjct  359  LLALVISQSDSTLQNVGKIYSDDVPHSPFPDVDFDNPFDFCDEPLLVSKTHLISISDDGK  418

Query  55   LWKWLLTAEGSGDEQKN  5
            +W WLLTAEG  D +K+
Sbjct  419  IWNWLLTAEGLEDNRKD  435



>ref|XP_011017794.1| PREDICTED: WD repeat-containing protein 11 isoform X2 [Populus 
euphratica]
Length=1345

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDGK S WRRKEGEQVH+MCAMEEL+PSIGTSVPSPS
Sbjct  305  PRGCGKFLDVLPDPNNELLYCAHLDGKLSIWRRKEGEQVHVMCAMEELMPSIGTSVPSPS  364

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLAV I  S+ST+Q+++K+ SD    PS   D DNP+D CD+++V S T +ISISDDG +
Sbjct  365  VLAVAICQSESTLQHVAKICSDAPDSPSAEVDFDNPFDFCDDTVVHSATHMISISDDGKV  424

Query  52   WKWLLTAEGSGDEQKN  5
            WKWLLTAEG+GD  K+
Sbjct  425  WKWLLTAEGTGDNHKD  440



>ref|XP_011017793.1| PREDICTED: WD repeat-containing protein 11 isoform X1 [Populus 
euphratica]
Length=1346

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDGK S WRRKEGEQVH+MCAMEEL+PSIGTSVPSPS
Sbjct  305  PRGCGKFLDVLPDPNNELLYCAHLDGKLSIWRRKEGEQVHVMCAMEELMPSIGTSVPSPS  364

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLAV I  S+ST+Q+++K+ SD    PS   D DNP+D CD+++V S T +ISISDDG +
Sbjct  365  VLAVAICQSESTLQHVAKICSDAPDSPSAEVDFDNPFDFCDDTVVHSATHMISISDDGKV  424

Query  52   WKWLLTAEGSGDEQKN  5
            WKWLLTAEG+GD  K+
Sbjct  425  WKWLLTAEGTGDNHKD  440



>ref|XP_007013497.1| Transducin family protein / WD-40 repeat family protein isoform 
3 [Theobroma cacao]
 gb|EOY31116.1| Transducin family protein / WD-40 repeat family protein isoform 
3 [Theobroma cacao]
Length=1094

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E++YCAHLDGK S WRRKEGEQ+H+MC MEEL+PSIG+SVPSPS
Sbjct  305  PRGCAKFLDVLPDPNQELVYCAHLDGKLSIWRRKEGEQIHIMCTMEELMPSIGSSVPSPS  364

Query  226  VLAVVISHSDSTIQNISKLYSD-GHPSLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            VLAV+IS S+ST+QNISKLYS   + +   D DNP+D CD++L++ KT L+SISDDG LW
Sbjct  365  VLAVLISQSESTLQNISKLYSGLSNGASDEDFDNPFDFCDDTLLVFKTRLMSISDDGKLW  424

Query  49   KWLLTAEGSGDEQKN  5
             W+LTAEG+GD QK+
Sbjct  425  SWILTAEGTGDMQKD  439



>ref|XP_007013495.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOY31114.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
Length=1349

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E++YCAHLDGK S WRRKEGEQ+H+MC MEEL+PSIG+SVPSPS
Sbjct  305  PRGCAKFLDVLPDPNQELVYCAHLDGKLSIWRRKEGEQIHIMCTMEELMPSIGSSVPSPS  364

Query  226  VLAVVISHSDSTIQNISKLYSD-GHPSLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            VLAV+IS S+ST+QNISKLYS   + +   D DNP+D CD++L++ KT L+SISDDG LW
Sbjct  365  VLAVLISQSESTLQNISKLYSGLSNGASDEDFDNPFDFCDDTLLVFKTRLMSISDDGKLW  424

Query  49   KWLLTAEGSGDEQKN  5
             W+LTAEG+GD QK+
Sbjct  425  SWILTAEGTGDMQKD  439



>ref|XP_007013496.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 gb|EOY31115.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
Length=1248

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E++YCAHLDGK S WRRKEGEQ+H+MC MEEL+PSIG+SVPSPS
Sbjct  305  PRGCAKFLDVLPDPNQELVYCAHLDGKLSIWRRKEGEQIHIMCTMEELMPSIGSSVPSPS  364

Query  226  VLAVVISHSDSTIQNISKLYSD-GHPSLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            VLAV+IS S+ST+QNISKLYS   + +   D DNP+D CD++L++ KT L+SISDDG LW
Sbjct  365  VLAVLISQSESTLQNISKLYSGLSNGASDEDFDNPFDFCDDTLLVFKTRLMSISDDGKLW  424

Query  49   KWLLTAEGSGDEQKN  5
             W+LTAEG+GD QK+
Sbjct  425  SWILTAEGTGDMQKD  439



>ref|XP_002325208.1| hypothetical protein POPTR_0018s12850g [Populus trichocarpa]
 gb|EEF03773.1| hypothetical protein POPTR_0018s12850g [Populus trichocarpa]
Length=1311

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDGK S WRRKEGEQVH+MCAMEEL+PSIGTSVPSPS
Sbjct  305  PRGCGKFLDVLPDPNNELLYCAHLDGKLSIWRRKEGEQVHVMCAMEELMPSIGTSVPSPS  364

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLAV I  S+ST+Q+++K+ SD    PS   D DNP+D CD+++V S T +ISISDDG +
Sbjct  365  VLAVAICQSESTLQHVAKICSDAPDSPSAEVDFDNPFDFCDDTVVHSTTHMISISDDGKV  424

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG+GD  K+
Sbjct  425  WNWLLTAEGTGDNHKD  440



>ref|XP_002875574.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51833.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=1348

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 111/135 (82%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYCAH+DG+ S WRRKEGEQ+H+MC MEE +PSIG S+PSPS
Sbjct  291  PRGCAKFLDVLPDPNKELLYCAHVDGRLSIWRRKEGEQLHVMCTMEEFMPSIGMSIPSPS  350

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++SHSDST+Q I+KL+SDG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  351  ALAVLLSHSDSTMQTITKLHSDGTSSI--DFDNPFDFYDESLLVSKTTFISLSDDGKIWK  408

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  409  WVLSAEGVEDALKNA  423



>gb|EYU34987.1| hypothetical protein MIMGU_mgv1a0003443mg, partial [Erythranthe 
guttata]
Length=621

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFLEVLPD N+EV YC HLDGK STWRRKE EQ+H+MC+M+EL+PSIGTSVPSP 
Sbjct  44   PRGCGKFLEVLPDVNMEVFYCVHLDGKLSTWRRKEEEQLHIMCSMDELMPSIGTSVPSPL  103

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            VLAV IS SD T+Q+I KL  D    +  D  NP+D  DES +ISKT LIS+SDDG +WK
Sbjct  104  VLAVAISQSDYTLQDIHKLCPDSDLDVM-DFSNPFDFLDESRIISKTHLISVSDDGKVWK  162

Query  46   WLLTAEGSGDEQKN  5
            WLLTAEGS D QK+
Sbjct  163  WLLTAEGSRDSQKD  176



>gb|KDP30267.1| hypothetical protein JCGZ_17049 [Jatropha curcas]
Length=1333

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYCAHLDG+ S WRRKEGEQVH+MC MEEL+P++G+SVPSPS
Sbjct  296  PRGCSKFLDVLPDPNNELLYCAHLDGRLSIWRRKEGEQVHIMCLMEELMPAVGSSVPSPS  355

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLAV +  S+ST+QN++KLY D    P    D DNP+D CD++L++SKT +ISISDDG +
Sbjct  356  VLAVTVCQSESTLQNVAKLYYDSPNTPLADMDFDNPFDFCDDTLLLSKTHVISISDDGKI  415

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLT+EG+GD QK+
Sbjct  416  WNWLLTSEGTGDTQKD  431



>ref|XP_006475888.1| PREDICTED: WD repeat-containing protein 11-like isoform X3 [Citrus 
sinensis]
Length=1342

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VL D N ++LYCAHLDGK S WRRKEGEQVH+MC MEELIPSIGTSVPSPS
Sbjct  294  PRGCAKFLDVLADPNNDLLYCAHLDGKLSIWRRKEGEQVHVMCTMEELIPSIGTSVPSPS  353

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAV++S S+STIQN++KL  D    PS   D D+P++  D++L++SKT LISISDDG +
Sbjct  354  ILAVLVSQSESTIQNVAKLCLDAPHSPSANVDIDSPFEFSDDTLLLSKTHLISISDDGKV  413

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLTAEG+GD QK+A
Sbjct  414  WNWLLTAEGAGDLQKDA  430



>gb|KDO80184.1| hypothetical protein CISIN_1g000703mg [Citrus sinensis]
Length=1341

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VL D N ++LYCAHLDGK S WRRKEGEQVH+MC MEELIPSIGTSVPSPS
Sbjct  294  PRGCAKFLDVLADPNNDLLYCAHLDGKLSIWRRKEGEQVHVMCTMEELIPSIGTSVPSPS  353

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAV++S S+STIQN++KL  D    PS   D D+P++  D++L++SKT LISISDDG +
Sbjct  354  ILAVLVSQSESTIQNVAKLCLDAPHSPSANVDIDSPFEFSDDTLLLSKTHLISISDDGKV  413

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLTAEG+GD QK+A
Sbjct  414  WNWLLTAEGAGDLQKDA  430



>ref|XP_006475886.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Citrus 
sinensis]
Length=1343

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VL D N ++LYCAHLDGK S WRRKEGEQVH+MC MEELIPSIGTSVPSPS
Sbjct  294  PRGCAKFLDVLADPNNDLLYCAHLDGKLSIWRRKEGEQVHVMCTMEELIPSIGTSVPSPS  353

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAV++S S+STIQN++KL  D    PS   D D+P++  D++L++SKT LISISDDG +
Sbjct  354  ILAVLVSQSESTIQNVAKLCLDAPHSPSANVDIDSPFEFSDDTLLLSKTHLISISDDGKV  413

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLTAEG+GD QK+A
Sbjct  414  WNWLLTAEGAGDLQKDA  430



>ref|XP_006475887.1| PREDICTED: WD repeat-containing protein 11-like isoform X2 [Citrus 
sinensis]
 gb|KDO80185.1| hypothetical protein CISIN_1g000703mg [Citrus sinensis]
Length=1342

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VL D N ++LYCAHLDGK S WRRKEGEQVH+MC MEELIPSIGTSVPSPS
Sbjct  294  PRGCAKFLDVLADPNNDLLYCAHLDGKLSIWRRKEGEQVHVMCTMEELIPSIGTSVPSPS  353

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAV++S S+STIQN++KL  D    PS   D D+P++  D++L++SKT LISISDDG +
Sbjct  354  ILAVLVSQSESTIQNVAKLCLDAPHSPSANVDIDSPFEFSDDTLLLSKTHLISISDDGKV  413

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLTAEG+GD QK+A
Sbjct  414  WNWLLTAEGAGDLQKDA  430



>ref|XP_004288789.1| PREDICTED: uncharacterized protein LOC101293525 [Fragaria vesca 
subsp. vesca]
Length=1360

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKF++VLPD N E LYC H+DG+ STWRRKEGEQVH MC+MEEL+PS+GTSVPSPS
Sbjct  298  PRGCGKFMDVLPDPNNEFLYCGHVDGRLSTWRRKEGEQVHEMCSMEELLPSLGTSVPSPS  357

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYA--DPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA+ IS SDST+QNI KLYSD   S ++  + DNP+D CD  LV+SKT L+SISDDG +
Sbjct  358  VLALAISQSDSTLQNIGKLYSDAPDSPFSAVEFDNPFDFCDAPLVLSKTHLVSISDDGKV  417

Query  52   WKWLLTAEG  26
            W WLLTAEG
Sbjct  418  WNWLLTAEG  426



>ref|XP_006450880.1| hypothetical protein CICLE_v10007259mg [Citrus clementina]
 gb|ESR64120.1| hypothetical protein CICLE_v10007259mg [Citrus clementina]
Length=1344

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VL D N ++LYCAHLDGK S WRRKEGEQVH+MC MEELIPSIGTSVPSPS
Sbjct  294  PRGCAKFLDVLADPNNDLLYCAHLDGKLSIWRRKEGEQVHVMCTMEELIPSIGTSVPSPS  353

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAV++S S+STIQN++KL  D    PS   D D+P++  D++L++SKT LISISDDG +
Sbjct  354  ILAVLVSQSESTIQNVAKLCLDAPHSPSANVDIDSPFEFSDDTLLLSKTHLISISDDGKV  413

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLTAEG+GD QK+A
Sbjct  414  WNWLLTAEGAGDLQKDA  430



>gb|KHG28159.1| WD repeat-containing 11 [Gossypium arboreum]
Length=1334

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+ YC HLDGK S WRRKEGEQVH+MC MEEL+PS+G+ VPSPS
Sbjct  292  PRGCAKFLDVLPDPNQELAYCTHLDGKISIWRRKEGEQVHVMCTMEELMPSLGSPVPSPS  351

Query  226  VLAVVISHSDSTIQNISKLYSD-GHPSLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            VLAV++S S+ST+QNISKLYSD  + +   D DNP++ CD++L+++KT L SISDDG LW
Sbjct  352  VLAVLVSQSESTLQNISKLYSDSSNGASDVDSDNPFEFCDDTLLVAKTRLFSISDDGKLW  411

Query  49   KWLLTAEGSGDEQKNA  2
             W+LTAEG G  QK+A
Sbjct  412  SWILTAEGEGVMQKDA  427



>ref|XP_010103723.1| hypothetical protein L484_016638 [Morus notabilis]
 gb|EXB96865.1| hypothetical protein L484_016638 [Morus notabilis]
Length=1232

 Score =   192 bits (488),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 92/135 (68%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKEGEQ H+MC+MEEL+PS+GTSVPSPS
Sbjct  310  PRGCGKFLDVLPDPNNEFLYCAHLDGKLSTWRRKEGEQAHIMCSMEELMPSLGTSVPSPS  369

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA VI  SDS ++N+ K+YS+    P    D D+P+D  DE L++SKT LISISDDG +
Sbjct  370  VLAAVICQSDSPLENVGKIYSNVPNSPFPVEDFDSPFDFYDEPLLVSKTHLISISDDGKI  429

Query  52   WKWLLTAEGSGDEQK  8
            W WLLTAEG  D QK
Sbjct  430  WNWLLTAEGDEDTQK  444



>emb|CBI28216.3| unnamed protein product [Vitis vinifera]
Length=1250

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDG+ STWRRKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  206  PRGCGKFLDVLPDPNNELLYCAHLDGRLSTWRRKEGEQVHVMCTMEELMPSIGTPVPSPS  265

Query  226  VLAVVISHSDSTIQNISKLY--SDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+Q +  LY       S   D DNP+D CDES  +SKT LISISDDG +
Sbjct  266  ILAVVICKSDSTLQCVGNLYSSGSCSSSFDMDFDNPFDFCDESFYVSKTHLISISDDGKI  325

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLT+EG+ D  K A
Sbjct  326  WNWLLTSEGTEDTHKEA  342



>ref|XP_010656441.1| PREDICTED: WD repeat-containing protein 11 isoform X2 [Vitis 
vinifera]
Length=1337

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDG+ STWRRKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  293  PRGCGKFLDVLPDPNNELLYCAHLDGRLSTWRRKEGEQVHVMCTMEELMPSIGTPVPSPS  352

Query  226  VLAVVISHSDSTIQNISKLY--SDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+Q +  LY       S   D DNP+D CDES  +SKT LISISDDG +
Sbjct  353  ILAVVICKSDSTLQCVGNLYSSGSCSSSFDMDFDNPFDFCDESFYVSKTHLISISDDGKI  412

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLT+EG+ D  K A
Sbjct  413  WNWLLTSEGTEDTHKEA  429



>ref|XP_010656440.1| PREDICTED: WD repeat-containing protein 11 isoform X1 [Vitis 
vinifera]
Length=1338

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDG+ STWRRKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  293  PRGCGKFLDVLPDPNNELLYCAHLDGRLSTWRRKEGEQVHVMCTMEELMPSIGTPVPSPS  352

Query  226  VLAVVISHSDSTIQNISKLY--SDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+Q +  LY       S   D DNP+D CDES  +SKT LISISDDG +
Sbjct  353  ILAVVICKSDSTLQCVGNLYSSGSCSSSFDMDFDNPFDFCDESFYVSKTHLISISDDGKI  412

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLT+EG+ D  K A
Sbjct  413  WNWLLTSEGTEDTHKEA  429



>ref|NP_189790.2| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE77713.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=1345

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL++LPD N E+LYC H+DG+ S WRRKEGEQVH+MC MEE +PSIG S+PSPS
Sbjct  288  PRGCAKFLDILPDPNKELLYCGHVDGRLSIWRRKEGEQVHVMCTMEEFMPSIGMSIPSPS  347

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++SHSDST+Q I+K++ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  348  ALAVLLSHSDSTMQTITKIHPDGTSSI--DFDNPFDFYDESLLVSKTTFISLSDDGKIWK  405

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  406  WVLSAEGVEDALKNA  420



>ref|XP_010656442.1| PREDICTED: WD repeat-containing protein 11 isoform X3 [Vitis 
vinifera]
Length=1337

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDG+ STWRRKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  293  PRGCGKFLDVLPDPNNELLYCAHLDGRLSTWRRKEGEQVHVMCTMEELMPSIGTPVPSPS  352

Query  226  VLAVVISHSDSTIQNISKLY--SDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+Q +  LY       S   D DNP+D CDES  +SKT LISISDDG +
Sbjct  353  ILAVVICKSDSTLQCVGNLYSSGSCSSSFDMDFDNPFDFCDESFYVSKTHLISISDDGKI  412

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLT+EG+ D  K A
Sbjct  413  WNWLLTSEGTEDTHKEA  429



>ref|NP_001154659.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE77714.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=1358

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL++LPD N E+LYC H+DG+ S WRRKEGEQVH+MC MEE +PSIG S+PSPS
Sbjct  288  PRGCAKFLDILPDPNKELLYCGHVDGRLSIWRRKEGEQVHVMCTMEEFMPSIGMSIPSPS  347

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++SHSDST+Q I+K++ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  348  ALAVLLSHSDSTMQTITKIHPDGTSSI--DFDNPFDFYDESLLVSKTTFISLSDDGKIWK  405

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  406  WVLSAEGVEDALKNA  420



>ref|XP_010656443.1| PREDICTED: WD repeat-containing protein 11 isoform X4 [Vitis 
vinifera]
Length=1239

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E+LYCAHLDG+ STWRRKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  293  PRGCGKFLDVLPDPNNELLYCAHLDGRLSTWRRKEGEQVHVMCTMEELMPSIGTPVPSPS  352

Query  226  VLAVVISHSDSTIQNISKLY--SDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+Q +  LY       S   D DNP+D CDES  +SKT LISISDDG +
Sbjct  353  ILAVVICKSDSTLQCVGNLYSSGSCSSSFDMDFDNPFDFCDESFYVSKTHLISISDDGKI  412

Query  52   WKWLLTAEGSGDEQKNA  2
            W WLLT+EG+ D  K A
Sbjct  413  WNWLLTSEGTEDTHKEA  429



>gb|AAF03461.1|AC009992_3 unknown protein [Arabidopsis thaliana]
Length=1350

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL++LPD N E+LYC H+DG+ S WRRKEGEQVH+MC MEE +PSIG S+PSPS
Sbjct  288  PRGCAKFLDILPDPNKELLYCGHVDGRLSIWRRKEGEQVHVMCTMEEFMPSIGMSIPSPS  347

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++SHSDST+Q I+K++ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  348  ALAVLLSHSDSTMQTITKIHPDGTSSI--DFDNPFDFYDESLLVSKTTFISLSDDGKIWK  405

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  406  WVLSAEGVEDALKNA  420



>ref|NP_001190004.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE77715.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=1376

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL++LPD N E+LYC H+DG+ S WRRKEGEQVH+MC MEE +PSIG S+PSPS
Sbjct  288  PRGCAKFLDILPDPNKELLYCGHVDGRLSIWRRKEGEQVHVMCTMEEFMPSIGMSIPSPS  347

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++SHSDST+Q I+K++ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  348  ALAVLLSHSDSTMQTITKIHPDGTSSI--DFDNPFDFYDESLLVSKTTFISLSDDGKIWK  405

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  406  WVLSAEGVEDALKNA  420



>ref|XP_010535861.1| PREDICTED: WD repeat-containing protein 11 [Tarenaya hassleriana]
Length=1321

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 111/134 (83%), Gaps = 2/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLP+ N E+LYCAH+DG+ S WRRKEGEQVH+MC +EEL+PSIG S+PSPS
Sbjct  292  PRGCAKFLDVLPNPNQELLYCAHVDGRLSIWRRKEGEQVHVMCTVEELMPSIGMSIPSPS  351

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +LAV++S SDST+Q ++KL+ D  PS+  D DNP+D  DESL++SKT  IS+SDDG +W+
Sbjct  352  MLAVLLSLSDSTMQTVTKLHPDSTPSV--DFDNPFDFYDESLLVSKTSFISLSDDGKIWR  409

Query  46   WLLTAEGSGDEQKN  5
            W+LTAEG  D QKN
Sbjct  410  WILTAEGVEDVQKN  423



>ref|XP_008385402.1| PREDICTED: WD repeat-containing protein 11-like [Malus domestica]
Length=1346

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 113/137 (82%), Gaps = 3/137 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N E LYCAHLDGK STWRRKEGEQVH+MC+MEEL+PSIGTSVPSPS
Sbjct  299  PRGCGKFLDVLPDPNHEFLYCAHLDGKLSTWRRKEGEQVHIMCSMEELMPSIGTSVPSPS  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHP---SLYADPDNPYDSCDESLVISKTPLISISDDGI  56
            +LA+VIS SDST+QN+SK+YSD  P       D DNP+D CDE L++SKT LISISDDG 
Sbjct  359  LLALVISQSDSTLQNVSKIYSDDVPHSPFPDXDFDNPFDFCDEPLLVSKTHLISISDDGK  418

Query  55   LWKWLLTAEGSGDEQKN  5
            +W WLLTA G  D +K+
Sbjct  419  IWNWLLTAXGLEDNRKD  435



>gb|AES91569.2| transducin family protein/WD-40 repeat protein [Medicago truncatula]
Length=1335

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E +YCAH+DGK STW+RK GEQVH M +MEEL+PS+GTSVPSPS
Sbjct  302  PRGCGKFLDVLPDPSNEWIYCAHVDGKLSTWKRKPGEQVHTMYSMEELMPSVGTSVPSPS  361

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+VV+  SDST+QNI K YSD    P L+ D DNP+D CDES +ISK  LISISDDG +
Sbjct  362  ILSVVLCQSDSTLQNIGKNYSDIPSSPYLHEDFDNPFDFCDESQIISKIHLISISDDGKI  421

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAE + D QK+
Sbjct  422  WDWLLTAEANADTQKD  437



>ref|XP_003609372.1| WD repeat-containing protein [Medicago truncatula]
Length=1581

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E +YCAH+DGK STW+RK GEQVH M +MEEL+PS+GTSVPSPS
Sbjct  302  PRGCGKFLDVLPDPSNEWIYCAHVDGKLSTWKRKPGEQVHTMYSMEELMPSVGTSVPSPS  361

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+VV+  SDST+QNI K YSD    P L+ D DNP+D CDES +ISK  LISISDDG +
Sbjct  362  ILSVVLCQSDSTLQNIGKNYSDIPSSPYLHEDFDNPFDFCDESQIISKIHLISISDDGKI  421

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAE + D QK+
Sbjct  422  WDWLLTAEANADTQKD  437



>gb|KCW82889.1| hypothetical protein EUGRSUZ_C04259 [Eucalyptus grandis]
Length=1242

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N + LYCAHLDG+ S W+RKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  198  PRGCGKFLDVLPDPNHDWLYCAHLDGRLSIWKRKEGEQVHVMCTMEELMPSIGTIVPSPS  257

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYA--DPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+QN++K YSD  PS  +  + DNP+D  D+SL++SKT LISISDDG +
Sbjct  258  ILAVVICESDSTLQNVAKQYSDAPPSPASSVEFDNPFDFSDDSLLVSKTRLISISDDGKV  317

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLT+EG    QK+
Sbjct  318  WNWLLTSEGDLCAQKD  333



>emb|CDY54259.1| BnaCnng26570D [Brassica napus]
Length=1117

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KF++VLPD N E+LYCAH+DG+ S WRR+EGEQVH+MC MEE +PSIG S+PSPS
Sbjct  74   PRGCAKFMDVLPDPNKELLYCAHVDGRLSIWRRQEGEQVHVMCTMEEFLPSIGMSIPSPS  133

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LA+++S SDST+Q I+KL+ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  134  ALAILLSQSDSTMQTITKLHPDGTSSV--DFDNPFDFYDESLIVSKTTFISLSDDGKIWK  191

Query  46   WLLTAEGSGDEQKN  5
            W+L+AEG  D  KN
Sbjct  192  WVLSAEGVEDALKN  205



>ref|XP_010050050.1| PREDICTED: WD repeat-containing protein 11 isoform X2 [Eucalyptus 
grandis]
Length=1345

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N + LYCAHLDG+ S W+RKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  301  PRGCGKFLDVLPDPNHDWLYCAHLDGRLSIWKRKEGEQVHVMCTMEELMPSIGTIVPSPS  360

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYA--DPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+QN++K YSD  PS  +  + DNP+D  D+SL++SKT LISISDDG +
Sbjct  361  ILAVVICESDSTLQNVAKQYSDAPPSPASSVEFDNPFDFSDDSLLVSKTRLISISDDGKV  420

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLT+EG    QK+
Sbjct  421  WNWLLTSEGDLCAQKD  436



>ref|XP_010050048.1| PREDICTED: WD repeat-containing protein 11 isoform X1 [Eucalyptus 
grandis]
Length=1387

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD N + LYCAHLDG+ S W+RKEGEQVH+MC MEEL+PSIGT VPSPS
Sbjct  301  PRGCGKFLDVLPDPNHDWLYCAHLDGRLSIWKRKEGEQVHVMCTMEELMPSIGTIVPSPS  360

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYA--DPDNPYDSCDESLVISKTPLISISDDGIL  53
            +LAVVI  SDST+QN++K YSD  PS  +  + DNP+D  D+SL++SKT LISISDDG +
Sbjct  361  ILAVVICESDSTLQNVAKQYSDAPPSPASSVEFDNPFDFSDDSLLVSKTRLISISDDGKV  420

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLT+EG    QK+
Sbjct  421  WNWLLTSEGDLCAQKD  436



>emb|CDY63491.1| BnaAnng18960D [Brassica napus]
Length=1115

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KF++VLPD N E+LYCAHLDG+ S WRR++GEQVH+MC MEE +PSIG S+PSPS
Sbjct  76   PRGCAKFMDVLPDPNKELLYCAHLDGRLSIWRRQQGEQVHVMCTMEEFLPSIGMSIPSPS  135

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LA+++S SDST+Q I+KL+ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  136  ALAILLSQSDSTMQTITKLHPDGTSSV--DFDNPFDFYDESLLVSKTTFISLSDDGKIWK  193

Query  46   WLLTAEGSGDEQKN  5
            W+L+AEG  D  KN
Sbjct  194  WVLSAEGVEDVLKN  207



>gb|KHN22115.1| WD repeat-containing protein 11 [Glycine soja]
Length=1165

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E +YCAHLDGK STWRRK GEQVH+M ++EEL+PS+GTSVPSPS
Sbjct  126  PRGCGKFLDVLPDPSNEWIYCAHLDGKLSTWRRKPGEQVHVMYSLEELMPSVGTSVPSPS  185

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+V++  SDS +QNI K YSD    P L  D DNP+D C ES ++SK  LISISDDG L
Sbjct  186  ILSVLLCQSDSILQNIGKNYSDVPSSPYLREDFDNPFDFCYESNIVSKIHLISISDDGKL  245

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  + QKN
Sbjct  246  WNWLLTAEGQANTQKN  261



>ref|XP_009124119.1| PREDICTED: WD repeat-containing protein 11 [Brassica rapa]
Length=1310

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KF++VLPD N E+LYCAHLDG+ S WRR++GEQVH+MC MEE +PSIG S+PSPS
Sbjct  288  PRGCAKFMDVLPDPNKELLYCAHLDGRLSIWRRQQGEQVHVMCTMEEFLPSIGMSIPSPS  347

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LA+++S SDST+Q I+KL+ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  348  ALAILLSQSDSTMQTITKLHPDGTSSV--DFDNPFDFYDESLLVSKTTFISLSDDGKIWK  405

Query  46   WLLTAEGSGDEQKN  5
            W+L+AEG  D  KN
Sbjct  406  WVLSAEGVEDVLKN  419



>ref|XP_004508475.1| PREDICTED: WD repeat-containing protein 11-like [Cicer arietinum]
Length=1323

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 109/136 (80%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGK L+VLPD + + +YCAHLDGK STWRRK GEQVH+M +MEEL+PS+GTSVPSPS
Sbjct  302  PRGCGKLLDVLPDPSNDWIYCAHLDGKLSTWRRKPGEQVHIMYSMEELMPSVGTSVPSPS  361

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+V++  SD+T+QNI K  SD    P L+ D DNP+D CDES +ISK  LISISDDG +
Sbjct  362  ILSVLLRQSDTTLQNIGKNCSDVPSSPYLHEDFDNPFDFCDESQIISKIHLISISDDGKI  421

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG+ D QK+
Sbjct  422  WNWLLTAEGNADNQKD  437



>ref|XP_010496533.1| PREDICTED: WD repeat-containing protein 11-like [Camelina sativa]
Length=1266

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYCAH+DG+ S WR+KEGEQVH+MC MEE +PSIG S+PSPS
Sbjct  284  PRGCAKFLDVLPDPNNELLYCAHVDGRLSIWRQKEGEQVHVMCTMEEFMPSIGLSIPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++S SDST+Q I+KLY D   S+  D DNP+D  DES+V+SKT   S+SDDG +WK
Sbjct  344  ALAVLLSQSDSTMQTITKLYPDETSSV--DFDNPFDFYDESIVVSKTTFFSLSDDGKIWK  401

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  402  WVLSAEGVEDALKNA  416



>ref|XP_010425785.1| PREDICTED: WD repeat-containing protein 11-like [Camelina sativa]
Length=1311

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYCAH+DG+ S WR+KEGEQVH+MC MEE +PSIG S+PSPS
Sbjct  284  PRGCAKFLDVLPDPNNELLYCAHVDGRLSIWRQKEGEQVHVMCTMEEFMPSIGLSIPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++S SDST+Q I+KL++D   S+  D DNP+D  DES+V+SKT   S+SDDG +WK
Sbjct  344  ALAVLLSQSDSTMQTITKLHTDETSSV--DFDNPFDFYDESIVVSKTTFFSLSDDGKIWK  401

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  402  WVLSAEGVEDALKNA  416



>ref|XP_006594234.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Glycine 
max]
Length=1335

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E +YCAHLDGK STWRRK GEQVH+M ++EEL+PS+GTSVPSPS
Sbjct  296  PRGCGKFLDVLPDPSNEWIYCAHLDGKLSTWRRKPGEQVHVMYSLEELMPSVGTSVPSPS  355

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+V++  SDS +QNI K YSD    P L  D +NP+D C ES ++SK  LISISDDG +
Sbjct  356  ILSVLLCQSDSILQNIGKNYSDVPSSPYLREDFENPFDFCYESNIVSKIHLISISDDGKM  415

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  + QKN
Sbjct  416  WNWLLTAEGQANTQKN  431



>ref|XP_006594235.1| PREDICTED: WD repeat-containing protein 11-like isoform X2 [Glycine 
max]
Length=1334

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E +YCAHLDGK STWRRK GEQVH+M ++EEL+PS+GTSVPSPS
Sbjct  296  PRGCGKFLDVLPDPSNEWIYCAHLDGKLSTWRRKPGEQVHVMYSLEELMPSVGTSVPSPS  355

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+V++  SDS +QNI K YSD    P L  D +NP+D C ES ++SK  LISISDDG +
Sbjct  356  ILSVLLCQSDSILQNIGKNYSDVPSSPYLREDFENPFDFCYESNIVSKIHLISISDDGKM  415

Query  52   WKWLLTAEGSGDEQKN  5
            W WLLTAEG  + QKN
Sbjct  416  WNWLLTAEGQANTQKN  431



>ref|XP_006279362.1| hypothetical protein CARUB_v10008020mg [Capsella rubella]
 gb|EOA12260.1| hypothetical protein CARUB_v10008020mg [Capsella rubella]
Length=1242

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 3/135 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYCAH+DG+ S WRRKEGEQVH+MC MEEL+P IG S+P+PS
Sbjct  291  PRGCAKFLDVLPDPNKELLYCAHVDGRLSIWRRKEGEQVHVMCTMEELMPPIGMSIPTPS  350

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++S SDST+Q I+KL+ DG  SL  D DNP+D  DESL +SKT  IS++DDG +WK
Sbjct  351  ALAVLLSQSDSTMQTITKLHPDGTFSL--DFDNPFDFYDESL-LSKTTFISLTDDGKIWK  407

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  408  WVLSAEGVEDALKNA  422



>gb|KFK33847.1| hypothetical protein AALP_AA5G067600 [Arabis alpina]
Length=1317

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYCAH+DG+ S WRRKEGEQVH+MC MEE +PSIG S P+PS
Sbjct  291  PRGCAKFLDVLPDPNKELLYCAHVDGRLSIWRRKEGEQVHVMCTMEEFMPSIGMSSPAPS  350

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LA+++S +DST+Q I+KL+ DG  S+  D DNP+D  DESL++SKT  IS+SDDG +WK
Sbjct  351  ALALLLSQTDSTMQTITKLHPDGTSSV--DLDNPFDFYDESLIVSKTTFISLSDDGKIWK  408

Query  46   WLLTAEGSGDEQKN  5
            W+L+ EG  D  KN
Sbjct  409  WVLSVEGLDDALKN  422



>ref|XP_010412480.1| PREDICTED: WD repeat-containing protein 11-like [Camelina sativa]
Length=1273

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYCAH+DG+ S WR+K GEQVH+MC MEE +PSIG S+PSPS
Sbjct  284  PRGCAKFLDVLPDPNNELLYCAHVDGRLSIWRQKGGEQVHVMCTMEEFMPSIGLSIPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             LAV++S SDST+Q I+KLY D   S+  D DNP+D  DES+V+SKT   S+SDDG +WK
Sbjct  344  ALAVLLSQSDSTMQTITKLYPDETSSV--DFDNPFDFYDESIVVSKTTFFSLSDDGKIWK  401

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AEG  D  KNA
Sbjct  402  WVLSAEGVEDALKNA  416



>ref|XP_007155027.1| hypothetical protein PHAVU_003G167000g, partial [Phaseolus vulgaris]
 gb|ESW27021.1| hypothetical protein PHAVU_003G167000g, partial [Phaseolus vulgaris]
Length=486

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + + +YCAH DGK STWRRK GEQ H M ++EEL+PS+GTSVPSPS
Sbjct  295  PRGCGKFLDVLPDPSNDWIYCAHRDGKLSTWRRKTGEQAHSMYSLEELMPSVGTSVPSPS  354

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+V++  SDST QNI K YSD    P L  D DNP+D C ES ++SK  LISISDDG +
Sbjct  355  ILSVLLCQSDSTFQNIGKDYSDVPSSPYLREDFDNPFDFCYESNIVSKIHLISISDDGKI  414

Query  52   WKWLLTAEGSGDEQKN  5
            W WLL AEG  D QK+
Sbjct  415  WNWLLAAEGLADTQKD  430



>ref|XP_006392568.1| hypothetical protein EUTSA_v10011188mg [Eutrema salsugineum]
 gb|ESQ29854.1| hypothetical protein EUTSA_v10011188mg [Eutrema salsugineum]
Length=1241

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KF++VLPD N E+LYCAH+DG+ S WRRKEGEQVH+MC +EEL+PSIG S+PSPS
Sbjct  290  PRGCAKFMDVLPDPNKELLYCAHVDGRLSIWRRKEGEQVHVMCTVEELMPSIGMSIPSPS  349

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
             +AV++S SDST+Q ISKL+SDG  S+  D D+P+D  D++L++SK+  IS+SDDG +WK
Sbjct  350  AMAVLLSQSDSTMQTISKLHSDGISSV--DFDSPFDFYDQNLLVSKSTFISLSDDGKIWK  407

Query  46   WLLTAEGSGDEQKNA  2
            W+L+AE   D  KNA
Sbjct  408  WVLSAEEVEDALKNA  422



>ref|XP_004172171.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
11-like, partial [Cucumis sativus]
Length=490

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 103/128 (80%), Gaps = 3/128 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E+LYC HLDG+ STWRRKEGEQVH+M AMEEL+PSIGTSVPSPS
Sbjct  299  PRGCGKFLDVLPDPDSELLYCPHLDGRLSTWRRKEGEQVHVMSAMEELLPSIGTSVPSPS  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPD--NPYDSCDESLVISKTPLISISDDGIL  53
            VLAVVI  SDS +QN++KL SD  P   A+ D  +P+DS DE   IS T LISISDDG +
Sbjct  359  VLAVVICQSDSILQNVAKLCSDV-PEAEAEADIVSPFDSYDECHPISSTHLISISDDGKV  417

Query  52   WKWLLTAE  29
            W WL+TAE
Sbjct  418  WNWLVTAE  425



>ref|XP_004150033.1| PREDICTED: WD repeat-containing protein 11-like [Cucumis sativus]
Length=1327

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 103/128 (80%), Gaps = 3/128 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E+LYC HLDG+ STWRRKEGEQVH+M AMEEL+PSIGTSVPSPS
Sbjct  299  PRGCGKFLDVLPDPDSELLYCPHLDGRLSTWRRKEGEQVHVMSAMEELLPSIGTSVPSPS  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPD--NPYDSCDESLVISKTPLISISDDGIL  53
            VLAVVI  SDS +QN++KL SD  P   A+ D  +P+DS DE   IS T LISISDDG +
Sbjct  359  VLAVVICQSDSILQNVAKLCSDV-PEAEAEADIVSPFDSYDECHPISSTHLISISDDGKV  417

Query  52   WKWLLTAE  29
            W WL+TAE
Sbjct  418  WNWLVTAE  425



>ref|XP_011078394.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
11 [Sesamum indicum]
Length=1336

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC K LEVLPD N+EV YCAHLDGK STWRRKEG+QVHMMC+M+EL+PSIGT+VPSP 
Sbjct  282  PRGCSKILEVLPDVNMEVFYCAHLDGKLSTWRRKEGDQVHMMCSMDELMPSIGTTVPSPL  341

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            VLAV IS SD  +Q+I KL   G  S   D DNP+D  DES +ISKT LISISDDG +WK
Sbjct  342  VLAVAISQSDYMLQDIRKL-CLGTDSFDMDFDNPFDFFDESPIISKTHLISISDDGKVWK  400

Query  46   WLLTAEGSGDEQKN  5
            WLLTAE   D QK+
Sbjct  401  WLLTAERLRDGQKD  414



>ref|XP_002527186.1| nucleotide binding protein, putative [Ricinus communis]
 gb|EEF35199.1| nucleotide binding protein, putative [Ricinus communis]
Length=1357

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 109/136 (80%), Gaps = 2/136 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+VLPD N E+LYC HLDGK S WRRK+GEQ+H+MCA+EEL+PSIGTSVPSPS
Sbjct  306  PRGCSKFLDVLPDPNNELLYCVHLDGKLSIWRRKDGEQLHVMCAIEELMPSIGTSVPSPS  365

Query  226  VLAVVISHSDSTIQNISKLYSD--GHPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLAV IS S+S +QN++KL SD    P    D DNP+D  D++L++SKT LISISDDG +
Sbjct  366  VLAVTISQSESILQNVAKLCSDIPNTPLSEKDFDNPFDFFDDTLLLSKTHLISISDDGKI  425

Query  52   WKWLLTAEGSGDEQKN  5
            W WL T EG+GD +K+
Sbjct  426  WNWLFTVEGTGDFKKD  441



>ref|XP_008443973.1| PREDICTED: WD repeat-containing protein 11 [Cucumis melo]
Length=1333

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 104/146 (71%), Gaps = 15/146 (10%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E+LYC HLDG+ STWRRKEGEQVH+M AMEEL+PSIGTSVPSPS
Sbjct  299  PRGCGKFLDVLPDPDSELLYCPHLDGRLSTWRRKEGEQVHVMSAMEELLPSIGTSVPSPS  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPD------------NPYDSCDESLVISKTP  83
            VLAVVI  SDS +QN++KL SD   S    P             +P+DS DE    S T 
Sbjct  359  VLAVVICQSDSILQNVAKLCSDVRHSHSPSPHADAEAEAEADIVSPFDSFDECHPNSSTH  418

Query  82   LISISDDGILWKWLLTAEGSGDEQKN  5
            LISISDDG +W WL+TAE   D QK+
Sbjct  419  LISISDDGKVWNWLVTAE---DTQKD  441



>ref|XP_010250155.1| PREDICTED: WD repeat-containing protein 11 [Nelumbo nucifera]
Length=1350

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PR CGKFL+VLPD + + LYCAH DGK STWRRKEGEQ + MC +EEL+PSIGTSVPSP 
Sbjct  301  PRKCGKFLDVLPDPDNDWLYCAHFDGKLSTWRRKEGEQAYTMCVVEELMPSIGTSVPSPI  360

Query  226  VLAVVISHSDSTIQNISKLYSDG-HPSLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            VLAV+   S ST+QN+  LYS+  H S + D D   D C +S++     L+SI+DDG +W
Sbjct  361  VLAVIRCQSVSTLQNVVDLYSNSPHTSPFWDYDTHLDRCSKSILNFMAHLLSITDDGKIW  420

Query  49   KWLLTAEGSGDEQK  8
             WLLTAEG+ D QK
Sbjct  421  NWLLTAEGARDAQK  434



>gb|EPS68588.1| hypothetical protein M569_06178, partial [Genlisea aurea]
Length=1239

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 98/133 (74%), Gaps = 6/133 (5%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGK L+VLPD ++EV YCAHLDGK STWRRKEGEQ + M +++EL+P+IGTSVPSP+
Sbjct  246  PRGCGKSLDVLPDLSMEVFYCAHLDGKLSTWRRKEGEQAYSMHSLDELLPAIGTSVPSPA  305

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            VLAV I  S+ T+Q I K        L  D  NP  SCDE + ISK  LI+ISDDG +WK
Sbjct  306  VLAVAICQSNYTLQVIHK------HCLETDSMNPLTSCDEPIDISKAHLITISDDGKIWK  359

Query  46   WLLTAEGSGDEQK  8
            W LTA+ SG ++K
Sbjct  360  WFLTAQRSGADRK  372



>ref|XP_010533145.1| PREDICTED: WD repeat-containing protein 11 isoform X1 [Tarenaya 
hassleriana]
Length=1301

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF++VLPD N E+LYC HLDG+ S WRRKEGEQVH++C +EEL+P IG SVPSP 
Sbjct  294  PRGFAKFVDVLPDPNQELLYCVHLDGRLSIWRRKEGEQVHVLCGIEELMPPIGNSVPSPC  353

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L V+IS  DST+QN+ K+YS+   S   + D P+D   ++L++SKT LIS+SDDG +W 
Sbjct  354  LLVVLISQLDSTLQNVRKIYSNAL-SNDLEFDTPFDFNHDALLVSKTSLISLSDDGKIWS  412

Query  46   WLLTAEGSGD  17
            W+LT + +GD
Sbjct  413  WILTVKRAGD  422



>ref|XP_010533146.1| PREDICTED: WD repeat-containing protein 11 isoform X2 [Tarenaya 
hassleriana]
Length=1201

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF++VLPD N E+LYC HLDG+ S WRRKEGEQVH++C +EEL+P IG SVPSP 
Sbjct  294  PRGFAKFVDVLPDPNQELLYCVHLDGRLSIWRRKEGEQVHVLCGIEELMPPIGNSVPSPC  353

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L V+IS  DST+QN+ K+YS+   S   + D P+D   ++L++SKT LIS+SDDG +W 
Sbjct  354  LLVVLISQLDSTLQNVRKIYSNAL-SNDLEFDTPFDFNHDALLVSKTSLISLSDDGKIWS  412

Query  46   WLLTAEGSGD  17
            W+LT + +GD
Sbjct  413  WILTVKRAGD  422



>ref|XP_008809225.1| PREDICTED: WD repeat-containing protein 11 isoform X2 [Phoenix 
dactylifera]
Length=1356

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 101/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKF +++PD ++++LYCAHLDGK S W+RKEGEQVH++C MEEL+PSIGT+VPSP+
Sbjct  310  PRGCGKFFDLVPDPDLDLLYCAHLDGKLSIWKRKEGEQVHVLCTMEELMPSIGTAVPSPA  369

Query  226  VLAVVISHSDSTIQNISKLYSDG---HPSL---YADPDNPYDSCDESLVISKTPLISISD  65
            VLA+ +  S+S IQN+ +L S+      SL   YA P + Y   D      K+ LISISD
Sbjct  370  VLAITLCQSESAIQNVVRLCSESSYTQSSLDLDYASPKSLYKEMDFG---PKSHLISISD  426

Query  64   DGILWKWLLTAEGSGDEQK  8
            DG +W WLLT++ + D QK
Sbjct  427  DGKIWNWLLTSDKARDAQK  445



>ref|XP_008809224.1| PREDICTED: WD repeat-containing protein 11 isoform X1 [Phoenix 
dactylifera]
Length=1357

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 101/139 (73%), Gaps = 9/139 (6%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKF +++PD ++++LYCAHLDGK S W+RKEGEQVH++C MEEL+PSIGT+VPSP+
Sbjct  310  PRGCGKFFDLVPDPDLDLLYCAHLDGKLSIWKRKEGEQVHVLCTMEELMPSIGTAVPSPA  369

Query  226  VLAVVISHSDSTIQNISKLYSDG---HPSL---YADPDNPYDSCDESLVISKTPLISISD  65
            VLA+ +  S+S IQN+ +L S+      SL   YA P + Y   D      K+ LISISD
Sbjct  370  VLAITLCQSESAIQNVVRLCSESSYTQSSLDLDYASPKSLYKEMDFG---PKSHLISISD  426

Query  64   DGILWKWLLTAEGSGDEQK  8
            DG +W WLLT++ + D QK
Sbjct  427  DGKIWNWLLTSDKARDAQK  445



>ref|XP_010922121.1| PREDICTED: WD repeat-containing protein 11 [Elaeis guineensis]
Length=1360

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 102/141 (72%), Gaps = 9/141 (6%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+++PD ++++LYCAHLDGK   W+RKEGEQVH++C MEEL+PS+GT+VPSP+
Sbjct  310  PRGCGKFLDLVPDPDLDLLYCAHLDGKLGVWKRKEGEQVHVLCTMEELMPSVGTAVPSPA  369

Query  226  VLAVVISHSDSTIQNISKLYSDG---HPSL---YADPDNPYDSCDESLVISKTPLISISD  65
            VLA+ +  S+S IQN+ +L S+      SL   YA   + Y   D     SK+ LISISD
Sbjct  370  VLAITLCQSESAIQNVIRLCSESSYTQSSLDLDYASHKSLYKEMDFG---SKSHLISISD  426

Query  64   DGILWKWLLTAEGSGDEQKNA  2
            DG +W WLLT++ + D QK A
Sbjct  427  DGKIWNWLLTSDKARDAQKAA  447



>ref|XP_010247604.1| PREDICTED: WD repeat-containing protein 11-like [Nelumbo nucifera]
Length=757

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PR CGKFL+VLPD + + LYCAHLDGK S WRRKEGEQ + MC MEE++PSIGTSVPSP+
Sbjct  298  PRKCGKFLDVLPDPDNDWLYCAHLDGKISIWRRKEGEQANRMCVMEEIMPSIGTSVPSPA  357

Query  226  VLAVVISHSDSTIQNISKLYSD-GHPSLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            +L+V++  S++ +QNI KL  +  H S   D D P D   +S ++ K  +ISI+DDG +W
Sbjct  358  LLSVILCQSEAMLQNIVKLCPNSSHDSPAEDYDAPLDCYSKSDLVPKAHIISITDDGKIW  417

Query  49   KWLLTAEGSGD  17
             W LTAEG+ D
Sbjct  418  NWHLTAEGARD  428



>ref|XP_010687946.1| PREDICTED: WD repeat-containing protein 11 [Beta vulgaris subsp. 
vulgaris]
Length=1352

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 102/129 (79%), Gaps = 3/129 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKFL+VLPD N E+LYC HLDGK STWRR+EGEQ + +C M+EL+PS+G+SVPSPS
Sbjct  317  PRG-GKFLDVLPDPNSELLYCVHLDGKLSTWRRREGEQAYSICTMQELMPSVGSSVPSPS  375

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADP--DNPYDSCDESLVISKTPLISISDDGIL  53
            +LA VI  SD  +QN+ K+YSD   + ++D   DNP+D CDESL  SKT LISISDDG +
Sbjct  376  ILAAVICESDCALQNVGKIYSDVPHTPFSDEDYDNPFDFCDESLPASKTHLISISDDGKV  435

Query  52   WKWLLTAEG  26
            W WLLTAEG
Sbjct  436  WNWLLTAEG  444



>ref|XP_010417809.1| PREDICTED: WD repeat-containing protein 11-like [Camelina sativa]
Length=1265

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VLPD + E LYC HLDG+ S WRRKEGEQVH++C +EELIP++G  VPSPS
Sbjct  284  PRGYAKFVNVLPDPSQEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELIPTVGNYVPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST QN+  ++SDG     ++P+  +D  +++ +  KT  ISISDDG +W 
Sbjct  344  LLTLLISQLDSTFQNMRTIHSDGLLD-SSEPEISFDFNNDAFLRFKTHFISISDDGKIWS  402

Query  46   WLLTAEGSGDEQKN  5
            W++T  G GD   N
Sbjct  403  WIMTFNGEGDGDGN  416



>ref|XP_006296211.1| hypothetical protein CARUB_v10025376mg [Capsella rubella]
 gb|EOA29109.1| hypothetical protein CARUB_v10025376mg [Capsella rubella]
Length=1254

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VLPD + E LYC HLDG+ S WRRKEGEQVH++C +EEL+P+IG SVPSPS
Sbjct  282  PRGYAKFVNVLPDPSQEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELMPTIGNSVPSPS  341

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST+QN+  ++S+G     ++ +  +D  +++ +  KT  ISISDDG +W 
Sbjct  342  LLTLLISQLDSTLQNMRTIHSNGLLD-SSETEISFDFNNDAFLRFKTHFISISDDGKIWS  400

Query  46   WLLTAEGSGDEQKN  5
            W++T  G GDE  N
Sbjct  401  WIMTFNGDGDEDFN  414



>ref|XP_010510887.1| PREDICTED: WD repeat-containing protein 11-like isoform X3 [Camelina 
sativa]
Length=1256

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VL D N E LYC HLDG+ S WRRKEGEQVH++C +EELIP+IG  VPSPS
Sbjct  282  PRGYAKFVNVLSDPNHEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELIPTIGNYVPSPS  341

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST QN+  ++SDG     ++P+  +D  +++ +  +T  ISISDDG +W 
Sbjct  342  LLTLLISQLDSTFQNMRTIHSDGLLD-SSEPEISFDFNNDAFLRFETHFISISDDGKIWS  400

Query  46   WLLTAEGSGD  17
            W++T  G GD
Sbjct  401  WIMTFNGEGD  410



>ref|XP_010510886.1| PREDICTED: WD repeat-containing protein 11-like isoform X2 [Camelina 
sativa]
Length=1262

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VL D N E LYC HLDG+ S WRRKEGEQVH++C +EELIP+IG  VPSPS
Sbjct  282  PRGYAKFVNVLSDPNHEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELIPTIGNYVPSPS  341

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST QN+  ++SDG     ++P+  +D  +++ +  +T  ISISDDG +W 
Sbjct  342  LLTLLISQLDSTFQNMRTIHSDGLLD-SSEPEISFDFNNDAFLRFETHFISISDDGKIWS  400

Query  46   WLLTAEGSGD  17
            W++T  G GD
Sbjct  401  WIMTFNGEGD  410



>ref|XP_010510885.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Camelina 
sativa]
Length=1265

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VL D N E LYC HLDG+ S WRRKEGEQVH++C +EELIP+IG  VPSPS
Sbjct  282  PRGYAKFVNVLSDPNHEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELIPTIGNYVPSPS  341

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST QN+  ++SDG     ++P+  +D  +++ +  +T  ISISDDG +W 
Sbjct  342  LLTLLISQLDSTFQNMRTIHSDGLLD-SSEPEISFDFNNDAFLRFETHFISISDDGKIWS  400

Query  46   WLLTAEGSGD  17
            W++T  G GD
Sbjct  401  WIMTFNGEGD  410



>ref|NP_850083.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC07867.1| uncharacterized protein AT2G26610 [Arabidopsis thaliana]
Length=1249

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF++VLPD + E LYC HLDG+ S WRRKEGEQVH++CA+EE +P+IG SVPSPS
Sbjct  284  PRGYAKFVDVLPDPSQEFLYCLHLDGRLSIWRRKEGEQVHVLCAIEEFMPTIGNSVPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST+QNI  ++SD      ++ +  +D  +++ ++ KT  ISISDDG +W 
Sbjct  344  LLTLLISQLDSTLQNIRTIHSDALLD-SSELEISFDFNNDAFLLFKTHFISISDDGKIWS  402

Query  46   WLLTAEGSGDEQKN  5
            W+LT   +GDE  N
Sbjct  403  WILTF--NGDEDSN  414



>ref|XP_002878992.1| hypothetical protein ARALYDRAFT_481528 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55251.1| hypothetical protein ARALYDRAFT_481528 [Arabidopsis lyrata subsp. 
lyrata]
Length=1253

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF++VLPD   E LYC HLDG+ S WRRKEGEQVH++C +EEL+P+IG SVPSPS
Sbjct  284  PRGYAKFVDVLPDPRQEFLYCLHLDGRLSIWRRKEGEQVHVLCGLEELMPTIGNSVPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST+QN+   +SD      ++ +  +D  +++ +  KT  ISISDDG +W 
Sbjct  344  LLTLLISQLDSTLQNMRTTHSDAVLD-SSELEISFDFNNDAFLRFKTHFISISDDGKIWS  402

Query  46   WLLTAEGSGDEQKN  5
            W+LT   SGDE  N
Sbjct  403  WILTF--SGDEDSN  414



>ref|XP_006842045.1| hypothetical protein AMTR_s00078p00015380 [Amborella trichopoda]
 gb|ERN03720.1| hypothetical protein AMTR_s00078p00015380 [Amborella trichopoda]
Length=1345

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC +FL++LPD   ++LYC HLDGK S W+RK+GEQ H++C MEELIPSIG +VPSP 
Sbjct  304  PRGCARFLDLLPDPYHDLLYCIHLDGKLSIWKRKDGEQAHVLCTMEELIPSIGITVPSPG  363

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPD----NPYDSCDESLVISKTPLISISDDG  59
            VLAVV+S  +S ++NI     D  PS  +       +  D+ + S +++   +ISISDDG
Sbjct  364  VLAVVVSPLESNLRNIGWHCLDTLPSFPSSVTTGDFSALDNHNRSFLVTVANVISISDDG  423

Query  58   ILWKWLLTAEGSGD  17
             +WKWLL+AEG  D
Sbjct  424  KIWKWLLSAEGRRD  437



>gb|KGN65342.1| hypothetical protein Csa_1G351950 [Cucumis sativus]
Length=1377

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGCGKFL+VLPD + E+LYC HLDG+ STWRRKEGEQVH+M AMEEL+PSIGTSVPSPS
Sbjct  299  PRGCGKFLDVLPDPDSELLYCPHLDGRLSTWRRKEGEQVHVMSAMEELLPSIGTSVPSPS  358

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPD  131
            VLAVVI  SDS +QN++KL SD   S    PD
Sbjct  359  VLAVVICQSDSILQNVAKLCSDVRHSHSPSPD  390



>ref|XP_010473047.1| PREDICTED: WD repeat-containing protein 11-like isoform X3 [Camelina 
sativa]
Length=1259

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VLPD + E LYC HLDG+ S WRRKEGEQVH++C +EELIP+IG  VPSPS
Sbjct  284  PRGYAKFVNVLPDPSQEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELIPTIGNYVPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST QN+  ++SDG     ++P+  +D  +++ +  KT  ISISDDG +W 
Sbjct  344  LLILLISQLDSTFQNMRTIHSDGLVD-SSEPEISFDFNNDAFLRFKTHFISISDDGKIWS  402

Query  46   WLLTAEGSGD  17
            W++T  G GD
Sbjct  403  WIMTFNGEGD  412



>ref|XP_010473046.1| PREDICTED: WD repeat-containing protein 11-like isoform X2 [Camelina 
sativa]
Length=1265

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VLPD + E LYC HLDG+ S WRRKEGEQVH++C +EELIP+IG  VPSPS
Sbjct  284  PRGYAKFVNVLPDPSQEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELIPTIGNYVPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST QN+  ++SDG     ++P+  +D  +++ +  KT  ISISDDG +W 
Sbjct  344  LLILLISQLDSTFQNMRTIHSDGLVD-SSEPEISFDFNNDAFLRFKTHFISISDDGKIWS  402

Query  46   WLLTAEGSGD  17
            W++T  G GD
Sbjct  403  WIMTFNGEGD  412



>ref|XP_010473044.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Camelina 
sativa]
 ref|XP_010473045.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Camelina 
sativa]
Length=1268

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG  KF+ VLPD + E LYC HLDG+ S WRRKEGEQVH++C +EELIP+IG  VPSPS
Sbjct  284  PRGYAKFVNVLPDPSQEALYCLHLDGRLSIWRRKEGEQVHVLCGIEELIPTIGNYVPSPS  343

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            +L ++IS  DST QN+  ++SDG     ++P+  +D  +++ +  KT  ISISDDG +W 
Sbjct  344  LLILLISQLDSTFQNMRTIHSDGLVD-SSEPEISFDFNNDAFLRFKTHFISISDDGKIWS  402

Query  46   WLLTAEGSGD  17
            W++T  G GD
Sbjct  403  WIMTFNGEGD  412



>ref|XP_009381634.1| PREDICTED: WD repeat-containing protein 11-like [Musa acuminata 
subsp. malaccensis]
Length=1320

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 8/132 (6%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KF+ ++PD  +++LYC HLDGK S W+RKEGEQ+H++C +EEL+PSIGT +P+P+
Sbjct  309  PRGCSKFMNLMPDPELDLLYCVHLDGKLSIWKRKEGEQLHVLCGVEELMPSIGTVIPTPA  368

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADP------DNPYDSCDESLVISKTPLISISD  65
            VLAV    S+S++QNI    +D  PS Y           P  S  E  +  KT L+SISD
Sbjct  369  VLAVNSCQSESSVQNIGLFCTD--PSSYTQALLSEECVPPKSSNKEMDIPLKTCLVSISD  426

Query  64   DGILWKWLLTAE  29
            DG +W WL+T++
Sbjct  427  DGKIWNWLVTSD  438



>ref|XP_002451504.1| hypothetical protein SORBIDRAFT_04g002960 [Sorghum bicolor]
 gb|EES04480.1| hypothetical protein SORBIDRAFT_04g002960 [Sorghum bicolor]
Length=1280

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 86/128 (67%), Gaps = 2/128 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ D ++++LYC HLDGK S WRRKEGEQVH++CA+EEL+PSIGT VPSP+
Sbjct  305  PRGFGKFSDVMADPDLDMLYCTHLDGKLSIWRRKEGEQVHLLCAVEELMPSIGTVVPSPA  364

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWK  47
            VLA  I HS+S  +NI K   D   + Y   D   D    +   + T L SIS+DG +W 
Sbjct  365  VLAATILHSESIFRNIDKQCQDLAQTYYFMTDTNSD--QNAYHGTMTYLTSISEDGKIWS  422

Query  46   WLLTAEGS  23
            WLL  + S
Sbjct  423  WLLKFDKS  430



>gb|AFW70064.1| hypothetical protein ZEAMMB73_820023 [Zea mays]
Length=1298

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 89/131 (68%), Gaps = 6/131 (5%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ D +I++LYC HLDGK S WRRKEGEQVH++CA+EEL+PSIGT VPSP+
Sbjct  304  PRGFGKFSDVMADPDIDMLYCTHLDGKLSIWRRKEGEQVHLLCAVEELMPSIGTVVPSPA  363

Query  226  VLAVVISHSDSTIQNISKLYSD-GHP-SLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA  I  S+S  ++I K   D   P S   D ++  ++C  ++    T L SIS+DG +
Sbjct  364  VLAATIWQSESIFRSIEKQCQDLAQPHSFMIDTNSDQNACQGTM----TYLTSISEDGKI  419

Query  52   WKWLLTAEGSG  20
            W WLL  + S 
Sbjct  420  WSWLLKFDKSA  430



>ref|XP_008681199.1| PREDICTED: uncharacterized protein LOC100193851 isoform X1 [Zea 
mays]
Length=1299

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 89/131 (68%), Gaps = 6/131 (5%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ D +I++LYC HLDGK S WRRKEGEQVH++CA+EEL+PSIGT VPSP+
Sbjct  304  PRGFGKFSDVMADPDIDMLYCTHLDGKLSIWRRKEGEQVHLLCAVEELMPSIGTVVPSPA  363

Query  226  VLAVVISHSDSTIQNISKLYSD-GHP-SLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            VLA  I  S+S  ++I K   D   P S   D ++  ++C  ++    T L SIS+DG +
Sbjct  364  VLAATIWQSESIFRSIEKQCQDLAQPHSFMIDTNSDQNACQGTM----TYLTSISEDGKI  419

Query  52   WKWLLTAEGSG  20
            W WLL  + S 
Sbjct  420  WSWLLKFDKSA  430



>ref|XP_004951954.1| PREDICTED: WD repeat-containing protein 11-like [Setaria italica]
Length=1302

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 88/138 (64%), Gaps = 9/138 (7%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKFL+V+ D ++++LYC H+DGK S W+RKEGEQVH++CA+EEL+PSIGT VP P+
Sbjct  307  PRGFGKFLDVMADPDLDLLYCTHVDGKLSIWKRKEGEQVHLLCAVEELMPSIGTVVPPPA  366

Query  226  VLAVVISHSDSTIQNISKLYSD-----GHPSLYADPDNPYDSCDESLVISKTPLISISDD  62
            VLA  I  S+S  +NI K   D        S   D ++  +    +L    T + SIS+D
Sbjct  367  VLATTIWQSESIFRNIDKQCQDLSQTNASLSFITDTNSEQNVYKGTL----TYVTSISED  422

Query  61   GILWKWLLTAEGSGDEQK  8
            G +W WLLT + S    K
Sbjct  423  GKIWSWLLTFDKSAHPNK  440



>gb|AAC14509.1| unknown protein [Arabidopsis thaliana]
Length=852

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 86/129 (67%), Gaps = 14/129 (11%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKE-------------GEQVHMMCAMEE  266
            PRG  KF++VLPD + E LYC HLDG+ S WRRKE             GEQVH++CA+EE
Sbjct  284  PRGYAKFVDVLPDPSQEFLYCLHLDGRLSIWRRKECAEKFSIHLCSSLGEQVHVLCAIEE  343

Query  265  LIPSIGTSVPSPSVLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKT  86
             +P+IG SVPSPS+L ++IS  DST+QNI  ++SD      ++ +  +D  +++ ++ KT
Sbjct  344  FMPTIGNSVPSPSLLTLLISQLDSTLQNIRTIHSDALLD-SSELEISFDFNNDAFLLFKT  402

Query  85   PLISISDDG  59
              ISISDDG
Sbjct  403  HFISISDDG  411



>ref|XP_009133929.1| PREDICTED: WD repeat-containing protein 11 [Brassica rapa]
Length=1242

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PR   KF++VLPD N E LYC H D + S WRR+EGEQVH++C +EELIP+IG S P PS
Sbjct  275  PREYAKFVDVLPDPNQEFLYCLHFDCRLSIWRRQEGEQVHVLCGIEELIPAIGISPPLPS  334

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+++IS  DST+QNI K++SD     S   D    +   D++ +  KT  ISISDDG +
Sbjct  335  LLSLLISQLDSTLQNIRKIHSDPVLDGSKVVDDSFYFSGDDDAFLGFKTHFISISDDGKI  394

Query  52   WKWLLTAEGSGD  17
            W W+L+ +   D
Sbjct  395  WSWILSVKRDND  406



>emb|CDX83244.1| BnaA03g22620D [Brassica napus]
Length=1242

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PR   KF++VLPD N E LYC H D + S WRR+EGEQVH++C +EELIP+IG S P PS
Sbjct  275  PREYAKFVDVLPDPNQEFLYCLHFDCRLSIWRRQEGEQVHVLCGIEELIPAIGISPPLPS  334

Query  226  VLAVVISHSDSTIQNISKLYSDG--HPSLYADPDNPYDSCDESLVISKTPLISISDDGIL  53
            +L+++IS  DST+QNI K++SD     S   D    +   D++ +  KT  ISISDDG +
Sbjct  335  LLSLLISQLDSTLQNIRKIHSDPVLDGSKVVDDSFYFSGDDDAFLGFKTHFISISDDGKI  394

Query  52   WKWLLTAEGSGD  17
            W W+L+ +   D
Sbjct  395  WSWILSVKRDND  406



>gb|EMS63946.1| WD repeat-containing protein 11 [Triticum urartu]
Length=1151

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 82/129 (64%), Gaps = 9/129 (7%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ DT++++LYC H DGK S W+RKEGEQVH++ A+EEL+PSIGT VP P+
Sbjct  120  PRGFGKFTDVMADTDLDLLYCTHADGKLSIWKRKEGEQVHLLHAVEELMPSIGTVVPPPA  179

Query  226  VLAVVISHSDSTIQNISKLYSD-----GHPSLYADPDNPYDSCDESLVISKTPLISISDD  62
            VLA  I  S+S  +NI K   D        S+  D  +  +    ++    T L SIS+D
Sbjct  180  VLATTIWQSESIFRNIDKQSQDLAHMQSSQSMIFDTKSNQNMYQGTM----TYLTSISED  235

Query  61   GILWKWLLT  35
            G +W W LT
Sbjct  236  GKIWSWHLT  244



>dbj|BAJ97189.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1302

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (61%), Gaps = 9/138 (7%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ DT++++LYC H DGK S W+RKEGEQVH++ A+EEL+PSIGT VP P+
Sbjct  312  PRGFGKFSDVMADTDLDLLYCTHADGKLSIWKRKEGEQVHLLHAVEELMPSIGTVVPPPA  371

Query  226  VLAVVISHSDSTIQNISKLYSD-----GHPSLYADPDNPYDSCDESLVISKTPLISISDD  62
            VLA  I  S+S  +NI K   D        S+  D  +  D     +    T L SIS+D
Sbjct  372  VLATTIWQSESIFRNIGKKSQDLAHMQSSESIIFDTKSNQDMYQGIM----TYLTSISED  427

Query  61   GILWKWLLTAEGSGDEQK  8
            G +W W LT + S    K
Sbjct  428  GKIWSWHLTFDKSVSSNK  445



>ref|XP_003574282.1| PREDICTED: WD repeat-containing protein 11-like [Brachypodium 
distachyon]
Length=1304

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ D ++++LYC H DGK S W+RKEGEQVH++ A+EEL+PSIGT VP P+
Sbjct  310  PRGFGKFSDVMADPDLDLLYCTHADGKLSIWKRKEGEQVHLLHAVEELMPSIGTVVPPPA  369

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYADPDNPYD-SCDESLVISKTP-LISISDDGIL  53
            VLA  I  S+S   NI K   D    + +     +D S ++++   KT  L SIS+DG +
Sbjct  370  VLATTIWQSESIFHNIEKQSQD-LAQMQSSQSIIFDTSLNQNMYQGKTTYLTSISEDGKI  428

Query  52   WKWLLTAEGSGDEQK  8
            W W LT + S   +K
Sbjct  429  WSWHLTFDKSACSKK  443



>gb|EMT08578.1| hypothetical protein F775_10973 [Aegilops tauschii]
Length=1162

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 83/127 (65%), Gaps = 5/127 (4%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ DT++++LYC H DGK S W+RKEGEQVH++ A+EEL+PSIGT VP P+
Sbjct  120  PRGFGKFTDVMADTDLDLLYCTHADGKLSIWKRKEGEQVHLLHAVEELMPSIGTVVPPPA  179

Query  226  VLAVVISHSDSTIQNISKLYSD-GHPSLYADPDNPYDSCDESLVI--SKTPLISISDDGI  56
            VLA  I  S+S  +NI K   D  H  + +     +D+     +   + T L SIS+DG 
Sbjct  180  VLATTIWQSESIFRNIDKQSQDLAH--MQSSQSMIFDTKSHQNMYQGTMTYLTSISEDGK  237

Query  55   LWKWLLT  35
            +W W LT
Sbjct  238  IWSWHLT  244



>gb|EEE56264.1| hypothetical protein OsJ_05300 [Oryza sativa Japonica Group]
Length=1262

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 87/139 (63%), Gaps = 9/139 (6%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRG GKF +V+ D + ++LYC H+DGK S W+RKEGE VH++CA+E+L+PSIGT VP P+
Sbjct  279  PRGFGKFSDVMSDPDFDLLYCTHIDGKLSIWKRKEGEHVHLLCAVEDLMPSIGTIVPPPA  338

Query  226  VLAVVISHSDSTIQNISKLYSD-----GHPSLYADPDNPYDSCDESLVISKTPLISISDD  62
            VLA  I  S++  +NI K   D        S+ +D +   +    ++    T L SIS+D
Sbjct  339  VLATTIWQSEAVFRNIEKQSRDLGQIQSTHSVISDTNTNQNMYQGTM----TYLTSISED  394

Query  61   GILWKWLLTAEGSGDEQKN  5
            G +W W L+ + S   +K+
Sbjct  395  GKIWSWHLSFDKSACARKD  413



>emb|CDY38532.1| BnaC03g26650D [Brassica napus]
Length=1245

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 90/133 (68%), Gaps = 5/133 (4%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PR   KF++VLPD N E LYC H D + S WRR+EGEQVH++C +EELIP+IG S P PS
Sbjct  276  PREYAKFVDVLPDPNQEFLYCLHFDCRLSIWRRQEGEQVHVLCGIEELIPAIGISAPLPS  335

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYA---DPDNPYDSCDESLVISKTPLISISDDGI  56
            +L+++IS  DST+QNI K++SD  P L A   D    +   D++ +  KT  ISISDDG 
Sbjct  336  LLSLLISQLDSTLQNIRKIHSD--PVLDASMVDDSFYFSGDDDAFLGFKTHFISISDDGK  393

Query  55   LWKWLLTAEGSGD  17
            LW W+L+ +   D
Sbjct  394  LWSWILSVKRDKD  406



>ref|XP_006646857.1| PREDICTED: WD repeat-containing protein 11-like isoform X1 [Oryza 
brachyantha]
Length=865

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 9/119 (8%)
 Frame = -1

Query  376  LPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPSVLAVVISHSD  197
            + D ++++LYC H+DGK S W+RKEGEQVH++CA+EEL+PSIGT VP P+VLA  I  S+
Sbjct  1    MADPDLDLLYCTHIDGKLSIWKRKEGEQVHLLCAVEELMPSIGTIVPPPAVLATTIWQSE  60

Query  196  STIQNISKLYSD-----GHPSLYADPDNPYDSCDESLVISKTPLISISDDGILWKWLLT  35
            S  +NI K   D        S+ +D +   +    ++      L SIS+DG +W W LT
Sbjct  61   SIFRNIDKQSQDLGQIQSTSSVISDTNTNQNMYQGTMAY----LTSISEDGKIWSWHLT  115



>ref|XP_001771311.1| predicted protein [Physcomitrella patens]
 gb|EDQ63871.1| predicted protein [Physcomitrella patens]
Length=1343

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 81/143 (57%), Gaps = 14/143 (10%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            P GC K L++L   + +VLYCAH DGK S WRRKEG QV  MC M  L+PSIG+ VP+P+
Sbjct  280  PPGCSKLLDLLTCIDGDVLYCAHQDGKVSAWRRKEGMQVFTMCLMSTLMPSIGSPVPAPA  339

Query  226  VLAVVISHSDSTIQNISKLYSDGHPSLYAD--------PDNPYDSCDESLVISKTP----  83
            VLAV+  H    +Q  +    D   SL  +        P     +   S V   +P    
Sbjct  340  VLAVI--HCPLQLQMQTSSNDDQSGSLQVNSPSGAIPIPSTFSQNDQLSKVKVSSPLEAT  397

Query  82   LISISDDGILWKWLLTAEGSGDE  14
            L+S+SDDG LW+W++  +G+G E
Sbjct  398  LLSVSDDGRLWRWVIDDDGTGSE  420



>ref|XP_001758093.1| predicted protein [Physcomitrella patens]
 gb|EDQ76915.1| predicted protein [Physcomitrella patens]
Length=1243

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 55/138 (40%), Positives = 79/138 (57%), Gaps = 14/138 (10%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC K L++L   + +VLYCAH DGK S WRRKE +QV  +C M  L+PSIG+ VP+P+
Sbjct  280  PRGCSKLLDLLACADGDVLYCAHQDGKVSAWRRKEDKQVFSLCFMGTLMPSIGSPVPAPA  339

Query  226  VLAVV-------ISHSDSTIQNISKLYSDGHPSLYADPDNPYDSCDESLVISKTP-----  83
            VLAVV       +  S +  Q+ S L  D  P   +   +     D+ + +   P     
Sbjct  340  VLAVVHCPLQLQVQKSSNDNQS-SSLQVDSLPGAIS-VSSTLAQNDQLVEVKILPALEAT  397

Query  82   LISISDDGILWKWLLTAE  29
            L+SI+DDG L +W++  +
Sbjct  398  LLSITDDGRLLRWVINGD  415



>ref|XP_002966240.1| hypothetical protein SELMODRAFT_407617 [Selaginella moellendorffii]
 gb|EFJ32267.1| hypothetical protein SELMODRAFT_407617 [Selaginella moellendorffii]
Length=1103

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 46/122 (38%), Positives = 64/122 (52%), Gaps = 23/122 (19%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+++ D   E+L+ AH+DGK S+W+RKE  QV  +  ++ L+PS GT VP PS
Sbjct  123  PRGCAKFLDLVADVGGELLFFAHVDGKLSSWKRKENSQVFSIVQIDSLMPSFGTPVPPPS  182

Query  226  VLAVVISHSDSTIQNISKLYSDGHP-SLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            VLAV                  G P  +  +P             +    +S+SDDG LW
Sbjct  183  VLAVTFC-------------PIGMPHGVELEPPKQQ---------AHITFVSVSDDGRLW  220

Query  49   KW  44
            +W
Sbjct  221  EW  222



>ref|XP_002982312.1| hypothetical protein SELMODRAFT_268579 [Selaginella moellendorffii]
 gb|EFJ16557.1| hypothetical protein SELMODRAFT_268579 [Selaginella moellendorffii]
Length=1227

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/122 (38%), Positives = 64/122 (52%), Gaps = 23/122 (19%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKEGEQVHMMCAMEELIPSIGTSVPSPS  227
            PRGC KFL+++ D   E+L+ AH+DGK S+W+RKE  QV  +  ++ L+PS GT VP PS
Sbjct  285  PRGCAKFLDLVADVGGELLFFAHVDGKLSSWKRKENSQVFSIVQIDSLMPSFGTPVPPPS  344

Query  226  VLAVVISHSDSTIQNISKLYSDGHP-SLYADPDNPYDSCDESLVISKTPLISISDDGILW  50
            VLAV                  G P  +  +P             +    +S+SDDG LW
Sbjct  345  VLAVTFC-------------PIGMPHGVELEPPKQQ---------AHITFVSVSDDGRLW  382

Query  49   KW  44
            +W
Sbjct  383  EW  384



>ref|XP_008809226.1| PREDICTED: WD repeat-containing protein 11 isoform X3 [Phoenix 
dactylifera]
Length=1004

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = -1

Query  274  MEELIPSIGTSVPSPSVLAVVISHSDSTIQNISKLYSDG---HPSL---YADPDNPYDSC  113
            MEEL+PSIGT+VPSP+VLA+ +  S+S IQN+ +L S+      SL   YA P + Y   
Sbjct  1    MEELMPSIGTAVPSPAVLAITLCQSESAIQNVVRLCSESSYTQSSLDLDYASPKSLYKEM  60

Query  112  DESLVISKTPLISISDDGILWKWLLTAEGSGDEQK  8
            D      K+ LISISDDG +W WLLT++ + D QK
Sbjct  61   DFG---PKSHLISISDDGKIWNWLLTSDKARDAQK  92



>gb|AFW70065.1| hypothetical protein ZEAMMB73_820023 [Zea mays]
Length=1000

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = -1

Query  304  EGEQVHMMCAMEELIPSIGTSVPSPSVLAVVISHSDSTIQNISKLYSD-GHP-SLYADPD  131
             GEQVH++CA+EEL+PSIGT VPSP+VLA  I  S+S  ++I K   D   P S   D +
Sbjct  5    RGEQVHLLCAVEELMPSIGTVVPSPAVLAATIWQSESIFRSIEKQCQDLAQPHSFMIDTN  64

Query  130  NPYDSCDESLVISKTPLISISDDGILWKWLLTAEGSG  20
            +  ++C  ++    T L SIS+DG +W WLL  + S 
Sbjct  65   SDQNACQGTM----TYLTSISEDGKIWSWLLKFDKSA  97



>ref|XP_002521541.1| hypothetical protein RCOM_0534980 [Ricinus communis]
 gb|EEF40812.1| hypothetical protein RCOM_0534980 [Ricinus communis]
Length=55

 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  406  PRGCGKFLEVLPDTNIEVLYCAHLDGKFSTWRRKE  302
            PR CGKFL++LPD N E+LYC HLDGK S W  K+
Sbjct  8    PRDCGKFLDLLPDPNNELLYCVHLDGKLSIWWHKD  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506499748756