BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1168_g1_i1 len=1305 path=[1380:0-1199 40:1200-1304]

Length=1305
                                                                      Score     E

ref|XP_009797332.1|  PREDICTED: dirigent protein 24-like                371   1e-121   
ref|XP_009622578.1|  PREDICTED: dirigent protein 24-like                364   5e-119   
ref|XP_004236764.1|  PREDICTED: dirigent protein 24-like                355   2e-115   
ref|XP_006345923.1|  PREDICTED: dirigent protein 24-like                355   3e-115   
ref|XP_004239767.1|  PREDICTED: dirigent protein 24-like                353   2e-114   
ref|XP_006361435.1|  PREDICTED: dirigent protein 9-like                 348   2e-112   
ref|XP_009778401.1|  PREDICTED: dirigent protein 24-like                342   4e-110   
ref|XP_009591518.1|  PREDICTED: dirigent protein 24-like                341   1e-109   
ref|XP_011077161.1|  PREDICTED: dirigent protein 24-like                325   7e-104   
ref|XP_011084398.1|  PREDICTED: dirigent protein 24-like                320   4e-102   
emb|CDP00024.1|  unnamed protein product                                313   8e-99    
gb|EYU39460.1|  hypothetical protein MIMGU_mgv1a021006mg                308   2e-97    
ref|XP_010032276.1|  PREDICTED: dirigent protein 24-like                290   4e-90    
ref|XP_010068851.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    286   3e-89    
ref|XP_010693138.1|  PREDICTED: dirigent protein 9-like                 283   1e-87    
ref|XP_007219824.1|  hypothetical protein PRUPE_ppa026919mg             279   2e-85    
ref|XP_010096679.1|  hypothetical protein L484_025428                   275   4e-84    
ref|XP_002311136.2|  disease resistance-responsive family protein       274   1e-83    Populus trichocarpa [western balsam poplar]
ref|XP_006436126.1|  hypothetical protein CICLE_v10033309mg             272   3e-83    
ref|XP_002530969.1|  conserved hypothetical protein                     271   6e-83    Ricinus communis
gb|KDP46122.1|  hypothetical protein JCGZ_06633                         270   2e-82    
ref|XP_008461621.1|  PREDICTED: dirigent protein 24                     270   2e-82    
emb|CBI33171.3|  unnamed protein product                                267   4e-82    
ref|XP_002276144.1|  PREDICTED: dirigent protein 24                     268   1e-81    Vitis vinifera
gb|KGN50510.1|  hypothetical protein Csa_5G179750                       268   1e-81    
gb|KEH44500.1|  disease resistance response/dirigent-like protein       267   1e-81    
ref|XP_004147710.1|  PREDICTED: uncharacterized protein LOC101204391    262   3e-81    
ref|XP_004164341.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    261   4e-81    
ref|XP_002316318.2|  disease resistance-responsive family protein       266   4e-81    Populus trichocarpa [western balsam poplar]
ref|XP_004307460.1|  PREDICTED: uncharacterized protein LOC101295273    265   2e-80    
ref|XP_011027097.1|  PREDICTED: dirigent protein 24-like                264   6e-80    
ref|XP_004492036.1|  PREDICTED: uncharacterized protein LOC101489698    263   1e-79    
ref|XP_010243746.1|  PREDICTED: dirigent protein 9-like                 261   2e-79    
ref|XP_009357651.1|  PREDICTED: dirigent protein 9-like                 257   2e-79    
ref|XP_003621654.1|  Disease resistance response protein                261   6e-79    
gb|KCW65310.1|  hypothetical protein EUGRSUZ_G02765                     259   6e-79    
ref|XP_009335913.1|  PREDICTED: dirigent protein 24-like                256   7e-79    
gb|ACU24111.1|  unknown                                                 259   3e-78    Glycine max [soybeans]
gb|AFK37477.1|  unknown                                                 259   3e-78    
ref|NP_001241330.1|  uncharacterized protein LOC100808391               259   3e-78    
ref|XP_006601830.1|  PREDICTED: uncharacterized protein LOC100808...    259   4e-78    
gb|KHN13831.1|  Disease resistance response protein 206                 259   5e-78    
ref|XP_007139311.1|  hypothetical protein PHAVU_008G018700g             259   6e-78    
ref|XP_010260030.1|  PREDICTED: dirigent protein 9-like                 256   9e-78    
ref|XP_003531914.1|  PREDICTED: dirigent protein 9-like                 256   3e-77    
ref|XP_009344911.1|  PREDICTED: dirigent protein 24-like                257   3e-77    
ref|XP_007009563.1|  Disease resistance-responsive family protein...    254   2e-76    
ref|XP_009139192.1|  PREDICTED: dirigent protein 24                     251   4e-76    
gb|KHN47528.1|  hypothetical protein glysoja_040063                     253   5e-76    
ref|XP_002281485.1|  PREDICTED: dirigent protein 24-like                251   7e-76    Vitis vinifera
ref|XP_008233548.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    252   3e-75    
ref|XP_008362698.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    251   1e-74    
ref|XP_002879796.1|  hypothetical protein ARALYDRAFT_482962             246   5e-74    
ref|XP_006403483.1|  hypothetical protein EUTSA_v10010565mg             246   7e-74    
ref|XP_010509017.1|  PREDICTED: dirigent protein 9-like                 246   8e-74    
ref|XP_010505613.1|  PREDICTED: dirigent protein 9 isoform X1           246   1e-73    
gb|KFK34759.1|  hypothetical protein AALP_AA5G189900                    245   1e-73    
ref|XP_010427284.1|  PREDICTED: dirigent protein 24-like                244   2e-73    
ref|NP_181475.1|  Disease resistance-responsive (dirigent-like pr...    244   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191083.1|  disease resistance-responsive, dirigent domain-...    244   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504370.1|  PREDICTED: dirigent protein 24                     244   3e-73    
ref|XP_010516083.1|  PREDICTED: dirigent protein 24-like                244   4e-73    
dbj|BAF00893.1|  disease resistance response/ dirigent - like pro...    243   5e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411169.1|  hypothetical protein EUTSA_v10016936mg             243   7e-73    
ref|XP_010517290.1|  PREDICTED: dirigent protein 9-like                 243   7e-73    
ref|XP_006651257.1|  PREDICTED: dirigent protein 25-like                240   2e-72    
ref|XP_009141808.1|  PREDICTED: dirigent protein 9-like                 242   2e-72    
emb|CDY53583.1|  BnaA05g34560D                                          241   3e-72    
emb|CDY07650.1|  BnaA03g18610D                                          241   5e-72    
ref|XP_009143318.1|  PREDICTED: dirigent protein 9                      241   5e-72    
ref|XP_006296385.1|  hypothetical protein CARUB_v10025558mg             241   8e-72    
emb|CDY20430.1|  BnaC04g06140D                                          240   1e-71    
emb|CDY24962.1|  BnaC03g22100D                                          240   1e-71    
gb|KFK36837.1|  hypothetical protein AALP_AA4G178000                    239   3e-71    
ref|XP_008369944.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    235   5e-71    
ref|XP_009133366.1|  PREDICTED: dirigent protein 9-like                 235   6e-70    
ref|XP_010534463.1|  PREDICTED: dirigent protein 9-like                 234   6e-69    
ref|XP_002876289.1|  hypothetical protein ARALYDRAFT_485944             230   5e-68    
ref|XP_007016543.1|  Disease resistance-responsive (dirigent-like...    231   1e-67    
emb|CAN80344.1|  hypothetical protein VITISV_003132                     228   2e-67    Vitis vinifera
ref|NP_001173366.1|  Os03g0280750                                       228   6e-67    
emb|CDX76115.1|  BnaA04g03790D                                          226   1e-66    
ref|XP_002468070.1|  hypothetical protein SORBIDRAFT_01g039060          226   2e-66    Sorghum bicolor [broomcorn]
gb|EAY89496.1|  hypothetical protein OsI_11028                          226   2e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_008660283.1|  PREDICTED: dirigent protein 24-like                227   2e-66    
ref|XP_010253352.1|  PREDICTED: dirigent protein 25                     225   1e-65    
emb|CDY02918.1|  BnaC04g25680D                                          224   1e-65    
ref|XP_007009562.1|  Disease resistance-responsive family protein       221   2e-64    
ref|XP_004984774.1|  PREDICTED: circumsporozoite protein-like           220   1e-63    
emb|CDX93263.1|  BnaC04g46330D                                          218   2e-63    
emb|CDY07009.1|  BnaA04g23060D                                          215   2e-62    
ref|XP_010033176.1|  PREDICTED: dirigent protein 25-like                212   7e-61    
ref|XP_003635227.1|  PREDICTED: dirigent protein 25-like                212   2e-60    
ref|XP_007207181.1|  hypothetical protein PRUPE_ppa017156mg             218   8e-60    
ref|XP_009354557.1|  PREDICTED: dirigent protein 10-like                208   2e-59    
ref|XP_008463531.1|  PREDICTED: dirigent protein 10-like                208   2e-59    
ref|XP_008385181.1|  PREDICTED: dirigent protein 25-like                207   3e-59    
ref|XP_010243747.1|  PREDICTED: dirigent protein 25-like                205   1e-58    
gb|KEH30093.1|  disease resistance response/dirigent-like protein       204   2e-58    
ref|XP_002312064.1|  disease resistance-responsive family protein       205   2e-58    Populus trichocarpa [western balsam poplar]
ref|XP_009110925.1|  PREDICTED: dirigent protein 25-like                206   2e-58    
ref|XP_004149818.1|  PREDICTED: uncharacterized protein LOC101221251    205   5e-58    
ref|XP_004166148.1|  PREDICTED: uncharacterized protein LOC101229995    204   6e-58    
ref|XP_006424738.1|  hypothetical protein CICLE_v10029904mg             203   7e-58    
gb|KDO37063.1|  hypothetical protein CISIN_1g041797mg                   202   8e-58    
emb|CDY71693.1|  BnaAnng38500D                                          207   1e-57    
ref|XP_010475548.1|  PREDICTED: dirigent protein 25-like                205   1e-57    
ref|XP_010487947.1|  PREDICTED: dirigent protein 25-like                205   2e-57    
emb|CAN77499.1|  hypothetical protein VITISV_002404                     214   5e-57    Vitis vinifera
ref|XP_007132121.1|  hypothetical protein PHAVU_011G068400g             198   1e-56    
ref|XP_009148022.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    201   2e-56    
gb|EAZ26477.1|  hypothetical protein OsJ_10366                          199   2e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010033175.1|  PREDICTED: dirigent protein 10-like                199   5e-56    
ref|XP_010457978.1|  PREDICTED: dirigent protein 25-like                201   5e-56    
ref|XP_011089415.1|  PREDICTED: dirigent protein 10                     197   1e-55    
ref|XP_010651068.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    195   1e-55    
ref|XP_007208752.1|  hypothetical protein PRUPE_ppa015993mg             206   2e-55    
ref|XP_006850696.1|  hypothetical protein AMTR_s00034p00240460          199   3e-55    
ref|XP_011027098.1|  PREDICTED: dirigent protein 25-like                196   4e-55    
ref|XP_011089838.1|  PREDICTED: dirigent protein 10                     193   4e-55    
ref|XP_002530972.1|  conserved hypothetical protein                     196   5e-55    Ricinus communis
ref|XP_002315250.2|  hypothetical protein POPTR_0010s21860g             195   6e-55    Populus trichocarpa [western balsam poplar]
gb|KFK43093.1|  hypothetical protein AALP_AA1G078900                    199   1e-54    
emb|CDX95129.1|  BnaC05g05420D                                          197   2e-54    
ref|XP_004145196.1|  PREDICTED: uncharacterized protein LOC101214738    192   3e-54    
gb|KFK32272.1|  hypothetical protein AALP_AA6G220900                    196   3e-54    
ref|XP_008440684.1|  PREDICTED: dirigent protein 9-like                 192   4e-54    
gb|KCW52731.1|  hypothetical protein EUGRSUZ_J02089                     194   1e-53    
ref|XP_006436125.1|  hypothetical protein CICLE_v10033627mg             189   1e-53    
ref|XP_007016542.1|  Disease resistance-responsive (dirigent-like...    191   2e-53    
ref|XP_010112925.1|  hypothetical protein L484_010856                   192   2e-53    
ref|XP_006409900.1|  hypothetical protein EUTSA_v10016661mg             195   4e-53    
gb|KHN22002.1|  Disease resistance response protein 206                 187   4e-53    
emb|CDY72481.1|  BnaUnng05170D                                          192   4e-53    
ref|XP_009103704.1|  PREDICTED: dirigent protein 10-like                193   7e-53    
ref|NP_973782.1|  dirigent protein 25                                   192   8e-53    Arabidopsis thaliana [mouse-ear cress]
emb|CDY04579.1|  BnaA07g14050D                                          192   8e-53    
ref|XP_009140931.1|  PREDICTED: dirigent protein 25 isoform X2          187   1e-52    
ref|XP_006417771.1|  hypothetical protein EUTSA_v10007858mg             192   1e-52    
ref|XP_009140930.1|  PREDICTED: dirigent protein 25 isoform X1          192   1e-52    
gb|KDP46091.1|  hypothetical protein JCGZ_06602                         189   1e-52    
ref|XP_004968254.1|  PREDICTED: angiomotin-like                         191   2e-52    
emb|CDY31724.1|  BnaA04g16600D                                          192   2e-52    
ref|XP_009357650.1|  PREDICTED: dirigent protein 10-like                188   3e-52    
emb|CDY63718.1|  BnaC04g54770D                                          191   4e-52    
ref|XP_010523131.1|  PREDICTED: dirigent protein 25                     192   4e-52    
ref|XP_007219177.1|  hypothetical protein PRUPE_ppa016665mg             186   4e-52    
ref|XP_009358379.1|  PREDICTED: dirigent protein 25-like                188   5e-52    
ref|XP_004295954.1|  PREDICTED: uncharacterized protein LOC101303601    186   3e-51    
ref|XP_010685843.1|  PREDICTED: dirigent protein 10-like                187   3e-51    
ref|XP_004308836.1|  PREDICTED: uncharacterized protein LOC101311810    185   4e-51    
ref|XP_006488244.1|  PREDICTED: dirigent protein 25-like                182   6e-51    
ref|XP_010313548.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    184   7e-51    
ref|XP_007132120.1|  hypothetical protein PHAVU_011G068300g             185   8e-51    
ref|XP_007132117.1|  hypothetical protein PHAVU_011G068000g             184   9e-51    
ref|XP_006424739.1|  hypothetical protein CICLE_v10030177mg             193   9e-51    
ref|XP_009598242.1|  PREDICTED: dirigent protein 25-like                187   1e-50    
ref|NP_180435.1|  protein ENHANCED SUBERIN 1                            186   9e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011021115.1|  PREDICTED: dirigent protein 25-like                182   1e-49    
ref|NP_001154539.1|  protein ENHANCED SUBERIN 1                         179   2e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881003.1|  hypothetical protein ARALYDRAFT_481780             185   2e-49    
emb|CDX77197.1|  BnaC04g39920D                                          183   5e-49    
ref|XP_009344912.1|  PREDICTED: dirigent protein 10-like                180   5e-49    
ref|XP_009785872.1|  PREDICTED: dirigent protein 25                     183   6e-49    
ref|XP_004241252.1|  PREDICTED: dirigent protein 25-like isoform X2     180   9e-49    
ref|XP_010322375.1|  PREDICTED: dirigent protein 25-like isoform X1     180   1e-48    
ref|XP_010470056.1|  PREDICTED: dirigent protein 10-like                181   1e-48    
gb|EYU36248.1|  hypothetical protein MIMGU_mgv1a022936mg                186   2e-48    
ref|XP_006350901.1|  PREDICTED: dirigent protein 25-like                179   3e-48    
ref|XP_009769099.1|  PREDICTED: dirigent protein 25-like isoform X2     178   3e-48    
ref|XP_009769097.1|  PREDICTED: dirigent protein 25-like isoform X1     178   3e-48    
gb|KDO72989.1|  hypothetical protein CISIN_1g039110mg                   178   3e-48    
ref|XP_010414493.1|  PREDICTED: dirigent protein 10-like                181   5e-48    
ref|XP_010510592.1|  PREDICTED: dirigent protein 10-like                181   5e-48    
ref|XP_006296346.1|  hypothetical protein CARUB_v10025518mg             180   6e-48    
gb|EAY72597.1|  hypothetical protein OsI_00463                          178   7e-48    Oryza sativa Indica Group [Indian rice]
tpg|DAA53401.1|  TPA: hypothetical protein ZEAMMB73_420609              178   1e-47    
ref|NP_001150958.1|  dirigent-like protein precursor                    178   1e-47    Zea mays [maize]
ref|XP_009624598.1|  PREDICTED: dirigent protein 25-like isoform X2     176   2e-47    
ref|XP_009624597.1|  PREDICTED: dirigent protein 25-like isoform X1     176   2e-47    
ref|XP_002457319.1|  hypothetical protein SORBIDRAFT_03g005530          177   4e-47    Sorghum bicolor [broomcorn]
ref|XP_006363356.1|  PREDICTED: dirigent protein 25-like                172   5e-47    
ref|XP_009335912.1|  PREDICTED: dirigent protein 10-like                172   5e-47    
gb|KDO72990.1|  hypothetical protein CISIN_1g039130mg                   171   1e-46    
dbj|BAB64642.1|  hypothetical protein                                   174   2e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003539707.1|  PREDICTED: dirigent protein 10-like                172   2e-46    
ref|XP_008233549.1|  PREDICTED: dirigent protein 25-like                172   3e-46    
ref|XP_006850693.1|  hypothetical protein AMTR_s00034p00239800          172   7e-46    
gb|AFK49581.1|  unknown                                                 169   5e-45    
emb|CDX93623.1|  BnaA06g04250D                                          169   4e-44    
ref|XP_003538024.1|  PREDICTED: dirigent protein 10-like                161   4e-42    
gb|KEH30098.1|  disease resistance-responsive, dirigent domain pr...    161   5e-42    
ref|NP_001236972.1|  uncharacterized protein LOC100500624 precursor     158   8e-42    
gb|KEH30094.1|  disease resistance-responsive, dirigent domain pr...    160   1e-41    
emb|CAN80345.1|  hypothetical protein VITISV_003133                     168   2e-41    Vitis vinifera
gb|KHN22000.1|  Disease resistance response protein 206                 160   2e-41    
ref|XP_004505900.1|  PREDICTED: mitochondrial substrate carrier f...    157   2e-40    
ref|XP_004161978.1|  PREDICTED: uncharacterized protein LOC101227210    154   7e-40    
ref|XP_008224164.1|  PREDICTED: dirigent protein 25-like                153   3e-39    
gb|KHN21997.1|  Disease resistance response protein 206                 148   5e-38    
emb|CBI33170.3|  unnamed protein product                                155   3e-37    
ref|XP_006645512.1|  PREDICTED: dirigent protein 10-like                147   3e-37    
ref|XP_009769482.1|  PREDICTED: dirigent protein 24-like                141   6e-37    
emb|CDP08987.1|  unnamed protein product                                150   5e-36    
gb|EMS55918.1|  hypothetical protein TRIUR3_12732                       144   5e-36    
gb|EAZ10599.1|  hypothetical protein OsJ_00431                          139   6e-34    Oryza sativa Japonica Group [Japonica rice]
emb|CBI16200.3|  unnamed protein product                                144   2e-33    
ref|XP_004299214.1|  PREDICTED: uncharacterized protein LOC101310995    134   1e-32    
ref|XP_010527489.1|  PREDICTED: dirigent protein 16                     131   2e-31    
ref|XP_007226305.1|  hypothetical protein PRUPE_ppa020939mg             130   2e-31    
ref|XP_004134021.1|  PREDICTED: uncharacterized protein LOC101219771    130   2e-31    
ref|XP_011002155.1|  PREDICTED: dirigent protein 18-like                129   6e-31    
emb|CBI33333.3|  unnamed protein product                                129   6e-31    
ref|XP_002468522.1|  hypothetical protein SORBIDRAFT_01g047330          130   7e-31    Sorghum bicolor [broomcorn]
ref|XP_009622054.1|  PREDICTED: dirigent protein 16-like                129   8e-31    
ref|XP_008224088.1|  PREDICTED: dirigent protein 16-like                129   9e-31    
gb|KDO46285.1|  hypothetical protein CISIN_1g041927mg                   128   1e-30    
ref|XP_006492143.1|  PREDICTED: dirigent protein 16-like                129   2e-30    
ref|XP_007034496.1|  Disease resistance-responsive (dirigent-like...    127   2e-30    
ref|XP_006420526.1|  hypothetical protein CICLE_v10006624mg             128   3e-30    
ref|XP_009781789.1|  PREDICTED: dirigent protein 16-like                126   6e-30    
ref|XP_002285613.1|  PREDICTED: dirigent protein 16-like                126   8e-30    Vitis vinifera
ref|XP_004985736.1|  PREDICTED: uncharacterized protein LOC101773107    127   8e-30    
ref|XP_008650968.1|  PREDICTED: dirigent protein 16-like                127   9e-30    
ref|XP_008438410.1|  PREDICTED: dirigent protein 18                     126   1e-29    
ref|XP_002303806.2|  disease resistance-responsive family protein       125   1e-29    Populus trichocarpa [western balsam poplar]
ref|XP_010264004.1|  PREDICTED: dirigent protein 18                     125   1e-29    
ref|XP_006420521.1|  hypothetical protein CICLE_v10007167mg             125   1e-29    
ref|XP_010450187.1|  PREDICTED: dirigent protein 18-like                125   2e-29    
ref|XP_010440560.1|  PREDICTED: dirigent protein 18-like                125   2e-29    
emb|CDY47358.1|  BnaCnng14950D                                          125   2e-29    
gb|KFK36242.1|  hypothetical protein AALP_AA4G096600                    125   2e-29    
ref|XP_009139613.1|  PREDICTED: dirigent protein 18                     125   2e-29    
ref|XP_011002154.1|  PREDICTED: dirigent protein 18-like                124   3e-29    
ref|NP_193094.1|  disease resistance-responsive, dirigent domain-...    124   3e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870373.1|  disease resistance-responsive family protein       124   4e-29    
emb|CDY43705.1|  BnaA08g05150D                                          124   4e-29    
ref|XP_011092678.1|  PREDICTED: dirigent protein 18-like                124   4e-29    
ref|XP_002282961.1|  PREDICTED: dirigent protein 16                     124   5e-29    Vitis vinifera
emb|CDY01141.1|  BnaA04g06780D                                          124   5e-29    
ref|XP_009107703.1|  PREDICTED: dirigent protein 18-like                124   5e-29    
ref|XP_008223997.1|  PREDICTED: dirigent protein 16-like                124   5e-29    
ref|XP_006414882.1|  hypothetical protein EUTSA_v10027245mg             124   5e-29    
ref|XP_009619983.1|  PREDICTED: dirigent protein 16-like                124   6e-29    
ref|XP_006651031.1|  PREDICTED: dirigent protein 16-like                124   6e-29    
emb|CDY18745.1|  BnaC08g08710D                                          123   8e-29    
gb|EYU40519.1|  hypothetical protein MIMGU_mgv1a026440mg                123   9e-29    
ref|XP_010532814.1|  PREDICTED: dirigent protein 16-like                123   1e-28    
ref|XP_007226337.1|  hypothetical protein PRUPE_ppa022306mg             123   1e-28    
ref|XP_011088098.1|  PREDICTED: dirigent protein 18-like                123   1e-28    
ref|XP_002885622.1|  disease resistance-responsive family protein       122   1e-28    
gb|AFK35503.1|  unknown                                                 119   1e-28    
ref|NP_001173264.1|  Os03g0143900                                       123   2e-28    
gb|KFK39702.1|  hypothetical protein AALP_AA3G277700                    122   2e-28    
ref|XP_006418792.1|  hypothetical protein EUTSA_v10002774mg             122   2e-28    
ref|XP_010435243.1|  PREDICTED: dirigent protein 18                     122   2e-28    
ref|XP_009362050.1|  PREDICTED: dirigent protein 16-like                122   2e-28    
gb|EYU37234.1|  hypothetical protein MIMGU_mgv1a012425mg                122   2e-28    
ref|XP_006285077.1|  hypothetical protein CARUB_v10006390mg             121   3e-28    
ref|XP_008380978.1|  PREDICTED: dirigent protein 18-like                122   3e-28    
ref|XP_010488507.1|  PREDICTED: dirigent protein 16                     121   3e-28    
ref|XP_009377445.1|  PREDICTED: dirigent protein 16-like                121   4e-28    
ref|XP_010466800.1|  PREDICTED: dirigent protein 16-like                121   4e-28    
emb|CDO99388.1|  unnamed protein product                                121   4e-28    
ref|XP_006300155.1|  hypothetical protein CARUB_v10016386mg             121   4e-28    
ref|XP_009362064.1|  PREDICTED: dirigent protein 18-like                121   5e-28    
ref|XP_006492161.1|  PREDICTED: dirigent protein 16-like                120   5e-28    
ref|XP_009377452.1|  PREDICTED: dirigent protein 18-like                121   5e-28    
ref|XP_009377444.1|  PREDICTED: dirigent protein 18-like                121   6e-28    
ref|XP_002299293.2|  hypothetical protein POPTR_0001s14080g             121   7e-28    Populus trichocarpa [western balsam poplar]
ref|XP_006854254.1|  hypothetical protein AMTR_s00039p00028010          120   7e-28    
ref|XP_004301050.1|  PREDICTED: uncharacterized protein LOC101301978    120   9e-28    
gb|KCW57310.1|  hypothetical protein EUGRSUZ_H00107                     119   9e-28    
ref|NP_189044.1|  disease resistance-responsive, dirigent domain-...    120   1e-27    Arabidopsis thaliana [mouse-ear cress]
gb|EAZ25551.1|  hypothetical protein OsJ_09378                          120   1e-27    Oryza sativa Japonica Group [Japonica rice]
emb|CDX85181.1|  BnaC07g07250D                                          119   1e-27    
ref|XP_002299294.2|  hypothetical protein POPTR_0001s14070g             118   2e-27    Populus trichocarpa [western balsam poplar]
gb|KEH41221.1|  disease resistance-responsive, dirigent domain pr...    119   2e-27    
ref|XP_009102540.1|  PREDICTED: dirigent protein 16                     119   2e-27    
ref|XP_010513281.1|  PREDICTED: dirigent protein 16-like                119   2e-27    
ref|XP_011020714.1|  PREDICTED: dirigent protein 16                     119   2e-27    
ref|XP_009106061.1|  PREDICTED: dirigent protein 16                     119   3e-27    
gb|AFK44731.1|  unknown                                                 118   4e-27    
ref|XP_009362051.1|  PREDICTED: dirigent protein 18-like                118   5e-27    
ref|XP_010023773.1|  PREDICTED: dirigent protein 18                     118   5e-27    
ref|XP_009775303.1|  PREDICTED: probable serine incorporator            123   8e-27    
gb|KDP20338.1|  hypothetical protein JCGZ_06424                         117   1e-26    
ref|XP_007145425.1|  hypothetical protein PHAVU_007G238100g             117   2e-26    
ref|XP_004497739.1|  PREDICTED: uncharacterized protein LOC101509402    117   2e-26    
ref|XP_006367325.1|  PREDICTED: dirigent protein 18-like                115   2e-26    
ref|XP_004253009.1|  PREDICTED: dirigent protein 18-like                116   3e-26    
gb|KHN48453.1|  Disease resistance response protein 206                 115   3e-26    
gb|ACU21140.1|  unknown                                                 115   3e-26    
gb|AFK36631.1|  unknown                                                 115   4e-26    
ref|XP_010025823.1|  PREDICTED: probable serine incorporator            120   5e-26    
ref|XP_003555719.1|  PREDICTED: dirigent protein 16-like                115   6e-26    
gb|KEH41194.1|  disease resistance-responsive, dirigent domain pr...    114   1e-25    
ref|XP_007145426.1|  hypothetical protein PHAVU_007G238200g             114   1e-25    
ref|XP_002518169.1|  conserved hypothetical protein                     118   2e-25    
gb|KHN31616.1|  Disease resistance response protein 206                 112   2e-25    
ref|XP_006340917.1|  PREDICTED: dirigent protein 16-like                113   3e-25    
ref|XP_006850695.1|  hypothetical protein AMTR_s00034p00240370          113   4e-25    
ref|XP_003555718.1|  PREDICTED: dirigent protein 18-like                112   9e-25    
gb|ACU20190.1|  unknown                                                 112   9e-25    
ref|XP_004247941.2|  PREDICTED: probable serine incorporator            116   1e-24    
ref|XP_010666473.1|  PREDICTED: dirigent protein 18-like                111   1e-24    
ref|XP_004497740.1|  PREDICTED: uncharacterized protein LOC101509726    109   8e-24    
ref|XP_009778390.1|  PREDICTED: dirigent protein 25-like                108   1e-23    
gb|KHN10511.1|  Disease resistance response protein 206                 107   2e-23    
ref|XP_010097990.1|  hypothetical protein L484_026886                   108   2e-23    
ref|XP_011027096.1|  PREDICTED: dirigent protein 25-like                105   1e-22    
ref|XP_010321367.1|  PREDICTED: dirigent protein 18-like                105   1e-22    
ref|XP_009377453.1|  PREDICTED: dirigent protein 18-like                104   4e-22    
ref|NP_001235104.1|  uncharacterized protein LOC100500490               103   1e-21    
ref|XP_009591517.1|  PREDICTED: dirigent protein 25-like                100   1e-20    
gb|KDP46121.1|  hypothetical protein JCGZ_06632                       98.2    2e-20    
ref|XP_010067219.1|  PREDICTED: dirigent protein 25-like              99.0    3e-20    
ref|XP_010646809.1|  PREDICTED: dirigent protein 10-like              98.6    4e-20    
ref|XP_009362082.1|  PREDICTED: probable serine incorporator            102   7e-20    
emb|CDP21881.1|  unnamed protein product                              97.8    7e-20    
ref|XP_002316319.2|  hypothetical protein POPTR_0010s21880g           97.8    7e-20    
ref|XP_002530968.1|  conserved hypothetical protein                   97.4    8e-20    
dbj|BAB03020.1|  unnamed protein product                              97.4    8e-20    
ref|XP_008233547.1|  PREDICTED: dirigent protein 25-like              96.3    3e-19    
emb|CDY18060.1|  BnaA01g23210D                                        95.5    4e-19    
ref|XP_007009564.1|  Disease resistance-responsive family protein...  94.7    9e-19    
emb|CDY46347.1|  BnaC01g30230D                                        94.0    2e-18    
ref|XP_007220983.1|  hypothetical protein PRUPE_ppa016154mg           93.6    2e-18    
gb|KEH44501.1|  disease resistance-responsive, dirigent domain pr...  92.4    5e-18    
gb|KDO43045.1|  hypothetical protein CISIN_1g0245352mg                89.0    2e-17    
gb|KHN40625.1|  hypothetical protein glysoja_001123                   90.9    2e-17    
ref|XP_006602709.1|  PREDICTED: dirigent protein 25-like              90.5    3e-17    
ref|XP_004308835.1|  PREDICTED: uncharacterized protein LOC101311525  87.8    2e-16    
ref|XP_010113196.1|  hypothetical protein L484_000253                 85.5    2e-15    
gb|KHN29510.1|  hypothetical protein glysoja_005234                   85.5    2e-15    
ref|XP_004497314.1|  PREDICTED: uncharacterized protein LOC101497191  85.1    2e-15    
ref|XP_006587925.1|  PREDICTED: dirigent protein 25-like              84.3    4e-15    
ref|XP_006436127.1|  hypothetical protein CICLE_v10033511mg           84.3    5e-15    
gb|EMT01716.1|  hypothetical protein F775_22142                       82.4    6e-15    
gb|AFK37594.1|  unknown                                               82.8    8e-15    
ref|XP_007034497.1|  Serinc-domain containing serine and sphingol...  85.5    2e-14    
ref|XP_010512961.1|  PREDICTED: dirigent protein 9-like               80.9    4e-14    
ref|XP_009357761.1|  PREDICTED: dirigent protein 9-like               81.3    4e-14    
ref|XP_009335945.1|  PREDICTED: dirigent protein 9-like               80.9    5e-14    
ref|XP_010245683.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...  80.5    8e-14    
gb|KHN23458.1|  hypothetical protein glysoja_037876                   75.5    3e-12    
ref|XP_007140088.1|  hypothetical protein PHAVU_008G083300g           75.1    4e-12    
ref|XP_002986379.1|  hypothetical protein SELMODRAFT_124022           73.2    1e-11    
ref|XP_010260029.1|  PREDICTED: dirigent protein 25-like              73.6    2e-11    
gb|KHN32090.1|  hypothetical protein glysoja_028885                   73.2    2e-11    
ref|XP_002988690.1|  hypothetical protein SELMODRAFT_184063           72.0    2e-11    
ref|XP_002960306.1|  hypothetical protein SELMODRAFT_139600           72.0    2e-11    
ref|XP_008461620.1|  PREDICTED: dirigent protein 10-like              73.2    3e-11    
ref|XP_010101146.1|  hypothetical protein L484_016710                 72.0    3e-11    
ref|XP_002967407.1|  hypothetical protein SELMODRAFT_87141            70.5    8e-11    
ref|XP_009397495.1|  PREDICTED: dirigent protein 25                   70.9    1e-10    
ref|XP_008783768.1|  PREDICTED: dirigent protein 16-like              69.3    2e-10    
ref|XP_004305988.1|  PREDICTED: disease resistance response prote...  67.8    6e-10    
ref|XP_010921454.1|  PREDICTED: dirigent protein 11-like              68.2    6e-10    
ref|XP_002967426.1|  hypothetical protein SELMODRAFT_87848            67.8    7e-10    
ref|XP_008799193.1|  PREDICTED: dirigent protein 22-like              67.8    8e-10    
ref|XP_002966352.1|  hypothetical protein SELMODRAFT_6118             67.0    8e-10    
ref|XP_002978209.1|  hypothetical protein SELMODRAFT_6231             67.0    8e-10    
emb|CDP20709.1|  unnamed protein product                              67.0    2e-09    
ref|XP_010549445.1|  PREDICTED: dirigent protein 21-like              66.6    2e-09    
ref|XP_002960287.1|  hypothetical protein SELMODRAFT_74313            66.2    2e-09    
ref|XP_010922981.1|  PREDICTED: dirigent protein 18                   66.6    3e-09    
dbj|BAJ99603.1|  predicted protein                                    65.9    3e-09    
gb|EMS54626.1|  hypothetical protein TRIUR3_23462                     65.9    4e-09    
ref|XP_010494187.1|  PREDICTED: dirigent protein 2-like               65.9    4e-09    
ref|XP_010101145.1|  hypothetical protein L484_016709                 65.9    5e-09    
dbj|BAK01620.1|  predicted protein                                    65.1    6e-09    
ref|XP_008799203.1|  PREDICTED: uncharacterized protein LOC103713929  67.4    7e-09    
gb|KFK44377.1|  hypothetical protein AALP_AA1G249600                  65.1    8e-09    
gb|EMS46182.1|  hypothetical protein TRIUR3_05228                     64.7    8e-09    
dbj|BAJ89677.1|  predicted protein                                    64.7    1e-08    
gb|EYU43119.1|  hypothetical protein MIMGU_mgv1a021554mg              64.3    1e-08    
ref|XP_006841309.1|  hypothetical protein AMTR_s00134p00117580        64.7    1e-08    
ref|XP_004309140.1|  PREDICTED: disease resistance response prote...  64.3    1e-08    
gb|KGN50509.1|  hypothetical protein Csa_5G179740                     64.7    1e-08    
ref|XP_006281166.1|  hypothetical protein CARUB_v10027200mg           63.9    1e-08    
gb|KEH28822.1|  disease resistance-responsive, dirigent domain pr...  63.9    2e-08    
ref|XP_007024406.1|  Disease resistance-responsive family protein...  63.9    2e-08    
ref|XP_006281178.1|  hypothetical protein CARUB_v10027213mg           63.5    2e-08    
emb|CDM84876.1|  unnamed protein product                              63.9    2e-08    
ref|XP_004289175.1|  PREDICTED: disease resistance response prote...  63.2    2e-08    
ref|XP_009762822.1|  PREDICTED: dirigent protein 22-like              63.5    2e-08    
ref|XP_004140684.1|  PREDICTED: disease resistance response prote...  63.2    3e-08    
ref|XP_004977236.1|  PREDICTED: disease resistance response prote...  63.2    3e-08    
ref|XP_008460022.1|  PREDICTED: dirigent protein 20-like              63.2    3e-08    
ref|XP_002269397.1|  PREDICTED: dirigent protein 23                   62.8    3e-08    
ref|XP_006492696.1|  PREDICTED: dirigent protein 19-like              63.2    4e-08    
ref|XP_009596486.1|  PREDICTED: dirigent protein 22-like              62.4    4e-08    
ref|XP_010257545.1|  PREDICTED: dirigent protein 19-like              62.8    4e-08    
emb|CDY04773.1|  BnaC05g18160D                                        62.4    5e-08    
ref|XP_004978852.1|  PREDICTED: disease resistance response prote...  62.4    5e-08    
gb|KFK36665.1|  hypothetical protein AALP_AA4G154100                  62.0    5e-08    
emb|CDY21398.1|  BnaA09g30290D                                        62.4    6e-08    
ref|XP_004157564.1|  PREDICTED: disease resistance response prote...  62.8    6e-08    
ref|XP_004296168.1|  PREDICTED: disease resistance response prote...  62.4    7e-08    
ref|XP_002276722.1|  PREDICTED: dirigent protein 23-like              62.0    7e-08    
ref|XP_009115582.1|  PREDICTED: dirigent protein 2                    62.0    7e-08    
ref|XP_004978853.1|  PREDICTED: disease resistance response prote...  61.6    1e-07    
ref|XP_006445860.1|  hypothetical protein CICLE_v10016848mg           61.6    1e-07    
gb|EMT15027.1|  hypothetical protein F775_07361                       61.6    1e-07    
ref|XP_004294969.1|  PREDICTED: disease resistance response prote...  61.2    1e-07    
ref|XP_010046344.1|  PREDICTED: dirigent protein 2-like               61.6    1e-07    
ref|XP_006836063.1|  hypothetical protein AMTR_s00114p00093910        62.0    1e-07    
ref|XP_010416851.1|  PREDICTED: dirigent protein 23-like              61.2    1e-07    
gb|EYU46052.1|  hypothetical protein MIMGU_mgv1a024219mg              61.2    1e-07    
ref|XP_011079170.1|  PREDICTED: dirigent protein 23-like              60.5    1e-07    
ref|XP_010243402.1|  PREDICTED: dirigent protein 22-like isoform X2   61.2    2e-07    
ref|XP_006386058.1|  hypothetical protein POPTR_0003s21450g           61.2    2e-07    
gb|EMS46181.1|  hypothetical protein TRIUR3_05227                     60.8    2e-07    
ref|XP_004955787.1|  PREDICTED: disease resistance response prote...  60.5    2e-07    
ref|XP_010527558.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...  62.8    2e-07    
ref|XP_006386059.1|  hypothetical protein POPTR_0003s21460g           60.8    2e-07    
ref|XP_003519012.1|  PREDICTED: dirigent protein 21-like              60.8    2e-07    
dbj|BAK04824.1|  predicted protein                                    60.5    2e-07    
emb|CDM86469.1|  unnamed protein product                              60.5    2e-07    
emb|CAN61315.1|  hypothetical protein VITISV_023978                   60.5    2e-07    
ref|XP_010243401.1|  PREDICTED: dirigent protein 22-like isoform X1   60.5    3e-07    
ref|XP_010442171.1|  PREDICTED: dirigent protein 2-like               60.5    3e-07    
ref|XP_002276741.3|  PREDICTED: dirigent protein 23-like              60.5    3e-07    
ref|XP_004147726.1|  PREDICTED: uncharacterized protein LOC101208257  60.1    3e-07    
ref|XP_008379934.1|  PREDICTED: dirigent protein 1-like               61.2    3e-07    
ref|XP_002461904.1|  hypothetical protein SORBIDRAFT_02g010230        60.1    3e-07    
ref|XP_004162008.1|  PREDICTED: uncharacterized LOC101214802          60.5    3e-07    
gb|AAB72169.1|  hypothetical protein                                  60.1    3e-07    
gb|ABE73781.1|  dirigent-related protein                              60.1    3e-07    
ref|XP_004979966.1|  PREDICTED: disease resistance response prote...  59.7    3e-07    
emb|CDY60807.1|  BnaA01g37270D                                        60.1    3e-07    
ref|NP_173703.2|  disease resistance-responsive, dirigent domain-...  60.1    4e-07    
ref|XP_008225842.1|  PREDICTED: dirigent protein 22-like              60.1    4e-07    
ref|XP_010481983.1|  PREDICTED: dirigent protein 2-like               59.7    4e-07    
ref|XP_010257547.1|  PREDICTED: dirigent protein 21-like              59.7    4e-07    
gb|AFW84649.1|  hypothetical protein ZEAMMB73_339292                  60.1    4e-07    
ref|XP_010693360.1|  PREDICTED: dirigent protein 2-like               59.7    4e-07    
ref|XP_008775105.1|  PREDICTED: dirigent protein 21-like              59.3    4e-07    
ref|XP_004142157.1|  PREDICTED: uncharacterized protein LOC101214802  59.7    4e-07    
ref|XP_007132491.1|  hypothetical protein PHAVU_011G098600g           59.7    4e-07    
ref|XP_006445861.1|  hypothetical protein CICLE_v10018248mg           59.7    4e-07    
ref|XP_002276258.2|  PREDICTED: dirigent protein 22-like              59.7    4e-07    
ref|XP_010429003.1|  PREDICTED: dirigent protein 23                   59.7    4e-07    
ref|XP_010910756.1|  PREDICTED: dirigent protein 22-like              59.7    5e-07    
ref|XP_002458729.1|  hypothetical protein SORBIDRAFT_03g039190        59.7    5e-07    
ref|XP_007216435.1|  hypothetical protein PRUPE_ppa021830mg           59.3    5e-07    
ref|XP_009388050.1|  PREDICTED: dirigent protein 22-like              59.7    5e-07    
ref|NP_001149580.1|  disease resistance response protein 206 prec...  59.3    5e-07    
ref|XP_006366583.1|  PREDICTED: dirigent protein 1-like               59.3    5e-07    
ref|XP_007207483.1|  hypothetical protein PRUPE_ppa011828mg           59.3    5e-07    
emb|CDY13841.1|  BnaA09g43430D                                        59.3    5e-07    
ref|XP_002971049.1|  hypothetical protein SELMODRAFT_6269             58.5    5e-07    
ref|XP_004294970.1|  PREDICTED: disease resistance response prote...  59.3    6e-07    
ref|XP_011075257.1|  PREDICTED: dirigent protein 21-like              59.3    6e-07    
ref|XP_010243404.1|  PREDICTED: dirigent protein 22-like              59.3    6e-07    
gb|ABD52123.1|  dirigent-like protein pDIR12                          59.3    6e-07    
ref|XP_001752690.1|  predicted protein                                58.5    6e-07    
ref|XP_009117440.1|  PREDICTED: dirigent protein 23                   59.3    6e-07    
ref|XP_008783384.1|  PREDICTED: dirigent protein 22-like              59.3    6e-07    
ref|NP_199065.1|  disease resistance-responsive (dirigent-like pr...  58.9    7e-07    
ref|XP_004978854.1|  PREDICTED: disease resistance response prote...  58.9    7e-07    
emb|CDY60806.1|  BnaA01g37260D                                        58.9    7e-07    
ref|XP_004977239.1|  PREDICTED: disease resistance response prote...  58.9    8e-07    
emb|CDP10782.1|  unnamed protein product                              58.9    8e-07    
ref|XP_002880356.1|  hypothetical protein ARALYDRAFT_480959           58.9    8e-07    
gb|ADP55097.1|  dirigent-like protein                                 58.9    8e-07    
ref|XP_008229971.1|  PREDICTED: dirigent protein 22-like              58.9    8e-07    
ref|XP_007204144.1|  hypothetical protein PRUPE_ppa021998mg           58.9    8e-07    
gb|ADP55101.1|  dirigent-like protein                                 58.9    9e-07    
ref|XP_006492741.1|  PREDICTED: dirigent protein 7-like               58.9    9e-07    
gb|ADP55095.1|  dirigent-like protein                                 58.5    9e-07    
ref|XP_010690414.1|  PREDICTED: dirigent protein 23-like              58.5    9e-07    
ref|XP_002863772.1|  disease resistance-responsive family protein     58.5    9e-07    
ref|XP_009377686.1|  PREDICTED: dirigent protein 22-like              58.5    9e-07    
gb|KCW88770.1|  hypothetical protein EUGRSUZ_A01114                   58.5    1e-06    
gb|ADP55098.1|  dirigent-like protein                                 58.5    1e-06    
ref|XP_010472088.1|  PREDICTED: dirigent protein 23-like              58.5    1e-06    
ref|NP_850009.1|  dirigent protein 23                                 58.5    1e-06    
ref|XP_009353297.1|  PREDICTED: dirigent protein 22-like              58.2    1e-06    
ref|XP_010089478.1|  hypothetical protein L484_011932                 58.5    1e-06    
gb|ABR27717.1|  dirigent-like protein                                 58.5    1e-06    
gb|KCW88771.1|  hypothetical protein EUGRSUZ_A01115                   58.2    1e-06    
ref|XP_006416145.1|  hypothetical protein EUTSA_v10008857mg           58.5    1e-06    
gb|AAD29806.1|  putative disease resistance response protein          59.7    1e-06    
ref|XP_003578856.1|  PREDICTED: dirigent protein 22-like              58.2    1e-06    
ref|XP_006295056.1|  hypothetical protein CARUB_v10024124mg           58.2    1e-06    
ref|XP_010046355.1|  PREDICTED: dirigent protein 2-like               58.2    1e-06    
ref|XP_009117606.1|  PREDICTED: dirigent protein 22-like              58.2    1e-06    
ref|XP_009347128.1|  PREDICTED: dirigent protein 22-like              58.2    1e-06    
ref|XP_008351083.1|  PREDICTED: dirigent protein 22-like              58.2    1e-06    
ref|XP_006419382.1|  hypothetical protein CICLE_v10007072mg           58.2    1e-06    
ref|XP_006841304.1|  hypothetical protein AMTR_s00134p00100380        58.2    1e-06    
ref|XP_010068013.1|  PREDICTED: dirigent protein 2-like               57.8    1e-06    
gb|KDO37162.1|  hypothetical protein CISIN_1g046562mg                 57.8    2e-06    
ref|XP_007217417.1|  hypothetical protein PRUPE_ppa024264mg           57.8    2e-06    
ref|XP_006487695.1|  PREDICTED: dirigent protein 23-like              57.8    2e-06    
ref|XP_004243842.2|  PREDICTED: dirigent protein 1-like               57.8    2e-06    
ref|XP_003576241.1|  PREDICTED: dirigent protein 22-like              58.2    2e-06    
ref|XP_011046627.1|  PREDICTED: dirigent protein 23                   57.8    2e-06    



>ref|XP_009797332.1| PREDICTED: dirigent protein 24-like [Nicotiana sylvestris]
Length=377

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 223/245 (91%), Gaps = 3/245 (1%)
 Frame = -1

Query  867  SSATVANPTTD-HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING  691
            S ATVANP  + H   SFFMHDILGG+ PSGRVVTGIVAN++ANNLPF++ N+Q+FPI+G
Sbjct  135  SGATVANPIPEGHSTFSFFMHDILGGTHPSGRVVTGIVANTDANNLPFSKANNQVFPIDG  194

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            GVPLN INN++N+NNYPFLVGLNGQQQ++T+LQNTGNNN+VDSGDNQPFVT GQLP+GL+
Sbjct  195  GVPLNNINNIVNSNNYPFLVGLNGQQQSNTVLQNTGNNNIVDSGDNQPFVTAGQLPTGLS  254

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQQLMFGSITVVDN+ITEGHELGSA+LGRAQGFYL SS DGTSHTLALT LF     HEH
Sbjct  255  LQQLMFGSITVVDNEITEGHELGSAILGRAQGFYLTSSSDGTSHTLALTTLF--HGQHEH  312

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E+ DTISFFG+HRTATPISH+AIIGGTG YE AKGYATIETLPHVDQHTTDGVETITHFT
Sbjct  313  EVEDTISFFGIHRTATPISHIAIIGGTGKYENAKGYATIETLPHVDQHTTDGVETITHFT  372

Query  150  VYITP  136
            VYITP
Sbjct  373  VYITP  377



>ref|XP_009622578.1| PREDICTED: dirigent protein 24-like [Nicotiana tomentosiformis]
Length=377

 Score =   364 bits (934),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 198/245 (81%), Positives = 222/245 (91%), Gaps = 3/245 (1%)
 Frame = -1

Query  867  SSATVANPTTD-HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING  691
            S ATVA+P  + H   SFFMHDILGG+ PSGRVVTGIVAN++ANNLPF++ N+++FPI+G
Sbjct  135  SGATVADPIPEGHSTFSFFMHDILGGTHPSGRVVTGIVANTDANNLPFSKANNRVFPIDG  194

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            GVPLN INNV+NNNNYPFLVGLNGQQQ++T+LQNTGNNN+V+S DNQPFVT GQLP+GL+
Sbjct  195  GVPLNNINNVVNNNNYPFLVGLNGQQQSNTVLQNTGNNNIVNSEDNQPFVTAGQLPAGLS  254

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQQLMFGSITVVDN+ITEGHELGSA+LGRAQGFYL SS DGTSHTLALT LF     HEH
Sbjct  255  LQQLMFGSITVVDNEITEGHELGSAILGRAQGFYLTSSSDGTSHTLALTTLF--HGQHEH  312

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E+ DTISFFG+HRTATPISH+AIIGGTG YE AKGYATIETLPHVDQHTTDGVETITHFT
Sbjct  313  EVDDTISFFGIHRTATPISHIAIIGGTGKYENAKGYATIETLPHVDQHTTDGVETITHFT  372

Query  150  VYITP  136
            VYITP
Sbjct  373  VYITP  377



>ref|XP_004236764.1| PREDICTED: dirigent protein 24-like [Solanum lycopersicum]
Length=399

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            S ATVANP  DH   SFFMHDILGG+ PSGRVVTGIVA+++ NNLPFT+ ND +FP++GG
Sbjct  159  SGATVANPVLDHSKFSFFMHDILGGTHPSGRVVTGIVASTDVNNLPFTKANDNVFPLDGG  218

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            VPLN IN+++NNNNYPFL GLNGQQ + T+LQNTGNN++V++GDNQPFVT GQLPSG+ L
Sbjct  219  VPLNNINDIVNNNNYPFLAGLNGQQPS-TVLQNTGNNDIVNTGDNQPFVTAGQLPSGITL  277

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            QQLMFGSITVVDN+ITEGHELGS++LGRAQGFYL SS DGTSHTLALT LF    +H HE
Sbjct  278  QQLMFGSITVVDNEITEGHELGSSILGRAQGFYLTSSSDGTSHTLALTTLF--HGEHGHE  335

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
            + DTISFFG+HRTATPISH+AIIGGTG YE AKGYATIET+PHVDQHTTDG+ETITHFTV
Sbjct  336  VDDTISFFGIHRTATPISHIAIIGGTGKYENAKGYATIETMPHVDQHTTDGLETITHFTV  395

Query  147  YITP  136
            YITP
Sbjct  396  YITP  399



>ref|XP_006345923.1| PREDICTED: dirigent protein 24-like [Solanum tuberosum]
Length=400

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 215/244 (88%), Gaps = 2/244 (1%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            S A V +P  +HP  SFFMHDILGGS PSGRVVTGIVA S+ANNLPF++ N+Q+FPINGG
Sbjct  159  SGAKVESPILEHPTFSFFMHDILGGSLPSGRVVTGIVATSDANNLPFSKLNNQIFPINGG  218

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            V LN INN++NNNNYPFL GLNGQQQ +T+LQN+GNN+VV   +NQPFVT GQLPSGL+L
Sbjct  219  VSLNNINNIVNNNNYPFLAGLNGQQQANTVLQNSGNNDVVSGDNNQPFVTAGQLPSGLSL  278

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            QQLMFGSITVVDN++TEGHELGSAVLGRAQGFYL SS DGTSHTLALT LF    +H HE
Sbjct  279  QQLMFGSITVVDNELTEGHELGSAVLGRAQGFYLTSSSDGTSHTLALTTLF--HGEHNHE  336

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
            + DTISFFG+HRTATPISH+AIIGGTG YE AKG+ATIETLPHVDQHTTDG+ETITHFTV
Sbjct  337  VDDTISFFGIHRTATPISHIAIIGGTGKYENAKGFATIETLPHVDQHTTDGLETITHFTV  396

Query  147  YITP  136
            YITP
Sbjct  397  YITP  400



>ref|XP_004239767.1| PREDICTED: dirigent protein 24-like [Solanum lycopersicum]
Length=410

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 214/244 (88%), Gaps = 2/244 (1%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            S A V +P  +HP  SFFMHDILGGS PSGRVVTGIVA S+ANNLPF++ N+Q+FPINGG
Sbjct  169  SGAKVESPILEHPTFSFFMHDILGGSLPSGRVVTGIVATSDANNLPFSKLNNQIFPINGG  228

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            V LN INN++NNNNYPFL GLNGQQQ +T+LQN+GNN+VV   D QPFVT GQLPSGL+L
Sbjct  229  VSLNNINNIVNNNNYPFLAGLNGQQQANTVLQNSGNNDVVTGDDTQPFVTAGQLPSGLSL  288

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            QQLMFGSITVVDN++TEGHELGS+VLGRAQGFYL SS DGTSHTLALT LF    +H HE
Sbjct  289  QQLMFGSITVVDNELTEGHELGSSVLGRAQGFYLTSSSDGTSHTLALTTLF--HGEHNHE  346

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
            + DTISFFG+HRTATPISH+AIIGGTG YE AKG+ATIETLPHVDQHTTDG+ETITHFTV
Sbjct  347  VDDTISFFGIHRTATPISHIAIIGGTGKYENAKGFATIETLPHVDQHTTDGLETITHFTV  406

Query  147  YITP  136
            YITP
Sbjct  407  YITP  410



>ref|XP_006361435.1| PREDICTED: dirigent protein 9-like [Solanum tuberosum]
Length=395

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 215/244 (88%), Gaps = 5/244 (2%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            S ATVA    DH   SFFMHDILGG+ PSGRVVTGIVA+++ NNLPFT+ N+ +FP++GG
Sbjct  157  SGATVA---LDHSKFSFFMHDILGGTHPSGRVVTGIVASTDVNNLPFTKANNNVFPLDGG  213

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            VPLN IN+++NNNNYPFL GLNGQQQ +T+LQNTGNN++V++GDNQPFVT GQLPSG+ L
Sbjct  214  VPLNNINDIVNNNNYPFLAGLNGQQQPNTVLQNTGNNDIVNTGDNQPFVTAGQLPSGITL  273

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            QQLMFGSITVVDN+I+EGHELGS++LGRAQGFYL SS DGTSHTLALT LF    +H HE
Sbjct  274  QQLMFGSITVVDNEISEGHELGSSILGRAQGFYLTSSSDGTSHTLALTTLF--HGEHGHE  331

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
            + DTISFFG+HRTATPISH+AIIGGTG YE AKGYATIET+PH DQHTTDG+ETITHFTV
Sbjct  332  VDDTISFFGIHRTATPISHIAIIGGTGKYENAKGYATIETMPHADQHTTDGLETITHFTV  391

Query  147  YITP  136
            YITP
Sbjct  392  YITP  395



>ref|XP_009778401.1| PREDICTED: dirigent protein 24-like [Nicotiana sylvestris]
Length=392

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 220/242 (91%), Gaps = 2/242 (1%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVP  682
            ATV +P  +HP  SFFMHDILGG++PSGRVVTGIVA S+ANNLPF+ P +Q+FPINGGVP
Sbjct  153  ATVESPVLEHPTFSFFMHDILGGTRPSGRVVTGIVATSDANNLPFSNPTNQIFPINGGVP  212

Query  681  LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQ  502
            LNTINNV++NNNYPFL GLNGQQQ +T+LQN+GNNNVV+  +NQPFVT GQLPSGL+LQQ
Sbjct  213  LNTINNVVDNNNYPFLAGLNGQQQANTILQNSGNNNVVNGDNNQPFVTAGQLPSGLSLQQ  272

Query  501  LMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelg  322
            LMFGSITVVDN++TEGHELGSAVLGRAQGFYL SS DGTSHTLALTALF    +H+HE+ 
Sbjct  273  LMFGSITVVDNEVTEGHELGSAVLGRAQGFYLTSSSDGTSHTLALTALF--HGEHDHEVD  330

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            DTISFFG+HRTATPISH+AIIGGTG YE AKG+ATIETLPHVDQHTTDG+ETITHFTVYI
Sbjct  331  DTISFFGIHRTATPISHIAIIGGTGKYENAKGFATIETLPHVDQHTTDGLETITHFTVYI  390

Query  141  TP  136
            TP
Sbjct  391  TP  392



>ref|XP_009591518.1| PREDICTED: dirigent protein 24-like [Nicotiana tomentosiformis]
Length=392

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 218/242 (90%), Gaps = 2/242 (1%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVP  682
            A V +P  +HP  SFFMHDILGGSQPSGRVVTGIVA S+ANNLPF+   +Q+FPINGGVP
Sbjct  153  AAVESPVLEHPTFSFFMHDILGGSQPSGRVVTGIVATSDANNLPFSTTTNQIFPINGGVP  212

Query  681  LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQ  502
            LN INNV+NNNNYPFL GLNGQQQ +T+LQN+GNNNVV+ G+NQPFVT GQLPSGL+LQQ
Sbjct  213  LNNINNVVNNNNYPFLAGLNGQQQANTVLQNSGNNNVVNGGNNQPFVTAGQLPSGLSLQQ  272

Query  501  LMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelg  322
            LMFGSITVVDN+ITEGHELGSAVLG+AQGFYL SS DGTSHTLALTALF    +H+HE+ 
Sbjct  273  LMFGSITVVDNEITEGHELGSAVLGKAQGFYLTSSSDGTSHTLALTALF--HGEHDHEVD  330

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            DTISFFG+HRTATPISH+AIIGGTG YE AKG+ATIETLPHVDQHTTDGVETITHFTVYI
Sbjct  331  DTISFFGIHRTATPISHIAIIGGTGKYENAKGFATIETLPHVDQHTTDGVETITHFTVYI  390

Query  141  TP  136
            TP
Sbjct  391  TP  392



>ref|XP_011077161.1| PREDICTED: dirigent protein 24-like [Sesamum indicum]
Length=363

 Score =   325 bits (832),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 202/233 (87%), Gaps = 4/233 (2%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvi  658
            D    SFFMHDILGGSQPSGRVV GIVANSNANNLPF++PN+Q+FPINGGVPLNTIN VI
Sbjct  134  DPSTFSFFMHDILGGSQPSGRVVAGIVANSNANNLPFSKPNNQIFPINGGVPLNTINGVI  193

Query  657  nnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITV  478
            NNNNYPFLVGLNG   T+TL+Q+ GNN V D+ +NQ FVT GQLP GL +QQLMFGS+TV
Sbjct  194  NNNNYPFLVGLNGSP-TNTLVQSNGNNVVTDN-NNQAFVTAGQLPQGLTIQQLMFGSVTV  251

Query  477  VDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGV  298
            VDN+ITEGHELG+ VLG+AQGFY+ SS DG+SHTL LTALF       HE+ DTISFFGV
Sbjct  252  VDNEITEGHELGTGVLGKAQGFYITSSTDGSSHTLVLTALF--HGGDHHEIVDTISFFGV  309

Query  297  HRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            HRTATP+SH+A++GGTG YE AKGYATIETLPHVDQHTTDGVETITHFTVY+T
Sbjct  310  HRTATPMSHIAVVGGTGKYENAKGYATIETLPHVDQHTTDGVETITHFTVYLT  362



>ref|XP_011084398.1| PREDICTED: dirigent protein 24-like [Sesamum indicum]
Length=371

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 203/235 (86%), Gaps = 4/235 (2%)
 Frame = -1

Query  840  TDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnv  661
            +DHP LSFFMHDILGG+ PSGRVVTG+VANS+ANNLPF+ PN+Q+FPINGGVPLNTIN V
Sbjct  141  SDHPTLSFFMHDILGGTHPSGRVVTGVVANSDANNLPFSVPNNQIFPINGGVPLNTINGV  200

Query  660  innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
            INNNNYP LVGLNG   T+TL+Q+ GNN  V + +NQ FVT GQLP+GL LQQLMFG++T
Sbjct  201  INNNNYPSLVGLNGSP-TNTLVQSNGNN--VVASNNQAFVTAGQLPAGLTLQQLMFGTVT  257

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            VVDN+ITEGHELG++VLGRAQGFY+ SS DG+SHT+ALT  FHG       L  T+SFFG
Sbjct  258  VVDNEITEGHELGTSVLGRAQGFYMVSSSDGSSHTVALTVAFHGGEHDHEILD-TVSFFG  316

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYITP  136
            VHRTATPISH+AI+GGTG YE AKGYATIETLPH DQHTTDG+ETITHFT+Y+TP
Sbjct  317  VHRTATPISHIAIVGGTGKYENAKGYATIETLPHEDQHTTDGLETITHFTLYLTP  371



>emb|CDP00024.1| unnamed protein product [Coffea canephora]
Length=389

 Score =   313 bits (801),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 186/243 (77%), Positives = 209/243 (86%), Gaps = 5/243 (2%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVP  682
            A  +NP  DHP LSFFMHDILGGS PSGRVVTG+ AN+ AN LPF++PN+Q+FPINGGVP
Sbjct  151  AGASNP--DHPTLSFFMHDILGGSHPSGRVVTGVAANTAANGLPFSKPNNQVFPINGGVP  208

Query  681  LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQ  502
            LNTIN VINNNNYPFLVGLNG   T+T++ N    N V+ G+NQPFVT GQLP+GL +QQ
Sbjct  209  LNTINGVINNNNYPFLVGLNGSP-TNTIISNNNGGNNVNGGNNQPFVTAGQLPAGLTIQQ  267

Query  501  LMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelg  322
            LMFGS+TVVDNQITEGHELG+AVLG AQGFYLASS DGTSHTLALTALF  +H+ +HE+ 
Sbjct  268  LMFGSVTVVDNQITEGHELGTAVLGSAQGFYLASSRDGTSHTLALTALF-HDHNGDHEIV  326

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIET-LPHVDQHTTDGVETITHFTVY  145
            D++SFFGVHRTATPISHLAIIGGTG YE AKGYATIET L H DQHTTDGVETIT FTVY
Sbjct  327  DSVSFFGVHRTATPISHLAIIGGTGKYENAKGYATIETDLHHEDQHTTDGVETITQFTVY  386

Query  144  ITP  136
            +TP
Sbjct  387  LTP  389



>gb|EYU39460.1| hypothetical protein MIMGU_mgv1a021006mg, partial [Erythranthe 
guttata]
Length=349

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 201/230 (87%), Gaps = 2/230 (1%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnN  646
             SFFMHDILGGS PSGR VTGIVANS+ANNLPF++PN+Q+FPINGGVPLNTIN  INNNN
Sbjct  122  FSFFMHDILGGSHPSGRAVTGIVANSDANNLPFSKPNNQIFPINGGVPLNTINGAINNNN  181

Query  645  YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQ  466
            YPFLVGLNG   ++TL+Q+ GNN V  + +NQ FVT GQLP GL LQQLMFGS+TVVDN+
Sbjct  182  YPFLVGLNGSP-SNTLIQSNGNNVVSGN-NNQAFVTAGQLPQGLTLQQLMFGSVTVVDNE  239

Query  465  ITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTA  286
            +T GHELGSAVLG+AQGFY+ SS DG+SHTLALTALFH   +H  E+ DT+SFFGVHRTA
Sbjct  240  LTAGHELGSAVLGKAQGFYVTSSSDGSSHTLALTALFHSGSEHHEEIDDTVSFFGVHRTA  299

Query  285  TPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYITP  136
            TPISH+AI+GGTG YE AKGYATIE+LPH DQHTTDGVETITHFT+Y+TP
Sbjct  300  TPISHIAIVGGTGKYENAKGYATIESLPHEDQHTTDGVETITHFTLYLTP  349



>ref|XP_010032276.1| PREDICTED: dirigent protein 24-like [Eucalyptus grandis]
 gb|KCW51692.1| hypothetical protein EUGRSUZ_J01166 [Eucalyptus grandis]
Length=371

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 185/233 (79%), Gaps = 6/233 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P LSFFMHDILGG  PS RVVTGI+ANS  N LPF++PN+ +FPINGGVPL   N     
Sbjct  142  PQLSFFMHDILGGLHPSSRVVTGIIANSGDNALPFSKPNNNIFPINGGVPLVNANLNGLI  201

Query  651  nNY--PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITV  478
            NN   P L GLNG Q + T++QN+GNNN V  GDNQPF+T GQLP+G  LQQLMFG+ITV
Sbjct  202  NNNNLPSLTGLNGGQGS-TIIQNSGNNNQVTGGDNQPFITAGQLPAGATLQQLMFGTITV  260

Query  477  VDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGV  298
            +DNQ+TEGHELGSAVLG+AQGFYL+SSLDGTSHT+A T L    H  +HE+ DTISFFGV
Sbjct  261  IDNQLTEGHELGSAVLGQAQGFYLSSSLDGTSHTMAATVLL---HGSDHEIDDTISFFGV  317

Query  297  HRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            HRTA+P+S +AI+GGTG YE AKGYA +ETLP  +QHTTDGV+TI HF V+ +
Sbjct  318  HRTASPVSEVAIVGGTGKYEHAKGYAAVETLPQENQHTTDGVDTILHFNVFFS  370



>ref|XP_010068851.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 9-like [Eucalyptus 
grandis]
Length=330

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 193/247 (78%), Gaps = 11/247 (4%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--  676
             P T  P LSFFMHDI+GGS P+ RVVTG++ANS  + +PF++PN+ +FPINGGVPL   
Sbjct  84   KPGTAQPQLSFFMHDIIGGSHPTARVVTGVIANSEISAVPFSKPNNNIFPINGGVPLVNG  143

Query  675  --------tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPS  520
                     +N+VINNNN PFL GLNG Q + T++QNTGNN+ V+  DNQPFVT GQLP+
Sbjct  144  VGNINGIGNLNSVINNNNLPFLTGLNGAQAS-TVIQNTGNNDHVEGEDNQPFVTAGQLPA  202

Query  519  GLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehd  340
            G  LQQLMFG+ITV D+++TEGHELGSAV+G+AQGFYLASSLDGTS T+A+T + H    
Sbjct  203  GATLQQLMFGTITVFDDELTEGHELGSAVIGKAQGFYLASSLDGTSQTIAVTVMLHTSAS  262

Query  339  hehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETIT  160
             +HE+ DTISFFGVHRTA+P S +AI+ GTG YE AKGYAT+ETL   DQHTTDGV+TI 
Sbjct  263  GDHEIEDTISFFGVHRTASPESQVAIVSGTGKYEHAKGYATVETLHQADQHTTDGVDTIL  322

Query  159  HFTVYIT  139
             F+VY++
Sbjct  323  QFSVYLS  329



>ref|XP_010693138.1| PREDICTED: dirigent protein 9-like [Beta vulgaris subsp. vulgaris]
Length=374

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 186/237 (78%), Gaps = 7/237 (3%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvin  655
            HPA+SFFMHD+LGGS  SGR+VTG++A S+ N +PF++PN+Q+FP+  GVPL    N+ N
Sbjct  138  HPAISFFMHDVLGGSSASGRIVTGLIATSDMNGIPFSRPNNQVFPVTNGVPLMNNGNLNN  197

Query  654  nnNY---PFLVGLNGQQQ--TDTLLQNTGNNNVVDSGDN-QPFVTGGQLPSGLNLQQLMF  493
              N    PFL GL GQ Q    T++QN G N+VV+ GDN Q FVT GQLP+G  LQ+L+F
Sbjct  198  VLNNNNVPFLAGLTGQNQPQAQTIIQNAGTNSVVNGGDNNQAFVTPGQLPTGTTLQKLLF  257

Query  492  GSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTI  313
            GSITV+D+++TEGHELGS V+GR QGFYLASSLDG SHT+A TA+F    +HE    DTI
Sbjct  258  GSITVIDDELTEGHELGSGVIGRGQGFYLASSLDGESHTMAFTAVF-HGGEHEQVADDTI  316

Query  312  SFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            SFFGVHRTA+PIS +AIIGGTG YE AKGYATIET+P  +QHTTDGV+T+ HF+VY+
Sbjct  317  SFFGVHRTASPISQIAIIGGTGKYENAKGYATIETMPDQNQHTTDGVDTVAHFSVYL  373



>ref|XP_007219824.1| hypothetical protein PRUPE_ppa026919mg [Prunus persica]
 gb|EMJ21023.1| hypothetical protein PRUPE_ppa026919mg [Prunus persica]
Length=420

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 189/249 (76%), Gaps = 7/249 (3%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            + +TVA P  ++P LSFFMHDILGGS PS RVVTG+VAN+   N PF++ N+ +FP++GG
Sbjct  172  AGSTVAKPGAENPHLSFFMHDILGGSHPSVRVVTGLVANT-VFNAPFSKANNNIFPVSGG  230

Query  687  VPLntinnv----innnNYPFLVGLNG--QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL  526
             PL   N       N NN P + GL G    Q+ T++QN+GNNNVV  G NQPFVT GQL
Sbjct  231  TPLTNNNLNGFLDNNKNNIPSIAGLTGLTNSQSSTVIQNSGNNNVVSGGSNQPFVTAGQL  290

Query  525  PSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhge  346
            P+G  LQ+LMFGS+TV+D+++TEGHELGSAVLG+AQGFYLASSLDG SHT+A T L HGE
Sbjct  291  PTGATLQKLMFGSVTVIDDELTEGHELGSAVLGKAQGFYLASSLDGNSHTMAFTVLLHGE  350

Query  345  hdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVET  166
            H    E+ DTIS FGVHRTA+P+SH+A+IGGTG YE A GYA IE+L   DQHTTDGV+T
Sbjct  351  HGAHDEVEDTISLFGVHRTASPVSHIAVIGGTGKYEMATGYAAIESLHQEDQHTTDGVDT  410

Query  165  ITHFTVYIT  139
            I   +VY++
Sbjct  411  IMQISVYLS  419



>ref|XP_010096679.1| hypothetical protein L484_025428 [Morus notabilis]
 gb|EXB65347.1| hypothetical protein L484_025428 [Morus notabilis]
Length=394

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 187/252 (74%), Gaps = 14/252 (6%)
 Frame = -1

Query  858  TVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPL  679
            T A     HP LSF+MHDI+GGS P+ R+VTG+VA S  +N+PFT+ N+ +FP++G  PL
Sbjct  145  TSAGAAPGHPTLSFYMHDIIGGSHPTARIVTGLVA-STISNVPFTKANNNIFPVSGAAPL  203

Query  678  ntinn----vinnnNYPFLVGLNGQ-------QQTDTLLQNTGNNNVVDSGDNQPFVTGG  532
             T N       N NN PFL GLNGQ        QT+T +QN+GNNN+V  G  QPFVT G
Sbjct  204  TTANVNGILNNNRNNLPFLAGLNGQGASGFTNTQTNTFIQNSGNNNIVAGGSGQPFVTAG  263

Query  531  QLPSG-LNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALF  355
            QLPSG   LQ+LMFGS+TV+D+++TE HELGSAV+GRAQGFYLASSLDG SHT+ +T + 
Sbjct  264  QLPSGSATLQKLMFGSVTVLDDELTEEHELGSAVIGRAQGFYLASSLDGNSHTMVMTVMV  323

Query  354  hgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDG  175
            HG     H    TIS FGVHRTATP+SH+A+IGGTG Y+ A+GYAT+E+LPHVDQHTTDG
Sbjct  324  HGNDHDHHVED-TISLFGVHRTATPVSHVAVIGGTGKYDNAQGYATVESLPHVDQHTTDG  382

Query  174  VETITHFTVYIT  139
            V+TI H  +Y++
Sbjct  383  VDTIMHINIYLS  394



>ref|XP_002311136.2| disease resistance-responsive family protein [Populus trichocarpa]
 gb|EEE88503.2| disease resistance-responsive family protein [Populus trichocarpa]
Length=400

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 184/231 (80%), Gaps = 2/231 (1%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P LSFFMHDILGGS  S R+VTGI+A ++ N +PF+QPN+ +FP+  G PL  INN+IN 
Sbjct  171  PPLSFFMHDILGGSPASNRIVTGIIARTDINGIPFSQPNNNIFPLQDGTPLVNINNLINP  230

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            N  P L GL G Q T+TLLQNTGNNN V + +NQPFVT G  P+G  LQ+LMFGSITVVD
Sbjct  231  NTAPLLTGLTGAQ-TNTLLQNTGNNNNVVNSNNQPFVTAGNFPAGSALQKLMFGSITVVD  289

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELGSAV+G+AQGFYLASSLDGTSHT+A + L     ++  E+ DTISFFGVHR
Sbjct  290  DELTEGHELGSAVIGKAQGFYLASSLDGTSHTMAFSVLL-HGGENHGEIEDTISFFGVHR  348

Query  291  TATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            TATP S +A+IGGTG YE AKGYA++ETLP VDQHTTDG +TI HF VY++
Sbjct  349  TATPDSQIAVIGGTGKYENAKGYASVETLPQVDQHTTDGADTIMHFNVYLS  399



>ref|XP_006436126.1| hypothetical protein CICLE_v10033309mg [Citrus clementina]
 ref|XP_006486494.1| PREDICTED: dirigent protein 9-like [Citrus sinensis]
 gb|ESR49366.1| hypothetical protein CICLE_v10033309mg [Citrus clementina]
Length=382

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 185/241 (77%), Gaps = 6/241 (2%)
 Frame = -1

Query  846  PTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntin  667
            P    P L FFMHDILGGS PS RVVTGI+A++  N +PF++ ND  FP+ GG PL T N
Sbjct  140  PGPQTPPLCFFMHDILGGSHPSARVVTGIIADTEINGIPFSKSNDNFFPVQGGTPLLTQN  199

Query  666  nvinn---nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
            N+ +    +N PFL GLNG Q + T+LQ+TG +N+V+  DNQPFV+ GQLPSG+ LQ+LM
Sbjct  200  NLNDIINPDNVPFLTGLNGAQPS-TVLQDTGTSNIVNGDDNQPFVSAGQLPSGVTLQKLM  258

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALF--hgehdhehelg  322
            FG++TV+D+++TEGHELGS V+G+AQGFYLASSLDGTS T+ALTAL          H++ 
Sbjct  259  FGTMTVIDDELTEGHELGSGVIGKAQGFYLASSLDGTSQTIALTALLHGEEHDHDHHDVL  318

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            DTISFFGV+RTA+  S +A+IGG+G YE AKGYAT+ET+   DQHTTDGV+TI  F+VY+
Sbjct  319  DTISFFGVYRTASHESQVAVIGGSGKYENAKGYATVETIHQEDQHTTDGVDTIVKFSVYL  378

Query  141  T  139
            T
Sbjct  379  T  379



>ref|XP_002530969.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31404.1| conserved hypothetical protein [Ricinus communis]
Length=375

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 237/376 (63%), Gaps = 19/376 (5%)
 Frame = -1

Query  1215  MAKFF--LICIFFLVFTFG-CTQSARILDEASPVTPLSATLPEEEANPPEIddpvatppv  1045
             MAK     + +F L  T   C  SARILD+  P  P     P     PP           
Sbjct  1     MAKALKATLYLFLLAVTLSPCANSARILDDVEPENPFIVDPPATSTIPPPSAATTMPSGQ  60

Query  1044  apavaapgvvdpPETDD----PEvapptasavtapavnvvspvaavapppgaapvavatt  877
              PA A    +   +TD     PE   P   A        + P A VA P         + 
Sbjct  61    FPAAATVAPISTVDTDADPPLPEAEVPATVATPDDDAAPIVPPATVAAPIPVPTTITTSP  120

Query  876   pgTSS-----ATVANPT--TDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQP  718
              G SS     ATVANPT  T  P LSFFMHDILGGSQPS RVVTGI+A ++ N +PF+ P
Sbjct  121   SGPSSTVATTATVANPTSTTAAPPLSFFMHDILGGSQPSVRVVTGIIARTDINGIPFSVP  180

Query  717   NDQLFPINGGVPLntinnvinnn---NYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQP  547
             N+  FP+ GG PL  +NN+ N       P + GLN   Q +T+LQN+ NNN V +G++QP
Sbjct  181   NNNFFPLQGGTPLPNLNNLNNLINPNTAPLITGLN-PGQANTVLQNSANNNNVVNGNSQP  239

Query  546   FVTGGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLAL  367
             FVT GQLP+G ++Q+LMFGSITV+D+++TEGHELGSAVLG+AQGFYLASSLDGTSHT+A 
Sbjct  240   FVTAGQLPAG-SIQKLMFGSITVIDDELTEGHELGSAVLGKAQGFYLASSLDGTSHTMAF  298

Query  366   TALFhgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQH  187
             + + H    H   +GDTISFFGVHRTA+P S +A+IGGTG YE AKGYAT+ET+P VDQH
Sbjct  299   SIILHNGDAHHDAVGDTISFFGVHRTASPESQIAVIGGTGKYENAKGYATVETIPQVDQH  358

Query  186   TTDGVETITHFTVYIT  139
             TTDGV+T+ HFTVY++
Sbjct  359   TTDGVDTVMHFTVYLS  374



>gb|KDP46122.1| hypothetical protein JCGZ_06633 [Jatropha curcas]
Length=371

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 233/372 (63%), Gaps = 15/372 (4%)
 Frame = -1

Query  1215  MAKFFL---ICIFFLVFTFGCTQSARILDEA---SPV---TPLSATLPEEEANPPEIddp  1063
             MAK  L   I IF L  TF    SAR+LD+    +PV    P + T+P     P      
Sbjct  1     MAKALLKATIHIFLLAITFSAANSARVLDDVDPQNPVFVDPPATLTIPPSTTLPSGQVPA  60

Query  1062  vatppvapavaapgvvdpPETDDPEvapptasavtapavnvvspvaavapppgaapvava  883
             +A       +  P V    E  D +V  P A          V+    +     +   +  
Sbjct  61    IAPDEADSPLPVPQVPTTVEAPDADVEAPDADVAPITPPITVAAPIPLPTTTTSTSPSGP  120

Query  882   ttpgTSSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLF  703
              T   +SATVANP T  P LSFFMHDILGGS PS RVVTGI+A ++ N +PF++PN+  F
Sbjct  121   ATAVPTSATVANPATSAPQLSFFMHDILGGSTPSVRVVTGIIARTDINGIPFSEPNNNFF  180

Query  702   PINGGVPLntinnvinnn---NYPFLVGLN-GQQQTDTLLQNTGNNNVVDSGDNQPFVTG  535
             P+ GG+PL  I+N+ N       P + GLN GQ  T T+LQN+GNNN V + +NQPFV+ 
Sbjct  181   PVQGGIPLTNIDNINNLINPNTAPLITGLNPGQTGTSTVLQNSGNNNNVVNSNNQPFVSA  240

Query  534   GQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALF  355
             GQ+P+   LQ++MFGSITV+D+++TEGHELGSAV+G+AQGFYLASSLDGTSHT+ALT + 
Sbjct  241   GQIPASSTLQRIMFGSITVIDDELTEGHELGSAVMGKAQGFYLASSLDGTSHTMALTIML  300

Query  354   hgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDG  175
                 +    + DTISFFGVHRTA+  S +A+IGGTG YE  KGYAT+ETLP  +QH TDG
Sbjct  301   --HGEGNGHVEDTISFFGVHRTASHTSQIAVIGGTGKYENGKGYATVETLPQENQHVTDG  358

Query  174   VETITHFTVYIT  139
             V+T+ HF VY++
Sbjct  359   VDTVMHFNVYLS  370



>ref|XP_008461621.1| PREDICTED: dirigent protein 24 [Cucumis melo]
Length=394

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 185/237 (78%), Gaps = 9/237 (4%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPL----ntinnvi  658
            +SF+MHDILGGS PS RVVTGIVANS+++ + F++PND  FPI G +PL    N  N + 
Sbjct  157  ISFYMHDILGGSHPSARVVTGIVANSDSSGIAFSKPNDNFFPIQGTLPLFNNDNLKNIIN  216

Query  657  nnnNYPFLVGLNG-QQQTDTLLQNTGNNNVV--DSGDNQPFVTGGQLPSGLNLQQLMFGS  487
            NNNN PFL G NG  Q  + LLQN+ NN ++  D  +NQPFVT GQLPS + LQQLMFGS
Sbjct  217  NNNNLPFLAGFNGVAQGNNLLLQNSANNGILSGDEDNNQPFVTAGQLPSRVTLQQLMFGS  276

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            +TV+D+++TEGHELGSAV+GRAQGFY+ASSLDGTS T+ALTALF     HEH   D+ISF
Sbjct  277  VTVIDDELTEGHELGSAVVGRAQGFYMASSLDGTSQTVALTALF-HSGGHEHVAEDSISF  335

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPH-VDQHTTDGVETITHFTVYIT  139
            FGVHRTAT  S +A++GGTG YE A+GYAT+E L H  DQHTTDGV+TI HF+VY+T
Sbjct  336  FGVHRTATAGSQIAVVGGTGKYENARGYATVEMLHHQEDQHTTDGVDTIIHFSVYLT  392



>emb|CBI33171.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 188/244 (77%), Gaps = 4/244 (2%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            +SAT  N    +P LSFFMHDILGGS PS RVV+GI AN+  N LPF++ N  +FPINGG
Sbjct  82   TSATTGNAAPPNPPLSFFMHDILGGSHPSARVVSGITANTQINGLPFSKANGGVFPINGG  141

Query  687  VPLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            VPL   NN + NNN  PFL GLNG Q T T++QN GNNN V+ G NQPFVT GQLP+G  
Sbjct  142  VPLLNGNNGLINNNNIPFLTGLNGGQ-TSTIIQNNGNNNPVNGGSNQPFVTAGQLPAGAT  200

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ++MFG+ITV+D+++TEGHELGSAV+GRAQGFYLASSLDG SHT+ LT L        H
Sbjct  201  LQKVMFGTITVIDDELTEGHELGSAVVGRAQGFYLASSLDGGSHTMVLTVLL--HGSDHH  258

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            +  DTISFFGVHRTA+P+SH+A++GGTG YE AKGYATIE+L   DQHTTDGVET+    
Sbjct  259  QEEDTISFFGVHRTASPVSHIAVVGGTGEYENAKGYATIESLHQEDQHTTDGVETVIQVN  318

Query  150  VYIT  139
            VY++
Sbjct  319  VYLS  322



>ref|XP_002276144.1| PREDICTED: dirigent protein 24 [Vitis vinifera]
Length=362

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 188/244 (77%), Gaps = 4/244 (2%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            +SAT  N    +P LSFFMHDILGGS PS RVV+GI AN+  N LPF++ N  +FPINGG
Sbjct  121  TSATTGNAAPPNPPLSFFMHDILGGSHPSARVVSGITANTQINGLPFSKANGGVFPINGG  180

Query  687  VPLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            VPL   NN + NNN  PFL GLNG Q T T++QN GNNN V+ G NQPFVT GQLP+G  
Sbjct  181  VPLLNGNNGLINNNNIPFLTGLNGGQ-TSTIIQNNGNNNPVNGGSNQPFVTAGQLPAGAT  239

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ++MFG+ITV+D+++TEGHELGSAV+GRAQGFYLASSLDG SHT+ LT L        H
Sbjct  240  LQKVMFGTITVIDDELTEGHELGSAVVGRAQGFYLASSLDGGSHTMVLTVLL--HGSDHH  297

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            +  DTISFFGVHRTA+P+SH+A++GGTG YE AKGYATIE+L   DQHTTDGVET+    
Sbjct  298  QEEDTISFFGVHRTASPVSHIAVVGGTGEYENAKGYATIESLHQEDQHTTDGVETVIQVN  357

Query  150  VYIT  139
            VY++
Sbjct  358  VYLS  361



>gb|KGN50510.1| hypothetical protein Csa_5G179750 [Cucumis sativus]
Length=394

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 185/237 (78%), Gaps = 9/237 (4%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPL----ntinnvi  658
            +SF+MHDILGGS PS RVVTGIVANS+++ + F++PND  FPI G +PL    N  N + 
Sbjct  157  ISFYMHDILGGSHPSARVVTGIVANSDSSGIAFSKPNDNFFPIQGTLPLLNNDNLKNIIN  216

Query  657  nnnNYPFLVGLNG-QQQTDTLLQNTGNNNVV--DSGDNQPFVTGGQLPSGLNLQQLMFGS  487
            NNNN PFL G NG  Q  + LLQN+ NN V+  D  +NQPFVT GQLPS + LQQLMFGS
Sbjct  217  NNNNLPFLAGFNGVAQGNNLLLQNSANNGVLNGDEDNNQPFVTAGQLPSRVTLQQLMFGS  276

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            +TVVD+++TEGHELGSAV+GRAQGFY+ASSLDGTS T+ALTALF     HEH + D+ISF
Sbjct  277  VTVVDDELTEGHELGSAVVGRAQGFYMASSLDGTSQTVALTALF-HSGGHEHVVEDSISF  335

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPH-VDQHTTDGVETITHFTVYIT  139
            FGVHRTA   S +A++GGTG YE A+GYAT+E L H  DQHTTDG++TI HF+VY+T
Sbjct  336  FGVHRTAMAGSQIAVVGGTGKYENARGYATVEMLHHQEDQHTTDGMDTIIHFSVYLT  392



>gb|KEH44500.1| disease resistance response/dirigent-like protein [Medicago truncatula]
Length=353

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 177/238 (74%), Gaps = 3/238 (1%)
 Frame = -1

Query  846  PTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--t  673
            P    P+LSFFMHDILGGS PS RVVTGIVANS+   LPF++ N+ +FPI GG+PL    
Sbjct  116  PVVKEPSLSFFMHDILGGSHPSARVVTGIVANSDVTGLPFSKNNNNIFPITGGIPLVIPK  175

Query  672  innvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMF  493
            +N +I NNN P LVGL   Q + T+ QN G NNVV  G+NQPFV+ G LP GL +Q+LMF
Sbjct  176  LNGIITNNNLPLLVGLGNGQSSSTVFQNRGTNNVVTGGNNQPFVSAGNLPGGLTVQKLMF  235

Query  492  GSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTI  313
            GS+TV+D+Q+TEGHEL S V+GRAQGFY ASSLDGTS ++ +T +F    +    + D+I
Sbjct  236  GSVTVIDDQLTEGHELDSGVVGRAQGFYTASSLDGTSQSVVMT-VFLHGGNDHDGVDDSI  294

Query  312  SFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            S FGVHRTA+  S +A+IGG+G YE A+GYA +ETL   DQHTTDGV+TI HF +Y+T
Sbjct  295  SLFGVHRTASLKSEVAVIGGSGKYENARGYAALETLLKEDQHTTDGVDTIIHFDIYLT  352



>ref|XP_004147710.1| PREDICTED: uncharacterized protein LOC101204391 [Cucumis sativus]
Length=234

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 181/233 (78%), Gaps = 9/233 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPL----ntinnvinnnN  646
            MHDILGGS PS RVVTGIVANS+++ + F++PND  FPI G +PL    N  N + NNNN
Sbjct  1    MHDILGGSHPSARVVTGIVANSDSSGIAFSKPNDNFFPIQGTLPLLNNDNLKNIINNNNN  60

Query  645  YPFLVGLNG-QQQTDTLLQNTGNNNVV--DSGDNQPFVTGGQLPSGLNLQQLMFGSITVV  475
             PFL G NG  Q  + LLQN+ NN V+  D  +NQPFVT GQLPS + LQQLMFGS+TVV
Sbjct  61   LPFLAGFNGVAQGNNLLLQNSANNGVLNGDEDNNQPFVTAGQLPSRVTLQQLMFGSVTVV  120

Query  474  DNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVH  295
            D+++TEGHELGSAV+GRAQGFY+ASSLDGTS T+ALTALF     HEH + D+ISFFGVH
Sbjct  121  DDELTEGHELGSAVVGRAQGFYMASSLDGTSQTVALTALF-HSGGHEHVVEDSISFFGVH  179

Query  294  RTATPISHLAIIGGTGTYETAKGYATIETLPH-VDQHTTDGVETITHFTVYIT  139
            RTA   S +A++GGTG YE A+GYAT+E L H  DQHTTDG++TI HF+VY+T
Sbjct  180  RTAMAGSQIAVVGGTGKYENARGYATVEMLHHQEDQHTTDGMDTIIHFSVYLT  232



>ref|XP_004164341.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204391 
[Cucumis sativus]
Length=234

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 179/233 (77%), Gaps = 9/233 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnNY---  643
            MHDILGGS PS RVVTGIVANS+++ + F++PND  FPI G +PL   +N+ N  N    
Sbjct  1    MHDILGGSHPSARVVTGIVANSDSSGIAFSKPNDNFFPIQGTLPLLNNDNLKNIINNNNI  60

Query  642  -PFLVGLNG-QQQTDTLLQNTGNNNVV--DSGDNQPFVTGGQLPSGLNLQQLMFGSITVV  475
             PFL G NG  Q  + LLQN+ NN V+  D  +NQPFVT GQLPS + LQQLMFGS+TVV
Sbjct  61   SPFLAGFNGVAQGNNLLLQNSANNGVLNGDEDNNQPFVTAGQLPSRVTLQQLMFGSVTVV  120

Query  474  DNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVH  295
            D+++TEGHELGSAV+GRAQGFY+ASSLDGTS T+ALTALF     HEH + D+ISFFGVH
Sbjct  121  DDELTEGHELGSAVVGRAQGFYMASSLDGTSQTVALTALF-HSGGHEHVVEDSISFFGVH  179

Query  294  RTATPISHLAIIGGTGTYETAKGYATIETLPH-VDQHTTDGVETITHFTVYIT  139
            RTA   S +A++GGTG YE A+GYAT+E L H  DQHTTDG++TI HF+VY+T
Sbjct  180  RTAMAGSQIAVVGGTGKYENARGYATVEMLHHQEDQHTTDGMDTIIHFSVYLT  232



>ref|XP_002316318.2| disease resistance-responsive family protein [Populus trichocarpa]
 gb|EEF02489.2| disease resistance-responsive family protein [Populus trichocarpa]
Length=353

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 185/237 (78%), Gaps = 5/237 (2%)
 Frame = -1

Query  840  TDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnv  661
            T  P LSFFMHDILGGS PS R+VTGI+A +  N +PF+QPN+  FP+ GG PL  INN+
Sbjct  118  TTSPPLSFFMHDILGGSHPSNRIVTGIIARTEINGIPFSQPNNNFFPLQGGTPLVNINNL  177

Query  660  innnNY---PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFG  490
             N  N    P L GL G Q T+T LQNTGNNN V +G+NQPFVT G LP+G  LQ+LMFG
Sbjct  178  NNLINPNNAPLLTGLTGTQ-TNTFLQNTGNNNNVANGNNQPFVTAGNLPAGSALQKLMFG  236

Query  489  SITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTIS  310
            SITVVDN++TEGHELGSAV+G+AQGFYLASS+DGTSHT+A T L     ++  ++ DTIS
Sbjct  237  SITVVDNELTEGHELGSAVIGKAQGFYLASSMDGTSHTMAFTVLL-HGGENHGDVEDTIS  295

Query  309  FFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FFGVHRTAT  S +AIIGGTG YE AKGYAT+ETLP VDQHTTDGV+TI HF V+++
Sbjct  296  FFGVHRTATADSQIAIIGGTGKYENAKGYATVETLPQVDQHTTDGVDTIMHFNVFLS  352



>ref|XP_004307460.1| PREDICTED: uncharacterized protein LOC101295273 [Fragaria vesca 
subsp. vesca]
Length=388

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  843  TTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinn  664
            T   P L+FFMHDILGGS PS RVVTG++AN+ AN +PF++PN+ +FP++GG PLN  N 
Sbjct  149  TAAKPHLAFFMHDILGGSHPSVRVVTGLIANTVAN-VPFSKPNNNIFPVSGGTPLNNNNL  207

Query  663  vinnn----NYPFLVGLNG-----QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
                N    + P   GL G       QT T++QN+GNNN+V+ G N PFVT GQLP+G  
Sbjct  208  NGFLNNNRNSLPSFAGLTGTTGLTNSQTSTVIQNSGNNNIVNGGSNLPFVTAGQLPNGAT  267

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ+LMFGS+TV+D+++TEG ELGSAVLG+AQGFYLASSLDG SHT+A T L       EH
Sbjct  268  LQKLMFGSVTVIDDELTEGEELGSAVLGKAQGFYLASSLDGNSHTMAFTVLM----HGEH  323

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            ++ DTIS FGVHRTA+P+SH+A+IGGTG YE A GYA IE+L   DQHTTDGV+TI   +
Sbjct  324  DVEDTISLFGVHRTASPVSHIAVIGGTGKYENANGYAAIESLHQEDQHTTDGVDTIMQIS  383

Query  150  VYIT  139
            VY++
Sbjct  384  VYLS  387



>ref|XP_011027097.1| PREDICTED: dirigent protein 24-like [Populus euphratica]
Length=392

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 162/253 (64%), Positives = 191/253 (75%), Gaps = 12/253 (5%)
 Frame = -1

Query  867  SSATVANPT-------TDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQ  709
            +S TVA P        T  P+LSFFMHDILGGS PS R+V+GI+A +  N +PF+QPN+ 
Sbjct  141  TSPTVAKPAGSQTTTATTSPSLSFFMHDILGGSHPSNRIVSGIIARTEINGIPFSQPNNN  200

Query  708  LFPINGGVPLntinnvinnnNY---PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVT  538
             FP+ GG PL  INN+ N  N    P L GL G Q T+T LQNTGNNN VD+GDNQPFVT
Sbjct  201  FFPLQGGTPLVNINNLNNLINPNNAPLLTGLTGTQ-TNTFLQNTGNNNNVDNGDNQPFVT  259

Query  537  GGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTAL  358
             G LP+G  LQ+LMFGSITVVDN++TEGHELGSAV+G+AQGFYLASS+DGTSHT+A T L
Sbjct  260  AGNLPAGSALQKLMFGSITVVDNELTEGHELGSAVIGKAQGFYLASSMDGTSHTMAFTVL  319

Query  357  FhgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTD  178
                 ++  E+ DTISFFGVHRTAT  S +AIIGGTG YE AKGYA +ETLP  DQHTTD
Sbjct  320  L-HGGENHGEVEDTISFFGVHRTATADSPIAIIGGTGKYENAKGYAAVETLPQGDQHTTD  378

Query  177  GVETITHFTVYIT  139
            GV+TI HF VY++
Sbjct  379  GVDTIMHFNVYLS  391



>ref|XP_004492036.1| PREDICTED: uncharacterized protein LOC101489698 [Cicer arietinum]
Length=372

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 180/240 (75%), Gaps = 4/240 (2%)
 Frame = -1

Query  852  ANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn-  676
            A P    P+LSFFMHDILGGS PS RVV GIVAN++   LPF++ N+ LFPI GG+PL  
Sbjct  134  AKPAAKEPSLSFFMHDILGGSHPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVN  193

Query  675  -tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQL  499
              +N ++ NNN P LVGL+  Q + T+ +N+G +N V  G+NQPFV+ G LP+G  +Q+L
Sbjct  194  PKLNGIVTNNNLPNLVGLSAAQSS-TVFKNSGTSNTVSGGNNQPFVSAGNLPAGFTIQKL  252

Query  498  MFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgD  319
            MFGS+TV+D+Q+TE HEL S+V+GRAQGFYLASSLDGTS T+ LT L     +H   + D
Sbjct  253  MFGSVTVIDDQLTEEHELDSSVIGRAQGFYLASSLDGTSKTIVLTILV-HGGEHHDGVED  311

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            TIS FGVHRTA+P S +A+IGGTG YE A GYA +ETL + DQHTTDGV+TI HF +Y+T
Sbjct  312  TISLFGVHRTASPESEIAVIGGTGKYENAGGYAALETLLNEDQHTTDGVDTILHFNIYLT  371



>ref|XP_010243746.1| PREDICTED: dirigent protein 9-like [Nelumbo nucifera]
Length=334

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 190/243 (78%), Gaps = 6/243 (2%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            SS TV +P  D P LSFFMHDILGG+ PS RVVTGIVA+++ N +PF++PN  +FP+NGG
Sbjct  95   SSVTVTHPDAD-PPLSFFMHDILGGTAPSARVVTGIVASTSVNGIPFSRPNSGVFPVNGG  153

Query  687  VPL-ntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            VPL N  N VINNNN+PFL GL G   + T++QN GNNNVV+ G+N PFV  GQLP+G  
Sbjct  154  VPLFNGNNGVINNNNFPFLAGLGGTTTSSTIVQNNGNNNVVNGGNNLPFVAAGQLPAGAT  213

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ+LMFG+ITVVD+++TEGHELGS+V+G+AQGFYLASSLDG+S T+ LTALF        
Sbjct  214  LQKLMFGTITVVDDELTEGHELGSSVVGKAQGFYLASSLDGSSQTMVLTALF----HGGD  269

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
               D+IS FGVHRTA P S +AI+GGTG YE A+GYATI+T+   DQHTTDGVET+  F+
Sbjct  270  HEDDSISLFGVHRTAAPESQIAIVGGTGKYENAQGYATIQTIHPSDQHTTDGVETVLQFS  329

Query  150  VYI  142
            VY+
Sbjct  330  VYL  332



>ref|XP_009357651.1| PREDICTED: dirigent protein 9-like [Pyrus x bretschneideri]
Length=226

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 174/229 (76%), Gaps = 8/229 (3%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnN--YP  640
            MHDILGGS PS RVVTG++AN+   N  F++PN+ +FP++GG PL   N     NN   P
Sbjct  1    MHDILGGSHPSVRVVTGLIANT-VLNPAFSKPNNNIFPVSGGTPLTNNNINGFLNNNNIP  59

Query  639  FLVGLNG--QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQ  466
             + GL+G    Q+ T++QN+GNNN+V+ G NQPFVT GQLP+G   Q+LMFGS+TV+D+ 
Sbjct  60   NIAGLSGLTNSQSSTVIQNSGNNNIVNGGSNQPFVTAGQLPNGATFQKLMFGSVTVIDDD  119

Query  465  ITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTA  286
            +TEGHELGSAVLG+AQGFY+ASSLDG SHT+A T L    H  EH+  DTIS FGVHRTA
Sbjct  120  LTEGHELGSAVLGKAQGFYMASSLDGNSHTMAFTVLL---HAGEHDAEDTISLFGVHRTA  176

Query  285  TPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            +P+SH+A+IGGTG YE A GYA IE+L  VDQHTTDGV+TI   +VY++
Sbjct  177  SPVSHIAVIGGTGKYENANGYAAIESLHQVDQHTTDGVDTIMQISVYLS  225



>ref|XP_003621654.1| Disease resistance response protein [Medicago truncatula]
 gb|AES77872.1| disease resistance response/dirigent-like protein [Medicago truncatula]
Length=389

 Score =   261 bits (668),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 173/240 (72%), Gaps = 4/240 (2%)
 Frame = -1

Query  852  ANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLnt  673
            A P    P+ SFFMHDILGGS PS RVV GIVANS+   LPF++ N+ LFPI GG+PL  
Sbjct  151  AKPIAKEPSFSFFMHDILGGSHPSARVVAGIVANSDVTGLPFSKLNNNLFPITGGIPLVN  210

Query  672  innv--innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQL  499
                  + NNN P LVGL+  Q + T+ +N+G +N V  G+NQPFV+ G LP G  +Q+L
Sbjct  211  PKLNGIVTNNNLPNLVGLSAAQSS-TVFKNSGTSNTVSGGNNQPFVSAGNLPGGFTVQKL  269

Query  498  MFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgD  319
            MFGS+TV+D+Q+TE HEL S+V+GRAQGFYLASSLDGTS T+ LT L     +H     D
Sbjct  270  MFGSVTVIDDQLTEEHELDSSVIGRAQGFYLASSLDGTSKTIVLTVLV-HGAEHHDGADD  328

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            TIS FG+HRTA+P S +A+IGGTG YE A+GYA IE L   DQHTTDG +TI HF++Y+T
Sbjct  329  TISLFGIHRTASPESEIAVIGGTGKYENARGYAAIENLLKEDQHTTDGADTILHFSIYLT  388



>gb|KCW65310.1| hypothetical protein EUGRSUZ_G02765 [Eucalyptus grandis]
Length=309

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 183/247 (74%), Gaps = 24/247 (10%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--  676
             P T  P LSFFMHDI+GGS P+ RVVTG++ANS  + +PF++PN+ +FPINGGVPL   
Sbjct  76   KPGTAQPQLSFFMHDIIGGSHPTARVVTGVIANSEISAVPFSKPNNNIFPINGGVPLVNG  135

Query  675  --------tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPS  520
                     +N+VINNNN PFL GLNG Q + T++QNTGNN+ V+  DNQPF        
Sbjct  136  VGNINGIGNLNSVINNNNLPFLTGLNGAQAS-TVIQNTGNNDHVEGEDNQPF--------  186

Query  519  GLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehd  340
                 QLMFG+ITV D+++TEGHELGSAV+G+AQGFYLASSLDGTS T+A+T + H    
Sbjct  187  -----QLMFGTITVFDDELTEGHELGSAVIGKAQGFYLASSLDGTSQTIAVTVMLHTSAS  241

Query  339  hehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETIT  160
             +HE+ DTISFFGVHRTA+P S +AI+ GTG YE AKGYAT+ETL   DQHTTDGV+TI 
Sbjct  242  GDHEIEDTISFFGVHRTASPESQVAIVSGTGKYEHAKGYATVETLHQADQHTTDGVDTIL  301

Query  159  HFTVYIT  139
             F+VY++
Sbjct  302  QFSVYLS  308



>ref|XP_009335913.1| PREDICTED: dirigent protein 24-like [Pyrus x bretschneideri]
Length=227

 Score =   256 bits (653),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 176/230 (77%), Gaps = 9/230 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnNYPFL  634
            MHDILGGS PS RVVTG++AN+   N  F++PN+ +FP++GG+PL   N     NN   +
Sbjct  1    MHDILGGSHPSVRVVTGLIANT-VLNPAFSKPNNNIFPVSGGIPLTNNNINGFLNNNNNI  59

Query  633  ---VGLNG--QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDN  469
                GL+G    Q+ T++QN+GNNN+V+ G NQPFVT GQLP+G  LQ+LMFGS+TV+D+
Sbjct  60   PNIAGLSGLTNSQSSTVIQNSGNNNIVNGGSNQPFVTAGQLPNGATLQKLMFGSVTVIDD  119

Query  468  QITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRT  289
             +TEGHELGSAVLG+AQGFY+ASSLDG SHT+A T L    H  EH++ DTIS FGVHRT
Sbjct  120  NLTEGHELGSAVLGKAQGFYMASSLDGNSHTMAFTVLL---HAGEHDVEDTISLFGVHRT  176

Query  288  ATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            A+P+SH+A+IGGTG YE A GYA IE+L  VDQHTTDGV+TI   +VY++
Sbjct  177  ASPVSHIAVIGGTGKYENANGYAAIESLHQVDQHTTDGVDTIMQISVYLS  226



>gb|ACU24111.1| unknown [Glycine max]
Length=386

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 183/241 (76%), Gaps = 5/241 (2%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--  676
            N     P+ SFFMHD+LGGS+PS RVV GIVAN++   LPF++ N+ LFPI GG+PL   
Sbjct  146  NSLAKEPSFSFFMHDVLGGSRPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVNP  205

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
             +N +I NNN P LVGL+G Q + T+ +N+G +N V  G+NQPFV+ G LP+G  +Q+LM
Sbjct  206  KLNGIITNNNLPNLVGLSGAQSS-TVFKNSGTSNTVTGGNNQPFVSAGNLPAGFTIQKLM  264

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe--helg  322
            FGS+TV+D+Q+TEGHEL SAV+G+AQGFYLASSLDG+S T+ LT L HG    +    + 
Sbjct  265  FGSVTVIDDQLTEGHELDSAVIGKAQGFYLASSLDGSSQTILLTVLVHGGEHDQHHDVVD  324

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D+I+FFG+HRTA+  S +A+IGGTG YE A+GYA++ETL   DQHTTDGV+TI HF VY+
Sbjct  325  DSINFFGIHRTASSESEVAVIGGTGKYENARGYASLETLLKEDQHTTDGVDTILHFNVYL  384

Query  141  T  139
            T
Sbjct  385  T  385



>gb|AFK37477.1| unknown [Medicago truncatula]
Length=389

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = -1

Query  852  ANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLnt  673
            A P    P+ SFFMHDILGGS PS RVV GIVANS+   LPF++ N+ LFPI GG+PL  
Sbjct  151  AKPIAKEPSFSFFMHDILGGSHPSARVVAGIVANSDVTGLPFSKLNNNLFPITGGIPLVN  210

Query  672  innv--innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQL  499
                  + NNN P LVGL+  Q + T+ +N+G +N V  G+NQPFV+ G LP G  +Q+L
Sbjct  211  PKLNGIVTNNNLPNLVGLSAAQSS-TVFKNSGTSNTVSGGNNQPFVSAGNLPGGFTVQKL  269

Query  498  MFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgD  319
            MFGS+TV+D+Q+TE HEL S+V+GRAQGFYLASSLDGT  T+ LT L     +H     D
Sbjct  270  MFGSVTVIDDQLTEEHELDSSVIGRAQGFYLASSLDGTGKTIVLTVLV-HGAEHHDGADD  328

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            TIS FG+HRTA+P S +A+IGGTG YE A+GYA IE L   DQHTTDG +TI HF++Y+T
Sbjct  329  TISLFGIHRTASPESEIAVIGGTGKYENARGYAAIENLLKEDQHTTDGADTILHFSIYLT  388



>ref|NP_001241330.1| uncharacterized protein LOC100808391 [Glycine max]
 gb|ACU19963.1| unknown [Glycine max]
Length=396

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 180/241 (75%), Gaps = 5/241 (2%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLnti  670
            N     P+ SFFMHDILGGS+PS RVV GIVAN++   LPF++ N+ LFPI GG+PL   
Sbjct  156  NSLAKEPSFSFFMHDILGGSRPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVNP  215

Query  669  nnv--innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
                 I NNN P LVGL+G Q + T+ +N+G +N V  G+NQPFV+ G LP+G  +Q+LM
Sbjct  216  KLNGIITNNNLPNLVGLSGAQSS-TVFKNSGTSNTVTGGNNQPFVSAGNLPAGFTIQKLM  274

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe--helg  322
            FGS+TV+D+Q+TEGHEL SAV+G+AQGFYLASSLDG+S T+ LT L HG    +    + 
Sbjct  275  FGSVTVIDDQLTEGHELDSAVIGKAQGFYLASSLDGSSQTILLTVLVHGGEHDQHHDVVD  334

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D+I+FFG+HRTA+  S +A+IGGTG YE A+GYA++ETL   DQHTTDGV+TI HF VY+
Sbjct  335  DSINFFGIHRTASSESEVAVIGGTGKYENARGYASLETLLKEDQHTTDGVDTILHFNVYL  394

Query  141  T  139
            T
Sbjct  395  T  395



>ref|XP_006601830.1| PREDICTED: uncharacterized protein LOC100808391 isoform X1 [Glycine 
max]
Length=397

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 180/241 (75%), Gaps = 5/241 (2%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLnti  670
            N     P+ SFFMHDILGGS+PS RVV GIVAN++   LPF++ N+ LFPI GG+PL   
Sbjct  157  NSLAKEPSFSFFMHDILGGSRPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVNP  216

Query  669  nnv--innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
                 I NNN P LVGL+G Q + T+ +N+G +N V  G+NQPFV+ G LP+G  +Q+LM
Sbjct  217  KLNGIITNNNLPNLVGLSGAQSS-TVFKNSGTSNTVTGGNNQPFVSAGNLPAGFTIQKLM  275

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe--helg  322
            FGS+TV+D+Q+TEGHEL SAV+G+AQGFYLASSLDG+S T+ LT L HG    +    + 
Sbjct  276  FGSVTVIDDQLTEGHELDSAVIGKAQGFYLASSLDGSSQTILLTVLVHGGEHDQHHDVVD  335

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D+I+FFG+HRTA+  S +A+IGGTG YE A+GYA++ETL   DQHTTDGV+TI HF VY+
Sbjct  336  DSINFFGIHRTASSESEVAVIGGTGKYENARGYASLETLLKEDQHTTDGVDTILHFNVYL  395

Query  141  T  139
            T
Sbjct  396  T  396



>gb|KHN13831.1| Disease resistance response protein 206 [Glycine soja]
Length=389

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 183/241 (76%), Gaps = 5/241 (2%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--  676
            N     P+ SFFMHDILGGS+PS RVV GIVAN++   LPF++ N+ LFPI GG+PL   
Sbjct  149  NSLAKEPSFSFFMHDILGGSRPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVNP  208

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
             +N +I NNN P LVGL+G Q + T+ +N+G +N V  G+NQPFV+ G LP+G  +Q+LM
Sbjct  209  KLNGIITNNNLPNLVGLSGAQSS-TVFKNSGTSNTVTGGNNQPFVSAGNLPAGFTIQKLM  267

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe--helg  322
            FGS+TV+D+Q+TEGHEL SAV+G+AQGFYLASSLDG+S T+ LT L HG    +    + 
Sbjct  268  FGSVTVIDDQLTEGHELDSAVIGKAQGFYLASSLDGSSQTILLTVLVHGGEHDQHHDVVD  327

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D+I+FFG+HRTA+  S +A+IGGTG YE A+GYA++ETL   DQHTTDGV+TI HF VY+
Sbjct  328  DSINFFGIHRTASSESEVAVIGGTGKYENARGYASLETLLKEDQHTTDGVDTILHFNVYL  387

Query  141  T  139
            T
Sbjct  388  T  388



>ref|XP_007139311.1| hypothetical protein PHAVU_008G018700g [Phaseolus vulgaris]
 gb|ESW11305.1| hypothetical protein PHAVU_008G018700g [Phaseolus vulgaris]
Length=396

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 180/241 (75%), Gaps = 5/241 (2%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--  676
            NP T  P+ SFFMHDILGGS PS RVV GIVAN++   LPF++ N+ LFPI GG+PL   
Sbjct  156  NPVTKEPSFSFFMHDILGGSHPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVNP  215

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
             +N +I NNN P LVGL+G Q + T+ +N+G +N V   +NQPFV+ G LP+G  +Q+LM
Sbjct  216  KLNGIITNNNLPNLVGLSGAQSS-TVFKNSGTSNTVAGSNNQPFVSAGNLPAGFTIQKLM  274

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe--helg  322
            FGS+TV+D+Q+TEGHEL SAV+GRAQG YLASSLDGTS T+ LT L HG    +    L 
Sbjct  275  FGSVTVIDDQLTEGHELDSAVIGRAQGLYLASSLDGTSQTILLTILLHGGEHDQHHEGLE  334

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D+IS FG+HRTA+  S +A+IGG+G YE A+GY ++ETL   DQHTTDGV+TI HF VY+
Sbjct  335  DSISLFGIHRTASTESEIAVIGGSGKYENARGYVSLETLLKEDQHTTDGVDTILHFNVYL  394

Query  141  T  139
            T
Sbjct  395  T  395



>ref|XP_010260030.1| PREDICTED: dirigent protein 9-like [Nelumbo nucifera]
Length=334

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 187/243 (77%), Gaps = 6/243 (2%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            SS T  +P  + P LSFFMHDILGG+ PS +VVTGIVA S  N +PF++PN  +FP+NGG
Sbjct  95   SSVTATHPDAN-PPLSFFMHDILGGTTPSAKVVTGIVATSGMNGIPFSRPNSGVFPVNGG  153

Query  687  VPL-ntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            VPL N  N ++NNNN PFL GL G   + T++QN GNNNVV+ G+N PFV  GQLP+G  
Sbjct  154  VPLFNGNNGIVNNNNVPFLAGLGGTTTSSTVIQNNGNNNVVNGGNNLPFVAAGQLPAGAT  213

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ+LMFG+ITV+D+++TEGHE+GS+V+G+AQGFYLASSL G+S T+ALTALF        
Sbjct  214  LQKLMFGTITVIDDELTEGHEMGSSVVGKAQGFYLASSLGGSSQTMALTALF----HGGG  269

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
               D+ISFFGVHRTA P S +AI+GGTG YE AKGYATI+TL   DQHTTDGVET+  F+
Sbjct  270  HEDDSISFFGVHRTAAPESQIAIVGGTGKYENAKGYATIQTLHLSDQHTTDGVETVLQFS  329

Query  150  VYI  142
            VY+
Sbjct  330  VYL  332



>ref|XP_003531914.1| PREDICTED: dirigent protein 9-like [Glycine max]
Length=369

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 183/240 (76%), Gaps = 4/240 (2%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--  676
            NP     + SFFMHDILGGS+PS RVV GIVAN++   LPF++ N+ LFPI GG+PL   
Sbjct  130  NPVAKEASFSFFMHDILGGSRPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVNP  189

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
             +N +I NNN P LVGL+G Q + T+ +N+G +N V   +NQPFV+ G LP+G  +Q+LM
Sbjct  190  KLNGIITNNNLPNLVGLSGAQSS-TVFKNSGTSNTVTGSNNQPFVSAGNLPAGFTIQKLM  248

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALF-hgehdhehelgD  319
            FGS+TV+D+Q+TEGHEL SAV+G+AQGFYLASSLDGTS T+ LT L   GEH+H   + D
Sbjct  249  FGSVTVIDDQLTEGHELDSAVIGKAQGFYLASSLDGTSQTILLTVLVHGGEHEHHDLVDD  308

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            +I+ FG+HRTA+  S +A+IGGTG YE A+GYA++ETL   DQHTTDGV+TI HF VY+T
Sbjct  309  SINLFGIHRTASSESEVAVIGGTGKYENARGYASLETLLKEDQHTTDGVDTILHFNVYLT  368



>ref|XP_009344911.1| PREDICTED: dirigent protein 24-like [Pyrus x bretschneideri]
Length=401

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 179/242 (74%), Gaps = 10/242 (4%)
 Frame = -1

Query  846  PTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntin  667
            P  + P LSFFMHDILGGS PS RVVTG+VA +   N  F++PN+ +FP++GG PL   N
Sbjct  163  PGAETPHLSFFMHDILGGSHPSVRVVTGLVATT-VLNAAFSKPNNNIFPVSGGTPLTNNN  221

Query  666  nv----innnNYPFLVGLNG--QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQ  505
                   N NN P + GL+G    Q+ T++QN+GNNNVV+ G NQPFVT GQLP+G  LQ
Sbjct  222  INGFLDNNKNNIPNIAGLSGLTNSQSSTVIQNSGNNNVVNDGSNQPFVTAGQLPNGATLQ  281

Query  504  QLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehel  325
            +LMFGS+TV+D+ +TEGHEL SAVLG+AQGFYLASSLDG S TLA T L    H  EH++
Sbjct  282  KLMFGSVTVIDDDLTEGHELASAVLGKAQGFYLASSLDGNSPTLAFTVLL---HAGEHDV  338

Query  324  gDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVY  145
             DTIS FGVHRTA+ +SH+A+IGGTG YE A GYA IE+L   DQHTTDGV+TI   +VY
Sbjct  339  EDTISLFGVHRTASLVSHIAVIGGTGKYENANGYAAIESLHQEDQHTTDGVDTIMQISVY  398

Query  144  IT  139
            ++
Sbjct  399  LS  400



>ref|XP_007009563.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
 gb|EOY18373.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
Length=384

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 12/244 (5%)
 Frame = -1

Query  846  PTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPL----  679
            P +  P LSFFMHDILGGS PS RVVTGI+ANS  + +PF++ N+ LFP+ G  PL    
Sbjct  142  PGSHDPVLSFFMHDILGGSHPSARVVTGIIANSEVSGIPFSKTNNDLFPVQGAAPLLNGN  201

Query  678  -----ntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
                   INN+IN NN PFL GL G Q T+ +LQN+GNNN V +GD+QPFVT GQLP G 
Sbjct  202  NINDLKNINNLINPNNVPFLTGLTGAQ-TNAILQNSGNNNNVLNGDSQPFVTAGQLPPG-  259

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
            +LQ+LMFGSITV+D+++TE HELGSAVLGRAQGFYLASSLDG+S T+ALT L HG     
Sbjct  260  SLQRLMFGSITVIDDELTEAHELGSAVLGRAQGFYLASSLDGSSQTIALTVLLHGGEHGH  319

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                  ISFFGVHRT +P S +A++GGTG YE A+GYAT+ETL   DQH TDGV+TI HF
Sbjct  320  ELED-AISFFGVHRTVSPASQIAVVGGTGKYENARGYATVETLHQEDQHITDGVDTILHF  378

Query  153  TVYI  142
             VY+
Sbjct  379  NVYL  382



>ref|XP_009139192.1| PREDICTED: dirigent protein 24 [Brassica rapa]
Length=312

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 178/236 (75%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ N+ +FP++  VPL   NN+ N 
Sbjct  74   PVLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSNNNIFPVDNAVPLVNANNINNI  133

Query  651  nNY---PFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             N    P L GL+G Q  +T++QNT GN+    S +N PFVT GQLP    LQQLMFG+I
Sbjct  134  INPNTAPLLTGLSGSQ-ANTVIQNTNGNSQGSLSSNNLPFVTAGQLPPAAALQQLMFGTI  192

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFY+ASSLDGTS TL+LT LFHGEHDH   L D ISFF
Sbjct  193  TVVDDELTEGHELGSAIIGRAQGFYIASSLDGTSQTLSLTVLFHGEHDHHDTLDDAISFF  252

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF++Y+T
Sbjct  253  GVHRTASHASHIAVVGGTGKFEHAKGYAVVETLHNQEDQHVTDGRDTILHFSIYLT  308



>gb|KHN47528.1| hypothetical protein glysoja_040063 [Glycine soja]
Length=369

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 182/240 (76%), Gaps = 4/240 (2%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn--  676
            NP     + SFFMHDILGGS+PS RVV GIVAN++   LPF++ N+ LFPI GG+PL   
Sbjct  130  NPVAKEASFSFFMHDILGGSRPSARVVAGIVANTDVTGLPFSKLNNNLFPITGGIPLVNP  189

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
             +N +I NNN P LVGL+G Q + T+ +N+G +N V   +NQPFV+ G LP+G  +Q+LM
Sbjct  190  KLNGIITNNNLPNLVGLSGAQSS-TVFKNSGTSNTVTGSNNQPFVSAGNLPAGFTIQKLM  248

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALF-hgehdhehelgD  319
            FGS+TV+D+Q+TEGHEL SAV+G+AQGFYLASSLDGTS T+ LT L   GEH+H   + D
Sbjct  249  FGSVTVIDDQLTEGHELDSAVIGKAQGFYLASSLDGTSQTILLTVLVHGGEHEHHDLVDD  308

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            +I+ FG+HRTA+  S +A+IGGTG  E A+GYA++ETL   DQHTTDGV+TI HF VY+T
Sbjct  309  SINLFGIHRTASSESEVAVIGGTGKSENARGYASLETLLKEDQHTTDGVDTILHFNVYLT  368



>ref|XP_002281485.1| PREDICTED: dirigent protein 24-like [Vitis vinifera]
Length=317

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 193/249 (78%), Gaps = 13/249 (5%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            +SATVA+   +HP LSFFMHDILGGS P+ RV  GI+AN+  N LPFT+ N  +FP+NGG
Sbjct  74   TSATVAD---EHPPLSFFMHDILGGSNPTTRVEAGIIANTQINGLPFTKTNGGVFPMNGG  130

Query  687  VPLnti------nnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL  526
            VPL T       N ++NNNN PFL GLNG   T T++QN GNNNVV +GD  PFVT GQL
Sbjct  131  VPLVTANGVINNNGIMNNNNLPFLAGLNGAS-TSTVVQNNGNNNVVTNGDTLPFVTPGQL  189

Query  525  PSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhge  346
            P+G  LQ+LMFG+ITV+D+++TEGHE+GS+V+GRAQGFYLASSLDG+S T+A TALF   
Sbjct  190  PAGATLQKLMFGTITVIDDELTEGHEIGSSVVGRAQGFYLASSLDGSSQTMAFTALF---  246

Query  345  hdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVET  166
            H+ +H   DT+SFFGVHRTA P S +AI+GGTG YE A GYA+I+TL   DQHTTDGVET
Sbjct  247  HEGDHHEEDTLSFFGVHRTAAPESQIAIVGGTGKYENANGYASIQTLHPTDQHTTDGVET  306

Query  165  ITHFTVYIT  139
            + H +V+I+
Sbjct  307  LLHVSVFIS  315



>ref|XP_008233548.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 24 [Prunus mume]
Length=408

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 177/249 (71%), Gaps = 20/249 (8%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            +SATVA P  ++P LSFFMHDILGGS PS RVVTG+VAN+   N PF++ N+ +FP++GG
Sbjct  173  ASATVAKPGAENPHLSFFMHDILGGSHPSVRVVTGLVANT-VFNAPFSKANNNIFPVSGG  231

Query  687  VPLntinnvinnnN----YPFLVGLNG--QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL  526
             PL   N     NN     P + GL G    Q+ T++QN+GNNNVV  G NQPFVT G  
Sbjct  232  TPLTNNNINGFLNNNKNNIPSIAGLTGLTNSQSSTVIQNSGNNNVVSGGSNQPFVTAGX-  290

Query  525  PSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhge  346
                        S+TV+D+++TEGHELGSAVLG+AQGFYLASSLDG SHT+A T L HGE
Sbjct  291  ------------SVTVIDDELTEGHELGSAVLGKAQGFYLASSLDGNSHTMAFTVLLHGE  338

Query  345  hdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVET  166
            H    E+ DTIS FGVHRTA+P+SH+A+IGGTG YE A GYA IE+L   DQHTTDGV+T
Sbjct  339  HGAHDEVEDTISLFGVHRTASPVSHIAVIGGTGKYEMANGYAAIESLHQEDQHTTDGVDT  398

Query  165  ITHFTVYIT  139
            I   +VY++
Sbjct  399  IMQISVYLS  407



>ref|XP_008362698.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 24-like [Malus 
domestica]
Length=401

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 176/249 (71%), Gaps = 10/249 (4%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            +SA V  P  + P LSFFMHDILGGS PS RVVT +VA +   N+ F+ PN+ +FPI+GG
Sbjct  156  ASAIVVKPGAETPHLSFFMHDILGGSHPSVRVVTDLVATT-VLNVAFSIPNNNIFPISGG  214

Query  687  VPLntinnvinnnNYPFL----VGLNG--QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL  526
             PL   N     NN         GL+G    Q+ T++QN+GNNN+V+ G NQPFVT GQL
Sbjct  215  TPLTNNNINGFLNNNKNNIPNIAGLSGLTNSQSSTVIQNSGNNNIVNDGSNQPFVTAGQL  274

Query  525  PSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhge  346
            P+G  LQ+LMFGS+TV+D+ + EGHELGS VLG+A GFYLASSLDG SHT+A T L    
Sbjct  275  PNGATLQKLMFGSVTVIDDDLIEGHELGSTVLGKAXGFYLASSLDGNSHTMAFTVLL---  331

Query  345  hdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVET  166
            H  EH++ DTIS FGVH TA+ +SH+A+IGGTG YE A GYA IE+L   DQHTTDGV+T
Sbjct  332  HAGEHDVEDTISLFGVHHTASSVSHIAVIGGTGKYENANGYAAIESLHQEDQHTTDGVDT  391

Query  165  ITHFTVYIT  139
            I    VY++
Sbjct  392  IMQIDVYLS  400



>ref|XP_002879796.1| hypothetical protein ARALYDRAFT_482962 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56055.1| hypothetical protein ARALYDRAFT_482962 [Arabidopsis lyrata subsp. 
lyrata]
Length=322

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 176/236 (75%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  85   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  144

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S +N PFVT G LP G  LQ LMFG+I
Sbjct  145  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSANNLPFVTAGNLPPGAALQHLMFGTI  203

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+GRAQGFYLASSLDGTS TL+LT L HGEHDH+  L D ISFF
Sbjct  204  TVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDHQDTLDDAISFF  263

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL + D QH TDG +TI HF+VY+T
Sbjct  264  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQDNQHITDGQDTILHFSVYLT  319



>ref|XP_006403483.1| hypothetical protein EUTSA_v10010565mg [Eutrema salsugineum]
 gb|ESQ44936.1| hypothetical protein EUTSA_v10010565mg [Eutrema salsugineum]
Length=309

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 175/235 (74%), Gaps = 5/235 (2%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ N+ +FP++  VPL   NN+ N 
Sbjct  72   PVLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSNNNIFPVDNAVPLVNANNINNI  131

Query  651  nNY---PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             N    P L GL+G Q  +T++QNT  N+     +N PFVT GQLP    LQQLMFG+IT
Sbjct  132  INPNTAPLLTGLSGSQ-ANTVIQNTNGNSQGSLSNNLPFVTAGQLPPAAALQQLMFGTIT  190

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            VVD+++TEGHELGS V+GRAQGFYLASSLDGTS TL+LT LFHGEHDH   L D ISFFG
Sbjct  191  VVDDELTEGHELGSVVIGRAQGFYLASSLDGTSQTLSLTVLFHGEHDHHDTLDDAISFFG  250

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTDGVETITHFTVYIT  139
            VHRTA+  S +A++GGTG +E AKGYA +ETL + + QH TDG +TI HF++Y+T
Sbjct  251  VHRTASHASQIAVVGGTGKFEHAKGYAVVETLHNQENQHVTDGRDTILHFSIYLT  305



>ref|XP_010509017.1| PREDICTED: dirigent protein 9-like [Camelina sativa]
Length=326

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 175/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  89   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  148

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S +N PFVT G LP G  LQ LMFG+I
Sbjct  149  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSANNLPFVTAGNLPPGAALQHLMFGTI  207

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+GRAQGFYLASSLDGTS TL+LT L HGEHDH   L D ISFF
Sbjct  208  TVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDHHDTLDDAISFF  267

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL + D QH TDG +TI HF+VY+T
Sbjct  268  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQDNQHITDGQDTILHFSVYLT  323



>ref|XP_010505613.1| PREDICTED: dirigent protein 9 isoform X1 [Camelina sativa]
 ref|XP_010505614.1| PREDICTED: dirigent protein 9 isoform X2 [Camelina sativa]
Length=326

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 175/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  89   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  148

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S +N PFVT G LP G  LQ LMFG+I
Sbjct  149  INPNTAPLLTGLGGAQTT-TVIQNTNGNSNDALSANNLPFVTAGNLPPGAALQHLMFGTI  207

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+GRAQGFYLASSLDGTS TL+LT L HGEHDH   L D ISFF
Sbjct  208  TVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDHHDTLDDAISFF  267

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL + D QH TDG +TI HF+VY+T
Sbjct  268  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQDNQHITDGQDTILHFSVYLT  323



>gb|KFK34759.1| hypothetical protein AALP_AA5G189900 [Arabis alpina]
Length=319

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 176/236 (75%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++  VP    NN+ N 
Sbjct  81   PVLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPFVNPNNINNL  140

Query  651  nNY---PFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             N    P L GL+G Q  +T++QNT GN+    S +N PFVT GQLP    LQ LMFG+I
Sbjct  141  INPNTAPLLTGLSGSQ-ANTVIQNTNGNSQGSLSSNNLPFVTAGQLPPIAALQHLMFGTI  199

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFYLASSLDGTS TL+LT LFHGEHDH   L D ISFF
Sbjct  200  TVVDDELTEGHELGSAIIGRAQGFYLASSLDGTSQTLSLTVLFHGEHDHHDTLDDAISFF  259

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF++Y+T
Sbjct  260  GVHRTASHASHIAVVGGTGKFEHAKGYAVVETLHNQEDQHVTDGHDTILHFSIYLT  315



>ref|XP_010427284.1| PREDICTED: dirigent protein 24-like [Camelina sativa]
Length=320

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 176/236 (75%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++  VPL   NN+ N 
Sbjct  82   PILEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPLVNANNINNL  141

Query  651  nNY---PFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             N    P L GL+G Q  +T++QN+ GN+    S +N PFVT GQLP    LQQLMFG+I
Sbjct  142  INPNTAPLLTGLSGSQ-ANTVIQNSNGNSQGALSSNNLPFVTTGQLPPAAALQQLMFGTI  200

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFYLA+SLDGTS TL+LT L H EHDH   L D ISFF
Sbjct  201  TVVDDELTEGHELGSAIIGRAQGFYLATSLDGTSQTLSLTVLLHEEHDHHDTLDDAISFF  260

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF+VY+T
Sbjct  261  GVHRTASHASHIAVVGGTGRFEHAKGYAVVETLHNQEDQHVTDGHDTILHFSVYLT  316



>ref|NP_181475.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Arabidopsis thaliana]
 sp|O80630.1|DIR9_ARATH RecName: Full=Dirigent protein 9; Short=AtDIR9; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC27834.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AAR20779.1| At2g39430 [Arabidopsis thaliana]
 gb|AAS46642.1| At2g39430 [Arabidopsis thaliana]
 gb|AEC09674.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Arabidopsis thaliana]
Length=322

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 174/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  85   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  144

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  145  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSANSLPFVTAGNLPPGAALQHLMFGTI  203

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+GRAQGFYLASSLDGTS TL+LT L HGEHD    L D ISFF
Sbjct  204  TVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDQHDTLDDAISFF  263

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL + D QH TDG +TI HF+VY+T
Sbjct  264  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQDNQHITDGQDTILHFSVYLT  319



>ref|NP_191083.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9M3C8.1|DIR24_ARATH RecName: Full=Dirigent protein 24; Short=AtDIR24; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB75757.1| disease resistance response/ dirigent-like protein [Arabidopsis 
thaliana]
 gb|AEE79355.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
Length=306

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 175/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++  VPL   N++ N 
Sbjct  68   PILEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPLVNANSINNL  127

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL+G Q  +T++QN+ GN+    S +N PFVT GQLP    LQQLMFGSI
Sbjct  128  INPNTAPLLTGLSGSQ-ANTVIQNSNGNSQGSLSSNNLPFVTTGQLPPIAALQQLMFGSI  186

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFYLASSLDGTS TL+LT L H +HDH   L D ISFF
Sbjct  187  TVVDDELTEGHELGSAIIGRAQGFYLASSLDGTSQTLSLTVLLHEDHDHHDTLDDAISFF  246

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF+VY+T
Sbjct  247  GVHRTASHASHIAVVGGTGRFEHAKGYAVVETLHNQEDQHVTDGHDTILHFSVYLT  302



>ref|XP_010504370.1| PREDICTED: dirigent protein 24 [Camelina sativa]
Length=320

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 176/236 (75%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++  VPL   NN+ N 
Sbjct  82   PILEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPLVNANNINNL  141

Query  651  nNY---PFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             N    P L GL+G Q  +T++QN+ GN+    + +N PFVT GQLP    LQQLMFG+I
Sbjct  142  INPNTAPLLTGLSGSQ-ANTVIQNSNGNSQGALNSNNLPFVTTGQLPPAAALQQLMFGTI  200

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFYLA+SLDGTS TL+LT L H EHDH   L D ISFF
Sbjct  201  TVVDDELTEGHELGSAIIGRAQGFYLATSLDGTSQTLSLTVLLHEEHDHHDTLDDAISFF  260

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF+VY+T
Sbjct  261  GVHRTASHASHIAVVGGTGRFEHAKGYAVVETLHNQEDQHVTDGHDTILHFSVYLT  316



>ref|XP_010516083.1| PREDICTED: dirigent protein 24-like [Camelina sativa]
Length=318

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 176/236 (75%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++  VPL   NN+ N 
Sbjct  80   PILEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPLVNANNINNL  139

Query  651  nNY---PFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             N    P L GL+G Q  +T++QN+ GN+    S +N PFVT GQLP    LQQLMFG+I
Sbjct  140  INPNTAPLLTGLSGSQ-ANTVIQNSNGNSQGSLSSNNLPFVTTGQLPPAAALQQLMFGTI  198

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFYLA+SLDGTS TL+LT L H EHDH   L D ISFF
Sbjct  199  TVVDDELTEGHELGSAIIGRAQGFYLATSLDGTSQTLSLTVLLHEEHDHHDTLDDAISFF  258

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF+VY+T
Sbjct  259  GVHRTASHASHIAVVGGTGRFEHAKGYAVVETLYNQEDQHVTDGHDTILHFSVYLT  314



>dbj|BAF00893.1| disease resistance response/ dirigent - like protein [Arabidopsis 
thaliana]
Length=306

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 175/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++  VPL   N++ N 
Sbjct  68   PILEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPLVNANSINNL  127

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL+G Q  +T++QN+ GN+    S +N PFVT GQLP    LQQLMFGSI
Sbjct  128  INPNTAPLLTGLSGSQ-ANTVIQNSNGNSQGSLSSNNLPFVTTGQLPPIAVLQQLMFGSI  186

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFYLASSLDGTS TL+LT L H +HDH   L D ISFF
Sbjct  187  TVVDDELTEGHELGSAIIGRAQGFYLASSLDGTSQTLSLTVLLHEDHDHHDTLDDAISFF  246

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF+VY+T
Sbjct  247  GVHRTASHASHIAVVGGTGRFEHAKGYAVVETLHNQEDQHVTDGHDTILHFSVYLT  302



>ref|XP_006411169.1| hypothetical protein EUTSA_v10016936mg [Eutrema salsugineum]
 gb|ESQ52622.1| hypothetical protein EUTSA_v10016936mg [Eutrema salsugineum]
Length=324

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 175/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  87   PVLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNTNNINSV  146

Query  651  ---nNYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
               N  P L GL G Q T T++QNT GN N   + +N PFVT G LP G  LQ LMFG+I
Sbjct  147  INPNTAPLLTGLGGAQ-TSTVIQNTNGNTNDAFNSNNLPFVTAGNLPIGAALQHLMFGTI  205

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+Q+TE HELGSAV+G+AQGFYLASSLDGTS TL+LT L HGEHDH   L D ISFF
Sbjct  206  TVVDDQLTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTVLLHGEHDHHDTLDDAISFF  265

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+VY+T
Sbjct  266  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSVYLT  321



>ref|XP_010517290.1| PREDICTED: dirigent protein 9-like [Camelina sativa]
 ref|XP_010517291.1| PREDICTED: dirigent protein 9-like [Camelina sativa]
Length=327

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 175/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  90   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  149

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S +N PFVT G LP G  LQ LMFG+I
Sbjct  150  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSANNLPFVTAGNLPPGAALQHLMFGTI  208

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+GRAQGFYLASSLDGTS TL+LT L HGEHDH   L D ISFF
Sbjct  209  TVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDHHDTLDDAISFF  268

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF++Y+T
Sbjct  269  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSIYLT  324



>ref|XP_006651257.1| PREDICTED: dirigent protein 25-like [Oryza brachyantha]
Length=260

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 175/230 (76%), Gaps = 11/230 (5%)
 Frame = -1

Query  822  SFFMHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPL-ntinnvinnn  649
            +FFMHDILGGSQPS R+VTG+VA++ AN  LPF +PN+ +FPI G VPL    +N+I+ N
Sbjct  38   AFFMHDILGGSQPSARIVTGVVASAAANGQLPFARPNENIFPIQGAVPLPQGASNLIDGN  97

Query  648  NYPFLVGLNGQQQTDTLLQNTGNNNVVDSG-DNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            N P++ GL G   + T++Q+  N N V+ G  N PF+  G LPSG+ LQ L+FG+ TV+D
Sbjct  98   NVPYVAGLGGT--SATIVQS--NGNTVNGGSKNTPFINAGDLPSGVTLQNLLFGTTTVID  153

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELG+AV+GRAQGFY+ASS DGTS TLALTA+F    D   E GDT+SFFGVHR
Sbjct  154  DELTEGHELGAAVVGRAQGFYVASSQDGTSKTLALTAMF----DGGEEHGDTLSFFGVHR  209

Query  291  TATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
             A P SH+AIIGGTG YE AKG+A IETL   D+HTTDGVET+  F++++
Sbjct  210  MAAPESHVAIIGGTGKYENAKGFAAIETLHSGDEHTTDGVETLLQFSIHL  259



>ref|XP_009141808.1| PREDICTED: dirigent protein 9-like [Brassica rapa]
Length=309

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 177/244 (73%), Gaps = 7/244 (3%)
 Frame = -1

Query  852  ANPTTDH-PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn  676
            A  T +H P+L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL 
Sbjct  64   ATTTNEHEPSLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLV  123

Query  675  tinnvinnn---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNL  508
              NN+ +       P L GL+G Q T T++QNT GN N   S ++ PFVT G LP G  L
Sbjct  124  NSNNINSVINPNTAPLLTGLSGAQ-TSTVIQNTNGNTNDALSSNSLPFVTAGNLPPGAAL  182

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            Q LMFG+ITVVD+++TE HELGSAV+G+AQGFYLASSLDGTS  L+LT L   EHDH   
Sbjct  183  QHLMFGTITVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQILSLTVLLDREHDHHDT  242

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFT  151
            L D ISFFGVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+
Sbjct  243  LDDAISFFGVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFS  302

Query  150  VYIT  139
            VY+T
Sbjct  303  VYLT  306



>emb|CDY53583.1| BnaA05g34560D [Brassica napus]
Length=310

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 173/236 (73%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  72   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  131

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  132  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSTNSLPFVTAGNLPPGAALQHLMFGTI  190

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+G+AQGFYLASSLDGTS TL+LT L   EHDH   L D ISFF
Sbjct  191  TVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTVLLDREHDHHDTLDDAISFF  250

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+VY+T
Sbjct  251  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSVYLT  306



>emb|CDY07650.1| BnaA03g18610D [Brassica napus]
Length=309

 Score =   241 bits (614),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 173/236 (73%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  72   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  131

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  132  INPNTAPLLTGLGGAQTT-TVIQNTNGNSNDALSTNSLPFVTAGNLPPGAALQHLMFGTI  190

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+G+AQGFYLASSLDGTS TL+LT L   EHDH   L D ISFF
Sbjct  191  TVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTVLLDREHDHHDTLDDAISFF  250

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+VY+T
Sbjct  251  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSVYLT  306



>ref|XP_009143318.1| PREDICTED: dirigent protein 9 [Brassica rapa]
Length=310

 Score =   241 bits (614),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 173/236 (73%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  72   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  131

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  132  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSTNSLPFVTAGNLPPGAALQHLMFGTI  190

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+G+AQGFYLASSLDGTS TL+LT L   EHDH   L D ISFF
Sbjct  191  TVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTVLLDREHDHHDTLDDAISFF  250

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+VY+T
Sbjct  251  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSVYLT  306



>ref|XP_006296385.1| hypothetical protein CARUB_v10025558mg [Capsella rubella]
 gb|EOA29283.1| hypothetical protein CARUB_v10025558mg [Capsella rubella]
Length=325

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 175/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  88   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  147

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL+G Q T T++QNT GN+N     ++ PFVT G LP G  LQ LMFG+I
Sbjct  148  INPNTAPLLTGLSGAQ-TSTVIQNTNGNSNDALDANSLPFVTAGNLPPGAALQHLMFGTI  206

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+GRAQGFYLASSLDGTS TL+LT L HGEHDH   L D ISFF
Sbjct  207  TVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDHHDTLDDAISFF  266

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF++Y+T
Sbjct  267  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSIYLT  322



>emb|CDY20430.1| BnaC04g06140D [Brassica napus]
Length=310

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 173/236 (73%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  72   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  131

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  132  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSTNSLPFVTAGNLPPGAALQHLMFGTI  190

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+G+AQGFYLASSLDGTS TL+LT L   EHDH   L D ISFF
Sbjct  191  TVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTVLLDREHDHHDTLDDAISFF  250

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+VY+T
Sbjct  251  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSVYLT  306



>emb|CDY24962.1| BnaC03g22100D [Brassica napus]
Length=309

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 173/236 (73%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  72   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  131

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  132  INPNTAPLLTGLGGAQTT-TVIQNTNGNSNDALSTNSLPFVTAGNLPPGAALQHLMFGTI  190

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+G+AQGFYLASSLDGTS TL+LT L   EHDH   L D ISFF
Sbjct  191  TVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTVLLDREHDHHDTLDDAISFF  250

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+VY+T
Sbjct  251  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSVYLT  306



>gb|KFK36837.1| hypothetical protein AALP_AA4G178000 [Arabis alpina]
Length=318

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 174/236 (74%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL   NN+ + 
Sbjct  81   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSV  140

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  141  INPNTAPLLTGLGGAQ-TSTVIQNTNGNSNDALSSNSLPFVTAGNLPPGAALQHLMFGTI  199

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+GRAQGFYLASSLDGTS TL+LT L HGEHDHE  L D ISFF
Sbjct  200  TVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDHEDTLDDAISFF  259

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL    +Q  TDG +TI HF+VY+T
Sbjct  260  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQQNQQITDGQDTILHFSVYLT  315



>ref|XP_008369944.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 24-like [Malus 
domestica]
Length=228

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 168/231 (73%), Gaps = 10/231 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnNYPFL  634
            MHDILGGS PS RVVTG+VA +   N+ F++PN+ +FP++GG PL   N     NN    
Sbjct  1    MHDILGGSHPSIRVVTGLVATT-VLNVAFSKPNNNIFPVSGGXPLTNNNINSFLNNNKNN  59

Query  633  ----VGLNG--QQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
                 GL+G    Q++T++QN+GNNN+V+ G NQPFVT GQLP+G  L++LMFGS+TV+D
Sbjct  60   IPNIAGLSGLTNSQSNTVIQNSGNNNIVNDGSNQPFVTAGQLPNGATLKKLMFGSVTVID  119

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            + +TEGHELGSAVLG+AQ  YL SSLDG SHT+A T L    H  EH++ DTIS FGVHR
Sbjct  120  DNLTEGHELGSAVLGKAQXXYLVSSLDGNSHTMAFTVLL---HAGEHDVEDTISLFGVHR  176

Query  291  TATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            TA+P+SH+ +IGGTG YE A GY  IE+L   DQ+TTDGV+TI    +Y++
Sbjct  177  TASPVSHIVVIGGTGKYENANGYTAIESLHQEDQYTTDGVDTIMQIGLYLS  227



>ref|XP_009133366.1| PREDICTED: dirigent protein 9-like [Brassica rapa]
Length=309

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 172/236 (73%), Gaps = 6/236 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +F ++ GVP+   NN+ + 
Sbjct  72   PLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFTVDNGVPIVNSNNINSV  131

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL G Q T T++QNT GN+N   S ++ PFVT G LP G  LQ LMFG+I
Sbjct  132  INPNTAPLLTGLGGAQTT-TVIQNTNGNSNDALSTNSLPFVTAGNLPPGAALQHLMFGTI  190

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE HELGSAV+G+AQGFYLASSLDGTS TL+LT L   EHDH   L D ISFF
Sbjct  191  TVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTVLLDREHDHHDTLDDAISFF  250

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFTVYIT  139
            GVHRTA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+VY+T
Sbjct  251  GVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFSVYLT  306



>ref|XP_010534463.1| PREDICTED: dirigent protein 9-like [Tarenaya hassleriana]
Length=347

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 172/236 (73%), Gaps = 5/236 (2%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L+FFMHD+LGGS PS RVVTGIVA +  N +PF++ N+ +FP++  +PL  +NN+   
Sbjct  109  PDLAFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKANNNIFPVDNAIPLVNLNNINKI  168

Query  651  nNY---PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             N    P L GL G Q +  +    GN+N   + +N PFVT GQLP    LQQLMFG+IT
Sbjct  169  INPNTAPLLTGLTGAQASTIIQSTNGNSNNALNSNNLPFVTAGQLPPAAALQQLMFGTIT  228

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFh-gehdhehelgDTISFF  304
            VVD+++TE HELGSAV+GRAQGFYLASSLDGTS TLALT L H GEH +   + D ISFF
Sbjct  229  VVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLALTVLLHGGEHGNHDTVDDAISFF  288

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTDGVETITHFTVYIT  139
            GVHR+A+  S +A++GGTG YE AKGYA +ETL + D QH TDG++TI HF+VY+T
Sbjct  289  GVHRSASTASQIAVVGGTGRYEHAKGYAVVETLHNQDNQHITDGIDTILHFSVYLT  344



>ref|XP_002876289.1| hypothetical protein ARALYDRAFT_485944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52548.1| hypothetical protein ARALYDRAFT_485944 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 165/224 (74%), Gaps = 6/224 (3%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++  VPL   N++ N 
Sbjct  74   PILEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPLVNANSINNL  133

Query  651  n---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
                  P L GL+G Q  +T++QN+ GN+    S +N PFVT GQLP    LQQLMFGSI
Sbjct  134  INPNTAPLLTGLSGSQ-ANTVIQNSNGNSQGSLSSNNLPFVTTGQLPPIAALQQLMFGSI  192

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFYLASSLDGTS TL+LT L H EHDH   L D ISFF
Sbjct  193  TVVDDELTEGHELGSAIIGRAQGFYLASSLDGTSQTLSLTVLLHEEHDHHDTLDDAISFF  252

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDG  175
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG
Sbjct  253  GVHRTASHASHIAVVGGTGRFEHAKGYAVVETLHNQEDQHVTDG  296



>ref|XP_007016543.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
 gb|EOY34162.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
Length=381

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 164/230 (71%), Gaps = 2/230 (1%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinn-vinnn  649
            LSFFMHDI GGS PS RVV GI+A    N +PF++PN  +FP  GGVPL T    VI NN
Sbjct  152  LSFFMHDIFGGSAPSVRVVAGIIAIPQVNGIPFSKPNAGVFPKRGGVPLITATKGVIINN  211

Query  648  NYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDN  469
            N PF  GLNG      +  N  NN +  +    PFVT GQLP G  LQ+L+FG+ TV+D+
Sbjct  212  NLPFPSGLNGATANTVINNNGNNNLIRTNNKRLPFVTAGQLPQGATLQKLLFGTTTVIDD  271

Query  468  QITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRT  289
            ++TEGHE+GS+++G+AQGFYLASS+DG+SHT+A TA+F    D      D ISFFGVHRT
Sbjct  272  ELTEGHEIGSSIIGKAQGFYLASSMDGSSHTMAFTAMF-HYGDDHDAGDDAISFFGVHRT  330

Query  288  ATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            A   SH+A++GGTG +E A+GYA I+TL H ++HTTDG++T+  FTV++T
Sbjct  331  AALESHIAVVGGTGKHENAQGYAVIQTLQHTNEHTTDGIDTLLQFTVFLT  380



>emb|CAN80344.1| hypothetical protein VITISV_003132 [Vitis vinifera]
Length=298

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 170/244 (70%), Gaps = 22/244 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            +SATVA+   +HP LSFFMHDILGGS P+ RV  GI+AN+  N LPFT+ N  +FP+NGG
Sbjct  74   TSATVAD---EHPPLSFFMHDILGGSNPTTRVEAGIIANTQINGLPFTKTNGGVFPMNGG  130

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVT-GGQLPSGLN  511
            VPL               V  NG    + ++ N     + DS  + P +     LP+G  
Sbjct  131  VPL---------------VTANGVINNNGIMNNNNLPFLADSMAHPPALWYKTMLPAGAT  175

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ+LMFG+ITV+D+++TEGHE+GS+V+GRAQGFYLASSLDG+S T+A TALF   H+ +H
Sbjct  176  LQKLMFGTITVIDDELTEGHEIGSSVVGRAQGFYLASSLDGSSQTMAFTALF---HEGDH  232

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
               DT+SFFGVHRTA P S +AI+GGTG YE A GYA+I+TL   DQHTTDGVET+ H +
Sbjct  233  HEEDTLSFFGVHRTAAPESQIAIVGGTGKYENANGYASIQTLHPTDQHTTDGVETLLHVS  292

Query  150  VYIT  139
            V+I+
Sbjct  293  VFIS  296



>ref|NP_001173366.1| Os03g0280750 [Oryza sativa Japonica Group]
 gb|ABF95304.1| disease resistance-responsive family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG98992.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92094.1| Os03g0280750 [Oryza sativa Japonica Group]
Length=318

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 171/234 (73%), Gaps = 7/234 (3%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPL-ntinn  664
            DH  L+FFMHDILGGSQPS R+VTG+VA++ AN  LPF +PND +FPI G +PL    +N
Sbjct  89   DHHQLTFFMHDILGGSQPSARIVTGVVASAAANGQLPFARPNDNIFPIQGAMPLPQGASN  148

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++N NN P++ GL G      ++Q  GN N  +   N PFV  G LPSG  LQ L+FG+ 
Sbjct  149  LVNGNNVPYVAGLGGTSSA-AIVQGNGNGNGGNK--NIPFVNAGDLPSGATLQNLLFGTT  205

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELG+AV+GRAQGFY+ASS DGTS TL LTA+F  +       GDT+SFF
Sbjct  206  TVIDDELTEGHELGAAVVGRAQGFYVASSQDGTSKTLVLTAMF--DGGGVEAHGDTLSFF  263

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            GVHR A P SH+A+IGGTG YE AKG+A I+TL   D+HTTDGVET+  F++++
Sbjct  264  GVHRMAAPESHVAVIGGTGKYENAKGFAVIQTLHPGDEHTTDGVETLLQFSIHL  317



>emb|CDX76115.1| BnaA04g03790D [Brassica napus]
Length=298

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 169/236 (72%), Gaps = 20/236 (8%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ N+ +FP++  VPL   NN+ N 
Sbjct  74   PVLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSNNNIFPVDNAVPLVNANNINNI  133

Query  651  nNY---PFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             N    P L GL+G Q  +T++QNT GN+    S +N PF              LMFG+I
Sbjct  134  INPNTAPLLTGLSGSQ-ANTVIQNTNGNSQGSLSSNNLPF--------------LMFGTI  178

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGSA++GRAQGFY+ASSLDGTS TL+LT LFHGEHDH   L D ISFF
Sbjct  179  TVVDDELTEGHELGSAIIGRAQGFYIASSLDGTSQTLSLTVLFHGEHDHHDTLDDAISFF  238

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA+  SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF++Y+T
Sbjct  239  GVHRTASHASHIAVVGGTGKFEHAKGYAVVETLHNQEDQHVTDGRDTILHFSIYLT  294



>ref|XP_002468070.1| hypothetical protein SORBIDRAFT_01g039060 [Sorghum bicolor]
 gb|EER95068.1| hypothetical protein SORBIDRAFT_01g039060 [Sorghum bicolor]
Length=314

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 169/234 (72%), Gaps = 8/234 (3%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPL-ntinn  664
            DHP L+FFMHDILGGSQPSGR+VTG+VA++ AN  LPF +PN  +FPI G +PL    +N
Sbjct  86   DHP-LTFFMHDILGGSQPSGRIVTGVVASAAANGQLPFARPNTNIFPIQGAMPLPQGASN  144

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++N+NN P++ GL G   T + +     N V     N PFV  G LPSG  LQ L+FG+ 
Sbjct  145  LVNSNNVPYVAGLGG---TSSAVVQNNGNPVNGGNKNIPFVNAGDLPSGATLQNLLFGTT  201

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELG+ V+GRAQGFY+ASS DGTS T+ LTA+F  E       GDT+SFF
Sbjct  202  TVIDDELTEGHELGAGVIGRAQGFYVASSQDGTSKTIVLTAMF--EGPEAPHGGDTLSFF  259

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            GVHR A P SH+AIIGGTG YE AKG+A I+TL   D+HTTDGVET+  F V++
Sbjct  260  GVHRMAAPESHIAIIGGTGKYENAKGFAAIQTLHPGDEHTTDGVETLLQFNVHL  313



>gb|EAY89496.1| hypothetical protein OsI_11028 [Oryza sativa Indica Group]
Length=318

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 171/234 (73%), Gaps = 7/234 (3%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPL-ntinn  664
            DH  L+FFMHDILGGSQPS R+VTG+VA++ AN  LPF +PND +FPI G +PL    +N
Sbjct  89   DHHQLTFFMHDILGGSQPSARIVTGVVASAAANGQLPFARPNDNIFPIQGAMPLPQGASN  148

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++N NN P++ GL G      ++Q  GN N  +   N PFV  G LPSG  LQ L+FG+ 
Sbjct  149  LVNGNNVPYVAGLGGTSFA-AIVQGNGNGNGGNK--NIPFVNAGDLPSGATLQNLLFGTT  205

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELG+AV+GRAQGFY+ASS DGTS TL LTA+F  +       GDT+SFF
Sbjct  206  TVIDDELTEGHELGAAVVGRAQGFYVASSQDGTSKTLVLTAMF--DGGGVEAHGDTLSFF  263

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            GVHR A P SH+A+IGGTG YE AKG+A I+TL   D+HTTDGVET+  F++++
Sbjct  264  GVHRMAAPESHVAVIGGTGKYENAKGFAVIQTLHPGDEHTTDGVETLLQFSIHL  317



>ref|XP_008660283.1| PREDICTED: dirigent protein 24-like [Zea mays]
 gb|AFW88782.1| hypothetical protein ZEAMMB73_984010 [Zea mays]
Length=354

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 168/235 (71%), Gaps = 8/235 (3%)
 Frame = -1

Query  840  TDHPALSFFMHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPL-ntin  667
            +DHP L+FFMHDILGGSQPSGR+VTG+VA++ AN  LPF +PN  +FPI G VPL    +
Sbjct  125  SDHP-LTFFMHDILGGSQPSGRIVTGVVASAAANGQLPFARPNTNIFPIQGAVPLPQGAS  183

Query  666  nvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGS  487
            ++IN NN P++ GL G   T + +     N       N PFV  G LPSG  LQ L+FG+
Sbjct  184  SLINGNNAPYVAGLGG---TSSAVVQNNGNPANGGNKNIPFVNAGDLPSGATLQNLLFGT  240

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
             TV+D+++TEGHELG+ V+GRAQGFY+ASS DGTS T+ LTA+F  E       GDT+SF
Sbjct  241  TTVIDDELTEGHELGAGVVGRAQGFYVASSQDGTSKTIVLTAMF--EGPEAPHGGDTLSF  298

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            FGVHR A P SH+A+IGGTG YE AKG+A I+TL   D+HTTDGVET+  F V++
Sbjct  299  FGVHRMAAPESHIAVIGGTGKYENAKGFAAIQTLHPGDEHTTDGVETLLQFNVHL  353



>ref|XP_010253352.1| PREDICTED: dirigent protein 25 [Nelumbo nucifera]
Length=328

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 172/245 (70%), Gaps = 11/245 (4%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPING  691
            +SAT+ N    HP LSFFMHDILGGS PS R VTGIV N   N  +PF +PN  + P+N 
Sbjct  92   TSATMVNADPQHP-LSFFMHDILGGSNPSARAVTGIVNNPAMNGQVPFARPNGAVLPVNN  150

Query  690  GVPLnt-innvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            G+PLN+  + +INNNN PFL GL G   + T++QN GNN +       P V G QLP+G 
Sbjct  151  GIPLNSDNSAIINNNNIPFLTGLGGS--SSTVIQNNGNNVINGG-FGVPLVNGAQLPAGT  207

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             +Q+LMFG++TV+D+++TEGHELGS ++G+AQGFY+ASS DGTS T+A  A+F       
Sbjct  208  TIQKLMFGTMTVIDDELTEGHELGSGLVGKAQGFYVASSEDGTSQTMAFIAMF-----QS  262

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D++SFFGVHRTA   S LA++GGTG Y  AKGYAT++T+P V+ H TDG ET+  F
Sbjct  263  GNYADSLSFFGVHRTAVSESQLAVMGGTGKYVNAKGYATVKTIPSVNHHETDGAETLLEF  322

Query  153  TVYIT  139
            TVY+T
Sbjct  323  TVYLT  327



>emb|CDY02918.1| BnaC04g25680D [Brassica napus]
Length=298

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 167/236 (71%), Gaps = 20/236 (8%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P L FFMHD+LGGS PS RVVTGIVA +  N +PF++ N+ +FP++  VPL   NN+ N 
Sbjct  74   PVLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSNNNIFPVDNAVPLVNANNINNI  133

Query  651  nNY---PFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             N    P L GL+G Q  +T++QNT GN+    S +N PF              LMFG+I
Sbjct  134  INPNTAPLLTGLSGSQ-ANTVIQNTNGNSQGSLSSNNLPF--------------LMFGTI  178

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TEGHELGS ++GRAQGFY+ASSLDGTS TL+LT LFHGEHDH   L D ISFF
Sbjct  179  TVVDDELTEGHELGSTIIGRAQGFYIASSLDGTSQTLSLTVLFHGEHDHHDTLDDAISFF  238

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFTVYIT  139
            GVHRTA   SH+A++GGTG +E AKGYA +ETL    DQH TDG +TI HF++Y+T
Sbjct  239  GVHRTAAHASHIAVVGGTGKFEHAKGYAVVETLHNQEDQHVTDGRDTILHFSIYLT  294



>ref|XP_007009562.1| Disease resistance-responsive family protein [Theobroma cacao]
 gb|EOY18372.1| Disease resistance-responsive family protein [Theobroma cacao]
Length=300

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 164/239 (69%), Gaps = 11/239 (5%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLnt  673
            NP  DH  L+FFMHDILGGS P+   VTG+V+N   N  LPF +PN    P+N G+  N+
Sbjct  70   NPYPDH-TLTFFMHDILGGSNPTALAVTGVVSNPALNGQLPFAKPNGANLPVNNGINQNS  128

Query  672  inn-vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
             N  +INNNN P L GL G  Q   +LQN GNN +V+   N P   GGQLPSG  LQ+LM
Sbjct  129  GNTGLINNNNVPLLTGLGGNTQA--VLQNNGNN-LVNGALNFPVTAGGQLPSGSTLQKLM  185

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDT  316
            FG++TV+D+++T GHELGS  LG+AQGFY+ASS+DGTS T+A TA+F           DT
Sbjct  186  FGTMTVIDDELTVGHELGSGFLGKAQGFYVASSIDGTSQTMAFTAMF-----ESGHYADT  240

Query  315  ISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            +SFFGVHRT    SHLAI+GGTG Y  AKG+A ++T+P  +Q  TDG ET+  FTVY+T
Sbjct  241  LSFFGVHRTGVSESHLAIMGGTGKYVNAKGFAIVKTIPGANQQETDGFETVLEFTVYVT  299



>ref|XP_004984774.1| PREDICTED: circumsporozoite protein-like [Setaria italica]
Length=340

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 160/233 (69%), Gaps = 5/233 (2%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnv  661
            DHP L+FFMHDILGGSQPSGR+VTG+VA++ AN  LPF +PN  +FPI G VPL      
Sbjct  111  DHP-LTFFMHDILGGSQPSGRIVTGVVASAAANGQLPFARPNTNIFPIQGAVPLPQGATS  169

Query  660  innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
            + N N    V   G      +L     N V     N PFV  G LPSG+ LQ L+FG+ T
Sbjct  170  LINGNNAPYVAGLGGTSGGGVLVQNNGNPVNGGNKNIPFVNAGDLPSGVTLQNLLFGTTT  229

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V+D+++TEGHELG+ V+GRAQGFY+ASS DGTS T+ LTA+F      +   GDT+SFFG
Sbjct  230  VIDDELTEGHELGAGVIGRAQGFYVASSQDGTSKTIVLTAMF---EGPDAPHGDTLSFFG  286

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            VHR A P SH+AIIGGTG YE AKG+A I+TL   D+HTTDGVET+  F +++
Sbjct  287  VHRMAAPESHIAIIGGTGKYENAKGFAAIQTLHPGDEHTTDGVETLLQFNIHL  339



>emb|CDX93263.1| BnaC04g46330D [Brassica napus]
Length=286

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 164/244 (67%), Gaps = 30/244 (12%)
 Frame = -1

Query  852  ANPTTDH-PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn  676
            A  T++H P+L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL 
Sbjct  64   ATTTSEHEPSLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLV  123

Query  675  tinnvinnn---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNL  508
              NN+ +       P L GL+G Q T T++QNT GN N   S ++ PFVT G LP G  L
Sbjct  124  NSNNINSVINPNTAPLLTGLSGAQ-TSTVIQNTNGNTNDALSSNSLPFVTAGNLPPGAAL  182

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            Q LMFG+ITVVD+++TE HELGSAV+G+AQGFYLASSLDGTS TL+LT            
Sbjct  183  QHLMFGTITVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQTLSLTV-----------  231

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFT  151
                        TA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+
Sbjct  232  ------------TASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFS  279

Query  150  VYIT  139
            VY+T
Sbjct  280  VYLT  283



>emb|CDY07009.1| BnaA04g23060D [Brassica napus]
Length=286

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 162/244 (66%), Gaps = 30/244 (12%)
 Frame = -1

Query  852  ANPTTDH-PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLn  676
            A  T +H P+L FFMHD+LGGS PS RVVTGIVA +  N +PF++ ++ +FP++ GVPL 
Sbjct  64   ATTTNEHEPSLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLV  123

Query  675  tinnvinnn---NYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQLPSGLNL  508
              NN+ +       P L GL+G Q T T++QNT GN N   S ++ PFVT G LP G  L
Sbjct  124  NSNNINSVINPNTAPLLTGLSGAQ-TSTVIQNTNGNTNDALSSNSLPFVTAGNLPPGAAL  182

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            Q LMFG+ITVVD+++TE HELGSAV+G+AQGFYLASSLDGTS  L+LT            
Sbjct  183  QHLMFGTITVVDDELTESHELGSAVIGKAQGFYLASSLDGTSQILSLTV-----------  231

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETITHFT  151
                        TA+  S +A+IGGTG +E AKGYA +ETL +  +QH TDG +TI HF+
Sbjct  232  ------------TASHASQIAVIGGTGKFEHAKGYAIVETLHNQNNQHITDGQDTILHFS  279

Query  150  VYIT  139
            VY+T
Sbjct  280  VYLT  283



>ref|XP_010033176.1| PREDICTED: dirigent protein 25-like [Eucalyptus grandis]
 gb|KCW52732.1| hypothetical protein EUGRSUZ_J02090 [Eucalyptus grandis]
Length=312

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 164/234 (70%), Gaps = 12/234 (5%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPL-ntinnv  661
            HP L+F+MHDILGGS PS R VTGIVAN + +  +PF +PN    PIN G+P  +  N +
Sbjct  87   HP-LTFYMHDILGGSNPSARAVTGIVANPALSAQVPFAKPNGANLPINSGIPQNSANNGL  145

Query  660  innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
            INNNN PFL GL+G   T  ++QN G N +++ G   P + GGQLP G+ LQ+LMFG++T
Sbjct  146  INNNNVPFLTGLSGN--TGNVIQNNGVN-LINGGVGFPVLNGGQLPQGMTLQKLMFGTLT  202

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V D+++TEGHELGS ++G+AQGFY+ASS DG S T+ALTA+F           D++S FG
Sbjct  203  VFDDELTEGHELGSGLVGKAQGFYVASSEDGHSQTIALTAMF-----EGGGYVDSLSLFG  257

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPH-VDQHTTDGVETITHFTVYI  142
            VHRTA   S LAI+GGTG Y  A+GYAT++T P   +Q  TDG ET+  FTVY+
Sbjct  258  VHRTAVSESQLAIMGGTGKYVDARGYATVKTFPAPPNQQITDGTETLLEFTVYL  311



>ref|XP_003635227.1| PREDICTED: dirigent protein 25-like [Vitis vinifera]
Length=358

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 166/236 (70%), Gaps = 12/236 (5%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnv  661
            DHP LSFFMHDILGGS PS R VTGIV N   N  +PF +PN  L P+N GVPLN+ N+ 
Sbjct  131  DHP-LSFFMHDILGGSNPSARAVTGIVTNPAVNGQVPFAKPNGALLPVNNGVPLNSGNSG  189

Query  660  -innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             INNNN PFL GL+G   T T++ N GNN      +  P   GGQ  +G +LQ+LMFG++
Sbjct  190  LINNNNIPFLTGLSGI--TPTVIPNNGNNLFNGG-NGLPVGNGGQYLAGSSLQKLMFGTM  246

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D++ITEGHELGS  +G+AQGFY+ASS DGTS T+A TA+F           D++SFF
Sbjct  247  TVIDDEITEGHELGSGSVGKAQGFYVASSEDGTSQTMAFTAMF-----QSGSYADSLSFF  301

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQH-TTDGVETITHFTVYIT  139
            GVHRTA   S LAI+GGTG Y  AKG+AT++T+P   Q  TTDGVET+  FTVY+T
Sbjct  302  GVHRTAVSESQLAIMGGTGKYVNAKGFATVKTIPPTHQQATTDGVETLLEFTVYVT  357



>ref|XP_007207181.1| hypothetical protein PRUPE_ppa017156mg [Prunus persica]
 gb|EMJ08380.1| hypothetical protein PRUPE_ppa017156mg [Prunus persica]
Length=727

 Score =   218 bits (556),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 170/245 (69%), Gaps = 10/245 (4%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPING  691
            +SATV+N    HP L+FF+HDI+GGS PS R VTGIV N   N  +PF +PN  + PI  
Sbjct  490  TSATVSNSEAYHP-LTFFLHDIIGGSNPSARAVTGIVTNPAVNGEVPFAKPNGAVVPIGN  548

Query  690  GVPLntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            G+P N  NN I NNN  PF  GL G   ++ L+QN GN+N + SG+  P++ G QLP G+
Sbjct  549  GIPQNNNNNGIINNNNVPFFTGLGGNTASN-LIQNNGNHNNIISGNGLPYLNGAQLPPGI  607

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQ+LMFG++TV D+++TEGHELGS +LG+AQGFY+A+S DG+S T+A TA+F       
Sbjct  608  TLQKLMFGTLTVFDDELTEGHELGSGLLGKAQGFYVATSEDGSSQTIAFTAMF-----QS  662

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D+++FFGVHR A   SHLA++GGTG Y  AKGYA ++ +P  +QH T GV+T+  F
Sbjct  663  GGYADSLTFFGVHRVAASESHLAVMGGTGKYLNAKGYALVKAIPATNQHNT-GVDTVLQF  721

Query  153  TVYIT  139
            TV +T
Sbjct  722  TVCLT  726



>ref|XP_009354557.1| PREDICTED: dirigent protein 10-like [Pyrus x bretschneideri]
Length=310

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 169/245 (69%), Gaps = 9/245 (4%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            +SATV N  + HP L+FF+HDI+GGS PS R VTGIVAN + +  +PF +PN    PI  
Sbjct  72   TSATVGNTASYHP-LTFFLHDIIGGSNPSARAVTGIVANPAVSGQIPFAKPNGANIPIGN  130

Query  690  GVP-LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            G+P  +  N +I+NNN PF  GL G    + +  N  NNN++   +  P++ G QLP G+
Sbjct  131  GIPQNSNNNGIIDNNNVPFFTGLGGNTGNNLVQNNGNNNNIIGG-NGFPYINGAQLPPGI  189

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQ+LMFG++TV D+++TEGHELGS +LG+AQGFY+ASS DG+S T+A TA+F       
Sbjct  190  TLQKLMFGTLTVFDDELTEGHELGSGLLGKAQGFYVASSEDGSSQTIAFTAMF-----QS  244

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D+++FFGVH+ A   SHLAI+GGTG Y  AKGYA ++T+P  +QH TDGV+T+  F
Sbjct  245  GGYADSLTFFGVHQVAVSESHLAIMGGTGKYLNAKGYALVKTIPATNQHNTDGVDTVLEF  304

Query  153  TVYIT  139
            T Y+T
Sbjct  305  TTYLT  309



>ref|XP_008463531.1| PREDICTED: dirigent protein 10-like [Cucumis melo]
Length=327

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 160/236 (68%), Gaps = 10/236 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPLntinnv  661
            DH  L+FFMHDILGG+ PS R VTG V N   N  LPF +PN  +  +   VP +  N+ 
Sbjct  98   DHHILTFFMHDILGGTNPSARAVTGAVNNPALNGQLPFAKPNGAVLSVGNNVPQSNGNSG  157

Query  660  -innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGD-NQPFVTGGQLPSGLNLQQLMFGS  487
             INNNN PFL+GL G   T  LLQN        +G    P V  GQLPSG+++QQL+FG+
Sbjct  158  LINNNNLPFLIGLGGA--TSPLLQNNNGGGNNFNGQIGFPSVNAGQLPSGVSVQQLLFGT  215

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            +TV+D+++TEGHELGS ++G+AQGFY+ SS DG S T+A T +F           D++SF
Sbjct  216  MTVIDDELTEGHELGSGLIGKAQGFYVVSSEDGNSQTMAFTTMF-----ESGHYVDSLSF  270

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FGVHRTA   SHLAI+GGTG Y  A+GYA ++TLP ++QH TDGVET+  FTVYI+
Sbjct  271  FGVHRTAVSESHLAIMGGTGKYVNARGYANVKTLPGINQHETDGVETLLQFTVYIS  326



>ref|XP_008385181.1| PREDICTED: dirigent protein 25-like [Malus domestica]
Length=309

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 166/245 (68%), Gaps = 10/245 (4%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            +SATV N  + HP L+FF+HDI+GGS PS R VTGIVAN + +  +PF +PN    PI  
Sbjct  72   TSATVGNTASYHP-LTFFLHDIIGGSNPSARAVTGIVANPAVSGQIPFAKPNGANIPIGN  130

Query  690  GVP-LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            G+P  +  N +INNNN PF  GL G   T   L     NN +  G+  P++ G QLP G+
Sbjct  131  GIPQNSNNNGIINNNNVPFFTGLGGN--TGNNLVQNNGNNNIIGGNGFPYINGAQLPPGI  188

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQ+LMFG++TV D+++TEGHELGS +LG+AQGFY+ASS DG+S T+A TA+F       
Sbjct  189  TLQKLMFGTLTVFDDELTEGHELGSGLLGKAQGFYVASSEDGSSQTIAFTAMF-----QS  243

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D+++FFGVHR A   SHLA++GGTG Y  AKGYA ++T+P  +Q  TDGV+T+  F
Sbjct  244  GGYADSLTFFGVHRVAVSESHLAVMGGTGRYLNAKGYALVKTIPATNQPNTDGVDTVLEF  303

Query  153  TVYIT  139
            T Y+T
Sbjct  304  TTYLT  308



>ref|XP_010243747.1| PREDICTED: dirigent protein 25-like [Nelumbo nucifera]
Length=297

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 159/238 (67%), Gaps = 14/238 (6%)
 Frame = -1

Query  843  TTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntin  667
            T  H  LSFFMHD LGGS PS   VTGIV N   N  +PF +PN  + P+N GVPLN  N
Sbjct  70   TDPHHPLSFFMHDRLGGSNPSALAVTGIVNNPAVNGQVPFARPNGAVLPVNNGVPLNNDN  129

Query  666  nvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFG  490
              I NNN  PFL GL G   T T++QN       + G   P V G QLP+G  +Q+LMFG
Sbjct  130  RGIINNNNIPFLTGLGGS--TSTVIQNN----GNNGGFGVPLVNGAQLPAGTTIQKLMFG  183

Query  489  SITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTIS  310
            ++TV+D+++TEGHELGS ++G+AQGFY+ SS DG+S T+A TA+F           D++S
Sbjct  184  TMTVIDDELTEGHELGSGMVGKAQGFYVTSSEDGSSQTMAFTAMF-----ESGNYADSLS  238

Query  309  FFGVHRTATPISHLAIIGGTGTYETAKGYATIET-LPHVDQHTTDGVETITHFTVYIT  139
            FFGVHRTA   S LAI+GGTG Y  AKGYAT++T +P+ +Q TTDG ET+   TVY+T
Sbjct  239  FFGVHRTAVSESQLAIMGGTGKYVNAKGYATLKTAIPNANQQTTDGEETLLEVTVYLT  296



>gb|KEH30093.1| disease resistance response/dirigent-like protein [Medicago truncatula]
Length=257

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 157/235 (67%), Gaps = 18/235 (8%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVPLntinnvin  655
            P L+F+MHDILGGS PS R++ GI+ N+    N+PF++PN+++ P  G +P+   +    
Sbjct  36   PPLTFYMHDILGGSNPSERIMNGIIVNTQQTTNIPFSKPNNKILPNKGSIPIFDTS----  91

Query  654  nnNYPFLVGLNGQQQTDTLLQNTGNNNVV-DSGDNQ-PFVTGGQLPSGLNLQQLMFGSIT  481
                   +  NG   T T+++N   N VV D+  N  P+VT  QLP G+ +Q+L+FG IT
Sbjct  92   -------ISTNGSPSTKTIIKNIDKNKVVIDTNSNSLPYVTSNQLPLGVTIQKLLFGRIT  144

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V+D++IT+G+EL S V+G+ QGF+L SSLDG+S T+A TALF    +   +  D I+FFG
Sbjct  145  VIDDEITKGYELNSDVIGKVQGFHLVSSLDGSSQTMAFTALF--GDESHDDDDDAINFFG  202

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIET--LPHVDQHTTDGVETITHFTVYI  142
            VHR AT  S++A++GGTG YE A+GYA IET  LP+  + T +G+ET+   TVY+
Sbjct  203  VHRMATHESYIAVVGGTGKYENARGYAKIETLQLPYQHRSTNNGMETLFQITVYL  257



>ref|XP_002312064.1| disease resistance-responsive family protein [Populus trichocarpa]
 gb|EEE89431.1| disease resistance-responsive family protein [Populus trichocarpa]
Length=310

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 168/245 (69%), Gaps = 14/245 (6%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            +SAT++NP   H  LSFFMHDILGG+ PS R VTGIV+N + +  +PF +PN    PIN 
Sbjct  77   TSATISNP--GH-TLSFFMHDILGGTNPSARAVTGIVSNPAVSGQVPFAKPNGANLPINN  133

Query  690  GVP-LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            GVP  +  N +INNNN PFL GL G  Q   ++QN GNN       N P   GG LPSG 
Sbjct  134  GVPQNSNNNGLINNNNLPFLTGLGGTTQP--VVQNNGNNFNNAF--NLPLSNGGNLPSGS  189

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQQLMFG+ITV+D+++TEGH+L S+ +G+AQGFY+ASSLDGTS T+A TA+F       
Sbjct  190  TLQQLMFGTITVIDDELTEGHDLRSSFVGKAQGFYVASSLDGTSQTMAFTAMF-----QS  244

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D++SFFGV RT    S LAI+GGTG Y  A+GYA I+ +P  +Q+TTDGVET+  F
Sbjct  245  GHYADSLSFFGVLRTGVSESQLAIMGGTGKYVNAQGYAIIKIIPSTNQNTTDGVETLLEF  304

Query  153  TVYIT  139
             VY++
Sbjct  305  VVYVS  309



>ref|XP_009110925.1| PREDICTED: dirigent protein 25-like [Brassica rapa]
Length=365

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 163/241 (68%), Gaps = 20/241 (8%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN+  +  LPF +PN    P++ GVP  +  N 
Sbjct  136  DH-TLVFFMHDILGGSNPTARAVTGVVANAALSGQLPFAKPNGANLPVSNGVPSNSNNNG  194

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T ++LQN GN+ +    +  P   GGQLPSG +LQ LMFG++
Sbjct  195  ILNNNNVPLLVGLGGT--TSSILQNNGNSLL----NGLPVANGGQLPSGSSLQMLMFGTM  248

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  249  TVMDNELTEGHELGSGLLGKAQGFYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  303

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHT------TDGVETITHFTVYI  142
            GVHRTA   SHL ++GGTG Y  A+GYA ++T      +T      TDG+ET+   TVY+
Sbjct  304  GVHRTAASESHLGVMGGTGKYVNARGYAVVKTYTGGSGNTQQPHQFTDGLETVLECTVYL  363

Query  141  T  139
            +
Sbjct  364  S  364



>ref|XP_004149818.1| PREDICTED: uncharacterized protein LOC101221251 [Cucumis sativus]
 gb|KGN51255.1| hypothetical protein Csa_5G505160 [Cucumis sativus]
Length=329

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 159/235 (68%), Gaps = 8/235 (3%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPLntinnv  661
            DH  L+FFMHDILGG+ PS R VTG V N   N  LPF +PN  +  +   VP +  N+ 
Sbjct  100  DHHVLTFFMHDILGGTNPSARAVTGAVNNPALNGQLPFAKPNGAVLSVGNNVPQSNGNSG  159

Query  660  -innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             INNNN PFL+GL G   +  L  + G  N  +     P V  GQLPSG+++QQL+FG++
Sbjct  160  LINNNNLPFLIGLGGAA-SPLLQNSNGGGNNFNGQLGFPSVNAGQLPSGVSVQQLLFGTM  218

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS ++G+AQGFY+ SS DG S T+A T +F           D++SFF
Sbjct  219  TVIDDELTEGHELGSGLIGKAQGFYVVSSEDGNSQTMAFTTMF-----ESGHYVDSLSFF  273

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            GVHRTA   SHLAI+GGTG Y  A+GYA ++TLP ++QH TDGVET+  FTVYI+
Sbjct  274  GVHRTAVSESHLAIMGGTGKYVNARGYANVKTLPGINQHETDGVETLLQFTVYIS  328



>ref|XP_004166148.1| PREDICTED: uncharacterized protein LOC101229995 [Cucumis sativus]
Length=329

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 159/235 (68%), Gaps = 8/235 (3%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPLntinnv  661
            DH  L+FFMHDILGG+ PS R VTG V N   N  LPF +PN  +  +   VP +  N+ 
Sbjct  100  DHHVLTFFMHDILGGTNPSARAVTGAVNNPALNGQLPFAKPNGAVLSVGNNVPQSNGNSG  159

Query  660  -innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             INNNN PFL+GL G   +  L  + G  N  +     P V  GQLPSG+++QQL+FG++
Sbjct  160  LINNNNLPFLIGLGGAA-SPLLQNSNGGGNNFNGQLGFPSVNAGQLPSGVSVQQLLFGTM  218

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS ++G+AQGFY+ SS DG S T+A T +F           D++SFF
Sbjct  219  TVIDDELTEGHELGSGLIGKAQGFYVVSSEDGNSQTMAFTTMF-----ESGHYVDSLSFF  273

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            GVHRTA   SHLAI+GGTG Y  A+GYA ++TLP ++QH TDGVET+  FTVYI+
Sbjct  274  GVHRTAVSESHLAIMGGTGKYVNARGYANVKTLPGINQHETDGVETLLQFTVYIS  328



>ref|XP_006424738.1| hypothetical protein CICLE_v10029904mg [Citrus clementina]
 gb|ESR37978.1| hypothetical protein CICLE_v10029904mg [Citrus clementina]
Length=279

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 164/236 (69%), Gaps = 22/236 (9%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnN  646
            LSFF+HDILGGS PS RVV GI A++  N LPF++PN+++FPI GGVPL T NN IN NN
Sbjct  59   LSFFIHDILGGSAPSERVVAGITASTQINGLPFSKPNNRVFPIKGGVPLVTANNGININN  118

Query  645  -------YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGS  487
                    PFL G NG     T++ N GNNN+V +G+   FVT G LP G  LQ  +FG+
Sbjct  119  GFVNNNNLPFLGGPNGAT-VSTVISNNGNNNLVTNGNALLFVTAGLLPQGAALQNPIFGA  177

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            ITV+D+++TEGHELG++V+G+AQGFY        S T+A +A+F    +       TISF
Sbjct  178  ITVIDDELTEGHELGASVIGKAQGFY--------SQTMAFSAIFGDHEED------TISF  223

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FGVHRTA+  S +A++GGTG YE A+GYATIETL   +QHTTDGVE +  FTVY+T
Sbjct  224  FGVHRTASHESGIAVVGGTGKYENAEGYATIETLHLTNQHTTDGVEAVLEFTVYLT  279



>gb|KDO37063.1| hypothetical protein CISIN_1g041797mg [Citrus sinensis]
Length=279

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 164/236 (69%), Gaps = 22/236 (9%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnN  646
            LSFF+HDILGGS PS RVV GI A++  N LPF++PN+++FPI GGVPL T NN IN NN
Sbjct  59   LSFFIHDILGGSAPSERVVAGITASTQINGLPFSKPNNRVFPIKGGVPLVTANNGININN  118

Query  645  -------YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGS  487
                    PFL G NG     T++ N GNNN+V +G+   FVT G LP G  LQ  +FG+
Sbjct  119  GFVNNNNLPFLGGPNGAT-VSTVISNNGNNNLVTNGNALLFVTAGLLPQGAALQNPIFGA  177

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            ITV+D+++TEGHELG++V+G+AQGFY        S T+A +A+F    +       TISF
Sbjct  178  ITVIDDELTEGHELGASVIGKAQGFY--------SQTMAFSAIFGDHEED------TISF  223

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FGVHRTA+  S +A++GGTG YE A+GYATIETL   +QHTTDGVE +  FTVY+T
Sbjct  224  FGVHRTASHESGIAVVGGTGKYENAEGYATIETLHLTNQHTTDGVEAVLEFTVYLT  279



>emb|CDY71693.1| BnaAnng38500D, partial [Brassica napus]
Length=436

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 163/241 (68%), Gaps = 20/241 (8%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN+  +  LPF +PN    P++ GVP  +  N 
Sbjct  207  DH-TLVFFMHDILGGSNPTARAVTGVVANAALSGQLPFAKPNGANLPVSNGVPSNSNNNG  265

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T ++LQN GN+ +    +  P   GGQLPSG +LQ LMFG++
Sbjct  266  ILNNNNVPLLVGLGGT--TSSILQNNGNSLL----NGLPVANGGQLPSGSSLQMLMFGTM  319

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  320  TVMDNELTEGHELGSGLLGKAQGFYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  374

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHT------TDGVETITHFTVYI  142
            GVHRTA   SHL ++GGTG Y  A+GYA ++T      +T      TDG+ET+   TVY+
Sbjct  375  GVHRTAASESHLGVMGGTGKYVNARGYAVVKTYTGGSGNTQQPHQFTDGLETVLECTVYL  434

Query  141  T  139
            +
Sbjct  435  S  435



>ref|XP_010475548.1| PREDICTED: dirigent protein 25-like [Camelina sativa]
Length=377

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 161/242 (67%), Gaps = 21/242 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVPL-ntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN+  +  +PF + N    PI+ GVP  N  N 
Sbjct  147  DH-TLVFFMHDILGGSNPTARAVTGVVANAALSGQIPFAKTNGANLPISNGVPTDNNNNG  205

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQ+ GNN +    +  P   GGQLPSG +LQ LMFG++
Sbjct  206  ILNNNNVPLLVGLGGT--TSNILQSNGNNML----NGLPVANGGQLPSGSSLQMLMFGTL  259

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  260  TVIDNELTEGHELGSGLLGKAQGFYVASAIDGTSQTMAFTAMF-----ESGGYEDSISFF  314

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-------QHTTDGVETITHFTVY  145
            G+HRTAT  SHL ++GGTG Y  A+GYA ++T            Q  TDG+ET+   TVY
Sbjct  315  GIHRTATSESHLGVMGGTGKYINARGYAIVKTFTGASGTQQQQPQRFTDGLETVLECTVY  374

Query  144  IT  139
            ++
Sbjct  375  LS  376



>ref|XP_010487947.1| PREDICTED: dirigent protein 25-like [Camelina sativa]
Length=383

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 161/242 (67%), Gaps = 21/242 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVPL-ntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN+  +  +PF + N    PI+ GVP  N  N 
Sbjct  153  DH-TLVFFMHDILGGSNPTARAVTGVVANAALSGQIPFAKTNGANLPISNGVPTDNNNNG  211

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQ+ GNN +    +  P   GGQLPSG +LQ LMFG++
Sbjct  212  ILNNNNVPLLVGLGGT--TSNILQSNGNNML----NGLPVANGGQLPSGSSLQMLMFGTL  265

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  266  TVIDNELTEGHELGSGLLGKAQGFYVASAIDGTSQTMAFTAMF-----ESGGYEDSISFF  320

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-------QHTTDGVETITHFTVY  145
            G+HRTAT  SHL ++GGTG Y  A+GYA ++T            Q  TDG+ET+   TVY
Sbjct  321  GIHRTATSESHLGVMGGTGKYMNARGYAIVKTFTGASGTQQQQPQRFTDGLETVLECTVY  380

Query  144  IT  139
            ++
Sbjct  381  LS  382



>emb|CAN77499.1| hypothetical protein VITISV_002404 [Vitis vinifera]
Length=1393

 Score =   214 bits (545),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 167/236 (71%), Gaps = 12/236 (5%)
 Frame = -1

Query  837   DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinn-  664
             DHP LSFFMHDILGGS PS R VTGIV N   N  +PF +PN  L P+N GVPLN+ N+ 
Sbjct  1166  DHP-LSFFMHDILGGSNPSARAVTGIVTNPAVNGQVPFAKPNGALLPVNNGVPLNSGNSG  1224

Query  663   vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
             +INNNN PFL GL+G   T T++ N GNN      +  P   GGQ  +G +LQ+LMFG++
Sbjct  1225  LINNNNIPFLTGLSGI--TPTVIPNNGNNLFNGG-NGLPVGNGGQYLAGSSLQKLMFGTM  1281

Query  483   TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
             TV+D+++TEGHELGS  +G+AQGFY+ASS DGTS T+A TA+F           D++SFF
Sbjct  1282  TVIDDELTEGHELGSGSVGKAQGFYVASSEDGTSQTMAFTAMF-----QSGSYADSLSFF  1336

Query  303   GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQH-TTDGVETITHFTVYIT  139
             GVHRTA   S LAI+GGTG Y  AKG+AT++T+P   Q  TTDGVET+  FTVY+T
Sbjct  1337  GVHRTAVSESQLAIMGGTGKYVNAKGFATVKTIPPTHQQATTDGVETLLEFTVYVT  1392



>ref|XP_007132121.1| hypothetical protein PHAVU_011G068400g [Phaseolus vulgaris]
 gb|ESW04115.1| hypothetical protein PHAVU_011G068400g [Phaseolus vulgaris]
Length=245

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 146/231 (63%), Gaps = 24/231 (10%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            PA++FFMHDI+GGS PS R+V G + ++    LPF++PN++LFP  G +PL   +     
Sbjct  39   PAITFFMHDIIGGSAPSERIVAGTIVDTQTAKLPFSKPNNRLFPFKGAIPLVDTSTAT--  96

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
                     N    +  ++++   N VV   +          P G +L   +FG ITV+D
Sbjct  97   ---------NPTHSSTMVIKSIDKNKVVIDRN----------PLGASLDMFLFGRITVID  137

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            ++IT+GHE GS V+G+AQGF+L SSLDG+S T+A T +F  E D E +    +SFFGVHR
Sbjct  138  DEITQGHEFGSEVIGKAQGFHLTSSLDGSSRTMAFTVVFGREGDEEED---AVSFFGVHR  194

Query  291  TATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            TAT  SH+A++GGTG Y+ AKGYA IETL    QHTT+G+ET+   T+YIT
Sbjct  195  TATQESHIAVVGGTGKYDNAKGYAKIETLLSPQQHTTNGLETLLQITLYIT  245



>ref|XP_009148022.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 25 [Brassica 
rapa]
Length=360

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 164/250 (66%), Gaps = 19/250 (8%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            S AT      DH  L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    P+N 
Sbjct  122  SGATXGGSVPDH-TLVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPVNN  180

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            G+P N  N ++ NNN P L+GL G   T ++LQN GNN +    +  P   GGQLPSG +
Sbjct  181  GIPSNNNNGILTNNNVPLLIGLGGT--TSSILQNDGNNLL----NGLPVANGGQLPSGSS  234

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ LMFG++TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F        
Sbjct  235  LQMLMFGTMTVMDNELTEGHELGSGLLGKAQGFYVASAVDGTSQTMAFTAMF-----ESG  289

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHT------TDGVE  169
               D+ISFF VHRTA   SHL ++GGTG Y  A+GYA ++T      +T      TDG+E
Sbjct  290  GYEDSISFFSVHRTAASESHLGVMGGTGKYVNARGYAIVKTFTGGTGNTQQPHQFTDGLE  349

Query  168  TITHFTVYIT  139
            T+   TVY++
Sbjct  350  TVLECTVYLS  359



>gb|EAZ26477.1| hypothetical protein OsJ_10366 [Oryza sativa Japonica Group]
Length=296

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 156/217 (72%), Gaps = 7/217 (3%)
 Frame = -1

Query  786  PSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPL-ntinnvinnnNYPFLVGLNGQQ  613
            PS R+VTG+VA++ AN  LPF +PND +FPI G +PL    +N++N NN P++ GL G  
Sbjct  84   PSARIVTGVVASAAANGQLPFARPNDNIFPIQGAMPLPQGASNLVNGNNVPYVAGLGGTS  143

Query  612  QTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAV  433
                ++Q  GN N  +   N PFV  G LPSG  LQ L+FG+ TV+D+++TEGHELG+AV
Sbjct  144  SA-AIVQGNGNGNGGNK--NIPFVNAGDLPSGATLQNLLFGTTTVIDDELTEGHELGAAV  200

Query  432  LGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATPISHLAIIGG  253
            +GRAQGFY+ASS DGTS TL LTA+F  +       GDT+SFFGVHR A P SH+A+IGG
Sbjct  201  VGRAQGFYVASSQDGTSKTLVLTAMF--DGGGVEAHGDTLSFFGVHRMAAPESHVAVIGG  258

Query  252  TGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            TG YE AKG+A I+TL   D+HTTDGVET+  F++++
Sbjct  259  TGKYENAKGFAVIQTLHPGDEHTTDGVETLLQFSIHL  295



>ref|XP_010033175.1| PREDICTED: dirigent protein 10-like [Eucalyptus grandis]
Length=307

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 159/243 (65%), Gaps = 9/243 (4%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGV  685
            A+  + T  HP L F+MHDILGGS P+ R VTGIV N + +  +PF +PN    PIN G+
Sbjct  70   ASTGSNTDLHPML-FYMHDILGGSSPTARAVTGIVTNPALSAQVPFAKPNGANLPINSGI  128

Query  684  PLntinn-vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGD-NQPFVTGGQLPSGLN  511
            P N+ N  +INNNN PFL GL G            N   + +G    P + GGQLP G+ 
Sbjct  129  PQNSANTGLINNNNVPFLTGLGGNTGNVLQNNGGNNGANLINGGPGFPILNGGQLPQGMT  188

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            +Q+LMFG++TV D+++TEGHELGS ++G+AQGFY+ASS DG S T+  TA+F        
Sbjct  189  IQKLMFGTLTVFDDELTEGHELGSGLVGKAQGFYVASSEDGNSQTITFTAMF-----ESG  243

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
               D+ISFFGVHRTA   S LAI+GGTG Y  A+GYAT++T    +QH TDG+ET+  FT
Sbjct  244  GYIDSISFFGVHRTAVSQSQLAIMGGTGKYVNARGYATVKTFAASNQHDTDGMETVLEFT  303

Query  150  VYI  142
            VY+
Sbjct  304  VYL  306



>ref|XP_010457978.1| PREDICTED: dirigent protein 25-like [Camelina sativa]
Length=383

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 161/242 (67%), Gaps = 21/242 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVPL-ntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN+  +  +PF + N    PI+ GVP  N  N 
Sbjct  153  DH-TLVFFMHDILGGSNPTARAVTGVVANAALSGQIPFAKTNGANLPISNGVPTDNNNNG  211

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQ+ GNN +    +  P   GGQLPSG +LQ LMFG++
Sbjct  212  ILNNNNVPLLVGLGGT--TSNILQSNGNNML----NGLPVANGGQLPSGSSLQMLMFGTL  265

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            +V+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  266  SVIDNELTEGHELGSGLLGKAQGFYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  320

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-------QHTTDGVETITHFTVY  145
            G+HRTAT  SHL ++GGTG Y  A+GYA ++T            Q  TDG+ET+   TVY
Sbjct  321  GIHRTATSESHLGVMGGTGKYINARGYAIVKTFTGASGTQQQQQQRFTDGLETVLECTVY  380

Query  144  IT  139
            ++
Sbjct  381  LS  382



>ref|XP_011089415.1| PREDICTED: dirigent protein 10 [Sesamum indicum]
Length=289

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 152/234 (65%), Gaps = 9/234 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            D  +L+FFMHDILGGS PS   VTGIVAN +    +PF +PN  + P+N G+P  N    
Sbjct  61   DVHSLTFFMHDILGGSHPSAIAVTGIVANPAVGGQVPFAKPNGAVLPVNNGIPTNNANGG  120

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN PFL GL+G         N  N      G   P +   Q PSG  LQ+LMFG++
Sbjct  121  IVNNNNIPFLTGLSGFSSNILQNNNGNNIIGGVPG--FPVLNSAQFPSGTTLQKLMFGTM  178

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHELGS ++G+AQGFY++SS DGTS T+A T +F           D++SFF
Sbjct  179  TVFDDELTEGHELGSGLVGKAQGFYISSSEDGTSQTMAFTVMF-----TSGSYADSLSFF  233

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            GVHRTA   SHLA++GGTG Y  AKG+AT++T P  +QH TDGVET+   TV +
Sbjct  234  GVHRTAVAESHLAVMGGTGKYVNAKGFATVKTFPAANQHETDGVETLLQITVIL  287



>ref|XP_010651068.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 25 [Vitis vinifera]
Length=220

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 153/226 (68%), Gaps = 10/226 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPLntinnv-innnNYP  640
            MHDILGGS PS   VTGIV N   N  +PF +PN  + P+  GVPLN  N+  INNNN P
Sbjct  1    MHDILGGSNPSAGAVTGIVTNPAVNGQVPFAKPNGAVLPVKNGVPLNNGNSALINNNNIP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
            FL GL+G   T  ++QN GNN +       P   GGQ P+G NLQ+LMFG++TV+D+++T
Sbjct  61   FLTGLSGN--TANVIQNNGNNVINGG-SGLPVFNGGQFPAGTNLQKLMFGTMTVIDDELT  117

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            EGH+ GS ++G+AQGFY+ASS DG+S T+A TA+F            ++SFFGVHRTA  
Sbjct  118  EGHDRGSGLVGKAQGFYVASSEDGSSQTMAFTAMF-----ESDGYASSLSFFGVHRTAXS  172

Query  279  ISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
             S LAI+GGTG Y  A+GYAT++T+P  +QH TDG ET+    VY+
Sbjct  173  ESQLAIMGGTGKYVNAEGYATVKTIPGANQHNTDGTETLLQIIVYL  218



>ref|XP_007208752.1| hypothetical protein PRUPE_ppa015993mg [Prunus persica]
 gb|EMJ09951.1| hypothetical protein PRUPE_ppa015993mg [Prunus persica]
Length=714

 Score =   206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 165/245 (67%), Gaps = 10/245 (4%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPING  691
            +SATV+N    HP L+FF+HDI+GGS PS R VTGIV N   N  +PF +PN  + PI  
Sbjct  477  TSATVSNSEAYHP-LTFFLHDIIGGSNPSARAVTGIVTNPAVNGQVPFAKPNGAVVPIGN  535

Query  690  GVPLntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            G+P N  NN I NNN  PF  GL G   ++  L     NN +  G+  P++ G QLP G+
Sbjct  536  GIPQNNNNNGIINNNNVPFFTGLGGNTASN--LIQNNGNNNIIGGNGLPYLNGAQLPPGI  593

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQ+LMFG++TV D+++TEGHELGS +LG+AQGFY+ASS DG+S T+A TA+F       
Sbjct  594  TLQKLMFGTLTVFDDELTEGHELGSGLLGKAQGFYVASSEDGSSQTIAFTAMF-----QS  648

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D+++FFGVH  A   SHLA++GGTG Y  AKGYA ++T+P  +QH TDGV+T+  F
Sbjct  649  GGYADSLTFFGVHLVAASESHLAVMGGTGKYLNAKGYALVKTIPATNQHNTDGVDTVLQF  708

Query  153  TVYIT  139
            T Y+T
Sbjct  709  TAYLT  713



>ref|XP_006850696.1| hypothetical protein AMTR_s00034p00240460 [Amborella trichopoda]
 gb|ERN12277.1| hypothetical protein AMTR_s00034p00240460 [Amborella trichopoda]
Length=373

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 162/252 (64%), Gaps = 27/252 (11%)
 Frame = -1

Query  864  SATVANPTT---DHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPIN  694
            +A+ A P +   +HP ++FFMHDI+GG+ PS R VTGIVAN     LPF + N  + PIN
Sbjct  135  AASAAQPISVDAEHP-ITFFMHDIVGGTHPSTRPVTGIVANVVNGQLPFAKANG-VLPIN  192

Query  693  GGVP--------LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVT  538
            GG+         L    N   N   P + GL G     T+ QN GNN       + PFVT
Sbjct  193  GGIAIPNNNNPALPVTTNGNMNGGLPLVTGLGG-----TVAQN-GNNPT----GSIPFVT  242

Query  537  GGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTAL  358
               LP+G  +Q L FG+ITV+D+++TE HELGS+V+G+AQGFY+ASS DG+SHT+A+TAL
Sbjct  243  ASNLPNGATVQGLQFGTITVIDDELTESHELGSSVVGKAQGFYVASSQDGSSHTMAVTAL  302

Query  357  FhgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTD  178
                 +   +  D+I FFGVHRT    S++A+IGGTG Y+ AKGYAT+++L   D H TD
Sbjct  303  L----EEGGKYEDSICFFGVHRTVAHESYVAVIGGTGKYQGAKGYATVQSLHPADDHATD  358

Query  177  GVETITHFTVYI  142
            GVET+  FTVY+
Sbjct  359  GVETLLQFTVYL  370



>ref|XP_011027098.1| PREDICTED: dirigent protein 25-like [Populus euphratica]
Length=312

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 165/245 (67%), Gaps = 14/245 (6%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            + AT+ NP   H  LSFFMHDI+GG+ PS R VTGIV+N +    +PF +PN    P+N 
Sbjct  79   AEATITNP--GH-TLSFFMHDIIGGTNPSARAVTGIVSNPAVTGQVPFAKPNGANLPLNN  135

Query  690  GVPLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            GVP N  NN + NNN  PFL GL G  Q   +LQN GNN       N P  TGG LPSG 
Sbjct  136  GVPQNNNNNGLINNNNLPFLTGLGGTTQP--VLQNNGNNFNNAF--NLPLSTGGNLPSGS  191

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQQLMFG+ITV+D++ITEGH+L S  +G+AQGFY+ASS+DGTS T+  TA+F       
Sbjct  192  TLQQLMFGTITVIDDEITEGHDLRSGFIGKAQGFYVASSVDGTSQTMVFTAMF-----QS  246

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D++SFFGVHR     S LAI+GGTG Y  A+G+A ++T+P ++QH+TDGVET+  F
Sbjct  247  GLYADSLSFFGVHRKGVSDSRLAIMGGTGKYVNARGFAIVKTIPSINQHSTDGVETLLEF  306

Query  153  TVYIT  139
             VY++
Sbjct  307  AVYVS  311



>ref|XP_011089838.1| PREDICTED: dirigent protein 10 [Sesamum indicum]
Length=221

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 152/226 (67%), Gaps = 9/226 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-LntinnvinnnNYP  640
            MHDILGGS+PS   VTGIVAN +    +PF +PN  + P+N G+P  N    ++NNNN P
Sbjct  1    MHDILGGSRPSAIAVTGIVANPAIGGQVPFAKPNGAVLPVNNGIPTNNANGGIVNNNNIP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
            FL GL+G   T +  QN   NN++      P +   Q PSG  LQ+LMFG++TV D+++T
Sbjct  61   FLTGLSGF--TSSFAQNNNGNNIIGGMPGFPVLDSSQFPSGTTLQKLMFGTMTVFDDELT  118

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            EGHELGS ++G+AQGFY++SS DGTS T+A T +F           D++SFFGVHRTA  
Sbjct  119  EGHELGSGLVGKAQGFYISSSEDGTSQTMAFTVMF-----TSGSYADSLSFFGVHRTAVS  173

Query  279  ISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
             SHLAI+GGTG Y  AKG+AT++T    +QH TDGVET+   TVY+
Sbjct  174  ESHLAIMGGTGKYVNAKGFATVKTFRGTNQHETDGVETLLQITVYL  219



>ref|XP_002530972.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31407.1| conserved hypothetical protein [Ricinus communis]
Length=290

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 163/245 (67%), Gaps = 15/245 (6%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            S  T ANP  D   L+FFMHDILGGS P+ R VTGIV N + +  +PF +PN  + P++ 
Sbjct  58   SGTTAANP--DGHTLTFFMHDILGGSNPTARAVTGIVNNPAVSGQVPFAKPNGAVLPVSN  115

Query  690  GVP-LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            GVP  N  N +INNNN PFL GL+G     T      NN   ++  N P V+G QLPS  
Sbjct  116  GVPQNNNNNGLINNNNLPFLTGLSGT----TPNVVVQNNGNNNNAMNFPVVSGDQLPS--  169

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
              QQLMFG++TV+D+++TEGH+L S  +GRAQGFY+ASS+DGTS  +A T +F   H  +
Sbjct  170  TPQQLMFGTMTVIDDELTEGHDLRSGFVGRAQGFYVASSVDGTSQIMAFTVMFQSSHYED  229

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                 ++SFFGVHRTA   S LAI+GGTG Y  A+G+A ++T P  +QH TDG+ET+  F
Sbjct  230  -----SLSFFGVHRTAVSESQLAIMGGTGKYVNAQGFAIVKTFPATNQHETDGIETLLEF  284

Query  153  TVYIT  139
            TVY+T
Sbjct  285  TVYVT  289



>ref|XP_002315250.2| hypothetical protein POPTR_0010s21860g, partial [Populus trichocarpa]
 gb|EEF01421.2| hypothetical protein POPTR_0010s21860g, partial [Populus trichocarpa]
Length=277

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 165/245 (67%), Gaps = 14/245 (6%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            + AT+ NP   H  LSFFMHDILGG+ PS R VTGIV+N +    +PF +PN    PIN 
Sbjct  44   AGATITNP--GH-TLSFFMHDILGGTNPSTRAVTGIVSNPAVTGQVPFAKPNGANLPINN  100

Query  690  GVPLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            GVP N  NN + NNN  PFL GL G  Q   +LQN GNN       N P  TGG LPSG 
Sbjct  101  GVPQNNNNNGLINNNNLPFLTGLGGTTQP--VLQNNGNNFNNAF--NLPQSTGGNLPSGS  156

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
              QQLMFG+ITV+D++ITEGH+LGS  +G+AQGFY+ASS+DGTS T+A TA+F       
Sbjct  157  AFQQLMFGTITVIDDEITEGHDLGSGFIGKAQGFYVASSVDGTSQTMAFTAMF-----QS  211

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D++SFFGVHRT    S LAI+GGTG Y  A+G+A ++T+P  +QH TDGVET+  F
Sbjct  212  GLYADSLSFFGVHRTGVSESQLAIMGGTGKYVNAQGFAIVKTIPSNNQHATDGVETLLEF  271

Query  153  TVYIT  139
             VY++
Sbjct  272  AVYVS  276



>gb|KFK43093.1| hypothetical protein AALP_AA1G078900 [Arabis alpina]
Length=420

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 161/242 (67%), Gaps = 21/242 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  + F+MHDILGGS P+ R VTG+VAN+  +  LPF +PN    P++ GVP  N  N 
Sbjct  190  DH-TMVFYMHDILGGSNPTARAVTGVVANAALSGQLPFAKPNGANLPVSNGVPSNNNNNG  248

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +INNNN P LVGL G   T  +LQ+ GNN +    +  P   GGQLPSG +LQ LMFG++
Sbjct  249  IINNNNVPLLVGLGGT--TSNILQSNGNNLL----NGLPVANGGQLPSGSSLQMLMFGTL  302

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGH LGS +LG+AQGFY+AS+LDGTS T+A TA+F           D+ISFF
Sbjct  303  TVMDNELTEGHALGSGLLGKAQGFYVASALDGTSQTMAFTAMF-----ESGGYEDSISFF  357

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHT-------TDGVETITHFTVY  145
            GVHRTA   SHL ++GGTG +  A+G+A ++T    + +        TDG+ET+   TVY
Sbjct  358  GVHRTAVSESHLGVMGGTGKFVNARGFAIVKTFTGSNGNQQQQPLQFTDGLETVLECTVY  417

Query  144  IT  139
            +T
Sbjct  418  LT  419



>emb|CDX95129.1| BnaC05g05420D [Brassica napus]
Length=378

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 163/241 (68%), Gaps = 20/241 (8%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnv  661
            DH +L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    P+N GVP N  NN 
Sbjct  149  DH-SLVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPVNNGVPSNNNNNG  207

Query  660  innnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            I NNN  P LVGL G   T ++LQN GNN +    +  P   GGQLPSG +LQ LMFG++
Sbjct  208  ILNNNNVPLLVGLGGT--TSSILQNDGNNLL----NGLPVANGGQLPSGSSLQMLMFGTM  261

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  262  TVMDNELTEGHELGSGLLGKAQGFYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  316

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHT------TDGVETITHFTVYI  142
            GVHRTA   SHL ++GGTG Y  A+GYA ++T      +T      TDG+ET+   TVY+
Sbjct  317  GVHRTAASESHLGVMGGTGKYVNARGYAIVKTFTGGTGNTQQPHQFTDGLETVLECTVYL  376

Query  141  T  139
            +
Sbjct  377  S  377



>ref|XP_004145196.1| PREDICTED: uncharacterized protein LOC101214738 [Cucumis sativus]
 ref|XP_004153488.1| PREDICTED: uncharacterized protein LOC101209251 [Cucumis sativus]
 gb|KGN64478.1| hypothetical protein Csa_1G058130 [Cucumis sativus]
Length=257

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 149/253 (59%), Gaps = 32/253 (13%)
 Frame = -1

Query  867  SSATVANPTTDHPA------LSFFMHDILGGSQPSGRVVTGIVANSN--ANNLPFTQPND  712
            SS T+ N    +P       LSFFMH+ILGGS P+ R VTG + N       LPF++P  
Sbjct  26   SSTTIHNQVAPNPIDQFETNLSFFMHNILGGSHPTARTVTGTIPNKAEPTAGLPFSKPKK  85

Query  711  QLFPINGGVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGG  532
             +FP+ G VPL                    +   +  + N  N N      NQPFVT G
Sbjct  86   TIFPLPGAVPLIAA----------------NRNSNEGGIANHNNKN------NQPFVTAG  123

Query  531  QLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTA-LF  355
            Q+PS   LQ +MFGSIT +D+++TEG ELGS V+GR QGFY  SSLDG+SHT+ALT  L 
Sbjct  124  QVPSAAVLQHVMFGSITTIDDELTEGEELGSGVMGRGQGFYFISSLDGSSHTVALTVILH  183

Query  354  hgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTD  178
              + + E +  DTISFFGVHR  +  S +A++GGTG YE A G+A IE L   + Q+ TD
Sbjct  184  RYDENEEKKDEDTISFFGVHRRGSMESPIAVVGGTGKYENASGFAVIENLRRRENQYMTD  243

Query  177  GVETITHFTVYIT  139
            G +TI HF VY++
Sbjct  244  GDDTIVHFRVYLS  256



>gb|KFK32272.1| hypothetical protein AALP_AA6G220900 [Arabis alpina]
Length=383

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 161/240 (67%), Gaps = 15/240 (6%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH AL FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    P++ GVP  N  N 
Sbjct  151  DH-ALVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPVSNGVPSNNNNNG  209

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN PFLVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  210  LVNNNNVPFLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  267

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D++IT+GHELGS +LG+AQG+Y+AS++DGTS T+A T +F           D+ISFF
Sbjct  268  TVIDDEITQGHELGSGLLGKAQGYYVASAVDGTSQTMAFTVMF-----ESGGYEDSISFF  322

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLP-----HVDQHTTDGVETITHFTVYIT  139
            GVHRTA   SHL ++GGTG Y  A+G+A ++T          Q  TDG+ET+   TVY+T
Sbjct  323  GVHRTAVSESHLGVMGGTGKYVNARGFAIVKTFIGSSGLQQQQQFTDGLETVLQCTVYLT  382



>ref|XP_008440684.1| PREDICTED: dirigent protein 9-like [Cucumis melo]
Length=258

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 146/233 (63%), Gaps = 25/233 (11%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSN--ANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            LSFFMH+ILGGS P+ R VTG + N       LPF++P   +FPI GGVPL   N     
Sbjct  46   LSFFMHNILGGSHPTARTVTGTIPNKAEPTAGLPFSKPRKTIFPIPGGVPLVAANRNS--  103

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
                     NG+          G     ++ +NQPFVT GQLPSG  LQ +MFGS+T +D
Sbjct  104  ---------NGR----------GGITNNNNNNNQPFVTAGQLPSGAVLQHVMFGSLTTID  144

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTA-LFhgehdhehelgDTISFFGVH  295
            N++TEG ELGS V+GR QGFY  SSLDG+SHT+ALT  L   + D E +  DTISFFGVH
Sbjct  145  NELTEGEELGSGVMGRGQGFYFISSLDGSSHTVALTVILHRFDEDEEKKDEDTISFFGVH  204

Query  294  RTATPISHLAIIGGTGTYETAKGYATIETLPHVD-QHTTDGVETITHFTVYIT  139
            R  +  S +A++GGTG YE A G+A IE L   + Q+ TDG +TI HF VY++
Sbjct  205  RRGSMESPIAVVGGTGKYENASGFAVIENLRRRENQYMTDGDDTIVHFRVYLS  257



>gb|KCW52731.1| hypothetical protein EUGRSUZ_J02089, partial [Eucalyptus grandis]
Length=339

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 156/240 (65%), Gaps = 9/240 (4%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGV  685
            A+  + T  HP L F+MHDILGGS P+ R VTGIV N + +  +PF +PN    PIN G+
Sbjct  106  ASTGSNTDLHPML-FYMHDILGGSSPTARAVTGIVTNPALSAQVPFAKPNGANLPINSGI  164

Query  684  PLntinn-vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGD-NQPFVTGGQLPSGLN  511
            P N+ N  +INNNN PFL GL G            N   + +G    P + GGQLP G+ 
Sbjct  165  PQNSANTGLINNNNVPFLTGLGGNTGNVLQNNGGNNGANLINGGPGFPILNGGQLPQGMT  224

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            +Q+LMFG++TV D+++TEGHELGS ++G+AQGFY+ASS DG S T+  TA+F        
Sbjct  225  IQKLMFGTLTVFDDELTEGHELGSGLVGKAQGFYVASSEDGNSQTITFTAMF-----ESG  279

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
               D+ISFFGVHRTA   S LAI+GGTG Y  A+GYAT++T    +QH TDG+ET+  FT
Sbjct  280  GYIDSISFFGVHRTAVSQSQLAIMGGTGKYVNARGYATVKTFAASNQHDTDGMETVLEFT  339



>ref|XP_006436125.1| hypothetical protein CICLE_v10033627mg [Citrus clementina]
 ref|XP_006486012.1| PREDICTED: dirigent protein 10-like [Citrus sinensis]
 gb|ESR49365.1| hypothetical protein CICLE_v10033627mg [Citrus clementina]
Length=220

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 151/227 (67%), Gaps = 10/227 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnvinnnN-YP  640
            MHDILGGS PS   +TGIV N + +  + F +PN     IN GVP +  NN + NNN  P
Sbjct  1    MHDILGGSNPSALAITGIVNNPAVSGQVAFAKPNGANLAINTGVPQSNGNNGLINNNNVP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
            FL GL+G       +     NN   +G N P  TGGQLPSG  LQ+LMFG++TV+D+++T
Sbjct  61   FLTGLSG---ITQNVVQNNGNNFNANGINFPAATGGQLPSGSVLQKLMFGTMTVIDDELT  117

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            EGHEL SA LG+AQGFY+ASS+DGTSHT+A T +F      E    D++SFFGVHRTA  
Sbjct  118  EGHELRSAFLGKAQGFYVASSVDGTSHTMAFTTMF-----AEGHYVDSLSFFGVHRTAVS  172

Query  279  ISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
             S LAI+GGTG Y  AKG+A ++T+P   Q  TDG+ET+  F VYI+
Sbjct  173  ESQLAIMGGTGKYVNAKGFAIVKTIPETRQQETDGIETLLEFVVYIS  219



>ref|XP_007016542.1| Disease resistance-responsive (dirigent-like protein) family 
protein, putative [Theobroma cacao]
 gb|EOY34161.1| Disease resistance-responsive (dirigent-like protein) family 
protein, putative [Theobroma cacao]
Length=301

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 164/242 (68%), Gaps = 8/242 (3%)
 Frame = -1

Query  858  TVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP  682
            TV +    H  L+FFMHDILGGS PS R V+GIV+N + +  +PF +PN    P+N GV 
Sbjct  65   TVTSAADPHHPLTFFMHDILGGSNPSARAVSGIVSNPAVSGQVPFAKPNGANLPVNNGVS  124

Query  681  LntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQ  505
            +N+ NN I NNN  PFL  L G   T+ + QN GNN + +       ++GGQ+P+G  +Q
Sbjct  125  VNSNNNGIINNNNVPFLTSLGGTSATNAV-QNNGNNPINNGIGGVAVLSGGQVPAGSTIQ  183

Query  504  QLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehel  325
            + MFG++TV+D+++TEGHELGS ++G+A+GFY+ASS+DG S T+A TA+F          
Sbjct  184  KFMFGTLTVIDDELTEGHELGSGLIGKAEGFYVASSIDGNSQTMAFTAMF-----ESGGY  238

Query  324  gDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVY  145
             D+ISFFGVHRTA   S LAI+GGTG Y  AKG A ++T P  +QH TDG ET+  FTVY
Sbjct  239  ADSISFFGVHRTAVSESQLAIMGGTGKYLNAKGSAIVKTFPTTNQHETDGFETLLQFTVY  298

Query  144  IT  139
            ++
Sbjct  299  LS  300



>ref|XP_010112925.1| hypothetical protein L484_010856 [Morus notabilis]
 gb|EXC35074.1| hypothetical protein L484_010856 [Morus notabilis]
Length=331

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 160/244 (66%), Gaps = 9/244 (4%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGV  685
            AT+ N    H  L F+MHDI+GG+ PS   +TGIV+N + +  +PF +PN  + PIN GV
Sbjct  93   ATLGNADPHH-TLIFYMHDIVGGTNPSAIAITGIVSNPAVSGQVPFAKPNGAVLPINNGV  151

Query  684  PLntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            P N  N  I +NN  PF  GL G         N  NNN +  G+  PF+ G QLP G+ L
Sbjct  152  PQNNNNQGIISNNNVPFFTGLAGNTANLLQNTNNNNNNFIAGGNGFPFLNGAQLPPGMTL  211

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            Q+LMFG++T  D+++TEGHELGS +LG+AQGFY+ASS+DGTS  +A TA+F         
Sbjct  212  QKLMFGTVTAFDDELTEGHELGSGLLGKAQGFYVASSVDGTSQIMAFTAMF-----QTGG  266

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETL-PHVDQHTTDGVETITHFT  151
              D+++FFGVH TA   SHLAI+GGTG Y  AKG AT++T  P  DQH TDG+ET+  FT
Sbjct  267  YADSLTFFGVHMTAAAESHLAIMGGTGKYLNAKGIATVKTFPPTADQHNTDGLETLLQFT  326

Query  150  VYIT  139
            VY++
Sbjct  327  VYLS  330



>ref|XP_006409900.1| hypothetical protein EUTSA_v10016661mg [Eutrema salsugineum]
 gb|ESQ51353.1| hypothetical protein EUTSA_v10016661mg [Eutrema salsugineum]
Length=443

 Score =   195 bits (495),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 160/242 (66%), Gaps = 17/242 (7%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH AL FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    P+  GVP  N  N 
Sbjct  209  DH-ALVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPLTNGVPSNNNNNG  267

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  268  IVNNNNVPLLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  325

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFF
Sbjct  326  TVIDDELTEGHELGSGLLGKAQGYYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  380

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIE-------TLPHVDQHTTDGVETITHFTVY  145
            GVHRTA   SHL ++GGTG Y  A+G+A ++       TL       TDG+ET+   TVY
Sbjct  381  GVHRTAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTLQQQPHQFTDGLETVLQCTVY  440

Query  144  IT  139
            ++
Sbjct  441  LS  442



>gb|KHN22002.1| Disease resistance response protein 206 [Glycine soja]
Length=202

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 140/224 (63%), Gaps = 23/224 (10%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnNYPFL  634
            MHDI+GGS PS R+V G + N+  N+LPF++PN+++ P  G +PL   +           
Sbjct  1    MHDIIGGSTPSERIVAGTIVNTQTNHLPFSKPNNRVLPFKGAIPLVDTSTGS--------  52

Query  633  VGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQITEG  454
             G N    + T+++N   N VV        +    L  G   +  +FG ITV+D++IT+G
Sbjct  53   -GTNPTHTSTTVIKNIDKNKVV--------INKNSLGLGATPENFLFGRITVIDDKITKG  103

Query  453  HELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATPIS  274
             ELGS V+G+AQGF+LASSLDG+S T+A TALFH + +        ISFFGVHRTA   S
Sbjct  104  LELGSEVIGKAQGFHLASSLDGSSKTMAFTALFHDDEED------AISFFGVHRTAAHES  157

Query  273  HLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            H+A++GGTG Y  AKGYA IETL    QHTT+GVET+   TVY+
Sbjct  158  HIAVVGGTGKYINAKGYAIIETLHSPQQHTTNGVETLVQITVYL  201



>emb|CDY72481.1| BnaUnng05170D [Brassica napus]
Length=366

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 156/244 (64%), Gaps = 26/244 (11%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN+  +  LPF +PN    P++ GVP  +  N 
Sbjct  137  DH-TLVFFMHDILGGSNPTARAVTGVVANAALSGQLPFAKPNGANLPVSNGVPSNSNNNG  195

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G             NN  +  +  P   GGQLPSG +LQ LMFG++
Sbjct  196  ILNNNNVPLLVGLGGTTSNIL------QNNGNNLLNGLPVANGGQLPSGSSLQMLMFGTM  249

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  250  TVMDNELTEGHELGSGLLGKAQGFYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  304

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL---------PHVDQHTTDGVETITHFT  151
            GVHRTA   SHL ++GGTG Y  A+GYA ++T          PH     TDG+ET+   T
Sbjct  305  GVHRTAASESHLGVMGGTGKYVNARGYAVVKTYTGGSGNSQQPH---QFTDGLETVLECT  361

Query  150  VYIT  139
            VY++
Sbjct  362  VYLS  365



>ref|XP_009103704.1| PREDICTED: dirigent protein 10-like [Brassica rapa]
Length=405

 Score =   193 bits (491),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 160/245 (65%), Gaps = 23/245 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    PI  GVP  N  N 
Sbjct  171  DH-TLVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPITNGVPSNNNNNG  229

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  230  IVNNNNVPLLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  287

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFF
Sbjct  288  TVIDDELTEGHELGSGLLGKAQGYYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  342

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHF  154
            GVHRTA   SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   
Sbjct  343  GVHRTAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLQC  399

Query  153  TVYIT  139
            TVY++
Sbjct  400  TVYLS  404



>ref|NP_973782.1| dirigent protein 25 [Arabidopsis thaliana]
 sp|Q9LQQ0.1|DIR25_ARATH RecName: Full=Dirigent protein 25; Short=AtDIR25; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF75080.1|AC007583_16 Contains similarity to disease resistance response protein from 
Pisum sativum gb|M18250. EST gb|F13940 comes from this gene 
[Arabidopsis thaliana]
 gb|AEE28172.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Arabidopsis thaliana]
Length=389

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 157/241 (65%), Gaps = 26/241 (11%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVPL-ntinnvinn  652
            L FFMHDILGGS P+ R VTG+VAN+  +  +PF +PN    P++ GVP  N  N ++NN
Sbjct  162  LVFFMHDILGGSNPTARAVTGVVANAALSGQIPFAKPNGANLPVSNGVPSDNNNNGILNN  221

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN P LVGL G   T  +LQN       +  +  P   GGQLPSG +LQ LMFG++TV+D
Sbjct  222  NNVPLLVGLGGT--TSNILQNN----GNNMLNGLPVANGGQLPSGSSLQMLMFGTLTVMD  275

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            N++TEGHELGS +LG+AQGFY+AS+LDGTS T+A TA+F           D+ISFFGVHR
Sbjct  276  NELTEGHELGSGLLGKAQGFYVASALDGTSQTMAFTAMF-----ESGGYEDSISFFGVHR  330

Query  291  TATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHFTVYI  142
            TA   SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   TVY+
Sbjct  331  TAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLECTVYL  387

Query  141  T  139
            +
Sbjct  388  S  388



>emb|CDY04579.1| BnaA07g14050D [Brassica napus]
Length=386

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 160/245 (65%), Gaps = 23/245 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    PI  GVP  N  N 
Sbjct  152  DH-TLVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPITNGVPSNNNNNG  210

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  211  IVNNNNVPLLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  268

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFF
Sbjct  269  TVIDDELTEGHELGSGLLGKAQGYYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  323

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHF  154
            GVHRTA   SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   
Sbjct  324  GVHRTAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLQC  380

Query  153  TVYIT  139
            TVY++
Sbjct  381  TVYLS  385



>ref|XP_009140931.1| PREDICTED: dirigent protein 25 isoform X2 [Brassica rapa]
Length=228

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 155/237 (65%), Gaps = 22/237 (9%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-LntinnvinnnNYP  640
            MHDILGGS P+ R VTG+VAN + +  LPF +PN    PI  GVP  N  N ++NNNN P
Sbjct  1    MHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPITNGVPSNNNNNGIVNNNNVP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
             LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++TV+D+++T
Sbjct  61   LLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTMTVIDDELT  118

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            EGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFFGVHRTA  
Sbjct  119  EGHELGSGLLGKAQGYYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFFGVHRTAAS  173

Query  279  ISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHFTVYIT  139
             SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   TVY++
Sbjct  174  ESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLQCTVYLS  227



>ref|XP_006417771.1| hypothetical protein EUTSA_v10007858mg [Eutrema salsugineum]
 gb|ESQ36124.1| hypothetical protein EUTSA_v10007858mg [Eutrema salsugineum]
Length=391

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 153/244 (63%), Gaps = 26/244 (11%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSN-ANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  + FFMHDILGGS P+ R VTG+VAN+  +  LPF +PN    P++ GVP  N  N 
Sbjct  162  DHTVI-FFMHDILGGSNPTARAVTGVVANAALSGQLPFAKPNGANLPVSNGVPTNNNNNG  220

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G              N        P   GGQLPSG +LQ LMFG++
Sbjct  221  ILNNNNVPLLVGLGGTTSNILQNNGNNLLN------GLPVANGGQLPSGSSLQMLMFGTM  274

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+DN++TEGHELGS +LG+AQGFY+AS++DGTS T+A TA+F           D+ISFF
Sbjct  275  TVMDNELTEGHELGSGLLGKAQGFYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  329

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL---------PHVDQHTTDGVETITHFT  151
            GVHRTA   SHL ++GGTG Y  A+GYA ++T          PH     TDG+ET+   T
Sbjct  330  GVHRTAASESHLGVMGGTGKYVNARGYAIVKTFTGGSGNQQQPH---RFTDGLETVMQCT  386

Query  150  VYIT  139
            VY++
Sbjct  387  VYLS  390



>ref|XP_009140930.1| PREDICTED: dirigent protein 25 isoform X1 [Brassica rapa]
Length=413

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 160/245 (65%), Gaps = 23/245 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    PI  GVP  N  N 
Sbjct  179  DH-TLVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPITNGVPSNNNNNG  237

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  238  IVNNNNVPLLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  295

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFF
Sbjct  296  TVIDDELTEGHELGSGLLGKAQGYYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  350

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHF  154
            GVHRTA   SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   
Sbjct  351  GVHRTAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLQC  407

Query  153  TVYIT  139
            TVY++
Sbjct  408  TVYLS  412



>gb|KDP46091.1| hypothetical protein JCGZ_06602 [Jatropha curcas]
Length=304

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 152/231 (66%), Gaps = 10/231 (4%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnvinnn  649
            L+FFMHDILGGS P+ R VTGIV+N   N  +PF +PN  + PIN GVP N  NN + NN
Sbjct  81   LTFFMHDILGGSNPTARAVTGIVSNPAVNGRVPFAKPNGAVLPINNGVPQNNNNNGLINN  140

Query  648  NY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            N  PFL GL+G                 ++  N P V G +LPS   LQQLMFG+ITV+D
Sbjct  141  NNLPFLTGLSGATANVVQNNGNNVLINNNA-FNVPIVNGDKLPS--TLQQLMFGTITVID  197

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGH+L S  +GRAQGFY+ASS+DGTS T+A T LF           D+++FFGVHR
Sbjct  198  DELTEGHDLSSGFVGRAQGFYVASSVDGTSQTMAFTTLF-----QSGHFEDSLTFFGVHR  252

Query  291  TATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            TA   S LAI+GGTG Y  A+GYA ++T P  +QH TDG ET+  FTVY++
Sbjct  253  TAVSESQLAIMGGTGKYVNAQGYAIVKTFPVNNQHETDGAETLLEFTVYVS  303



>ref|XP_004968254.1| PREDICTED: angiomotin-like [Setaria italica]
Length=344

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/250 (49%), Positives = 158/250 (63%), Gaps = 17/250 (7%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNA-NNLPFTQPNDQLFPING  691
            + A VANPT DH  + FFMHDILGG+ PS R+V GIV N+     LPF +PN  + P++ 
Sbjct  103  AGAAVANPTGDH-GMVFFMHDILGGTNPSARIVAGIVDNAAVTGQLPFARPNGAVLPLSS  161

Query  690  GVPLntinnvin-nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            GV +N+       NNN PFL GL G       +++  NNN  + G+  P   GG LP G 
Sbjct  162  GVNVNSGAASAIDNNNIPFLTGLGGATNA---VKSINNNNNNNGGNGVPIFAGGSLPQGT  218

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQ+L+FG++TVVD+++TE  ELGSA +GRAQGFY+ASS +G S T+A+TA+F      E
Sbjct  219  TLQKLLFGTMTVVDDELTEAPELGSAAVGRAQGFYIASSEEGVSQTVAVTAMF-----KE  273

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIE------TLPHVDQHTTDGV  172
                DTISFFGVHRTA   SHLAI+GGTG Y  AKG+A +        +       TDGV
Sbjct  274  GGFDDTISFFGVHRTADSESHLAIVGGTGKYVGAKGFAKVAVVRPGGVVASGALLETDGV  333

Query  171  ETITHFTVYI  142
            ET+  FTV++
Sbjct  334  ETVLQFTVFL  343



>emb|CDY31724.1| BnaA04g16600D [Brassica napus]
Length=412

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 160/245 (65%), Gaps = 23/245 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    PI  GVP  N  N 
Sbjct  178  DH-TLVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPITNGVPSNNNNNG  236

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN P LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  237  IVNNNNVPLLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  294

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFF
Sbjct  295  TVIDDELTEGHELGSGLLGKAQGYYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  349

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHF  154
            GVHRTA   SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   
Sbjct  350  GVHRTAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLQC  406

Query  153  TVYIT  139
            TVY++
Sbjct  407  TVYLS  411



>ref|XP_009357650.1| PREDICTED: dirigent protein 10-like [Pyrus x bretschneideri]
Length=301

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 152/237 (64%), Gaps = 16/237 (7%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnv  661
            DHPAL FFMHDILGGS P+ R +TGIV N   N  +PF +PN  + P N GVP N  N  
Sbjct  76   DHPALIFFMHDILGGSNPTARAMTGIVNNPAVNGQVPFAKPNGAVLPFNNGVPQNNNNGG  135

Query  660  innnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPF-VTGGQL-PSGLNLQQLMFG  490
            + NNN  PFL GL+G         N G N+  + G    F + GGQL P    LQ LMFG
Sbjct  136  LINNNNIPFLTGLSGTTP------NVGQNSNRNGGGFGNFPINGGQLLPGSSALQNLMFG  189

Query  489  SITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTIS  310
            +++V D+++TEGHE  S ++G+AQGFY+ SS DGTS T+A TA+F           DT+S
Sbjct  190  TMSVFDDELTEGHERSSGLVGKAQGFYVVSSEDGTSQTMAFTAMF-----QSGSYSDTLS  244

Query  309  FFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FFGVHRTA   SHLAI+GGTG Y  AKG+A ++T P  +Q  TDG ET+  FTVY+T
Sbjct  245  FFGVHRTAVSESHLAIMGGTGKYVNAKGFALVKTFPASNQQ-TDGAETLLEFTVYVT  300



>emb|CDY63718.1| BnaC04g54770D [Brassica napus]
Length=387

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 160/245 (65%), Gaps = 23/245 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinn  664
            DH  L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    PI  GVP  N  N 
Sbjct  153  DH-TLVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPITNGVPSNNNNNG  211

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +INNNN P LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  212  IINNNNVPLLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  269

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS +LG+AQG+Y++S++DGTS T+A TA+F           D+ISFF
Sbjct  270  TVIDDELTEGHELGSGLLGKAQGYYVSSAVDGTSQTMAFTAMF-----ENGGYEDSISFF  324

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHF  154
            GVHRTA   SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   
Sbjct  325  GVHRTAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLQC  381

Query  153  TVYIT  139
            TVY++
Sbjct  382  TVYLS  386



>ref|XP_010523131.1| PREDICTED: dirigent protein 25 [Tarenaya hassleriana]
Length=437

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 152/217 (70%), Gaps = 16/217 (7%)
 Frame = -1

Query  828  ALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinnvin  655
            AL F+MHDILGGS P+ R VTG+VAN +    +PF +PN    P++ GVP  N  N +IN
Sbjct  176  ALMFYMHDILGGSNPTARAVTGVVANPAVTGQVPFAKPNGANLPVSNGVPTNNNNNGIIN  235

Query  654  nnNYPFLVGLNGQQQTDTLLQNTGNN---NVVDSGDNQ----PFVTGGQLPSGLNLQQLM  496
            NNN PFLVGL G   T  +LQN GNN    + ++G+N     P   GGQLP+G  LQ LM
Sbjct  236  NNNVPFLVGLGGT--TANILQNNGNNLLTGLPNNGNNLLTGLPVANGGQLPTGSALQNLM  293

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDT  316
            FG++TV+D+++TEGHELGS ++G+AQGFY+AS++DGTS T+A+TA+F           D+
Sbjct  294  FGTMTVIDDELTEGHELGSGLIGKAQGFYVASAIDGTSQTMAITAMF-----ESGGYEDS  348

Query  315  ISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETL  205
            ISFFGVHRTA   SHLAI+GGTG Y  A+G+A ++T 
Sbjct  349  ISFFGVHRTAASESHLAIMGGTGKYINARGFAIVKTF  385



>ref|XP_007219177.1| hypothetical protein PRUPE_ppa016665mg, partial [Prunus persica]
 gb|EMJ20376.1| hypothetical protein PRUPE_ppa016665mg, partial [Prunus persica]
Length=232

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 153/235 (65%), Gaps = 16/235 (7%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPLntinnv  661
            D   L FFMHDILGGS P+ R +TGIV +  AN  LPF +PN  + P N GVP N  NN 
Sbjct  11   DQHTLIFFMHDILGGSNPTARAMTGIVNSPAANGQLPFAKPNGAVLPFNNGVPQNNNNNG  70

Query  660  innnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            + NNN  PFL GL+G   T  + QN G N     G N P + GGQL  G  LQ LMFG++
Sbjct  71   LINNNNIPFLTGLSGT--TSNVAQNNGIN-----GGNFP-INGGQLQPGSVLQNLMFGTM  122

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            +V D+++TEGHEL S ++G+AQGFY+ SS DGTS T+  TA+F           D++SFF
Sbjct  123  SVFDDELTEGHELSSGLVGKAQGFYVVSSEDGTSQTMGFTAMF-----ESGSYADSLSFF  177

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            GVHRTA   SHLAI+GGTG Y  AKG+A ++T P  +Q  TDG ET+  FTVY+T
Sbjct  178  GVHRTAVSESHLAIMGGTGKYVNAKGFAMVKTFPASNQQ-TDGAETLLQFTVYLT  231



>ref|XP_009358379.1| PREDICTED: dirigent protein 25-like [Pyrus x bretschneideri]
Length=310

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 159/239 (67%), Gaps = 10/239 (4%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLnt  673
            N  + HP L+FF+HDI+GGS PS R VTGIVAN + +  +PF +PN    PI  G+P N 
Sbjct  79   NTASYHP-LTFFLHDIIGGSNPSARAVTGIVANPAVSGQVPFAKPNGANIPIGNGIPQNN  137

Query  672  innvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
             NN I NNN  PF  GL G    + +  N  NN +  +    P++ G QLP G+ LQ+LM
Sbjct  138  NNNGIINNNNVPFFTGLGGNAGNNLIQNNGNNNIIGGN--GLPYLNGTQLPPGITLQKLM  195

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDT  316
            FG++TV D+++TEGHELGS +LG+AQGFY+ASS DG+S T+A TA+F           D+
Sbjct  196  FGTLTVFDDELTEGHELGSGLLGKAQGFYVASSEDGSSQTIAFTAMF-----QSGGYADS  250

Query  315  ISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            ++FFGVH+ A   SHLA++GGTG Y  AKGYA ++T P  +Q  TDGV+T+  FT Y+T
Sbjct  251  LTFFGVHQVAASESHLAVMGGTGKYLNAKGYALVKTTPATNQQNTDGVDTVLQFTTYLT  309



>ref|XP_004295954.1| PREDICTED: uncharacterized protein LOC101303601 [Fragaria vesca 
subsp. vesca]
Length=299

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 164/244 (67%), Gaps = 9/244 (4%)
 Frame = -1

Query  864  SATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGG  688
            +ATVAN  + HP L+FF+HDI+GG+ PS R VTGIV N   N  +PF +PN  +   N G
Sbjct  62   TATVANGESYHP-LTFFLHDIIGGTNPSARAVTGIVTNPAVNGQVPFAKPNGAVIGGNNG  120

Query  687  VPLntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            +P N  NN I NNN  PF  GL G    +   +N  NN +  + +  P V G QLP G +
Sbjct  121  IPQNNNNNGIINNNNVPFFTGLGGNINNNLRQRNNNNNFIGGN-NGFPVVNGAQLPPGQS  179

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ+LMFG++TV D+++TEGHELGS +LG+AQGFY+ASS DG+S T+A TA+F        
Sbjct  180  LQKLMFGTLTVFDDELTEGHELGSGLLGKAQGFYVASSEDGSSQTIAFTAMF-----ESG  234

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
               D+++FFGVH  A+  SHLA++GGTG Y  AKGYA ++T+  V++  TDGV+T+  FT
Sbjct  235  GYADSLTFFGVHTMASSESHLAVMGGTGKYLNAKGYALVKTINGVNEQNTDGVDTVLEFT  294

Query  150  VYIT  139
            VY++
Sbjct  295  VYLS  298



>ref|XP_010685843.1| PREDICTED: dirigent protein 10-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 159/235 (68%), Gaps = 9/235 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            +HP L FFMHDILGGS P+ + +TG+V+N + +  +PF +PN  +   N GVP N  N+ 
Sbjct  136  EHPTLVFFMHDILGGSNPTAKAITGVVSNPAVSGQVPFAKPNGAVLANNNGVPQNNGNSG  195

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            ++NNNN PFL GL G      ++QN    N    G+  P V G QL SG  LQQLMFG++
Sbjct  196  IMNNNNMPFLTGLGGVN--PNVMQNNNGGNNYIGGNGFPVVNGAQLGSGTTLQQLMFGTM  253

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
              VD+++T+GH L S ++GRAQGFY+ SS+DG + T+  TA+F      E    ++++FF
Sbjct  254  IAVDDELTDGHALNSGMVGRAQGFYVYSSVDGKTQTMLFTAMF-----QEGGYHNSLNFF  308

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            G+H+TA   S ++++GGTG Y  AKG+AT++TLP VDQH TDG+E++  F+VY+T
Sbjct  309  GIHQTAVSESVVSVMGGTGKYVNAKGFATVKTLPPVDQHETDGLESVLEFSVYLT  363



>ref|XP_004308836.1| PREDICTED: uncharacterized protein LOC101311810 [Fragaria vesca 
subsp. vesca]
Length=292

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 160/245 (65%), Gaps = 21/245 (9%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANN--LPFTQPNDQLFPINGG  688
            ATVA+   DH +L FF+HDILGG+ P+ R +TGIV NS A N  +PF +PN  + P N G
Sbjct  64   ATVAD---DHHSLVFFLHDILGGTNPTARAMTGIV-NSPAVNGQVPFAKPNGAVLPFNNG  119

Query  687  VPLntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PSGL  514
            VP N  NN I +NN  PFL GL+G  Q              ++ +N  F+ GGQL P G 
Sbjct  120  VPQNNNNNGILSNNNIPFLTGLSGTTQNAI--------RNNNNNNNNNFINGGQLFPGGS  171

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
            +LQ LMFG+++V D+++TEGHELGS ++G+AQGFY+ SS DGTS T+A TA+F       
Sbjct  172  SLQNLMFGTMSVFDDELTEGHELGSGLVGKAQGFYVVSSEDGTSQTMAFTAMF-----ES  226

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                D++SFFGVHR A   SHLAI+GGTG Y  AKG+A ++T P  ++  TDG ET+  F
Sbjct  227  GGYADSLSFFGVHRVAASESHLAIMGGTGKYVDAKGFAIVKTFPATNEQQTDGAETLLQF  286

Query  153  TVYIT  139
             VYIT
Sbjct  287  IVYIT  291



>ref|XP_006488244.1| PREDICTED: dirigent protein 25-like [Citrus sinensis]
Length=221

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 151/227 (67%), Gaps = 9/227 (4%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnvinnnNYP-  640
            MHDILGGS PS R VTGI AN +    + F +PN    P+N GVPLN  NN + NNN   
Sbjct  1    MHDILGGSNPSARAVTGIAANPAVTGQVAFAKPNGANLPLNNGVPLNNNNNGLVNNNNVP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
            FL GL+G   T  + QN GNN       N P + GGQ+P+G   Q+LMFG++TV+D+++T
Sbjct  61   FLTGLSGT--TAGVAQNNGNNFPNGGFANIPVLNGGQVPAGSTFQKLMFGTLTVIDDELT  118

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            E HELGS ++G+ QGFY+ASS DGTS T+A TA+F           D+ISFFGVHRTA  
Sbjct  119  EDHELGSGLVGKVQGFYVASSEDGTSQTMAFTAMF-----ESGGYADSISFFGVHRTAVS  173

Query  279  ISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
             S LAIIGGTG Y  AKGYAT++T P  +QH  DGVET+   TV++T
Sbjct  174  ESQLAIIGGTGKYVNAKGYATVKTFPATNQHNIDGVETLLQLTVFLT  220



>ref|XP_010313548.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 10 [Solanum 
lycopersicum]
Length=288

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 154/236 (65%), Gaps = 17/236 (7%)
 Frame = -1

Query  846  PTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntin  667
            P TD    SFFMHDILGGS PS   V      S +  +PF +PN  +  +  GVP+ + N
Sbjct  67   PATDDHIFSFFMHDILGGSNPSAIAV----XPSLSGQVPFAKPNGAVLAVENGVPVTSGN  122

Query  666  n-vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFG  490
            + +I+NNN PFL GL+G   T  ++QN    N++  G+  P +   QL SG+  Q+LMFG
Sbjct  123  SGIISNNNIPFLTGLSGT--TPNVVQN----NIIGGGNGYPALNMAQLGSGITFQKLMFG  176

Query  489  SITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTIS  310
            ++TV D+++T+GHEL S ++G++QGFY++SS DGTS T+A T +F     H     D++S
Sbjct  177  TLTVFDDELTQGHELNSGLVGKSQGFYVSSSEDGTSQTMAFTVMF-----HSGSYSDSLS  231

Query  309  FFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            FFGVHR     SHLAI+GGTG Y  AKG+AT++T P  +Q  TDGV+T+ H TVY+
Sbjct  232  FFGVHRVRVSESHLAIMGGTGKYVNAKGFATVKTFPAANQE-TDGVQTLLHITVYL  286



>ref|XP_007132120.1| hypothetical protein PHAVU_011G068300g [Phaseolus vulgaris]
 gb|ESW04114.1| hypothetical protein PHAVU_011G068300g [Phaseolus vulgaris]
Length=298

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 153/239 (64%), Gaps = 11/239 (5%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVP-Ln  676
            N    H  LSFFMHDILGGS PS R VTG+V N   N  + F +PN    P NGG+P  N
Sbjct  66   NGVDQHHTLSFFMHDILGGSNPSARAVTGVVTNPALNAQVAFAKPNGANLPFNGGLPQNN  125

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
                ++NNNN PFL GL G   T   + N   NN+V+ G   P     QLP G+ LQ++M
Sbjct  126  NNGGILNNNNLPFLTGLGG---TTGNVFNNNGNNLVNGGIGFPVTNTNQLPEGMTLQKVM  182

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDT  316
            FG++ V D+++TEGHELGS ++G+AQGFY+ASS+DGTS ++A TA F      E+   D+
Sbjct  183  FGTMIVFDDELTEGHELGSGLVGKAQGFYIASSVDGTSQSMAFTAKF-----EENGYVDS  237

Query  315  ISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITHFTVYI  142
            +SFFGVHRT    SH+AIIGGTG Y  A+G+A I+T P    Q  TDGVET+   T Y+
Sbjct  238  LSFFGVHRTQVSESHIAIIGGTGKYLNAEGFAIIKTFPVSGQQQNTDGVETLLQLTAYL  296



>ref|XP_007132117.1| hypothetical protein PHAVU_011G068000g [Phaseolus vulgaris]
 gb|ESW04111.1| hypothetical protein PHAVU_011G068000g [Phaseolus vulgaris]
Length=298

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 153/239 (64%), Gaps = 11/239 (5%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVP-Ln  676
            N    H  LSFFMHDILGGS PS R VTG+V N   N  + F +PN    P NGG+P  N
Sbjct  66   NGVDQHHTLSFFMHDILGGSNPSARAVTGVVTNPALNAQVAFAKPNGANLPFNGGLPQNN  125

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
                ++NNNN PFL GL G   T   + N   NN+V+ G   P     QLP G+ LQ++M
Sbjct  126  NNGGILNNNNLPFLTGLGG---TTGNVFNNNGNNLVNGGIGFPVTNTNQLPEGMTLQKVM  182

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDT  316
            FG++ V D+++TEGHELGS ++G+AQGFY+ASS+DGTS ++A TA F      E+   D+
Sbjct  183  FGTMIVFDDELTEGHELGSGLVGKAQGFYIASSVDGTSQSMAFTAKF-----EENGYVDS  237

Query  315  ISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITHFTVYI  142
            +SFFGVHRT    SH+AIIGGTG Y  A+G+A I+T P    Q  TDGVET+   T Y+
Sbjct  238  LSFFGVHRTQVSESHIAIIGGTGKYLNAEGFAIIKTFPVSGQQQNTDGVETLLQLTAYL  296



>ref|XP_006424739.1| hypothetical protein CICLE_v10030177mg [Citrus clementina]
 gb|ESR37979.1| hypothetical protein CICLE_v10030177mg [Citrus clementina]
Length=797

 Score =   193 bits (491),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 157/236 (67%), Gaps = 10/236 (4%)
 Frame = -1

Query  840  TDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn  664
            T HP L FFMHDILGGS PS R VTGI AN +    + F +PN    P+N GVPLN  NN
Sbjct  569  THHP-LIFFMHDILGGSNPSARAVTGIAANPAVTGQVAFAKPNGANLPLNNGVPLNNNNN  627

Query  663  vinnnNYP-FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGS  487
             + NNN   FL GL+G   T  + QN GNN       N P + GGQ+P+G   Q+LMFG+
Sbjct  628  GLVNNNNVPFLTGLSGT--TAGVAQNNGNNFPNGGFANIPVLNGGQVPAGSTFQKLMFGT  685

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            +TV+D+++TE HELGS ++G+ QGFY+ASS DGTS T+A TA+F           D+ISF
Sbjct  686  LTVIDDELTEDHELGSGLVGKVQGFYVASSEDGTSQTMAFTAMF-----ESGGYADSISF  740

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FGVHRTA   S LAIIGGTG Y  AKGYAT++T P  +QH  DGVET+   TV++T
Sbjct  741  FGVHRTAVSESQLAIIGGTGKYVNAKGYATVKTFPATNQHNIDGVETLLQLTVFLT  796



>ref|XP_009598242.1| PREDICTED: dirigent protein 25-like [Nicotiana tomentosiformis]
Length=389

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 157/234 (67%), Gaps = 9/234 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnv  661
            D    SFFMHDILGGS PS   VTGI  N S +  +PF +PN  +  ++ GVP+N+ NN 
Sbjct  161  DDHIFSFFMHDILGGSNPSAIAVTGIATNPSLSGQVPFAKPNGAVLAVDNGVPVNSNNNG  220

Query  660  innnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            I +NN  PFL GL+G   T  ++QN GNNN++  G   P +   QL SG+  Q+LMFG++
Sbjct  221  IISNNNIPFLTGLSGT--TSNVIQNNGNNNIIGGGSGFPALNMAQLGSGITFQKLMFGTL  278

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TE HEL S ++G+AQGFY+ASS DG S T+A T +F     H     D+++FF
Sbjct  279  TVFDDELTESHELNSGLVGKAQGFYVASSEDGNSQTMAFTVMF-----HSGSYSDSLTFF  333

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            GVHRT    SHLAI+GGTG Y  AKG+AT++T P  +Q  TDGV+T+ H TVY+
Sbjct  334  GVHRTRVSESHLAIMGGTGKYVNAKGFATVKTFPAANQQETDGVQTLLHITVYL  387



>ref|NP_180435.1| protein ENHANCED SUBERIN 1 [Arabidopsis thaliana]
 sp|Q9SIA8.1|DIR10_ARATH RecName: Full=Dirigent protein 10; Short=AtDIR10; AltName: Full=Protein 
ENHANCED SUBERIN 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD24368.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AAO22706.1| putative fibroin protein [Arabidopsis thaliana]
 gb|AAU90058.1| At2g28670 [Arabidopsis thaliana]
 gb|AEC08157.1| protein ENHANCED SUBERIN 1 [Arabidopsis thaliana]
Length=447

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 156/241 (65%), Gaps = 24/241 (10%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinnvinn  652
            L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    P++ GVP  N  N ++NN
Sbjct  218  LVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPVSNGVPSNNNNNGIVNN  277

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFLVGL G     T      NNN  +  +  P  +GGQLPSG  LQ LMFG++TV+D
Sbjct  278  NNVPFLVGLGGT----TANILQNNNNGNNILNGFPVASGGQLPSGSALQMLMFGTMTVID  333

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFFGV R
Sbjct  334  DELTEGHELGSGLLGKAQGYYVASAIDGTSQTMAFTAMF-----ESGGYEDSISFFGVLR  388

Query  291  TATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHFTVYI  142
            TA   SH+ ++GGTG Y  A+G+A ++T           PH     TDG+ET+   TVY+
Sbjct  389  TAVSESHIGVMGGTGKYVNARGFAILKTFTGSSGTQQNQPH---QFTDGLETVVECTVYL  445

Query  141  T  139
            +
Sbjct  446  S  446



>ref|XP_011021115.1| PREDICTED: dirigent protein 25-like [Populus euphratica]
Length=312

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 159/245 (65%), Gaps = 13/245 (5%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            +SAT++NP   H  LSFFMHDILGG+ PS R VTGIV+N + +  +PF +PN    P+N 
Sbjct  78   TSATISNP--GH-TLSFFMHDILGGTNPSARAVTGIVSNPAFSGQVPFAKPNGANLPLNN  134

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
            GVP N+ NN + NNN   L+   G      +  N    N  ++  N P   GG LPSG  
Sbjct  135  GVPQNSNNNGLINNNNLPLLSGLGGTAQPVVQNNG---NNFNNAFNLPLSNGGNLPSGST  191

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            LQ+LMFG+ITV+D+++TEG+ L S+ LG+AQGFY+ASSLDGTS  +A TA+F        
Sbjct  192  LQKLMFGTITVIDDELTEGNNLRSSFLGKAQGFYVASSLDGTSQIMAFTAMF-----QSG  246

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIE-TLPHVDQHTTDGVETITHF  154
               D++SFFGV RT    S LAI+GGTG Y  A+GYA I+  +P  +Q TTDGVET+  F
Sbjct  247  HYADSLSFFGVLRTGVSESQLAIMGGTGKYVNAQGYAIIKINIPSTNQSTTDGVETVLEF  306

Query  153  TVYIT  139
             VY++
Sbjct  307  VVYVS  311



>ref|NP_001154539.1| protein ENHANCED SUBERIN 1 [Arabidopsis thaliana]
 gb|AEC08158.1| protein ENHANCED SUBERIN 1 [Arabidopsis thaliana]
Length=226

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 153/237 (65%), Gaps = 24/237 (10%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-LntinnvinnnNYP  640
            MHDILGGS P+ R VTG+VAN + +  LPF +PN    P++ GVP  N  N ++NNNN P
Sbjct  1    MHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPVSNGVPSNNNNNGIVNNNNVP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
            FLVGL G     T      NNN  +  +  P  +GGQLPSG  LQ LMFG++TV+D+++T
Sbjct  61   FLVGLGG----TTANILQNNNNGNNILNGFPVASGGQLPSGSALQMLMFGTMTVIDDELT  116

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            EGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFFGV RTA  
Sbjct  117  EGHELGSGLLGKAQGYYVASAIDGTSQTMAFTAMF-----ESGGYEDSISFFGVLRTAVS  171

Query  279  ISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHFTVYIT  139
             SH+ ++GGTG Y  A+G+A ++T           PH     TDG+ET+   TVY++
Sbjct  172  ESHIGVMGGTGKYVNARGFAILKTFTGSSGTQQNQPH---QFTDGLETVVECTVYLS  225



>ref|XP_002881003.1| hypothetical protein ARALYDRAFT_481780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57262.1| hypothetical protein ARALYDRAFT_481780 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 156/241 (65%), Gaps = 24/241 (10%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Lntinnvinn  652
            L FFMHDILGGS P+ R VTG+VAN + +  LPF +PN    P++ GVP  N  N ++NN
Sbjct  225  LVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPVSNGVPSNNNNNGIVNN  284

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFLVGL G     T      NNN  +  +  P  +GGQLPSG  LQ LMFG++TV+D
Sbjct  285  NNVPFLVGLGGT----TANILQNNNNGNNILNGFPVASGGQLPSGSALQMLMFGTMTVID  340

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELGS +LG+AQG+Y+AS++DGTS TLA TA+F           D+ISFFGV R
Sbjct  341  DELTEGHELGSGLLGKAQGYYVASAIDGTSQTLAFTAMF-----ESGGYEDSISFFGVLR  395

Query  291  TATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHFTVYI  142
            TA   SH+ ++GGTG Y  A+G+A ++T           PH     TDG+ET+   TVY+
Sbjct  396  TAVSESHIGVMGGTGKYVNARGFAILKTFTGSSGTQQNQPH---QFTDGLETVLECTVYL  452

Query  141  T  139
            +
Sbjct  453  S  453



>emb|CDX77197.1| BnaC04g39920D [Brassica napus]
Length=403

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 158/245 (64%), Gaps = 23/245 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnv  661
            DH  L FF+HDILGGS P+ R VTG+VAN + +  LPF +PN    PI  GV  N  NN 
Sbjct  169  DH-TLVFFIHDILGGSNPTARAVTGVVANPALSGQLPFAKPNGANLPITNGVAANNNNNG  227

Query  660  innnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            I NNN  P LVGL G   T  +LQN GNN   +  +  P   GGQLPSG  LQ LMFG++
Sbjct  228  IVNNNNVPLLVGLGGT--TANILQNNGNNGNNNLLNGLPVANGGQLPSGSALQMLMFGTM  285

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D+++TEGHELGS +LG+AQG+Y+AS++DGTS T+A TA+F           D+ISFF
Sbjct  286  TVIDDELTEGHELGSGLLGKAQGYYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFF  340

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL----------PHVDQHTTDGVETITHF  154
            GVHRTA   SHL ++GGTG Y  A+G+A ++T           PH     TDG+ET+   
Sbjct  341  GVHRTAASESHLGVMGGTGKYVNARGFAIVKTFTGSSGTQQQQPH---QFTDGLETVLQC  397

Query  153  TVYIT  139
            TVY++
Sbjct  398  TVYLS  402



>ref|XP_009344912.1| PREDICTED: dirigent protein 10-like [Pyrus x bretschneideri]
Length=306

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 155/246 (63%), Gaps = 15/246 (6%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPING  691
            S AT+AN   +HP L FFMHDILGGS P+ R +TGIV N   N  +PF +PN  + P N 
Sbjct  67   SIATIAN-AAEHPTLIFFMHDILGGSNPTARAMTGIVNNPAVNGQVPFAKPNGAVLPFNN  125

Query  690  GVPLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PSG  517
            GVP N  NN + NNN  PFL GL+G         N       +   N     GGQL P  
Sbjct  126  GVPQNNNNNGLINNNNIPFLAGLSGTTPNVGQNNNGNGGGFGNFPIN-----GGQLLPGP  180

Query  516  LNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdh  337
              LQ LMFG+++V D+++TEGHELGS ++G+AQGFY+ SS DGTS T+A TA+F      
Sbjct  181  SALQNLMFGTMSVFDDELTEGHELGSGLVGKAQGFYIVSSEDGTSQTMAFTAMF-----Q  235

Query  336  ehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITH  157
                 D++SFFGVH+T+   SHLA++GGTG Y  AKG+A ++T P  +Q  TDG ET+  
Sbjct  236  SGSYTDSLSFFGVHQTSVSESHLAVMGGTGKYVNAKGFALVKTFPASNQQ-TDGAETLLQ  294

Query  156  FTVYIT  139
            FTVYIT
Sbjct  295  FTVYIT  300



>ref|XP_009785872.1| PREDICTED: dirigent protein 25 [Nicotiana sylvestris]
Length=407

 Score =   183 bits (464),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 153/234 (65%), Gaps = 10/234 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnv  661
            D    SFFMHDILGGS PS   VTGI  N S +  +PF +PN  +  ++ GVP+N+ NN 
Sbjct  180  DDHIFSFFMHDILGGSNPSAIAVTGIATNPSLSGQVPFAKPNGAVLAVDNGVPVNSNNNG  239

Query  660  innnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            I +NN  PFL GL+G   T + +     NN++  G   P +   QL SG+  Q+LMFG++
Sbjct  240  IISNNNIPFLTGLSG---TASNVVQNNGNNIIGGGSGFPALNMAQLGSGITFQKLMFGTL  296

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TE HEL S ++G+AQGFY+ASS DG S T+A T +F     H     D+++FF
Sbjct  297  TVFDDELTESHELNSGLVGKAQGFYVASSEDGNSQTMAFTVMF-----HSGSYSDSLTFF  351

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            GVHRT    SHLAI+GGTG Y  AKG+AT++T P  +Q  TDGV+T+ H TVY+
Sbjct  352  GVHRTRVSESHLAIMGGTGKYVNAKGFATVKTFPAANQQETDGVQTLLHITVYL  405



>ref|XP_004241252.1| PREDICTED: dirigent protein 25-like isoform X2 [Solanum lycopersicum]
Length=328

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 154/235 (66%), Gaps = 11/235 (5%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            D    SFF+HDILGGS PS   VTG+V N + +  +PF +PN  +  ++ GVP N  N+ 
Sbjct  100  DDHTFSFFLHDILGGSNPSAIAVTGVVTNPAVSGQVPFAKPNGAVLAVDNGVPTNNANSG  159

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +I+NNN PFL GL+G   T +   N  NN ++  G+  P +   QL SG+N Q+LMFG++
Sbjct  160  IISNNNIPFLTGLSG---TTSNFINQNNNGIIGGGNGLPAINLQQLGSGINFQKLMFGTL  216

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHEL S ++G+AQGFY+ASS DG S T+A T +F           D++SFF
Sbjct  217  TVFDDELTEGHELNSGLIGKAQGFYVASSEDGLSQTMAFTVMF-----KSGSYADSLSFF  271

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQ-HTTDGVETITHFTVYI  142
            GVHR     SHLA++ GTG Y  AKG+AT++T P  +Q   TDGVET+ H TVY+
Sbjct  272  GVHRMGVSESHLAVMAGTGKYVNAKGFATVKTFPATNQLQETDGVETVLHITVYL  326



>ref|XP_010322375.1| PREDICTED: dirigent protein 25-like isoform X1 [Solanum lycopersicum]
Length=329

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 154/235 (66%), Gaps = 11/235 (5%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            D    SFF+HDILGGS PS   VTG+V N + +  +PF +PN  +  ++ GVP N  N+ 
Sbjct  101  DDHTFSFFLHDILGGSNPSAIAVTGVVTNPAVSGQVPFAKPNGAVLAVDNGVPTNNANSG  160

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +I+NNN PFL GL+G   T +   N  NN ++  G+  P +   QL SG+N Q+LMFG++
Sbjct  161  IISNNNIPFLTGLSG---TTSNFINQNNNGIIGGGNGLPAINLQQLGSGINFQKLMFGTL  217

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHEL S ++G+AQGFY+ASS DG S T+A T +F           D++SFF
Sbjct  218  TVFDDELTEGHELNSGLIGKAQGFYVASSEDGLSQTMAFTVMF-----KSGSYADSLSFF  272

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQ-HTTDGVETITHFTVYI  142
            GVHR     SHLA++ GTG Y  AKG+AT++T P  +Q   TDGVET+ H TVY+
Sbjct  273  GVHRMGVSESHLAVMAGTGKYVNAKGFATVKTFPATNQLQETDGVETVLHITVYL  327



>ref|XP_010470056.1| PREDICTED: dirigent protein 10-like [Camelina sativa]
Length=397

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 158/243 (65%), Gaps = 26/243 (11%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPL-ntinnvinn  652
            L FFMHDILGGS P+ R VTG+VAN + +  LPF + N     +N GVP  N  N ++NN
Sbjct  166  LVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKTNGANLAVNNGVPSDNNNNGIVNN  225

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFLVGL G   T  +LQ  GN N   +G +    +GGQLPSG  LQ LMFG++TV+D
Sbjct  226  NNVPFLVGLGGT--TANILQANGNGNNNINGFS--VASGGQLPSGSALQMLMFGTMTVID  281

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELGS +LG+AQG+Y+AS++DGTS TLA TA+F           D+ISFFGV R
Sbjct  282  DELTEGHELGSGLLGKAQGYYVASAVDGTSQTLAFTAMF-----ESGGYEDSISFFGVLR  336

Query  291  TATPISHLAIIGGTGTYETAKGYATIET------------LPHVDQHTTDGVETITHFTV  148
            TA   SHL ++GGTG Y  A+G+A ++T            LPH     TDG+ET+   TV
Sbjct  337  TAVSESHLGVMGGTGKYVNARGFAIVKTFTGSSGSGTQQNLPH---QFTDGLETVLQCTV  393

Query  147  YIT  139
            Y++
Sbjct  394  YLS  396



>gb|EYU36248.1| hypothetical protein MIMGU_mgv1a022936mg, partial [Erythranthe 
guttata]
Length=694

 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 151/238 (63%), Gaps = 10/238 (4%)
 Frame = -1

Query  849  NPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVP-Ln  676
            NP  D  +L+FFMHDILGGS PS   VTGIVAN +    +PF +PN  + P+N G+P  N
Sbjct  463  NP--DDHSLTFFMHDILGGSHPSAIAVTGIVANPAVGGQVPFAKPNGAVLPVNNGIPTNN  520

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLM  496
                +INNNN PFL GL+G         N  NN +       P +   Q PSG  LQ+LM
Sbjct  521  ANGGIINNNNIPFLTGLSGYTSNIGQNNNGNNNIIGGM-PGFPVLNSAQFPSGTTLQKLM  579

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDT  316
            FG++TV D+++TEGHELGS ++G+AQGFY++SS DGTS T+A T +F           D+
Sbjct  580  FGTMTVFDDELTEGHELGSGLVGKAQGFYISSSEDGTSQTMAFTVMF-----ASGGYADS  634

Query  315  ISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            +SFFGV RTA   SHLAI+GGTG Y  AKG AT +     +QH TDG+ET+   T+++
Sbjct  635  LSFFGVLRTAAGESHLAIMGGTGKYVGAKGLATAKVFTGANQHETDGMETLLQITLFL  692



>ref|XP_006350901.1| PREDICTED: dirigent protein 25-like [Solanum tuberosum]
Length=351

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 154/235 (66%), Gaps = 11/235 (5%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            D    SFF+HDILGGS PS   VTGIV N + +  +PF +PN  +  ++ GVP N  N+ 
Sbjct  123  DDHTFSFFLHDILGGSNPSAIAVTGIVTNPAVSGQVPFAKPNGAVLAVDNGVPTNNANSG  182

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +I+NNN PFL GL+G   T +   N  NN ++  G+  P +   QL SG++ Q+LMFG++
Sbjct  183  IISNNNIPFLTGLSG---TTSNFINQNNNGIIGGGNGLPAINLQQLGSGISFQKLMFGTL  239

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHEL S ++G+AQGFY+ASS DG S T+A T +F           D++SFF
Sbjct  240  TVFDDELTEGHELNSGLIGKAQGFYVASSEDGLSQTMAFTVMF-----KSGSYADSLSFF  294

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQ-HTTDGVETITHFTVYI  142
            GVHR     SHLA++ GTG Y  AKG+AT++T P  +Q   TDGVET+ H TVY+
Sbjct  295  GVHRMGVSESHLAVMAGTGKYVNAKGFATVKTFPATNQLQETDGVETVLHITVYL  349



>ref|XP_009769099.1| PREDICTED: dirigent protein 25-like isoform X2 [Nicotiana sylvestris]
Length=319

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 148/235 (63%), Gaps = 10/235 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            D    SFFMHDILGGS PS   VTGIV N + +  +PF +PN  +  ++ GVP N  N+ 
Sbjct  90   DDHTFSFFMHDILGGSNPSAIAVTGIVTNPATSGQVPFAKPNGAVLAVDNGVPTNNANSG  149

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +I+NNN PFL GL+G         N  N      G   P +   QL SG++ Q+LMFG++
Sbjct  150  IISNNNVPFLTGLSGITSNVVNQNNGNNIIGGGYG--LPAINLQQLGSGISFQKLMFGTL  207

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHEL S ++G+AQGFY+ASS DG SHT+A T +F           D++SFF
Sbjct  208  TVFDDELTEGHELNSGLIGKAQGFYVASSEDGLSHTMAFTVMF-----KSGSYADSLSFF  262

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQ-HTTDGVETITHFTVYI  142
            GVHR     SHLA++ GTG Y  AKG+AT++T P  +Q   TDGV+T+   TVY+
Sbjct  263  GVHRMGVSESHLAVMAGTGKYVNAKGFATVKTFPATNQVQETDGVQTVLLITVYL  317



>ref|XP_009769097.1| PREDICTED: dirigent protein 25-like isoform X1 [Nicotiana sylvestris]
Length=320

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 148/235 (63%), Gaps = 10/235 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            D    SFFMHDILGGS PS   VTGIV N + +  +PF +PN  +  ++ GVP N  N+ 
Sbjct  91   DDHTFSFFMHDILGGSNPSAIAVTGIVTNPATSGQVPFAKPNGAVLAVDNGVPTNNANSG  150

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +I+NNN PFL GL+G         N  N      G   P +   QL SG++ Q+LMFG++
Sbjct  151  IISNNNVPFLTGLSGITSNVVNQNNGNNIIGGGYG--LPAINLQQLGSGISFQKLMFGTL  208

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHEL S ++G+AQGFY+ASS DG SHT+A T +F           D++SFF
Sbjct  209  TVFDDELTEGHELNSGLIGKAQGFYVASSEDGLSHTMAFTVMF-----KSGSYADSLSFF  263

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQ-HTTDGVETITHFTVYI  142
            GVHR     SHLA++ GTG Y  AKG+AT++T P  +Q   TDGV+T+   TVY+
Sbjct  264  GVHRMGVSESHLAVMAGTGKYVNAKGFATVKTFPATNQVQETDGVQTVLLITVYL  318



>gb|KDO72989.1| hypothetical protein CISIN_1g039110mg [Citrus sinensis]
Length=299

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 153/234 (65%), Gaps = 10/234 (4%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnvi  658
            HP L FF+HDILGGS PS R VTGIVAN +    + F +PN    P+N GV LN  NN +
Sbjct  73   HP-LIFFLHDILGGSNPSARAVTGIVANPAVTGQVAFAKPNGANLPLNNGVLLNNNNNGL  131

Query  657  nnnNYP-FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             NNN   FL  L+G   T  + QN GNN       N P + GGQ+P+G  LQ+LMFG++T
Sbjct  132  VNNNNVPFLTSLSGT--TAGVAQNNGNNFPNGGFANIPVLNGGQVPAGSTLQKLMFGTLT  189

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V+D++ TE HELGS ++G+ QGFY+ASS DGTS T+A TA+F           D+ISFF 
Sbjct  190  VIDDEQTEDHELGSGLVGKVQGFYVASSEDGTSQTMAFTAMF-----ESGGYADSISFFV  244

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            VHRT    S LAIIGGTG Y  AKGYAT++T P  +QH  DGVET+   TV++T
Sbjct  245  VHRTPVSESQLAIIGGTGKYVNAKGYATVKTFPATNQHNIDGVETLLQLTVFLT  298



>ref|XP_010414493.1| PREDICTED: dirigent protein 10-like [Camelina sativa]
Length=411

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 157/243 (65%), Gaps = 26/243 (11%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPL-ntinnvinn  652
            L FFMHDILGGS P+ R VTG+VAN + +  LPF + N     IN GVP  N  N ++NN
Sbjct  180  LVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKTNGANLAINNGVPSDNNNNGIVNN  239

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFLVGL G   T  +LQ  GN N   +G +    +GGQLPSG  LQ LMFG++TV+D
Sbjct  240  NNVPFLVGLGGT--TANILQANGNGNNNINGFS--VASGGQLPSGSALQMLMFGTMTVID  295

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELGS +LG+AQG+Y+AS++DGTS TLA TA+F           D+ISFFGV R
Sbjct  296  DELTEGHELGSGLLGKAQGYYVASAVDGTSQTLAFTAMF-----ESGGYEDSISFFGVLR  350

Query  291  TATPISHLAIIGGTGTYETAKGYATIETL------------PHVDQHTTDGVETITHFTV  148
            TA   SHL ++GGTG Y  A+G+A ++T             PH     TDG+ET+   TV
Sbjct  351  TAVSESHLGVMGGTGKYVNARGFAIVKTFTGSSGSGTQQNQPH---QFTDGLETVLQCTV  407

Query  147  YIT  139
            Y++
Sbjct  408  YLS  410



>ref|XP_010510592.1| PREDICTED: dirigent protein 10-like [Camelina sativa]
Length=426

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 157/243 (65%), Gaps = 26/243 (11%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPL-ntinnvinn  652
            L FFMHDILGGS P+ R VTG+VAN + +  LPF + N     IN GVP  N  N ++NN
Sbjct  195  LVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKTNGANLAINNGVPSDNNNNGIVNN  254

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFLVGL G   T  +LQ  GN N   +G +    +GGQLPSG  LQ LMFG++TV+D
Sbjct  255  NNVPFLVGLGGT--TANILQENGNGNNNINGFS--VASGGQLPSGSALQMLMFGTMTVID  310

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELGS +LG+AQG+Y+AS++DGTS TLA TA+F           D+ISFFGV R
Sbjct  311  DELTEGHELGSGLLGKAQGYYVASAVDGTSQTLAFTAMF-----ESGGYEDSISFFGVLR  365

Query  291  TATPISHLAIIGGTGTYETAKGYATIETL------------PHVDQHTTDGVETITHFTV  148
            TA   SHL ++GGTG Y  A+G+A ++T             PH     TDG+ET+   TV
Sbjct  366  TAVSESHLGVMGGTGKYVNARGFAIVKTFTGSSGSGTQQNQPH---QFTDGLETVLQCTV  422

Query  147  YIT  139
            Y++
Sbjct  423  YLS  425



>ref|XP_006296346.1| hypothetical protein CARUB_v10025518mg [Capsella rubella]
 gb|EOA29244.1| hypothetical protein CARUB_v10025518mg [Capsella rubella]
Length=425

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 156/243 (64%), Gaps = 25/243 (10%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPL-ntinnvinn  652
            L FFMHDILGGS P+ R VTG+VAN + +  LPF + N     ++ GVP  +  N ++NN
Sbjct  193  LVFFMHDILGGSNPTARAVTGVVANPALSGQLPFAKTNGANLAVSNGVPSDSNNNGIVNN  252

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFLVGL G   T  +LQ+ GN N           +GGQLPSG  LQ LMFG++TV+D
Sbjct  253  NNVPFLVGLGGT--TANILQDNGNGNNNIVNGFS-VASGGQLPSGSALQMLMFGTMTVID  309

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TEGHELGS +LG+AQG+Y+AS++DGTS TLA TA+F           D+ISFFGV R
Sbjct  310  DELTEGHELGSGLLGKAQGYYVASAVDGTSQTLAFTAMF-----ESGGYEDSISFFGVLR  364

Query  291  TATPISHLAIIGGTGTYETAKGYATIET------------LPHVDQHTTDGVETITHFTV  148
            TA   SHL ++GGTG Y  A+G+A ++T            LPH     TDG+ET+   TV
Sbjct  365  TAVSESHLGVMGGTGKYVNARGFAIVKTFTGSSGSGGPQNLPH---QFTDGLETVLQCTV  421

Query  147  YIT  139
            Y++
Sbjct  422  YLS  424



>gb|EAY72597.1| hypothetical protein OsI_00463 [Oryza sativa Indica Group]
Length=340

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 147/240 (61%), Gaps = 20/240 (8%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNA-NNLPFTQPNDQLFPINGGVPLntinnv  661
            DHP + FFMHDILGG+ PS R+V GIV N+     LPF +PN  + P+N GV + +    
Sbjct  110  DHP-MVFFMHDILGGTNPSARIVAGIVDNTAVTGQLPFARPNGAVLPLNSGVNVKSGAAG  168

Query  660  in-nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
               NNN PFL GL G         +  NNN V      P   GG LP G  LQ+L+FG++
Sbjct  169  AIDNNNIPFLTGLGGATNAAFTSNSNNNNNGV------PVFAGGSLPQGTTLQKLLFGTM  222

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE   LGS  +GRAQGFY+ASS +G S T+A+TA+F      E E  D+ISFF
Sbjct  223  TVVDDELTEAPGLGSPAVGRAQGFYIASSEEGVSQTVAVTAMF-----KEGEFADSISFF  277

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL------PHVDQHTTDGVETITHFTVYI  142
            GVHRTA   SHLA++GGTG +  AKG+A +  +          +H TDGVET+  FTV +
Sbjct  278  GVHRTADSESHLAVVGGTGKFAGAKGFAKVAVVRPGGVAATAAEHETDGVETVLQFTVLL  337



>tpg|DAA53401.1| TPA: hypothetical protein ZEAMMB73_420609 [Zea mays]
Length=362

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 147/236 (62%), Gaps = 15/236 (6%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNA-NNLPFTQPNDQLFPINGGVPLntinnvin-n  652
            + FFMHDILGG+ PS R+V GIV N+     LPF +PN  + P+N GV +N+       N
Sbjct  133  MVFFMHDILGGTNPSARIVAGIVDNAAVTGQLPFARPNGAVLPLNSGVNVNSGAAGAIDN  192

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFL GL G   T+       N N   +G+  P   GG LP G  LQ+L+FG++TVVD
Sbjct  193  NNIPFLTGLGGA--TNAAKSVGSNGNGNGNGNGVPVFAGGSLPQGTTLQKLLFGTMTVVD  250

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TE  ELGSA +GRAQGFY+ASS +G S T+A+TA+F      E    DTISFFGVHR
Sbjct  251  DELTEAPELGSAAVGRAQGFYIASSEEGVSQTVAVTAMF-----KEGGFDDTISFFGVHR  305

Query  291  TATPISHLAIIGGTGTYETAKGYATIETLPHVDQHT------TDGVETITHFTVYI  142
            TA   SHLA++GGTG Y  AKG+A +  +             TDGVE++  FTV++
Sbjct  306  TADSESHLAVVGGTGKYVGAKGFAKVAVVRPGGVAASGALLETDGVESVLQFTVFL  361



>ref|NP_001150958.1| dirigent-like protein precursor [Zea mays]
 gb|ACG41079.1| dirigent-like protein [Zea mays]
Length=361

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 148/240 (62%), Gaps = 17/240 (7%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNA-NNLPFTQPNDQLFPINGGVPLntinnv  661
            D   + FFMHDILGG+ PS R+V GIV N+     LPF +PN  + P+N GV +N+    
Sbjct  130  DGHGMVFFMHDILGGTNPSARIVAGIVDNAAVTGQLPFARPNGAVLPLNSGVNVNSGAAG  189

Query  660  in-nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
               NNN PFL GL G     T    +  +N   +G+  P   GG LP G  LQ+L+FG++
Sbjct  190  AIDNNNIPFLTGLGGA----TNAAKSVGSNGNGNGNGVPVFAGGSLPQGTTLQKLLFGTM  245

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE  ELGSA +GRAQGFY+ASS +G S T+A+TA+F      E    DT+SFF
Sbjct  246  TVVDDELTEAPELGSAAVGRAQGFYIASSEEGVSQTVAVTAMF-----KEGGFDDTVSFF  300

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHT------TDGVETITHFTVYI  142
            GVHRTA   SHLA++GGTG Y  AKG+A +  +             TDGVE++  FTV++
Sbjct  301  GVHRTADSESHLAVVGGTGKYVGAKGFAKVAVVRPGGVAASGALLETDGVESVLQFTVFL  360



>ref|XP_009624598.1| PREDICTED: dirigent protein 25-like isoform X2 [Nicotiana tomentosiformis]
Length=322

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 152/235 (65%), Gaps = 10/235 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            D    SFFMHDILGGS PS   VTGIV N + +  +PF +PN  +  ++ GVP N  N+ 
Sbjct  93   DDNTFSFFMHDILGGSNPSAIAVTGIVTNPATSGQVPFAKPNGAVLAVDNGVPTNNANSG  152

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +I+NNN PFL GL+G   T  ++     NN++  G   P +   QL SG++ Q+LMFG++
Sbjct  153  IISNNNVPFLTGLSGI--TSNVINQNNGNNIIGGGYGLPAINLQQLGSGISFQKLMFGTL  210

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHEL S ++G+AQGFY+ASS DG S T+A T +F           D++SFF
Sbjct  211  TVFDDELTEGHELNSGLIGKAQGFYVASSEDGLSQTMAFTVMF-----KSGSYADSLSFF  265

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQ-HTTDGVETITHFTVYI  142
            GVHR     SHLA++ GTG Y  AKG+AT++T P  +Q   TDGV+T+   TVY+
Sbjct  266  GVHRMGVSESHLAVMAGTGKYVNAKGFATVKTFPATNQIQETDGVQTVLLITVYL  320



>ref|XP_009624597.1| PREDICTED: dirigent protein 25-like isoform X1 [Nicotiana tomentosiformis]
Length=323

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 152/235 (65%), Gaps = 10/235 (4%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-  664
            D    SFFMHDILGGS PS   VTGIV N + +  +PF +PN  +  ++ GVP N  N+ 
Sbjct  94   DDNTFSFFMHDILGGSNPSAIAVTGIVTNPATSGQVPFAKPNGAVLAVDNGVPTNNANSG  153

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +I+NNN PFL GL+G   T  ++     NN++  G   P +   QL SG++ Q+LMFG++
Sbjct  154  IISNNNVPFLTGLSGI--TSNVINQNNGNNIIGGGYGLPAINLQQLGSGISFQKLMFGTL  211

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV D+++TEGHEL S ++G+AQGFY+ASS DG S T+A T +F           D++SFF
Sbjct  212  TVFDDELTEGHELNSGLIGKAQGFYVASSEDGLSQTMAFTVMF-----KSGSYADSLSFF  266

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQ-HTTDGVETITHFTVYI  142
            GVHR     SHLA++ GTG Y  AKG+AT++T P  +Q   TDGV+T+   TVY+
Sbjct  267  GVHRMGVSESHLAVMAGTGKYVNAKGFATVKTFPATNQIQETDGVQTVLLITVYL  321



>ref|XP_002457319.1| hypothetical protein SORBIDRAFT_03g005530 [Sorghum bicolor]
 gb|EES02439.1| hypothetical protein SORBIDRAFT_03g005530 [Sorghum bicolor]
Length=367

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 144/236 (61%), Gaps = 14/236 (6%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNA-NNLPFTQPNDQLFPINGGVPLntinnvin-n  652
            + FFMHDILGG+ PS R+V GIV N+     LPF +PN  + P+N GV +N+       N
Sbjct  137  MVFFMHDILGGTNPSARIVAGIVDNAAVTGQLPFARPNGAVLPLNSGVNVNSGAAGAIDN  196

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
            NN PFL GL G       + +  N N   +    P   GG LP G  LQ+L+FG++TVVD
Sbjct  197  NNIPFLTGLGGATNAAKSISSNSNGNGNGN-SGVPVFAGGSLPQGTTLQKLLFGTMTVVD  255

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            +++TE  ELGSA +GRAQGFY+ASS +G S T+A+TA+F      E    DTISFFGVHR
Sbjct  256  DELTEAPELGSAAVGRAQGFYIASSEEGVSQTVAVTAMF-----KEGGFEDTISFFGVHR  310

Query  291  TATPISHLAIIGGTGTYETAKGYATIE------TLPHVDQHTTDGVETITHFTVYI  142
            T    SHLAI+GGTG Y  AKG+A +        +       TDG+ET+  FTV++
Sbjct  311  TVDSESHLAIVGGTGKYVGAKGFAKVAVVRPGGVVASGALLETDGIETVLQFTVFL  366



>ref|XP_006363356.1| PREDICTED: dirigent protein 25-like [Solanum tuberosum]
Length=219

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 153/226 (68%), Gaps = 11/226 (5%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinn-vinnnNYP  640
            MHDILGGS PS   VTGI  N S +  +PF +PN  +  ++ GVP+N  N+ +I+NNN P
Sbjct  1    MHDILGGSNPSAIAVTGIATNPSLSGQVPFAKPNGAVLAVDNGVPVNNGNSGIISNNNIP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
            FL GL+G   T  ++QN GNN +    +  P +   QL SG+  Q+LMFG++TV D+++T
Sbjct  61   FLTGLSGT--TPNVVQNNGNNIIGGG-NGYPALNMAQLGSGVTFQKLMFGTLTVFDDELT  117

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            EGHEL S ++G++QGFY++SS DG+S T+A T +F     H     D++SFFGVHR    
Sbjct  118  EGHELNSGLVGKSQGFYISSSEDGSSQTMAFTVMF-----HSGSYSDSLSFFGVHRVRVS  172

Query  279  ISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
             SHLAI+GGTG Y  AKG+AT++T P  +Q  TDGVET+ H TVY+
Sbjct  173  ESHLAIMGGTGKYVNAKGFATVKTFPAANQE-TDGVETLLHITVYL  217



>ref|XP_009335912.1| PREDICTED: dirigent protein 10-like [Pyrus x bretschneideri]
Length=218

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 145/229 (63%), Gaps = 16/229 (7%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNANN-LPFTQPNDQLFPINGGVPLntinnvinnnNY-P  640
            MHDILGGS P+ R +TGIV N   N  +PF +PN  + P N GVP N  N  + NNN  P
Sbjct  1    MHDILGGSNPTARAMTGIVNNPAVNGQVPFAKPNGAVLPFNNGVPQNNNNGGLINNNNIP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPF-VTGGQL-PSGLNLQQLMFGSITVVDNQ  466
            FL GL+G         N G N+  + G    F + GGQL P    LQ LMFG+++V D++
Sbjct  61   FLTGLSGTTP------NVGQNSNRNGGGFGNFPINGGQLLPGSSALQNLMFGTMSVFDDE  114

Query  465  ITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTA  286
            +TEGHE  S ++G+AQGFY+ SS DGTS T+A TA+F           DT+SFFGVHRTA
Sbjct  115  LTEGHERSSGLVGKAQGFYVVSSEDGTSQTMAFTAMF-----QSGSYSDTLSFFGVHRTA  169

Query  285  TPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
               SHLAI+GGTG Y  AKG+A ++T P  +Q  TDG ET+  FTVY+T
Sbjct  170  VSESHLAIMGGTGKYVNAKGFALVKTFPASNQQ-TDGAETLLEFTVYVT  217



>gb|KDO72990.1| hypothetical protein CISIN_1g039130mg, partial [Citrus sinensis]
Length=223

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 146/230 (63%), Gaps = 43/230 (19%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnN  646
            LSFFMHDILGG                                   VPL T NN   NNN
Sbjct  35   LSFFMHDILGG-----------------------------------VPLVTANNGFVNNN  59

Query  645  -YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDN  469
              PFL G NG   + T++ N GNNN+V +G+  PFVT GQLP G  LQ  MF +ITV+D+
Sbjct  60   NLPFLGGPNGATAS-TVISNNGNNNLVTNGNTLPFVTAGQLPQGAALQNPMFRAITVIDD  118

Query  468  QITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRT  289
            ++TEGHELG++V+G+AQGFYLASSLDG+S T+A +A+F           DTISFFGVHRT
Sbjct  119  ELTEGHELGASVIGKAQGFYLASSLDGSSQTMAFSAMF------GDHEEDTISFFGVHRT  172

Query  288  ATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            A+  S +A++GGTG YE A+GYA IETL   +QHTTDGVET+  FTVY+T
Sbjct  173  ASHESGIAVVGGTGKYENAEGYANIETLHLTNQHTTDGVETVLQFTVYLT  222



>dbj|BAB64642.1| hypothetical protein [Oryza sativa Japonica Group]
Length=340

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 145/240 (60%), Gaps = 20/240 (8%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNA-NNLPFTQPNDQLFPINGGVPLntinnv  661
            DHP + FFMHDILGG+ PS R+V GIV N+     LPF +PN  + P+N GV + +    
Sbjct  110  DHP-MVFFMHDILGGTNPSARIVAGIVDNTAVTGQLPFARPNGAVLPLNSGVNVKSGAAG  168

Query  660  in-nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
               NNN PFL GL G         +  NNN V      P   GG LP G  LQ+L+FG++
Sbjct  169  AIDNNNIPFLTGLGGATNAAFTSNSNNNNNGV------PVFAGGSLPQGTTLQKLLFGTM  222

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TVVD+++TE   LGS  +GRAQGFY+ASS +G S T+ +TA+F      E E  D+ISFF
Sbjct  223  TVVDDELTEAPGLGSPAVGRAQGFYIASSEEGVSQTVVVTAMF-----KEGEFADSISFF  277

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETL------PHVDQHTTDGVETITHFTVYI  142
            GVHRTA   SHLA++GGTG +   KG+A +  +          +H TDGVET+  FTV +
Sbjct  278  GVHRTADSESHLAVVGGTGKFAGVKGFAKVAVVRPGGVAATAAEHETDGVETVLQFTVLL  337



>ref|XP_003539707.1| PREDICTED: dirigent protein 10-like [Glycine max]
Length=280

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 144/234 (62%), Gaps = 18/234 (8%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnvi  658
            H  LSFFMHDILGGS P+ R VTG+V N   N  + F +PN    P+N GVP N  N  I
Sbjct  60   HHTLSFFMHDILGGSNPTARAVTGVVTNPALNAQVAFAKPNGANLPLNNGVPQNNNNGGI  119

Query  657  nnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             NNN  PFL GL G          T  N   + G   P     QLP+G+ LQ++MFG++T
Sbjct  120  LNNNNLPFLTGLGG----------TTANVFNNGGTGFPVTNTNQLPAGMTLQKVMFGTMT  169

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V D+++T GHE GS ++G+AQGFY+AS++DGTS  +A TA F      E+   D++SFFG
Sbjct  170  VFDDELTHGHEFGSGLVGKAQGFYIASAVDGTSQVMAFTAKF-----EENGYVDSLSFFG  224

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITHFTVYI  142
            VHR     S +AIIGGTG Y  A+GYA I+T P    QH TDGV+T+   T Y+
Sbjct  225  VHRAQVSESQIAIIGGTGKYVNAEGYAIIKTFPLSPQQHNTDGVQTLLQLTAYL  278



>ref|XP_008233549.1| PREDICTED: dirigent protein 25-like [Prunus mume]
Length=286

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/235 (50%), Positives = 149/235 (63%), Gaps = 14/235 (6%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnv  661
            D   L FFMHDILGGS P+ + +TGIV +  AN  LPF +PN  + P N GVP N  NN 
Sbjct  63   DQHTLIFFMHDILGGSNPTAQAMTGIVNSPAANGQLPFAKPNGAVLPFNNGVPQNNNNNG  122

Query  660  innnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            + NNN  PFL GL+G         N   NN ++ G     + GGQL  G  LQ LMFG++
Sbjct  123  LINNNNIPFLTGLSGTTS------NVAQNNGINGGFGNFPINGGQLQPGSVLQNLMFGTM  176

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            +V D+++TEGHEL S ++G+AQGF + SS DGTS T+  TA+F           D++SFF
Sbjct  177  SVFDDELTEGHELSSGLVGKAQGFNVVSSEDGTSQTMGFTAMF-----ESGSYADSLSFF  231

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            GVHRTA   SHLAI+GGTG Y  AKG+A ++T P  +Q  TDG ET+  FTVY+T
Sbjct  232  GVHRTAVSESHLAIMGGTGKYVNAKGFAMVKTFPASNQQ-TDGAETLLQFTVYLT  285



>ref|XP_006850693.1| hypothetical protein AMTR_s00034p00239800 [Amborella trichopoda]
 gb|ERN12274.1| hypothetical protein AMTR_s00034p00239800 [Amborella trichopoda]
Length=311

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 146/239 (61%), Gaps = 23/239 (10%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQ-----PNDQLFPINGGVP-Ln  676
            D+P L+FFMHDILGG+ PS + VTGIV NS    +PF +     P++   P +  +P L 
Sbjct  88   DNP-LTFFMHDILGGANPSAKPVTGIVTNSVNGQIPFAKITGVLPSNGANPFSNSIPTLT  146

Query  675  tinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGG-QLPSGLNLQQL  499
              N    N   P + GL G       +   GNN    SG + P +TG  QL  G NL  +
Sbjct  147  NSNGNNMNGVIPVVTGLGGT------IGQVGNN---PSG-SVPILTGSNQLSVGTNLLGV  196

Query  498  MFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgD  319
             FG+IT++D+++TEGHELGSAV+G+AQGFY+ASS DG S  +ALT L            D
Sbjct  197  EFGTITIIDDELTEGHELGSAVVGKAQGFYVASSEDGNSQMMALTVLM-----EIGGYED  251

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            ++SFFG+HR A   SH+A+IGGTG Y+ A GYA + TLP    + TDG+ET+  FTVY+
Sbjct  252  SLSFFGIHRAAVHESHIAVIGGTGKYKGANGYAIVRTLPPTVGNNTDGMETLLEFTVYL  310



>gb|AFK49581.1| unknown [Lotus japonicus]
Length=305

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 146/235 (62%), Gaps = 14/235 (6%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnvi  658
            H  LSFFMHDILGGS P+ R VTG+V N   N  + F +PN    P+N GVP N  N  I
Sbjct  80   HHTLSFFMHDILGGSNPTARAVTGVVTNPAVNAQVAFAKPNGANLPLNNGVPQNNNNAGI  139

Query  657  nnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             NNN  PF+ GL+G         N   N    S  N        LP+GL LQ+LMFG++T
Sbjct  140  LNNNDLPFITGLSGTTGNVFNNNNNNGNGNGFSVTNP-----NNLPAGLTLQKLMFGTMT  194

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V D+++TEGHELGS ++G+AQGFY+ASS+DGTS  +A TA F      E+   D++SFFG
Sbjct  195  VFDDELTEGHELGSGMVGKAQGFYIASSVDGTSQVMAFTAKF-----EENGYVDSLSFFG  249

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVD--QHTTDGVETITHFTVYI  142
            VH T    S LAIIGGTG Y  A+G+A I+T P  +  QH TDG+ET+   T Y+
Sbjct  250  VHGTQVSESQLAIIGGTGKYVNAEGFAIIKTFPVTNDQQHHTDGLETLLQLTAYL  304



>emb|CDX93623.1| BnaA06g04250D [Brassica napus]
Length=409

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 147/223 (66%), Gaps = 19/223 (9%)
 Frame = -1

Query  783  SGRVVTGIVAN-SNANNLPFTQPNDQLFPINGGVPLntinnvinnnN-YPFLVGLNGQQQ  610
            S R VTG+VAN + +  LPF +PN    P+N GVP N  NN I  NN  P L+GL G   
Sbjct  197  SARAVTGVVANPALSGPLPFAKPNGANLPVNNGVPSNNNNNGILTNNNVPLLIGLGGT--  254

Query  609  TDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVL  430
            T ++LQ+ GNN +    +  P   GGQLPSG +LQ LMFG++TV+DN++TEGHELGS +L
Sbjct  255  TSSILQSDGNNLL----NGLPVANGGQLPSGSSLQMLMFGTMTVMDNELTEGHELGSGLL  310

Query  429  GRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATPISHLAIIGGT  250
            G+AQGFY+AS++DGTS T+A TA+F           D+ISFFGVHRTA   SHL ++GGT
Sbjct  311  GKAQGFYVASAVDGTSQTMAFTAMF-----ESGGYEDSISFFGVHRTAASESHLGVMGGT  365

Query  249  GTYETAKGYATIETLPHVDQHT------TDGVETITHFTVYIT  139
            G Y  A+GYA ++T      +T      TDG+ET+   TVY++
Sbjct  366  GKYVNARGYAIVKTFTGGTGNTQQPHQFTDGLETVLECTVYLS  408



>ref|XP_003538024.1| PREDICTED: dirigent protein 10-like [Glycine max]
 ref|XP_003538025.1| PREDICTED: dirigent protein 10-like [Glycine max]
Length=302

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 148/244 (61%), Gaps = 14/244 (6%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGV  685
            A V      H  LSFFMHDILGGS P+ R VTG+V N   N  + F +PN    P+N GV
Sbjct  67   AEVKGVDQQHHTLSFFMHDILGGSNPTARAVTGVVTNPALNAQVAFAKPNGANLPLNNGV  126

Query  684  PLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            P N  N  I NNN  PFL GL G   T   + N  N     +G   P     QLP G+ L
Sbjct  127  PQNNNNGGILNNNNLPFLTGLGG---TTASVFNNNNLLNGGAGF--PVTNTNQLPEGMTL  181

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            Q++MFG++TV D+++TEG ELGS ++G+AQGFY+AS++DG S  +A TA F      E+ 
Sbjct  182  QKVMFGTMTVFDDELTEGQELGSGLVGKAQGFYIASAVDGASQLMAFTAKF-----EENG  236

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV--DQHTTDGVETITHF  154
              D++SFFGVH T    S +AI+GGTG +  A+G+A I+T P +   QH TDGV+T+   
Sbjct  237  YVDSLSFFGVHLTQVSESQIAIVGGTGKFLNAEGFAIIKTFPVIGGQQHNTDGVQTLLQL  296

Query  153  TVYI  142
            T Y+
Sbjct  297  TAYL  300



>gb|KEH30098.1| disease resistance-responsive, dirigent domain protein [Medicago 
truncatula]
Length=303

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 148/236 (63%), Gaps = 16/236 (7%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnvi  658
            H  LSFFMHDILGGS P+ R VTG+V N   N  + F +PN    P+N GVP N  NN I
Sbjct  79   HHTLSFFMHDILGGSNPTARAVTGVVTNPALNAQVAFAKPNGANLPLNNGVPQNNNNNGI  138

Query  657  nnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             NNN  PFL GL+G         N GNNN        P     Q+P G  +Q+LMFG++T
Sbjct  139  LNNNNLPFLTGLSGNTGNVFNNNNNGNNNF-------PVTNMNQIPQGTTVQELMFGTMT  191

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V D+++TEG ELGS ++G+AQGFY+ASS +GTS  +A TA F      E+   D++SFFG
Sbjct  192  VFDDELTEGEELGSGLVGKAQGFYIASSTEGTSQVMAFTAKF-----EENGYEDSLSFFG  246

Query  300  VHRTA-TPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITHFTVYIT  139
            VHRT     S LAIIGGTG Y  A G+A I+T P +  QH TDG+ET+ H T Y++
Sbjct  247  VHRTTQVSQSQLAIIGGTGKYVNANGFAIIKTFPVNGQQHNTDGLETLLHLTAYLS  302



>ref|NP_001236972.1| uncharacterized protein LOC100500624 precursor [Glycine max]
 gb|ACU15750.1| unknown [Glycine max]
Length=212

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 121/201 (60%), Gaps = 23/201 (11%)
 Frame = -1

Query  831  PALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinn  652
            P ++FFMHDI+GGS PS R+V G + N+  N+LPF++PN+++ P  G +PL   +     
Sbjct  32   PTITFFMHDIIGGSTPSERIVAGTIVNTQTNHLPFSKPNNRVLPFKGAIPLVDTSTGS--  89

Query  651  nNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVD  472
                   G N      T+++N   N VV        +    L  G   +  +FG ITV+D
Sbjct  90   -------GTNPTHTGTTVIKNIDKNKVV--------INKNSLGLGATPENFLFGRITVID  134

Query  471  NQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHR  292
            ++IT+G ELGS V+G+AQGF+LASSLDG+S T+A TALF        +  D ISFFGV R
Sbjct  135  DKITKGLELGSEVIGKAQGFHLASSLDGSSKTMAFTALF------HDDGEDAISFFGVQR  188

Query  291  TATPISHLAIIGGTGTYETAK  229
            TA   SH+A++GGTG Y  AK
Sbjct  189  TAAHESHIAVVGGTGKYINAK  209



>gb|KEH30094.1| disease resistance-responsive, dirigent domain protein [Medicago 
truncatula]
Length=304

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 149/236 (63%), Gaps = 17/236 (7%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnvi  658
            H  LSFFMHDILGGS P+ R VTG+V N   N  + F +PN    P+N GVP N  NN I
Sbjct  81   HHTLSFFMHDILGGSNPTARAVTGVVTNPALNAQVAFAKPNGANLPLNNGVPQNNNNNGI  140

Query  657  nnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             NNN  PFL GL+G              N  ++G+N P     Q+P G  +Q+LMFG++T
Sbjct  141  LNNNNLPFLTGLSGNTGNVF--------NNNNNGNNFPVTNMNQIPQGTTVQELMFGTMT  192

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V D+++TEG ELGS ++G+AQGFY+ASS +GTS  +A TA F      E+   D++SFFG
Sbjct  193  VFDDELTEGEELGSGLVGKAQGFYIASSTEGTSQVMAFTAKF-----EENGYEDSLSFFG  247

Query  300  VHRTA-TPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITHFTVYIT  139
            VHRT     S LAIIGGTG Y  A G+A I+T P +  QH TDG+ET+ H T Y++
Sbjct  248  VHRTTQVSQSQLAIIGGTGKYVNANGFAIIKTFPVNGQQHNTDGLETLLHLTAYLS  303



>emb|CAN80345.1| hypothetical protein VITISV_003133 [Vitis vinifera]
Length=1051

 Score =   168 bits (426),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 143/234 (61%), Gaps = 25/234 (11%)
 Frame = -1

Query  834   HPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLnt-innv  661
             H  LSFFMHDILGGS PS   VTGIV N   N  +PF +PN  + P+  GVPLN   + +
Sbjct  840   HHTLSFFMHDILGGSNPSAGAVTGIVTNPAVNGQVPFAKPNGAVLPVKNGVPLNNGNSAL  899

Query  660   innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             INNNN PFL GL+G   T  ++QN GNN +       P   GGQ P+G NLQ+LMFG++T
Sbjct  900   INNNNIPFLTGLSGN--TANVIQNNGNNVINGG-SGLPVFNGGQFPAGTNLQKLMFGTMT  956

Query  480   VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
             V+D+++TEGH+ G    GR               T+A TA+F  +         ++SFFG
Sbjct  957   VIDDELTEGHDRGFG-FGR--------------QTMAFTAMFESDGYAS-----SLSFFG  996

Query  300   VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
             VHRTA   S LAI+GGTG Y  A+GYAT++T+P  +QH TDG ET+    VY+ 
Sbjct  997   VHRTAVSESQLAIMGGTGKYVNAEGYATVKTIPGANQHNTDGTETLLQIIVYLA  1050



>gb|KHN22000.1| Disease resistance response protein 206 [Glycine soja]
Length=302

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 147/244 (60%), Gaps = 14/244 (6%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGV  685
            A V      H  LSFFMHDILGGS P+ R VTG+V N   N  + F +PN    P+N GV
Sbjct  67   AEVKGVDQQHHTLSFFMHDILGGSNPTARAVTGVVTNPALNAQVAFAKPNGANLPLNNGV  126

Query  684  PLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            P N  N  I NNN  PFL GL G   T   + N  N     +G   P     QLP G+ L
Sbjct  127  PQNNNNGGILNNNNLPFLTGLGG---TTASVFNNNNLLNGGAGF--PVTNTNQLPEGMTL  181

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
            Q++MFG++TV D+++TEG ELGS ++G+AQGFY+AS++DG S  +A TA F      E+ 
Sbjct  182  QKVMFGTMTVFDDELTEGQELGSGLVGKAQGFYIASAVDGASQLMAFTAKF-----EENG  236

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV--DQHTTDGVETITHF  154
              D++SFFGVH T    S +AI+GGTG +  A+G+A I+T P     QH TDGV+T+   
Sbjct  237  YVDSLSFFGVHLTQVSESQIAIVGGTGKFLNAEGFAIIKTFPVSGGQQHNTDGVQTLLQL  296

Query  153  TVYI  142
            T Y+
Sbjct  297  TAYL  300



>ref|XP_004505900.1| PREDICTED: mitochondrial substrate carrier family protein Y-like 
[Cicer arietinum]
Length=294

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 149/247 (60%), Gaps = 26/247 (11%)
 Frame = -1

Query  864  SATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGG  688
            +AT ++    H  LSFFMHDILGGS P+ R VTG+V N   N  + F +PN    P+N G
Sbjct  66   AATTSDIPEQHHTLSFFMHDILGGSNPTARAVTGVVTNPALNAQVAFAKPNGANIPLNNG  125

Query  687  VPLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGN---NNVVDSGDNQPFVTGGQLPS  520
            +  N  NN + NNN  PFL GL+G         NTG+   NN  ++G+  P     Q+P 
Sbjct  126  ISQNNNNNGVLNNNNLPFLTGLSG---------NTGSVFNNNNGNNGNGFPLTNMNQVPQ  176

Query  519  GLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehd  340
            G  +Q+LMFG++TV D++ITEG ELGS       GFY+ASS+DG S  +  TA F     
Sbjct  177  GTTVQKLMFGTMTVFDDEITEGEELGSG------GFYIASSVDGISQVMGFTAKF-----  225

Query  339  hehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHV-DQHTTDGVETI  163
             E+   D++SFFGVHRT    S +AIIGGTG Y  AKG+A I+T P    QH TDG+ET+
Sbjct  226  EENGYADSLSFFGVHRTQVSQSQIAIIGGTGKYVNAKGFAIIKTFPVTGQQHNTDGLETL  285

Query  162  THFTVYI  142
             H T Y+
Sbjct  286  LHLTAYL  292



>ref|XP_004161978.1| PREDICTED: uncharacterized protein LOC101227210 [Cucumis sativus]
Length=242

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = -1

Query  567  DSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDG  388
            ++ +NQPFVT GQ+PS   LQ +MFGSIT +D+++TEG ELGS V+GR QGFY  SSLDG
Sbjct  97   NNKNNQPFVTAGQVPSAAVLQHVMFGSITTIDDELTEGEELGSGVMGRGQGFYFISSLDG  156

Query  387  TSHTLALTA-LFhgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIE  211
            +SHT+ALT  L   + + E +  DTISFFGVHR  +  S +A++GGTG YE A G+A IE
Sbjct  157  SSHTVALTVILHRYDENEEKKDEDTISFFGVHRRGSMESPIAVVGGTGKYENASGFAVIE  216

Query  210  TLPHVD-QHTTDGVETITHFTVYIT  139
             L   + Q+ TDG +TI HF VY++
Sbjct  217  NLRRRENQYMTDGDDTIVHFRVYLS  241



>ref|XP_008224164.1| PREDICTED: dirigent protein 25-like [Prunus mume]
Length=277

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 138/204 (68%), Gaps = 9/204 (4%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPING  691
            +SATV+N    HP L+FF+HDI+GGS PS   VTGIV N   N  +PF +PN  + PI  
Sbjct  62   TSATVSNSEAYHP-LTFFLHDIIGGSNPSATAVTGIVTNPAVNGQVPFAKPNGAVVPIGN  120

Query  690  GVPLntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            G+P N  NN I NNN  PF  GL G   ++ L+QN GNNN +  G+  P++ G QLP G+
Sbjct  121  GIPQNNNNNGIINNNNVPFFTGLGGNTASN-LIQNNGNNNNIIGGNGLPYLNGAQLPPGI  179

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             LQ+LMFG++TV D+++TEGHELGS +LG+AQGFY+ASS DG+S T+A TA+F       
Sbjct  180  TLQKLMFGTLTVFDDELTEGHELGSGLLGKAQGFYVASSEDGSSQTIAFTAMF-----QS  234

Query  333  helgDTISFFGVHRTATPISHLAI  262
                D+++FFGVH  A   SHLAI
Sbjct  235  GGYADSLTFFGVHLVAASESHLAI  258



>gb|KHN21997.1| Disease resistance response protein 206 [Glycine soja]
Length=220

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 140/228 (61%), Gaps = 14/228 (6%)
 Frame = -1

Query  813  MHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinnvinnnNY-P  640
            MHDILGGS P+ R VTG+V N   N  + F +PN    P+N GVP N  N  I NNN  P
Sbjct  1    MHDILGGSNPTARAVTGVVTNPALNAQVAFAKPNGANLPLNNGVPQNNNNGGILNNNNLP  60

Query  639  FLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQIT  460
            FL GL G   T   + N  N     +G   P     QLP G+ LQ++MFG++TV D+++T
Sbjct  61   FLTGLGG---TTASVFNNNNLLNGGAGF--PVTNTNQLPEGMTLQKVMFGTMTVFDDELT  115

Query  459  EGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVHRTATP  280
            EG ELGS ++G+AQGFY+AS++DG S  +A TA F      E+   D++SFFGVH T   
Sbjct  116  EGQELGSGLVGKAQGFYIASAVDGASQLMAFTAKF-----EENGYVDSLSFFGVHLTQVS  170

Query  279  ISHLAIIGGTGTYETAKGYATIETLP--HVDQHTTDGVETITHFTVYI  142
             S +AI+GGTG +  A+G+A I+T P     QH TDGV+T+   T Y+
Sbjct  171  ESQIAIVGGTGKFLNAEGFAIIKTFPVSGGQQHNTDGVQTLLQLTAYL  218



>emb|CBI33170.3| unnamed protein product [Vitis vinifera]
Length=997

 Score =   155 bits (393),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 139/236 (59%), Gaps = 52/236 (22%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLntinn-  664
            DHP LSFFMHDILGGS PS R VTGIV N   N  +PF +PN  L P+N GVPLN+ N+ 
Sbjct  810  DHP-LSFFMHDILGGSNPSARAVTGIVTNPAVNGQVPFAKPNGALLPVNNGVPLNSGNSG  868

Query  663  vinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSI  484
            +INNNN PFL GL+G   T T++ N GNN      +  P   GGQ  +G +LQ+LMFG++
Sbjct  869  LINNNNIPFLTGLSGI--TPTVIPNNGNNLFNGG-NGLPVGNGGQYLAGSSLQKLMFGTM  925

Query  483  TVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFF  304
            TV+D++ITEGHELGS  +G+AQGFY+ASS DGTS T+A TA+F                 
Sbjct  926  TVIDDEITEGHELGSGSVGKAQGFYVASSEDGTSQTMAFTAMFQ----------------  969

Query  303  GVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQH-TTDGVETITHFTVYIT  139
                                         I+T+P   Q  TTDGVET+  FTVY+T
Sbjct  970  -----------------------------IKTIPPTHQQATTDGVETLLEFTVYVT  996



>ref|XP_006645512.1| PREDICTED: dirigent protein 10-like [Oryza brachyantha]
Length=247

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 14/201 (7%)
 Frame = -1

Query  738  NLPFTQPNDQLFPINGGVPLntinnvinnnN-YPFLVGLNGQQQTDTLLQNTGNNNVVDS  562
            + P    N  + P+N GV +N+      +NN  PFL GL G     T   N  NN V   
Sbjct  56   DAPVAAANGAVLPLNSGVSVNSGAAGAIDNNNIPFLTGLGGATNAVTSNNNNNNNGV---  112

Query  561  GDNQPFVTGGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTS  382
                P   GG LP G  LQ+L+FG++TVVD+++TE  ELGSA +GRAQGFY+ SS +G S
Sbjct  113  ----PVFAGGSLPQGTTLQKLLFGTMTVVDDELTEAPELGSAAVGRAQGFYIDSSEEGVS  168

Query  381  HTLALTALFhgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETL-  205
             T+A+T +F      + E  D+ISFFGVHRTA   SHLAI+GGTG Y  AKG+A +  + 
Sbjct  169  QTVAVTTMF-----KDGEFADSISFFGVHRTADSESHLAIVGGTGKYVGAKGFAKVAVVR  223

Query  204  PHVDQHTTDGVETITHFTVYI  142
            P    H TDGVET+  FTV++
Sbjct  224  PGGAAHETDGVETVLQFTVFL  244



>ref|XP_009769482.1| PREDICTED: dirigent protein 24-like [Nicotiana sylvestris]
Length=106

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (89%), Gaps = 2/96 (2%)
 Frame = -1

Query  498  MFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgD  319
            MFGSITVVDN+ITEGHELGSAVLG+AQGFYL SS DGTSHTLALTALF    +H+HE+ D
Sbjct  1    MFGSITVVDNEITEGHELGSAVLGKAQGFYLTSSSDGTSHTLALTALF--HGEHDHEVED  58

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIE  211
            TISFF +HRTATPISH+ IIGGTG YE AKGYATIE
Sbjct  59   TISFFVIHRTATPISHITIIGGTGKYENAKGYATIE  94



>emb|CDP08987.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   150 bits (378),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 137/245 (56%), Gaps = 52/245 (21%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVAN-SNANNLPFTQPNDQLFPING  691
            +S+ V   + DH  L+FFMHDILGGS PS   VTG+V N +    +PF +PN  + P+N 
Sbjct  493  ASSGVGAESPDH-MLTFFMHDILGGSTPSAIAVTGVVTNPAVGGQVPFAKPNGAVLPVNN  551

Query  690  GVPLntinnvinnnNY-PFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGL  514
            G+P+N  N+ I NNN  PFL GL+G      L+Q  GN+ ++  G   P +   Q P+G 
Sbjct  552  GIPVNNANSGIINNNNIPFLTGLSGT--APNLVQQNGNS-IIGGGFGFPALNPAQFPTGT  608

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
              Q LMFG++TV D+++TEGHELGS ++G+AQGFY+ASS DGTS T+A T          
Sbjct  609  TFQSLMFGTMTVFDDELTEGHELGSGLVGKAQGFYIASSEDGTSQTMAFT----------  658

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLP-HVDQHTTDGVETITH  157
                                               G AT++T P +++QH+TDGVET+  
Sbjct  659  -----------------------------------GLATVKTFPANLNQHSTDGVETVLE  683

Query  156  FTVYI  142
             TVY+
Sbjct  684  ITVYL  688



>gb|EMS55918.1| hypothetical protein TRIUR3_12732 [Triticum urartu]
Length=282

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 129/234 (55%), Gaps = 42/234 (18%)
 Frame = -1

Query  837  DHPALSFFMHDILG-GSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnv  661
            D P L+FFMHDILG  SQ S  +VTG+VA++           D L   N  VP       
Sbjct  90   DSP-LTFFMHDILGTSSQTSALMVTGVVASA-----------DGLASGNNVVP-------  130

Query  660  innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
                 Y  LV  NG         N G  N + S +      GG  P     Q L+ G  T
Sbjct  131  -----YDSLVQSNGNA------VNGGYKNTIPSVNGS---GGGDTP---QTQNLLLGMTT  173

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            VVD ++  GHELG+A +GRAQGFY+ASS DG+S T+ LTA+F          GDT+SFFG
Sbjct  174  VVDEELAGGHELGAAAVGRAQGFYVASSQDGSSKTVVLTAMF-----GGEVHGDTLSFFG  228

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            VH+ A P S +A+IGGTG YETAKG+A I TL   DQH  DGVE +  F ++++
Sbjct  229  VHQLAAPESRIAVIGGTGKYETAKGFAAIRTLHPGDQHAADGVEGLLQFDIHLS  282



>gb|EAZ10599.1| hypothetical protein OsJ_00431 [Oryza sativa Japonica Group]
Length=310

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 121/205 (59%), Gaps = 18/205 (9%)
 Frame = -1

Query  735  LPFTQPNDQLFPINGGVPLntinnvin-nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSG  559
            LPF +PN  + P+N GV + +       NNN PFL GL G         +  NNN V   
Sbjct  114  LPFARPNGAVLPLNSGVNVKSGAAGAIDNNNIPFLTGLGGATNAAFTSNSNNNNNGV---  170

Query  558  DNQPFVTGGQLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSH  379
               P   GG LP G  LQ+L+FG++TVVD+++TE   LGS  +GRAQGFY+ASS +G S 
Sbjct  171  ---PVFAGGSLPQGTTLQKLLFGTMTVVDDELTEAPGLGSPAVGRAQGFYIASSEEGVSQ  227

Query  378  TLALTALFhgehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETL--  205
            T+ +TA+F      E E  D+ISFFGVHRTA   SHLA++GGTG +   KG+A +  +  
Sbjct  228  TVVVTAMF-----KEGEFADSISFFGVHRTADSESHLAVVGGTGKFAGVKGFAKVAVVRP  282

Query  204  ----PHVDQHTTDGVETITHFTVYI  142
                    +H TDGVET+  FTV +
Sbjct  283  GGVAATAAEHETDGVETVLQFTVLL  307



>emb|CBI16200.3| unnamed protein product [Vitis vinifera]
Length=1093

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 131/233 (56%), Gaps = 50/233 (21%)
 Frame = -1

Query  834   HPALSFFMHDILGGSQPSGRVVTGIVANSNAN-NLPFTQPNDQLFPINGGVPLnt-innv  661
             H  LSFFMHDILGGS PS   VTGIV N   N  +PF +PN  + P+  GVPLN   + +
Sbjct  907   HHTLSFFMHDILGGSNPSAGAVTGIVTNPAVNGQVPFAKPNGAVLPVKNGVPLNNGNSAL  966

Query  660   innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSIT  481
             INNNN PFL GL+G   T  ++QN GNN +       P   GGQ P+G NLQ+LMFG++T
Sbjct  967   INNNNIPFLTGLSGN--TANVIQNNGNNVINGG-SGLPVFNGGQFPAGTNLQKLMFGTMT  1023

Query  480   VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
             V+D+++TEGH+ GS ++G+AQGFY+ASS DG+S T+A TA+F                  
Sbjct  1024  VIDDELTEGHDRGSGLVGKAQGFYVASSEDGSSQTMAFTAMF------------------  1065

Query  300   VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
                                   + GYA+       +QH TDG ET+    VY+
Sbjct  1066  ---------------------ESDGYAS------ANQHNTDGTETLLQIIVYL  1091



>ref|XP_004299214.1| PREDICTED: uncharacterized protein LOC101310995 [Fragaria vesca 
subsp. vesca]
Length=248

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 127/232 (55%), Gaps = 20/232 (9%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvin  655
             P L  +MHDILGGS P+ R +TG++ N     +PF +P     P  GGVP+   N    
Sbjct  36   EPILEMYMHDILGGSNPTARPITGLLGNIYGGQVPFAKPIG-FLPPQGGVPIPNANGA--  92

Query  654  nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVV  475
                P + G+NG      L   T +   +     Q        P GL+L    FG+ITV+
Sbjct  93   ---LPTVNGINGIPLGTGLSGTTFSGKPIGQAQTQ------LGPDGLSLG---FGTITVI  140

Query  474  DNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVH  295
            D+ +T   ELGS  +G+AQG Y+ASS DG++  +A TA+  G    +     +I+F+GV 
Sbjct  141  DDILTTAPELGSQTIGKAQGVYVASSADGSTQMMAFTAMIEGGEYGD-----SINFYGVF  195

Query  294  RTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            +  +P+SHL++ GGTG +++A G+A + +L    QH TDG ET+    V+++
Sbjct  196  KIGSPMSHLSVTGGTGKFKSASGFAEVRSLIPPGQHVTDGAETLLRIVVHLS  247



>ref|XP_010527489.1| PREDICTED: dirigent protein 16 [Tarenaya hassleriana]
Length=249

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 131/243 (54%), Gaps = 19/243 (8%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            +SA   +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  23   TSAEAVDPPPEVPVFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPKNGI  82

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + GLNG      L   T   N   SG N   +     P GL+
Sbjct  83   AIP-------NANGALPTVNGLNGVPLGTGLSGTTFTGN---SGQNPNGIQTQLGPDGLS  132

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ +T G +LGS  LG+AQG Y+ASS DG++  +A TA+F        
Sbjct  133  LG---FGTITVIDDIVTSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAMF-----EGG  184

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+GV+R  + +SHL++ GGTG ++ A G+A I  L    QH TDG E++    
Sbjct  185  EYNDNLNFYGVYRIGSAMSHLSVTGGTGRFKNACGFAEIRPLIPPGQHVTDGAESLLRII  244

Query  150  VYI  142
            V++
Sbjct  245  VHL  247



>ref|XP_007226305.1| hypothetical protein PRUPE_ppa020939mg [Prunus persica]
 gb|EMJ27504.1| hypothetical protein PRUPE_ppa020939mg [Prunus persica]
Length=249

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 129/233 (55%), Gaps = 22/233 (9%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvin  655
             P L  +MHDILGGS P+ R +TG++ N     +PF +P   L P  GGV +   N    
Sbjct  37   EPILEMYMHDILGGSSPTARPITGLLGNIYGGQVPFARPIGFL-PPQGGVAIPNANGA--  93

Query  654  nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PSGLNLQQLMFGSITV  478
                P + GLNG      L   T +     SG  Q      QL P GL L    FG++TV
Sbjct  94   ---LPTVNGLNGIPLGTGLAGTTFSGK--PSGQAQT-----QLGPDGLGLG---FGTLTV  140

Query  477  VDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGV  298
            +D+ +T   ELGS  +G+AQG Y+ASS DG+S  +A TA+  G    +     T++F+G+
Sbjct  141  IDDILTTAPELGSQTIGKAQGVYVASSADGSSQMMAFTAMIEGGEYGD-----TLNFYGI  195

Query  297  HRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
             +  +P+SHL++ GGTG +++A G+A + +L    QH TDG ET+    V+++
Sbjct  196  FKIGSPMSHLSVTGGTGKFKSASGFAEVRSLIPPGQHVTDGAETLLRIIVHLS  248



>ref|XP_004134021.1| PREDICTED: uncharacterized protein LOC101219771 [Cucumis sativus]
 ref|XP_004157660.1| PREDICTED: uncharacterized LOC101219771 [Cucumis sativus]
 gb|KGN56780.1| hypothetical protein Csa_3G133310 [Cucumis sativus]
Length=249

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/245 (38%), Positives = 135/245 (55%), Gaps = 22/245 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            S+A  AN     P L F+MHDILGG+ P+ R +TG++ N     +PF  P   L P +GG
Sbjct  24   SAAVTANVGAHEPVLEFYMHDILGGASPTARPITGLLGNIYTGQVPFATPIGFL-PPDGG  82

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQP-FVTGGQL-PSGL  514
            V +   N        P + G+NG      +   TG +    +G+  P  V   QL P GL
Sbjct  83   VAIPNANGA-----LPTVNGING------IPLGTGLSGTSFAGNPNPQNVPQTQLGPDGL  131

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             L    FG+ITV+D+ +T   ELGS  +G+AQG Y+ASS DGT+  +A TA+  G    +
Sbjct  132  GLG---FGTITVIDDVLTTSPELGSQSIGQAQGVYVASSADGTTQMMAFTAMVEGGEYGD  188

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                 +++F+GV R  +P SHL++ GGTG ++ A+G A + +L    QH  DG ET+   
Sbjct  189  -----SLNFYGVFRIGSPSSHLSVTGGTGKFKNARGIAEVRSLIPPGQHVADGAETLLRV  243

Query  153  TVYIT  139
             V++T
Sbjct  244  LVHLT  248



>ref|XP_011002155.1| PREDICTED: dirigent protein 18-like [Populus euphratica]
Length=252

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 129/251 (51%), Gaps = 48/251 (19%)
 Frame = -1

Query  843  TTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQP--------------NDQL  706
            T + P L  +MHDILGGS P+ R +TG++ N  +  +PF +P              N  +
Sbjct  33   TGEEPILELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFVPPNGVAIPNANGVI  92

Query  705  FPING--GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGG  532
              +NG  G+PL T          P    LNG  QT                         
Sbjct  93   PTVNGINGIPLGTGLAGTTFAGKPNGQNLNGNTQTQLA----------------------  130

Query  531  QLPSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFh  352
              P GL L    FG+ITV+D+ +T   ELGS  +G+AQG Y+ASS DG+S  +A TA+F 
Sbjct  131  --PDGLGLG---FGTITVIDDILTSSPELGSQSVGKAQGVYVASSADGSSQMMAFTAMF-  184

Query  351  gehdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGV  172
                   E GD+I+F+G+++  + +S L++ GGTG ++ A+G+A + +L    QH  DG 
Sbjct  185  ----EGGEYGDSINFYGMYKIGSTMSRLSVTGGTGKFKNARGFAEVRSLIPSGQHFIDGA  240

Query  171  ETITHFTVYIT  139
            ET+  FTV+++
Sbjct  241  ETLLRFTVHLS  251



>emb|CBI33333.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 135/247 (55%), Gaps = 21/247 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            ++  VA    +H  +  +MHDILGGS P+ R VTG++ N  +  +PF +P     P  GG
Sbjct  25   AAVEVAAEGGEH-VIELYMHDILGGSSPTARPVTGLLGNIYSGQVPFARPVG-FLPPKGG  82

Query  687  VPLntinnv---innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PS  520
            V +   N     +N N  P   GL G           GN N   +  NQ   T  QL P 
Sbjct  83   VAIPNANGALPTVNTNGIPLGTGLAGTNFV-------GNPNRKPNDPNQNGKTATQLGPD  135

Query  519  GLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehd  340
            GL L    FG+ITV+D+ +T G ELGS  +G+AQG Y+ASS DGT+  +A TA+      
Sbjct  136  GLGLG---FGTITVIDDVLTSGPELGSQSIGKAQGVYVASSADGTTQMMAFTAMM-----  187

Query  339  hehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETIT  160
               E GD ++FFGV++  + +S L++ GGTG ++ A+G+  +  L    QH TDG ET+ 
Sbjct  188  EGGEYGDNLNFFGVYKIGSAMSRLSVTGGTGKFKNARGFGEVRPLIPSGQHVTDGAETLL  247

Query  159  HFTVYIT  139
              TV+++
Sbjct  248  RITVHLS  254



>ref|XP_002468522.1| hypothetical protein SORBIDRAFT_01g047330 [Sorghum bicolor]
 gb|EER95520.1| hypothetical protein SORBIDRAFT_01g047330 [Sorghum bicolor]
Length=275

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 124/236 (53%), Gaps = 30/236 (13%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnnN  646
            L  +MHDILGGS P+ R +TG++ N     +PF +P     P NG VP+           
Sbjct  63   LELYMHDILGGSSPTARPITGLLGNIYNGQVPFARPIGFSAPRNG-VPIP----------  111

Query  645  YPFLVGLNGQQQTDTLLQNTG---NNNVVDSGDNQP----FVTGGQLPSGLNLQQLMFGS  487
                   N   Q  T   NTG   +  +  +G  QP         Q+  G +   L FG+
Sbjct  112  -------NANGQVPTYNGNTGIPLDTGLSGAGFLQPGNGAAAAPAQVQLGPDGLSLGFGT  164

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            ITV+D+ +T G +LG+  LGRAQG Y+ASS DG+S  +A TA+  G    +     TI+F
Sbjct  165  ITVIDDVLTGGPDLGAQPLGRAQGVYVASSADGSSQMMAFTAMMEGGEYGD-----TINF  219

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FGV++  TP+  L+I GGTG ++ A G+A +  L    QH TDG ET+   TV++ 
Sbjct  220  FGVYKVGTPLCRLSITGGTGKFKGACGFAEVRPLIASGQHVTDGAETLLRITVHLA  275



>ref|XP_009622054.1| PREDICTED: dirigent protein 16-like [Nicotiana tomentosiformis]
Length=247

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 131/243 (54%), Gaps = 35/243 (14%)
 Frame = -1

Query  843  TTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQP-------NDQLFP-INGG  688
            T   P L  +MHDILGGS P+ R +TG++ N  +  +PF +P       +    P  NG 
Sbjct  31   TPGEPILELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFQPPKDGVAIPNSNGA  90

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            +P        N N  P   GL G           GN N      +Q  VT    P GL L
Sbjct  91   IP------TFNINGVPLGTGLAGTT-------FAGNQN------SQTTVTTQLGPDGLGL  131

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
                FG+ITV+D+ +T   ELG+  LG+AQG Y++SS DG++  +A TA+F G    +  
Sbjct  132  G---FGTITVIDDYLTSSPELGTQNLGKAQGVYVSSSADGSTQMMAFTAMFEGGEYGD--  186

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
               +++FFGV+R ++P+S +++ GGTG ++ A G+A I +L    QH TDG ET+   TV
Sbjct  187  ---SLNFFGVYRISSPMSRISVTGGTGKFKNACGFAEIRSLIPAGQHVTDGAETLLRITV  243

Query  147  YIT  139
            ++T
Sbjct  244  HLT  246



>ref|XP_008224088.1| PREDICTED: dirigent protein 16-like [Prunus mume]
Length=249

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 125/232 (54%), Gaps = 20/232 (9%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvin  655
             P L  +MHDILGGS P+ R +TG++ N     +PF +P     P  GGV +   N    
Sbjct  37   EPILEMYMHDILGGSGPTARPITGLLGNIYGGQVPFARPIG-FLPPQGGVAIPNANGA--  93

Query  654  nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGSITVV  475
                P + GLNG      L   T +     SG  Q  +     P GL L    FG+ITV+
Sbjct  94   ---LPTVNGLNGIPLGTGLADTTFSGK--PSGQAQTRLG----PDGLGLG---FGTITVI  141

Query  474  DNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGVH  295
            D+ +T   ELGS  +G+ QG Y+ASS DG+S  +A TA+  G    +     T++F+G+ 
Sbjct  142  DDILTTAPELGSQTIGKTQGVYVASSADGSSQMMAFTAMIEGGEYGD-----TLNFYGIF  196

Query  294  RTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            +  +P+SHL++ GGTG ++ A G+A + +L    QH TDG ET+    V+++
Sbjct  197  KIGSPMSHLSVTGGTGKFKGASGFAEVRSLIPPGQHVTDGAETLLRIIVHLS  248



>gb|KDO46285.1| hypothetical protein CISIN_1g041927mg [Citrus sinensis]
Length=239

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 129/240 (54%), Gaps = 22/240 (9%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVP  682
            A +   T + P L  +MHDILGGS P+ R VTG++ N     +PF +P   L P  GGV 
Sbjct  20   AVIITATGEVPVLELYMHDILGGSSPTARPVTGLLGNIYNGQVPFARPVG-LRPPEGGVV  78

Query  681  LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQ  502
            +   N        P + G NG      L   T  N     G N     G   P GL L  
Sbjct  79   IPNANGA-----IPTVNGNNGIPLGTGLAGTTSAN-----GQNPQTQLG---PDGLGLG-  124

Query  501  LMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelg  322
              FG+ITV+D+ +T   ELGS  +GRAQG Y+ASS+DGTS  +  TA+         E G
Sbjct  125  --FGTITVIDDILTSNPELGSQAIGRAQGVYIASSVDGTSQMMTFTAMI-----EGGEYG  177

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D+++F+G+++  + +S L++ GGTG ++ A+G+A +  L    QH TDG ET+   TV++
Sbjct  178  DSLNFYGLYKIGSTMSRLSVTGGTGKFKNARGFAEVRALIPPGQHVTDGAETLLRITVHL  237



>ref|XP_006492143.1| PREDICTED: dirigent protein 16-like [Citrus sinensis]
Length=277

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 130/235 (55%), Gaps = 21/235 (9%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-GVPLntinnv  661
            +HP L F+MHDILGGS P+ R +TG++ N  +  +PF +P   L P +G  +P       
Sbjct  59   EHPILEFYMHDILGGSNPTARPITGLLGNIYSGQVPFARPIGFLPPQDGVAIP-------  111

Query  660  innnNYPFLVGLNGQQQTDTLLQNT--GNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFGS  487
              N   P + GLNG      L   T  G  N  +   N     G   P GL L    FG+
Sbjct  112  NANGAIPIVNGLNGVPLGTGLAGTTFAGEGNQQNLNGNTQTQLG---PDGLGLG---FGT  165

Query  486  ITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISF  307
            ITV+D+ +T   EL S  LG+AQG YLASS DG++  +A TA+       E E GD+++F
Sbjct  166  ITVIDDILTASPELRSQALGKAQGVYLASSADGSTQMMAFTAMI-----EEGEYGDSLNF  220

Query  306  FGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            +GV++  + +SHL++ GGTG ++ A G A +  L    QH TDG E++   TV++
Sbjct  221  YGVYKIGSTMSHLSVTGGTGKFKHACGLAEVRPLIPAGQHVTDGAESLLRITVHL  275



>ref|XP_007034496.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
 gb|EOY05422.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
Length=249

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 130/236 (55%), Gaps = 26/236 (11%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvi  658
            + P L F+MHDILGGS P+ R +TG++ N  +  +PF +P     P  GGV +   N   
Sbjct  34   EEPILEFYMHDILGGSSPTARPITGLLGNIYSGQVPFAKPVG-FLPPQGGVAIPNANGA-  91

Query  657  nnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGD-NQ---PFVTGGQLPSGLNLQQLMFG  490
                 P + G+NG      L   TG      +GD NQ   P     Q+P G +   L FG
Sbjct  92   ----IPTVNGVNG------LPLGTGLAGTAFAGDQNQNGNP-----QIPLGPDGLGLGFG  136

Query  489  SITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTIS  310
            +ITV+D+ +T   +LGS  +G+AQG Y+ASS DGT+  +A TA+         E  D ++
Sbjct  137  TITVIDDILTASPDLGSQAIGKAQGVYVASSADGTTQMMAFTAMI-----EGGEYNDNLN  191

Query  309  FFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            F+GV++  + +SH+++ GGTG ++ A G A +  L    QH TDG ET+   TV++
Sbjct  192  FYGVYKIGSTMSHVSVTGGTGKFKNACGLAEVRPLIPPGQHVTDGAETLLRITVHL  247



>ref|XP_006420526.1| hypothetical protein CICLE_v10006624mg, partial [Citrus clementina]
 gb|ESR33766.1| hypothetical protein CICLE_v10006624mg, partial [Citrus clementina]
Length=270

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 130/240 (54%), Gaps = 22/240 (9%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVP  682
            A +   T + P L  +MHDILGGS P+ R VTG++ N     +PF +P   L P  GGV 
Sbjct  51   AVIITATGEVPVLELYMHDILGGSSPTARPVTGLLGNIYNGQVPFARPVG-LRPPEGGVV  109

Query  681  LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQ  502
            +   N  I     P + G NG      L   T  N     G N     G   P GL L  
Sbjct  110  IPNANGAI-----PTVNGNNGIPLGTGLAGTTSAN-----GQNPQTQLG---PDGLGLG-  155

Query  501  LMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelg  322
              FG+ITV+D+ +T   ELGS  +GRAQG Y+ASS+DGTS  +  TA+         E G
Sbjct  156  --FGTITVIDDILTSNPELGSQAIGRAQGVYIASSVDGTSQMMTFTAMI-----EGGEYG  208

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D+++F+G+++  + +S L++ GGTG ++ A+G+A +  L    QH TDG ET+   TV++
Sbjct  209  DSLNFYGLYKIGSTMSRLSVTGGTGKFKNARGFAEVRALIPPGQHVTDGAETLLRITVHL  268



>ref|XP_009781789.1| PREDICTED: dirigent protein 16-like [Nicotiana sylvestris]
Length=247

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/240 (37%), Positives = 128/240 (53%), Gaps = 35/240 (15%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPI--------NGGVPL  679
             P L  ++HDILGGS P+ R +TG++ N  +  +PF +P     P         NG +P 
Sbjct  34   EPILELYLHDILGGSNPTARPITGLLGNIYSGQVPFAKPLGFEPPTDGVAIPNSNGAIP-  92

Query  678  ntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQL  499
                   N N  P   GL G           GN N      +Q  VT    P GL L   
Sbjct  93   -----TFNINGVPLGTGLAGTT-------FAGNQN------SQTTVTTQLGPDGLGLG--  132

Query  498  MFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgD  319
             FG+ITV+D+ +T   ELG+  LG+AQG Y++SS DG++  +A TA+F G    +     
Sbjct  133  -FGTITVIDDYLTSSPELGTQNLGKAQGVYVSSSADGSTQMMAFTAMFEGGEYGD-----  186

Query  318  TISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            +++FFGV+R A+P+S +++ GGTG ++ A G+A I +L    QH TDG ET+    V++T
Sbjct  187  SLNFFGVYRIASPMSRISVTGGTGKFKNACGFAEIRSLIPAGQHVTDGAETLLRIAVHLT  246



>ref|XP_002285613.1| PREDICTED: dirigent protein 16-like [Vitis vinifera]
Length=253

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 132/245 (54%), Gaps = 19/245 (8%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            S+  +A    + P L  +MHDILGG+ P+ R +TG++ N  +  +PF +P     P +G 
Sbjct  25   SAVDLATTGGEAPVLELYMHDILGGNNPTARPITGLLGNIYSGQVPFARPVGFNPPKDGV  84

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PSGL  514
             +P         N   P + G NG      L  +       D   NQ   T  QL P GL
Sbjct  85   AIP-------NANGAIPLVNGNNGIPLGTGLAGSAFGGKPNDP--NQNGKTATQLGPDGL  135

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             L    FG+ITV+D+ +T G ELGS  +G+AQG Y+ASS DGT+  +A TA+        
Sbjct  136  GLG---FGTITVIDDVLTSGPELGSQSIGKAQGVYVASSADGTTQMMAFTAMM-----EG  187

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
             E GD ++FFGV++  + +S L++ GGTG ++ A+G+  +  L    QH TDG ET+   
Sbjct  188  GEYGDNLNFFGVYKIGSAMSRLSVTGGTGKFKNARGFGEVRPLIPSGQHVTDGAETLLRI  247

Query  153  TVYIT  139
            TV+++
Sbjct  248  TVHLS  252



>ref|XP_004985736.1| PREDICTED: uncharacterized protein LOC101773107 [Setaria italica]
Length=279

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 130/249 (52%), Gaps = 47/249 (19%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-GVPLntinnv  661
            D P L  +MHDILGGS P+ R +TG++ N     +PF +P     P NG  +P       
Sbjct  62   DAP-LELYMHDILGGSSPTARPITGLLGNIYNGQVPFARPIGFSAPRNGVAIP-------  113

Query  660  innnNYPFLVGLNGQQQTDTLLQNTGNNNV-VDSG-DNQPFVTGG------------QL-  526
                        N   Q  T+    GNN + +D+G     F+  G            QL 
Sbjct  114  ------------NANGQVPTV---NGNNGIPLDTGLSGAGFLQPGSGAAAAAAPAQVQLG  158

Query  525  PSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhge  346
            P GL+L    FG+ITV+D+ +T G +LG+  LGRAQG Y+ASS DG+S  +A TA+  G 
Sbjct  159  PDGLSLG---FGTITVIDDVLTSGPDLGAQPLGRAQGVYVASSADGSSQMMAFTAMMEGG  215

Query  345  hdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVET  166
               +     TI+FFGV++  TP+  L+I GGTG ++ A G+A +  L    QH TDG ET
Sbjct  216  EYGD-----TINFFGVYKVGTPLCRLSITGGTGKFKGACGFAEVRPLIASGQHVTDGAET  270

Query  165  ITHFTVYIT  139
            +   TV++ 
Sbjct  271  LLRITVHLA  279



>ref|XP_008650968.1| PREDICTED: dirigent protein 16-like [Zea mays]
 tpg|DAA43333.1| TPA: hypothetical protein ZEAMMB73_203958 [Zea mays]
Length=282

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 126/245 (51%), Gaps = 43/245 (18%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-GVPLntinnvinnn  649
            L  +MHDILGGS P+ R +TG++ N     +PF +P     P NG  +P           
Sbjct  65   LELYMHDILGGSSPTARPITGLLGNIYNGQVPFARPIGFSAPRNGVAIP-----------  113

Query  648  NYPFLVGLNGQQQTDTLLQNTG---NNNVVDSGDNQPFVTGG-----------QL-PSGL  514
                    N   Q  T   NTG   +  +  +G  QP    G           QL P GL
Sbjct  114  --------NANGQVPTYNGNTGIPLDTGLSGAGFLQPGTGNGGGAAAAAPAQVQLGPDGL  165

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
            +L    FG+ITV+D+ +T G +LG+  LGRAQG Y+ASS DG+S  +A TA+  G    +
Sbjct  166  SLG---FGTITVIDDVLTSGPDLGAQPLGRAQGVYVASSADGSSQMMAFTAMMEGGEYGD  222

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
                 TI+FFGV++  TP+  L+I GGTG ++ A G+A +  L    QH TDG ET+   
Sbjct  223  -----TINFFGVYKVGTPLCRLSITGGTGKFKGACGFAEVRPLIASGQHVTDGAETLLRI  277

Query  153  TVYIT  139
            TV++ 
Sbjct  278  TVHLA  282



>ref|XP_008438410.1| PREDICTED: dirigent protein 18 [Cucumis melo]
Length=248

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 131/244 (54%), Gaps = 22/244 (9%)
 Frame = -1

Query  864  SATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGV  685
            SA V      H  L F+MHDILGG+ P+ R +TG++ N     +PF  P   L P +G  
Sbjct  24   SAAVTANVGGHEPLEFYMHDILGGASPTARPITGLLGNIYTGQVPFATPIGFLPPDDG--  81

Query  684  PLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQP-FVTGGQL-PSGLN  511
                +     N   P + G+NG      +   TG +    +G+  P  V   QL P GL 
Sbjct  82   ----VAIPNANGALPTVNGING------IPLGTGLSGTAFAGNPNPQNVPQTQLGPDGLG  131

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ +T   ELGS  +G+AQG Y+ASS DGT+  +A TA+  G    + 
Sbjct  132  LG---FGTITVIDDVLTTAPELGSQSIGQAQGVYVASSADGTTQMMAFTAMVEGGEYGD-  187

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
                +++F+GV R  +P SHL++ GGTG ++ A+G A + +L    QH  DG ET+    
Sbjct  188  ----SLNFYGVFRIGSPSSHLSVTGGTGKFKNARGIAEVRSLIPPGQHVADGAETLLRVL  243

Query  150  VYIT  139
            V++T
Sbjct  244  VHLT  247



>ref|XP_002303806.2| disease resistance-responsive family protein [Populus trichocarpa]
 gb|EEE78785.2| disease resistance-responsive family protein [Populus trichocarpa]
Length=252

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 130/242 (54%), Gaps = 29/242 (12%)
 Frame = -1

Query  846  PTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntin  667
            P    P L  +MHDILGGS P+ R +TG++ N  +  +PF +P     P  G V +   N
Sbjct  31   PAGGEPVLELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPVG-FVPPKGAVAIPNAN  89

Query  666  nvinnnNYPFLVGLNGQQQTDTLLQNT--GNNNVVDSGDNQPFVTGGQL-----PSGLNL  508
                    P + GLNG      L   T  GN N    G N    T GQ+     P GL L
Sbjct  90   GA-----LPTVNGLNGIPLGTGLAGTTFAGNPN----GQN----TNGQIQTQLGPDGLGL  136

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
                FG+ITV+D+ +T   ELGS  LG+AQG Y+ASS DG++  +A TA+F        E
Sbjct  137  G---FGTITVIDDTLTNSPELGSQQLGKAQGVYVASSADGSTQMMAFTAMF-----EGGE  188

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
             GD+++F+G++R  + +S L++ GGTG ++ A G+A +  L    Q  TDG ET+   +V
Sbjct  189  FGDSLNFYGIYRIGSAMSRLSVTGGTGKFKNAIGFAEVRGLVPPGQAVTDGAETLLRISV  248

Query  147  YI  142
            ++
Sbjct  249  HL  250



>ref|XP_010264004.1| PREDICTED: dirigent protein 18 [Nelumbo nucifera]
Length=255

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 129/234 (55%), Gaps = 22/234 (9%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvin  655
             P L  +MHDILGGS P+ R +TG++ N  +  +PF +P   + P NG VP+   N  I 
Sbjct  41   EPTLELYMHDILGGSSPTARPITGLLGNIYSGQVPFARPVGFIPPKNG-VPIPNANGAIP  99

Query  654  nnNYPFLVGLNGQQQTDTLLQNT-GNNNVVDSGDNQPFVTGGQL-PSGLNLQQLMFGSIT  481
                   V +NG      L   T   N    +G N     G QL P GL L    FG+IT
Sbjct  100  T------VNVNGVPLGTGLAGTTFSANGQAINGQN-----GAQLGPDGLGLG---FGTIT  145

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V+D+ +T G ELGS  +G+AQG Y+ASS DGT+  +A TA+         E GDT++ FG
Sbjct  146  VIDDILTSGPELGSQSIGKAQGVYVASSADGTTQMMAFTAML-----EGGEYGDTVNLFG  200

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            V++  + +S L++ GGTG ++ A G+A + +L    Q  T G ET+   TV++T
Sbjct  201  VYKVQSAMSRLSVTGGTGKFKNACGFAEVRSLVPSGQSVTGGAETLLRITVHLT  254



>ref|XP_006420521.1| hypothetical protein CICLE_v10007167mg [Citrus clementina]
 gb|ESR33761.1| hypothetical protein CICLE_v10007167mg [Citrus clementina]
Length=253

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/236 (38%), Positives = 130/236 (55%), Gaps = 27/236 (11%)
 Frame = -1

Query  837  DHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-GVPLntinnv  661
            +HP L F+MHDILGGS P+ R +TG++ N  +  +PF +P   L P +G  +P       
Sbjct  35   EHPILEFYMHDILGGSNPTARPITGLLGNIYSGQVPFARPIGFLPPQDGVAIP-------  87

Query  660  innnNYPFLVGLN----GQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PSGLNLQQLM  496
              +   P + GLN    G     T     GN   ++ G+ Q      QL P GL L    
Sbjct  88   NADGAIPIVNGLNGVPLGTGLAGTTFAGEGNQQSLN-GNTQT-----QLGPDGLGLG---  138

Query  495  FGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDT  316
            FG+ITV+D+ +T   EL S  LG+AQG Y+ASS DG++  +A TA+       E E GD+
Sbjct  139  FGTITVIDDILTASPELRSQALGKAQGVYVASSADGSTQMMAFTAMI-----EEGEYGDS  193

Query  315  ISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
            ++F+GV++  + +SHL++ GGTG ++ A G A +  L    QH TDG E++   T 
Sbjct  194  LNFYGVYKIGSTMSHLSVTGGTGKFKHACGLAEVRPLIPAGQHVTDGAESLLRITA  249



>ref|XP_010450187.1| PREDICTED: dirigent protein 18-like [Camelina sativa]
Length=244

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 128/242 (53%), Gaps = 20/242 (8%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            ++ T  NP  + P    +MHDILGGS P+ R +TG++ N     +PF +P   + P N  
Sbjct  21   TATTALNPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKPIGFVPPEN--  78

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
                ++     N   P + G+NG      +   TG +    SG N   +     P GL+L
Sbjct  79   ----SVAIPNANGALPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLSL  128

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
                FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A T +         E
Sbjct  129  G---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTVML-----EGGE  180

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
              D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    V
Sbjct  181  YNDNLNFYGIYRIGSTMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRIIV  240

Query  147  YI  142
            ++
Sbjct  241  HL  242



>ref|XP_010440560.1| PREDICTED: dirigent protein 18-like [Camelina sativa]
Length=244

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 128/242 (53%), Gaps = 20/242 (8%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            ++ T  NP  + P    +MHDILGGS P+ R +TG++ N     +PF +P   + P N  
Sbjct  21   TATTALNPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKPIGFVPPEN--  78

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
                ++     N   P + G+NG      +   TG +    SG N   +     P GL+L
Sbjct  79   ----SVAIPNANGALPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLSL  128

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
                FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A T +         E
Sbjct  129  G---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTVML-----EGGE  180

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
              D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    V
Sbjct  181  YNDNLNFYGIYRIGSTMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRIIV  240

Query  147  YI  142
            ++
Sbjct  241  HL  242



>emb|CDY47358.1| BnaCnng14950D [Brassica napus]
Length=244

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 131/243 (54%), Gaps = 23/243 (9%)
 Frame = -1

Query  864  SATVA-NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            SAT+A +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   SATIALDPAPEEPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPENGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGAIPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPSGQHFVDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>gb|KFK36242.1| hypothetical protein AALP_AA4G096600 [Arabis alpina]
Length=244

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/243 (35%), Positives = 129/243 (53%), Gaps = 22/243 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            ++ T  NP  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   TATTALNPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPENGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGAMPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFLDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>ref|XP_009139613.1| PREDICTED: dirigent protein 18 [Brassica rapa]
Length=244

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 131/243 (54%), Gaps = 23/243 (9%)
 Frame = -1

Query  864  SATVA-NPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            SAT+A +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   SATIALDPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPENGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGAMPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPSGQHFVDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>ref|XP_011002154.1| PREDICTED: dirigent protein 18-like [Populus euphratica]
 ref|XP_011012217.1| PREDICTED: dirigent protein 18-like [Populus euphratica]
Length=246

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 127/236 (54%), Gaps = 22/236 (9%)
 Frame = -1

Query  846  PTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntin  667
            P  + PAL  FMHDILGGS P+ R +TG++ N  +  +PF +P   + P    +P     
Sbjct  31   PAGEEPALELFMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFIPPDGMAIP-----  85

Query  666  nvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PSGLNLQQLMFG  490
                N   P + GLNG      +   TG +    +G N       QL P GL L    FG
Sbjct  86   --NANGALPAVNGLNG------IPLGTGLSGTTFAGQNPNGQIQTQLGPDGLGLG---FG  134

Query  489  SITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTIS  310
            +ITV+D+ +T   ELGS  LG+AQG Y+ASS DGT+  +A T +F        E GD ++
Sbjct  135  TITVIDDILTNSPELGSQQLGKAQGVYVASSADGTTQMMAFTTIF-----EGGEFGDALN  189

Query  309  FFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            F+G+++  + +S L++ GGTG ++ A G+A I  L    Q   DG +T+   TV++
Sbjct  190  FYGIYKIGSAMSRLSVTGGTGKFKNAMGFAEIRGLVPSGQVGIDGAQTLLRITVHL  245



>ref|NP_193094.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9T0H8.1|DIR18_ARATH RecName: Full=Dirigent protein 18; Short=AtDIR18; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB41116.1| putative protein [Arabidopsis thaliana]
 emb|CAB78400.1| putative protein [Arabidopsis thaliana]
 gb|AAL91156.1| putative protein [Arabidopsis thaliana]
 gb|AAM47872.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83298.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
Length=244

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 129/243 (53%), Gaps = 22/243 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            ++ T  +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   TATTALDPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPQNGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGAMPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>ref|XP_002870373.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH46632.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=244

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 129/243 (53%), Gaps = 22/243 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            ++ T  +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   TATTALDPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPQNGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGALPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>emb|CDY43705.1| BnaA08g05150D [Brassica napus]
Length=244

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 129/243 (53%), Gaps = 22/243 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            ++ T  +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   TATTALDPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPENGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGAMPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>ref|XP_011092678.1| PREDICTED: dirigent protein 18-like [Sesamum indicum]
Length=253

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 129/249 (52%), Gaps = 33/249 (13%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPI-----  697
            A  +  T + P L  +MHDILGGS P+ R +TG++ N  +  +PF +P   L P      
Sbjct  29   AAASAATGEVPVLELYMHDILGGSSPTARPITGLLGNIYSGQVPFARPLGFLPPRDGVAI  88

Query  696  ---NGGVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL  526
               NG +P       IN N  P   GL G         N  N N    G           
Sbjct  89   PNSNGAIP------TINPNGIPLGTGLVGTAFAGINNNNGQNINTAQLG-----------  131

Query  525  PSGLNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhge  346
            P GL L    FG+ITV+D+ +T   ELGS  LG+AQG Y+ASS DG++  +A TA+  G 
Sbjct  132  PDGLGLG---FGTITVIDDYLTSAPELGSQQLGKAQGVYVASSADGSTQMMAFTAMMEGG  188

Query  345  hdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVET  166
               +     +++FFGV++  + +S L++ GGTG ++ A G+A + +L    QH  DGVET
Sbjct  189  EYGD-----SLNFFGVYKIGSTMSRLSVTGGTGKFKNACGFAEVRSLFPAGQHVMDGVET  243

Query  165  ITHFTVYIT  139
            +   TV++T
Sbjct  244  LLRITVHLT  252



>ref|XP_002282961.1| PREDICTED: dirigent protein 16 [Vitis vinifera]
Length=249

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 133/246 (54%), Gaps = 25/246 (10%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            ++  VA    +H  +  +MHDILGGS P+ R VTG++ N  +  +PF +P     P  GG
Sbjct  25   AAVEVAAEGGEH-VIELYMHDILGGSSPTARPVTGLLGNIYSGQVPFARPVG-FLPPKGG  82

Query  687  VPLntinnv---innnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSG  517
            V +   N     +N N  P   GL G       + N   NN       +P    G  P G
Sbjct  83   VAIPNANGALPTVNTNGIPLGTGLAGTN----FVGNPNRNN------GRPATQLG--PDG  130

Query  516  LNLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdh  337
            L L    FG+ITV+D+ +T G +LGS  +G+AQG Y+ASS+DGT+  +  TA+  G    
Sbjct  131  LGLG---FGTITVIDDVLTSGPDLGSQQMGKAQGVYVASSVDGTTQMMTFTAMIEGGEYG  187

Query  336  ehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITH  157
            +     +I+FFGV++  + +S L++ GGTG ++ A G+A I  L    QH TDGVET+  
Sbjct  188  D-----SINFFGVYKIGSTMSRLSVTGGTGKFKNACGFAEIRPLIPSGQHVTDGVETLLR  242

Query  156  FTVYIT  139
             T +++
Sbjct  243  ITAHLS  248



>emb|CDY01141.1| BnaA04g06780D [Brassica napus]
Length=244

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 130/243 (53%), Gaps = 22/243 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            ++ T  +P+ + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   TATTALDPSPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPENGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGAMPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPSGQHFVDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>ref|XP_009107703.1| PREDICTED: dirigent protein 18-like [Brassica rapa]
Length=245

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 129/243 (53%), Gaps = 22/243 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            ++ T  +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  22   TATTALDPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPENGV  81

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  82   AIP-------NANGAMPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  128

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  129  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  180

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  181  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEILLRII  240

Query  150  VYI  142
            V++
Sbjct  241  VHL  243



>ref|XP_008223997.1| PREDICTED: dirigent protein 16-like [Prunus mume]
Length=252

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 130/244 (53%), Gaps = 22/244 (9%)
 Frame = -1

Query  864  SATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGV  685
            SA    P +  P L  +MHDILGGS P+ R +TG++ N  ++ +PF +P     P NG V
Sbjct  26   SAVDPAPVSSEPVLEIYMHDILGGSSPTARPITGLLGNIYSSQVPFAKP-IGFLPPNGAV  84

Query  684  PLntinnvinnnNYPFLVGLNGQQQTDTLLQNT---GNNNVVDSGDNQPFVTGGQLPSGL  514
             +   N        P + G NG     T L  T   GN N   +G+    +     P GL
Sbjct  85   AIPNANGA-----IPTVNGANGLP-LGTGLSGTAFAGNPNAQQNGNPATQLA----PDGL  134

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             L    FG+ITV+D+ +T   +LGS  +G+AQG Y+ASS DGT+  +A TA+        
Sbjct  135  GLG---FGTITVIDDILTSSPDLGSQTIGKAQGVYVASSADGTTQLMAFTAMM-----EG  186

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
             E  D ++F+GV++  +  S L++ GGTG ++ A G A ++ L    QH TDG ET+   
Sbjct  187  GEYNDNLNFYGVYKIGSTKSQLSVTGGTGKFKNANGIAKLQPLIPPGQHATDGAETLLRI  246

Query  153  TVYI  142
            TV++
Sbjct  247  TVHL  250



>ref|XP_006414882.1| hypothetical protein EUTSA_v10027245mg [Eutrema salsugineum]
 gb|ESQ56335.1| hypothetical protein EUTSA_v10027245mg [Eutrema salsugineum]
Length=244

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 127/240 (53%), Gaps = 22/240 (9%)
 Frame = -1

Query  858  TVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-GVP  682
            T  +P  + P    +MHDILGGS P+ R +TG++ N     +PF +    + P NG  +P
Sbjct  24   TALDPAPEDPIFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAKQIGFVPPQNGVAIP  83

Query  681  LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQ  502
                     N   P + G+NG      +   TG +    SG N   +     P GL+L  
Sbjct  84   -------NANGAIPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLSLG-  129

Query  501  LMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelg  322
              FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         E  
Sbjct  130  --FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGGEYN  182

Query  321  DTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYI  142
            D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    V++
Sbjct  183  DNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRIIVHL  242



>ref|XP_009619983.1| PREDICTED: dirigent protein 16-like [Nicotiana tomentosiformis]
Length=248

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 131/243 (54%), Gaps = 22/243 (9%)
 Frame = -1

Query  861  ATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-GV  685
            A +   T   P L  +MHDILGG+ P+ R +TG++ N  +  +PF  P     P +G  +
Sbjct  25   AAIDTVTPQEPILELYMHDILGGNNPTARPITGLLGNIYSGQVPFATPLGFQPPKDGVAI  84

Query  684  P-LntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
            P  N      N N  P   GL G     TL    GNNN   + + Q        P GL L
Sbjct  85   PNANGAMPTFNINGVPLGTGLAG-----TLFAG-GNNNNAQAVNTQ------LGPDGLGL  132

Query  507  QQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehe  328
                FG+ITV+D+ +T   +LG+  LG+AQG Y+ASS DG++  +A TA+F G    +  
Sbjct  133  G---FGTITVIDDFLTSSPDLGTQNLGKAQGVYVASSADGSTQMMAFTAMFEGGEYGD--  187

Query  327  lgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTV  148
               +++FFGV R  + +S L++ GGTG ++ A G+A + +L    QH TDG ET+   TV
Sbjct  188  ---SLNFFGVFRIGSTMSRLSVTGGTGKFKNACGFAEVRSLIPAGQHVTDGAETLLRITV  244

Query  147  YIT  139
            ++T
Sbjct  245  HLT  247



>ref|XP_006651031.1| PREDICTED: dirigent protein 16-like [Oryza brachyantha]
Length=265

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/234 (36%), Positives = 123/234 (53%), Gaps = 22/234 (9%)
 Frame = -1

Query  834  HPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvin  655
            H  L  ++HDILGGS P+ R +TG++ N     +PF +P     P NG VP+   N  I 
Sbjct  51   HEPLELYIHDILGGSSPTARPITGLLGNIYNGQVPFARPIGFATPKNG-VPIPNSNGAIP  109

Query  654  nnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGG--QLPSGLNLQQLMFGSIT  481
                      NG           G      +G  QP   GG  Q+  G +   L FG+IT
Sbjct  110  T--------YNGNXXXXXXXXXAG------AGFAQPAKGGGSAQVQVGPDGLSLGFGTIT  155

Query  480  VVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFG  301
            V+D+ +T G +LG+  LGRAQG Y+AS+ DG++  +A TA+  G    +     T++FFG
Sbjct  156  VIDDVLTSGPDLGAQPLGRAQGVYVASAADGSAQMMAFTAMMEGGEYGD-----TLNFFG  210

Query  300  VHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            V++  + +  L+I GGTG ++ A G+A +  L    QH TDG ET+   TV++ 
Sbjct  211  VYKVGSALCRLSITGGTGKFKGAGGFAEVRPLIASGQHVTDGAETLLRITVHLA  264



>emb|CDY18745.1| BnaC08g08710D [Brassica napus]
Length=244

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 129/243 (53%), Gaps = 22/243 (9%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPING-  691
            ++ T  +P  + P    +MHD+LGGS P+ R +TG++ N     +PF +    + P NG 
Sbjct  21   TATTALDPAPEDPIFELYMHDVLGGSSPTARPITGLLGNIYNGQVPFAKQIAFVPPENGV  80

Query  690  GVPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLN  511
             +P         N   P + G+NG      +   TG +    SG N   +     P GL+
Sbjct  81   AIP-------NANGAMPTVNGING------IPLGTGLSGTAFSGQNLNGIQTQLGPDGLS  127

Query  510  LQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdheh  331
            L    FG+ITV+D+ IT G +LGS  LG+AQG Y+ASS DG++  +A TA+         
Sbjct  128  LG---FGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML-----EGG  179

Query  330  elgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFT  151
            E  D ++F+G++R  + +SHL++ GGTG ++ A G+A +  L    QH  DG E +    
Sbjct  180  EYNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRII  239

Query  150  VYI  142
            V++
Sbjct  240  VHL  242



>gb|EYU40519.1| hypothetical protein MIMGU_mgv1a026440mg [Erythranthe guttata]
Length=255

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 126/233 (54%), Gaps = 24/233 (10%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGVPLntinnvinnn-  649
            L  FMHDILGGS P+ R +TG++ N  +  +PF +P    FP  GGV +   N  I    
Sbjct  42   LELFMHDILGGSNPTARPITGLLGNIYSGQVPFARPLG-FFPPKGGVAIPNSNGAIPTIN  100

Query  648  --NYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQL-PSGLNLQQLMFGSITV  478
                P   GL G     T            + ++   +   QL P GL L    FG+ITV
Sbjct  101  PNGIPLGTGLIGTAFAGT-----------PNSNSNNNINSAQLGPDGLGLG---FGTITV  146

Query  477  VDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTISFFGV  298
            +D+ +T   ELGS  LG+AQG Y+ASS DG++  +A TA+  G    +     T++FFGV
Sbjct  147  IDDYLTSAPELGSQQLGKAQGVYVASSADGSTQMMAFTAMMEGGEFGD-----TLNFFGV  201

Query  297  HRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            ++  + +S L++ GGTG ++ A G+A + +L    QH  DGVET+   TV++T
Sbjct  202  YKIGSTMSRLSVTGGTGKFKNACGFAEVRSLIPAGQHVLDGVETLLRITVHLT  254



>ref|XP_010532814.1| PREDICTED: dirigent protein 16-like [Tarenaya hassleriana]
Length=251

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 133/248 (54%), Gaps = 27/248 (11%)
 Frame = -1

Query  867  SSATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGG  688
            +SA   +P  + P    +MHDILGGS P+ R +TG++ N     +PF +   Q       
Sbjct  23   TSAAAVDPAPE-PVFELYMHDILGGSSPTARPITGLLGNIYNGQVPFAK---QAARWAHA  78

Query  687  VPLntinnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNL  508
             PL+ + +V      P + GLNG      +   TG +    SG++      GQ P+G+  
Sbjct  79   PPLDLLGSVETKTTLPTVNGLNG------VPLGTGLSGTAFSGNS------GQNPNGILT  126

Query  507  Q------QLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhge  346
            Q       L FG+ITV+D+ +T G +LGS  LG+AQG Y+ASS DG++  +A TA+    
Sbjct  127  QLGPDGLSLGFGTITVIDDILTSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAML---  183

Query  345  hdhehelgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVET  166
                 E  D ++F+GV+R  + +SHL++ GGTG ++ A G+A I  L    QH  DG E+
Sbjct  184  --EGGEYNDNLNFYGVYRIGSAMSHLSVTGGTGRFKNACGFAEIRPLIPPGQHVIDGAES  241

Query  165  ITHFTVYI  142
            +    V++
Sbjct  242  LLRIIVHL  249



>ref|XP_007226337.1| hypothetical protein PRUPE_ppa022306mg [Prunus persica]
 gb|EMJ27536.1| hypothetical protein PRUPE_ppa022306mg [Prunus persica]
Length=252

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 129/244 (53%), Gaps = 22/244 (9%)
 Frame = -1

Query  864  SATVANPTTDHPALSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFPINGGV  685
            SA    P  + P L  +MHDILGGS P+ R +TG++ N  ++ +PF +P     P NG V
Sbjct  26   SAVDPAPVGNEPVLEIYMHDILGGSSPTARPITGLLGNIYSSQVPFAKP-IGFLPPNGAV  84

Query  684  PLntinnvinnnNYPFLVGLNGQQQTDTLLQNT---GNNNVVDSGDNQPFVTGGQLPSGL  514
             +   N        P + G NG     T L  T   GN N   +G+    +     P GL
Sbjct  85   AIPNANGA-----IPTVNGANGLP-LGTGLSGTAFAGNPNAQQNGNPATQLA----PDGL  134

Query  513  NLQQLMFGSITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhe  334
             L    FG+ITV+D+ +T   +LGS  +G+AQG Y+ASS DGT   +A TA+        
Sbjct  135  GLG---FGTITVIDDILTSSPDLGSQTIGKAQGVYVASSADGTRQLMAFTAMM-----EG  186

Query  333  helgDTISFFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHF  154
             E  D ++F+GV++  +  S L++ GGTG ++ A G A ++ L    QH TDG ET+   
Sbjct  187  GEYNDNLNFYGVYKIGSTKSQLSVTGGTGKFKNANGIAELQPLIPPGQHATDGAETLLRI  246

Query  153  TVYI  142
            TV++
Sbjct  247  TVHL  250



>ref|XP_011088098.1| PREDICTED: dirigent protein 18-like [Sesamum indicum]
Length=256

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 128/237 (54%), Gaps = 30/237 (13%)
 Frame = -1

Query  825  LSFFMHDILGGSQPSGRVVTGIVANSNANNLPFTQPNDQLFP--------INGGVPLnti  670
            L  +MHDILGGS P+ R +TG++ N  +  +PF +P   L P         NG +P    
Sbjct  41   LELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFLPPKDGVAIPNANGAIP----  96

Query  669  nnvinnnNYPFLVGLNGQQQTDTLLQNTGNNNVVDSGDNQPFVTGGQLPSGLNLQQLMFG  490
               +N N  P   GL G       + N  NNN          ++  QL  G +   L FG
Sbjct  97   --TLNPNGIPLGTGLVGTAFAG--IPNGSNNN-------GKTISTTQL--GADGLGLGFG  143

Query  489  SITVVDNQITEGHELGSAVLGRAQGFYLASSLDGTSHTLALTALFhgehdhehelgDTIS  310
            +ITV+D+ +T   ELGS  LG+AQG Y+ASS DG++  +A TA+  G    +     +++
Sbjct  144  TITVIDDYLTSAPELGSQQLGKAQGVYVASSADGSTQMMAFTAMMEGGEFGD-----SLN  198

Query  309  FFGVHRTATPISHLAIIGGTGTYETAKGYATIETLPHVDQHTTDGVETITHFTVYIT  139
            FFGV++  + +S L++ GGTG ++ A G+A + +L    QH  DGVET+   TV++T
Sbjct  199  FFGVYKIGSTMSRLSVTGGTGKFKNACGFAEVRSLIPAGQHVADGVETLLRITVHLT  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3380901351172