BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11682_g1_i1 len=848 path=[1:0-369 371:370-847]

Length=848
                                                                      Score     E

ref|XP_010679102.1|  PREDICTED: uncharacterized protein LOC104894542    251   8e-80   
ref|XP_004229676.1|  PREDICTED: lactoylglutathione lyase                250   2e-79   
ref|XP_009790866.1|  PREDICTED: uncharacterized protein LOC104238246    247   4e-78   
gb|KDP43609.1|  hypothetical protein JCGZ_16896                         247   6e-78   
ref|XP_009602386.1|  PREDICTED: lactoylglutathione lyase                246   1e-77   
ref|XP_006345488.1|  PREDICTED: lactoylglutathione lyase-like           244   3e-77   
ref|XP_011091777.1|  PREDICTED: uncharacterized protein LOC105172134    244   4e-77   
ref|XP_008375286.1|  PREDICTED: uncharacterized protein LOC103438528    243   2e-76   
ref|NP_029429.1|  lactoylglutathione lyase / glyoxalase I-like pr...    242   3e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AAK97724.1|  At2g28420/T1B3.6                                        241   6e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368069.1|  PREDICTED: uncharacterized protein LOC103957616    242   7e-76   
ref|XP_002880927.1|  lactoylglutathione lyase family protein            240   1e-75   
ref|XP_010103284.1|  hypothetical protein L484_007953                   239   3e-75   
ref|XP_002527954.1|  lactoylglutathione lyase, putative                 239   7e-75   Ricinus communis
ref|XP_008231537.1|  PREDICTED: uncharacterized protein LOC103330708    238   8e-75   
ref|XP_007220131.1|  hypothetical protein PRUPE_ppa020131mg             238   2e-74   
ref|XP_010279599.1|  PREDICTED: uncharacterized protein LOC104613472    237   3e-74   
emb|CBI28596.3|  unnamed protein product                                238   3e-74   
ref|XP_006295738.1|  hypothetical protein CARUB_v10024857mg             238   3e-74   
ref|XP_002271319.1|  PREDICTED: uncharacterized protein LOC100244855    236   4e-74   Vitis vinifera
ref|XP_009103687.1|  PREDICTED: uncharacterized protein LOC103829741    236   6e-74   
gb|EYU42982.1|  hypothetical protein MIMGU_mgv1a025275mg                233   6e-73   
gb|KFK32298.1|  hypothetical protein AALP_AA6G224300                    233   1e-72   
ref|XP_010414525.1|  PREDICTED: lactoylglutathione lyase-like           233   1e-72   
ref|XP_011025508.1|  PREDICTED: lactoylglutathione lyase                232   2e-72   
ref|XP_006409867.1|  hypothetical protein EUTSA_v10017750mg             231   4e-72   
ref|XP_002313326.1|  hypothetical protein POPTR_0009s06040g             231   8e-72   Populus trichocarpa [western balsam poplar]
ref|XP_010470082.1|  PREDICTED: lactoylglutathione lyase-like           231   8e-72   
ref|XP_010510624.1|  PREDICTED: lactoylglutathione lyase-like           230   8e-72   
gb|KEH17675.1|  lactoylglutathione lyase/glyoxalase I family protein    231   9e-72   
ref|XP_010068955.1|  PREDICTED: uncharacterized protein LOC104455948    227   2e-70   
gb|KCW65990.1|  hypothetical protein EUGRSUZ_G03282                     226   3e-70   
ref|XP_004959863.1|  PREDICTED: uncharacterized protein LOC101765502    225   1e-69   
ref|XP_004305407.1|  PREDICTED: lactoylglutathione lyase-like           225   2e-69   
ref|XP_008653417.1|  PREDICTED: uncharacterized protein LOC103633514    225   3e-69   
gb|EAZ04990.1|  hypothetical protein OsI_27170                          225   3e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_002463313.1|  hypothetical protein SORBIDRAFT_02g041630          224   6e-69   Sorghum bicolor [broomcorn]
ref|NP_001152631.1|  lactoylglutathione lyase                           223   1e-68   Zea mays [maize]
ref|NP_001060509.1|  Os07g0657100                                       221   7e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007052436.1|  Lactoylglutathione lyase / glyoxalase I fami...    223   8e-68   
ref|XP_003559863.1|  PREDICTED: uncharacterized protein LOC100829748    221   8e-68   
ref|XP_008461357.1|  PREDICTED: lactoylglutathione lyase                221   9e-68   
gb|EMT24138.1|  hypothetical protein F775_26104                         220   2e-67   
ref|XP_006658057.1|  PREDICTED: uncharacterized protein LOC102717631    220   2e-67   
gb|EMS48558.1|  hypothetical protein TRIUR3_13403                       218   4e-67   
gb|ACF74334.1|  lactoylglutathione lyase                                217   2e-66   Arachis hypogaea [goober]
ref|XP_004136133.1|  PREDICTED: lactoylglutathione lyase-like           216   7e-66   
ref|XP_010926993.1|  PREDICTED: uncharacterized protein LOC105049...    215   2e-65   
gb|KGN45087.1|  hypothetical protein Csa_7G420800                       215   1e-64   
ref|XP_004516235.1|  PREDICTED: lactoylglutathione lyase-like           209   1e-63   
ref|XP_008354674.1|  PREDICTED: uncharacterized protein LOC103418323    206   9e-62   
gb|KDO83290.1|  hypothetical protein CISIN_1g047907mg                   201   6e-61   
ref|XP_010926992.1|  PREDICTED: uncharacterized protein LOC105049...    201   2e-59   
ref|XP_009392743.1|  PREDICTED: uncharacterized protein LOC103978621    200   3e-59   
ref|XP_003568834.1|  PREDICTED: uncharacterized protein LOC100821708    174   1e-49   
ref|XP_006655044.1|  PREDICTED: uncharacterized protein LOC102706197    174   2e-49   
ref|NP_001054776.1|  Os05g0171900                                       173   3e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960819.1|  PREDICTED: uncharacterized protein LOC101757142    172   1e-48   
gb|ABR17137.1|  unknown                                                 171   2e-48   Picea sitchensis
gb|AEW07933.1|  hypothetical protein 0_14804_01                         168   3e-48   
dbj|BAJ85628.1|  predicted protein                                      171   4e-48   
ref|XP_006856971.1|  hypothetical protein AMTR_s00190p00012330          168   9e-48   
ref|NP_001149571.1|  lactoylglutathione lyase                           169   2e-47   Zea mays [maize]
gb|AFG69131.1|  hypothetical protein 0_14804_01                         166   4e-47   
gb|AGT16646.1|  lactoylglutathione lyase                                168   6e-47   
ref|XP_002517606.1|  lactoylglutathione lyase, putative                 166   7e-47   Ricinus communis
ref|XP_002439371.1|  hypothetical protein SORBIDRAFT_09g005270          167   8e-47   Sorghum bicolor [broomcorn]
gb|EAY72730.1|  hypothetical protein OsI_00595                          167   8e-47   Oryza sativa Indica Group [Indian rice]
emb|CDO98135.1|  unnamed protein product                                165   2e-46   
ref|XP_010061928.1|  PREDICTED: uncharacterized protein LOC104449460    164   3e-46   
ref|XP_004968374.1|  PREDICTED: uncharacterized protein LOC101776223    166   4e-46   
ref|NP_001152619.1|  lactoylglutathione lyase                           166   5e-46   Zea mays [maize]
ref|XP_002285087.1|  PREDICTED: uncharacterized protein LOC100244070    164   5e-46   Vitis vinifera
ref|XP_002457260.1|  hypothetical protein SORBIDRAFT_03g004330          165   6e-46   Sorghum bicolor [broomcorn]
ref|XP_010097255.1|  hypothetical protein L484_025804                   163   8e-46   
ref|NP_001042158.1|  Os01g0173600                                       164   1e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ10730.1|  hypothetical protein OsJ_00566                          164   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010914889.1|  PREDICTED: uncharacterized protein LOC105040176    163   1e-45   
ref|XP_009801533.1|  PREDICTED: uncharacterized protein LOC104247275    164   1e-45   
dbj|BAJ53235.1|  JHL06P13.16                                            163   1e-45   
emb|CAP72290.1|  Glyoxalase                                             165   1e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002270473.1|  PREDICTED: uncharacterized protein LOC100242353    162   1e-45   Vitis vinifera
ref|XP_009348777.1|  PREDICTED: uncharacterized protein LOC103940388    162   2e-45   
ref|XP_008357276.1|  PREDICTED: uncharacterized protein LOC103421019    162   2e-45   
ref|XP_008792059.1|  PREDICTED: uncharacterized protein LOC103708766    162   3e-45   
gb|ABK24179.1|  unknown                                                 162   3e-45   Picea sitchensis
ref|XP_003565402.1|  PREDICTED: uncharacterized protein LOC100842326    163   3e-45   
ref|XP_009362525.1|  PREDICTED: uncharacterized protein LOC103952618    161   4e-45   
ref|XP_004236038.1|  PREDICTED: uncharacterized protein LOC101250492    161   4e-45   
ref|XP_008243712.1|  PREDICTED: uncharacterized protein LOC103341942    161   5e-45   
ref|XP_004302970.1|  PREDICTED: metallothiol transferase FosB-like      161   6e-45   
ref|XP_006302910.1|  hypothetical protein CARUB_v10021045mg             161   6e-45   
ref|XP_007215072.1|  hypothetical protein PRUPE_ppa012380mg             161   6e-45   
ref|XP_007023869.1|  Lactoylglutathione lyase / glyoxalase I fami...    160   8e-45   
gb|KHG29618.1|  Metallothiol transferase fosB                           161   9e-45   
ref|XP_004506908.1|  PREDICTED: uncharacterized protein YwkD-like       160   1e-44   
ref|XP_009594193.1|  PREDICTED: uncharacterized protein LOC104090726    160   1e-44   
gb|KDP42432.1|  hypothetical protein JCGZ_00229                         161   1e-44   
ref|XP_009802082.1|  PREDICTED: uncharacterized protein LOC104247701    160   1e-44   
ref|XP_010065333.1|  PREDICTED: uncharacterized protein LOC104452578    161   2e-44   
gb|EMT20922.1|  hypothetical protein F775_15409                         160   2e-44   
gb|KCW79803.1|  hypothetical protein EUGRSUZ_C01137                     159   2e-44   
ref|XP_002889306.1|  lactoylglutathione lyase family protein            159   2e-44   
gb|ABK26885.1|  unknown                                                 160   2e-44   Picea sitchensis
ref|XP_009604167.1|  PREDICTED: uncharacterized protein LOC104099009    159   3e-44   
ref|NP_001235416.1|  uncharacterized protein LOC100305695               159   3e-44   
ref|XP_009608053.1|  PREDICTED: uncharacterized protein LOC104102125    160   4e-44   
ref|XP_009778075.1|  PREDICTED: uncharacterized protein LOC104227516    158   5e-44   
ref|XP_010532163.1|  PREDICTED: uncharacterized protein LOC104808228    158   5e-44   
gb|KHG30572.1|  Metallothiol transferase fosB                           158   5e-44   
ref|XP_006364200.1|  PREDICTED: uncharacterized protein LOC102594644    159   6e-44   
ref|XP_010430002.1|  PREDICTED: uncharacterized protein LOC104714...    158   6e-44   
ref|XP_010472977.1|  PREDICTED: uncharacterized protein LOC104752515    158   6e-44   
ref|XP_007135739.1|  hypothetical protein PHAVU_010G154400g             160   7e-44   
ref|XP_010417742.1|  PREDICTED: uncharacterized protein LOC104703428    158   7e-44   
ref|XP_009606733.1|  PREDICTED: uncharacterized protein LOC104101037    160   7e-44   
ref|XP_009388525.1|  PREDICTED: uncharacterized protein LOC103975318    159   7e-44   
ref|XP_009785992.1|  PREDICTED: uncharacterized protein LOC104234167    159   9e-44   
gb|ACF74315.1|  lactoylglutathione lyase                                158   1e-43   Arachis hypogaea [goober]
gb|KEH28697.1|  lactoylglutathione lyase/glyoxalase I family protein    157   1e-43   
ref|XP_008673641.1|  PREDICTED: uncharacterized protein LOC103649687    160   1e-43   
ref|XP_009402147.1|  PREDICTED: uncharacterized protein LOC103986010    157   1e-43   
ref|XP_010691164.1|  PREDICTED: uncharacterized protein LOC104904575    157   1e-43   
gb|ACU18440.1|  unknown                                                 157   1e-43   Glycine max [soybeans]
ref|XP_009402148.1|  PREDICTED: uncharacterized protein LOC103986012    157   1e-43   
ref|XP_010250045.1|  PREDICTED: uncharacterized protein LOC104592394    158   1e-43   
gb|KHN01342.1|  hypothetical protein glysoja_009548                     157   2e-43   
ref|XP_006450972.1|  hypothetical protein CICLE_v10009574mg             157   2e-43   
ref|XP_009402188.1|  PREDICTED: uncharacterized protein LOC103986041    157   2e-43   
ref|XP_006475817.1|  PREDICTED: uncharacterized protein LOC102622259    157   2e-43   
ref|NP_565231.1|  GLYOXYLASE I 7                                        157   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011035678.1|  PREDICTED: uncharacterized protein LOC105133400    157   2e-43   
emb|CAN75608.1|  hypothetical protein VITISV_040444                     156   3e-43   Vitis vinifera
ref|NP_001237532.1|  uncharacterized protein LOC100306100               157   3e-43   
ref|XP_006349336.1|  PREDICTED: uncharacterized protein LOC102593899    157   3e-43   
gb|EYU26486.1|  hypothetical protein MIMGU_mgv1a013702mg                158   3e-43   
ref|XP_009621424.1|  PREDICTED: uncharacterized protein LOC104113047    158   3e-43   
ref|XP_010088321.1|  hypothetical protein L484_005835                   156   4e-43   
ref|XP_002298106.2|  hypothetical protein POPTR_0001s17160g             158   4e-43   Populus trichocarpa [western balsam poplar]
gb|KFK42418.1|  hypothetical protein AALP_AA2G253600                    156   4e-43   
ref|XP_002270395.1|  PREDICTED: uncharacterized protein LOC100247488    156   5e-43   Vitis vinifera
ref|XP_009770635.1|  PREDICTED: uncharacterized protein LOC104221297    157   5e-43   
emb|CDY37573.1|  BnaA02g19970D                                          155   5e-43   
ref|XP_010033948.1|  PREDICTED: uncharacterized protein LOC104423170    156   5e-43   
ref|XP_010049980.1|  PREDICTED: glyoxalase domain-containing prot...    155   6e-43   
gb|AAD55473.1|AC009322_13  Hypothetical protein                         157   6e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KHN15103.1|  hypothetical protein glysoja_011721                     155   6e-43   
gb|AFK41458.1|  unknown                                                 155   7e-43   
ref|XP_009128447.1|  PREDICTED: uncharacterized protein LOC103853278    155   7e-43   
ref|XP_009403405.1|  PREDICTED: uncharacterized protein LOC103986970    158   8e-43   
ref|XP_008461098.1|  PREDICTED: uncharacterized protein LOC103499788    155   8e-43   
ref|XP_004230457.1|  PREDICTED: uncharacterized protein LOC101243831    157   1e-42   
ref|XP_008781506.1|  PREDICTED: uncharacterized protein LOC103701277    156   1e-42   
emb|CDY38650.1|  BnaC02g23290D                                          155   1e-42   
ref|XP_008784259.1|  PREDICTED: uncharacterized protein LOC103703257    156   1e-42   
ref|XP_003609290.1|  hypothetical protein MTR_4g114080                  155   1e-42   
ref|NP_001236449.1|  uncharacterized protein LOC100305770               154   1e-42   
gb|KHG26581.1|  Metallothiol transferase fosB                           154   1e-42   
ref|XP_006593342.1|  PREDICTED: uncharacterized protein LOC100305...    154   2e-42   
ref|XP_004512116.1|  PREDICTED: uncharacterized protein LOC101496496    155   2e-42   
ref|XP_010263898.1|  PREDICTED: uncharacterized protein LOC104602042    155   2e-42   
ref|XP_006349333.1|  PREDICTED: uncharacterized protein LOC102593019    156   2e-42   
gb|AFK47459.1|  unknown                                                 155   2e-42   
ref|XP_007041249.1|  Lactoylglutathione lyase / glyoxalase I fami...    155   2e-42   
ref|XP_010912492.1|  PREDICTED: uncharacterized protein LOC105038392    155   2e-42   
ref|XP_007013389.1|  Lactoylglutathione lyase / glyoxalase I fami...    154   2e-42   
emb|CDY71329.1|  BnaC02g46640D                                          154   2e-42   
ref|XP_004252486.1|  PREDICTED: uncharacterized protein LOC101249440    154   3e-42   
ref|XP_006389762.1|  hypothetical protein EUTSA_v10019227mg             154   3e-42   
ref|XP_009407659.1|  PREDICTED: uncharacterized protein LOC103990300    154   3e-42   
ref|XP_004135860.1|  PREDICTED: uncharacterized protein LOC101209593    154   3e-42   
ref|XP_006425532.1|  hypothetical protein CICLE_v10026552mg             154   4e-42   
gb|AES95089.2|  lactoylglutathione lyase/glyoxalase I family protein    155   4e-42   
ref|XP_006438925.1|  hypothetical protein CICLE_v10033699mg             151   4e-42   
ref|XP_010271470.1|  PREDICTED: uncharacterized protein LOC104607512    154   4e-42   
emb|CDO97602.1|  unnamed protein product                                155   4e-42   
ref|XP_006476111.1|  PREDICTED: uncharacterized protein LOC102629469    154   5e-42   
ref|XP_010263899.1|  PREDICTED: uncharacterized protein LOC104602043    154   5e-42   
ref|XP_007200863.1|  hypothetical protein PRUPE_ppa027137mg             153   5e-42   
ref|XP_002531512.1|  lactoylglutathione lyase, putative                 154   6e-42   Ricinus communis
ref|XP_010256292.1|  PREDICTED: uncharacterized protein LOC104596717    154   6e-42   
ref|XP_010476624.1|  PREDICTED: uncharacterized protein LOC104755853    153   6e-42   
ref|XP_011040040.1|  PREDICTED: uncharacterized protein LOC105136415    153   7e-42   
ref|XP_002524466.1|  lactoylglutathione lyase, putative                 154   7e-42   Ricinus communis
ref|XP_007046744.1|  Lactoylglutathione lyase / glyoxalase I fami...    153   8e-42   
ref|XP_010459070.1|  PREDICTED: uncharacterized protein LOC104740...    153   8e-42   
ref|XP_007154988.1|  hypothetical protein PHAVU_003G163400g             152   1e-41   
ref|XP_009598365.1|  PREDICTED: uncharacterized protein LOC104094188    153   1e-41   
ref|XP_006842870.1|  hypothetical protein AMTR_s00081p00168190          152   1e-41   
ref|XP_006598804.1|  PREDICTED: uncharacterized protein LOC102662470    152   1e-41   
gb|KHG15596.1|  Metallothiol transferase fosB                           152   1e-41   
ref|XP_004231328.1|  PREDICTED: glyoxalase domain-containing prot...    153   1e-41   
ref|XP_009117831.1|  PREDICTED: uncharacterized protein LOC103842901    152   2e-41   
ref|XP_009402190.1|  PREDICTED: nucleobase-ascorbate transporter ...    161   2e-41   
gb|KHN39666.1|  Metallothiol transferase fosB                           152   2e-41   
ref|XP_006305709.1|  hypothetical protein CARUB_v10010450mg             152   2e-41   
ref|XP_009402807.1|  PREDICTED: uncharacterized protein LOC103986514    153   2e-41   
ref|XP_011088117.1|  PREDICTED: uncharacterized protein LOC105169423    150   2e-41   
emb|CDY39639.1|  BnaC05g11680D                                          151   3e-41   
emb|CDY55981.1|  BnaA09g56790D                                          151   3e-41   
ref|XP_004287347.1|  PREDICTED: metallothiol transferase FosB-lik...    152   3e-41   
gb|EPS59665.1|  hypothetical protein M569_15140                         151   3e-41   
ref|XP_004287830.1|  PREDICTED: uncharacterized protein LOC101304803    152   3e-41   
ref|XP_010497101.1|  PREDICTED: uncharacterized protein LOC104774130    151   3e-41   
ref|XP_010254369.1|  PREDICTED: uncharacterized protein LOC104595363    152   3e-41   
ref|XP_007223440.1|  hypothetical protein PRUPE_ppa011519mg             152   3e-41   
ref|XP_002303256.2|  lactoylglutathione lyase family protein            151   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_010087426.1|  hypothetical protein L484_018453                   154   3e-41   
gb|ABK22105.1|  unknown                                                 152   3e-41   Picea sitchensis
emb|CDX81709.1|  BnaC08g38920D                                          151   4e-41   
ref|XP_003612131.1|  Lactoylglutathione lyase                           152   4e-41   
gb|KHF99790.1|  Lactoylglutathione lyase                                152   4e-41   
ref|XP_004508519.1|  PREDICTED: uncharacterized protein YwkD-like       151   4e-41   
gb|AFK37770.1|  unknown                                                 151   4e-41   
ref|XP_010277693.1|  PREDICTED: uncharacterized protein LOC104612074    152   4e-41   
ref|XP_010930831.1|  PREDICTED: uncharacterized protein LOC105051...    152   4e-41   
ref|XP_010271469.1|  PREDICTED: uncharacterized protein LOC104607511    152   4e-41   
ref|XP_011047942.1|  PREDICTED: uncharacterized protein LOC105142135    152   5e-41   
ref|XP_010930832.1|  PREDICTED: uncharacterized protein LOC105051...    152   5e-41   
ref|XP_009110487.1|  PREDICTED: uncharacterized protein LOC103836030    151   5e-41   
emb|CDX83979.1|  BnaC08g16660D                                          150   5e-41   
ref|XP_009148927.1|  PREDICTED: uncharacterized protein LOC103872329    150   6e-41   
ref|XP_004509342.1|  PREDICTED: uncharacterized protein LOC101515606    151   6e-41   
gb|KDP32380.1|  hypothetical protein JCGZ_13305                         151   7e-41   
ref|XP_002890101.1|  lactoylglutathione lyase family protein            150   7e-41   
ref|NP_563973.1|  Lactoylglutathione lyase / glyoxalase I family ...    150   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781311.1|  PREDICTED: lactoylglutathione lyase-like           150   1e-40   
gb|KHN47772.1|  hypothetical protein glysoja_029190                     149   1e-40   
ref|XP_004251570.1|  PREDICTED: uncharacterized protein LOC101264...    149   1e-40   
ref|XP_006389541.1|  hypothetical protein POPTR_0022s00750g             151   1e-40   
emb|CDX96844.1|  BnaA08g23870D                                          149   1e-40   
gb|KHG30040.1|  Metallothiol transferase fosB                           150   2e-40   
ref|XP_010113383.1|  hypothetical protein L484_026715                   150   2e-40   
ref|XP_007203893.1|  hypothetical protein PRUPE_ppa012053mg             150   2e-40   
ref|XP_008218743.1|  PREDICTED: uncharacterized protein LOC103319...    150   2e-40   
ref|XP_002526462.1|  lactoylglutathione lyase, putative                 151   2e-40   Ricinus communis
gb|ABK93893.1|  unknown                                                 150   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008218742.1|  PREDICTED: uncharacterized protein LOC103319...    150   2e-40   
ref|XP_011072230.1|  PREDICTED: uncharacterized protein LOC105157526    149   2e-40   
gb|KHN31586.1|  hypothetical protein glysoja_043029                     149   2e-40   
ref|XP_010033467.1|  PREDICTED: uncharacterized protein LOC104422744    150   2e-40   
ref|NP_001236582.1|  uncharacterized protein LOC100305781               149   2e-40   
ref|XP_006465353.1|  PREDICTED: uncharacterized protein LOC102630180    149   2e-40   
ref|XP_006389542.1|  hypothetical protein POPTR_0022s00750g             150   3e-40   
ref|XP_006427237.1|  hypothetical protein CICLE_v10026643mg             149   3e-40   
ref|XP_009780118.1|  PREDICTED: lactoylglutathione lyase-like           149   3e-40   
ref|XP_008242749.1|  PREDICTED: uncharacterized protein LOC103341047    149   4e-40   
ref|XP_006431676.1|  hypothetical protein CICLE_v10002584mg             149   5e-40   
ref|XP_008241797.1|  PREDICTED: lactoylglutathione lyase-like           149   5e-40   
ref|XP_006383134.1|  hypothetical protein POPTR_0005s11890g             149   5e-40   
ref|XP_003631871.2|  PREDICTED: lactoylglutathione lyase-like           149   6e-40   
ref|XP_006364901.1|  PREDICTED: uncharacterized protein LOC102595975    147   6e-40   
gb|EYU21620.1|  hypothetical protein MIMGU_mgv1a014857mg                148   6e-40   
ref|XP_008465032.1|  PREDICTED: uncharacterized protein LOC103502748    149   6e-40   
gb|KDP46697.1|  hypothetical protein JCGZ_06485                         148   7e-40   
gb|KDO80289.1|  hypothetical protein CISIN_1g029305mg                   148   8e-40   
ref|XP_010049979.1|  PREDICTED: uncharacterized protein LOC104438513    147   1e-39   
ref|XP_010271474.1|  PREDICTED: uncharacterized protein LOC104607...    146   1e-39   
ref|XP_006385027.1|  hypothetical protein POPTR_0004s23200g             148   1e-39   
ref|NP_001237480.1|  uncharacterized protein LOC100305841               147   2e-39   
ref|XP_009378199.1|  PREDICTED: uncharacterized protein LOC103966725    147   2e-39   
ref|XP_009338642.1|  PREDICTED: uncharacterized protein LOC103930963    147   2e-39   
emb|CDP01926.1|  unnamed protein product                                147   2e-39   
gb|AFK38981.1|  unknown                                                 147   3e-39   
ref|XP_010271473.1|  PREDICTED: uncharacterized protein LOC104607...    147   3e-39   
ref|XP_008244727.1|  PREDICTED: uncharacterized protein LOC103342852    146   3e-39   
gb|KFK43791.1|  hypothetical protein AALP_AA1G173300                    146   3e-39   
ref|XP_011028328.1|  PREDICTED: uncharacterized protein LOC105128...    147   3e-39   
ref|XP_002309802.1|  hypothetical protein POPTR_0007s01900g             145   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_007157944.1|  hypothetical protein PHAVU_002G111300g             147   3e-39   
ref|XP_011028331.1|  PREDICTED: uncharacterized protein LOC105128...    147   3e-39   
gb|EPS70220.1|  hypothetical protein M569_04537                         145   3e-39   
ref|XP_011028327.1|  PREDICTED: uncharacterized protein LOC105128...    147   3e-39   
ref|XP_009355289.1|  PREDICTED: uncharacterized protein LOC103946346    147   4e-39   
gb|KDO71123.1|  hypothetical protein CISIN_1g029033mg                   147   4e-39   
ref|XP_006471156.1|  PREDICTED: uncharacterized protein LOC102612635    147   4e-39   
ref|XP_009618674.1|  PREDICTED: uncharacterized protein LOC104110822    147   5e-39   
gb|AFK47501.1|  unknown                                                 144   6e-39   
ref|XP_002310845.1|  hypothetical protein POPTR_0007s13840g             146   6e-39   Populus trichocarpa [western balsam poplar]
ref|XP_003629350.1|  Lactoylglutathione lyase                           146   7e-39   
ref|XP_011028775.1|  PREDICTED: uncharacterized protein LOC105128688    145   7e-39   
ref|XP_004287346.1|  PREDICTED: metallothiol transferase FosB-lik...    146   8e-39   
ref|XP_009599860.1|  PREDICTED: lactoylglutathione lyase-like           145   1e-38   
ref|XP_003597871.1|  Metallothiol transferase fosB                      144   1e-38   
ref|NP_001238378.1|  uncharacterized protein LOC100499688               145   1e-38   
ref|XP_008365316.1|  PREDICTED: uncharacterized protein LOC103428958    147   1e-38   
ref|XP_008372764.1|  PREDICTED: uncharacterized protein LOC103436125    145   1e-38   
emb|CBI29715.3|  unnamed protein product                                145   1e-38   
ref|XP_008372762.1|  PREDICTED: lactoylglutathione lyase-like           145   1e-38   
ref|XP_002263444.1|  PREDICTED: uncharacterized protein LOC100266411    145   1e-38   
ref|XP_007148556.1|  hypothetical protein PHAVU_006G218600g             146   2e-38   
ref|XP_006450973.1|  hypothetical protein CICLE_v10010755mg             144   2e-38   
ref|XP_004151211.1|  PREDICTED: uncharacterized protein LOC101203188    144   3e-38   
ref|XP_004486683.1|  PREDICTED: metallothiol transferase FosB 2-like    143   3e-38   
ref|XP_011092314.1|  PREDICTED: uncharacterized protein LOC105172535    145   4e-38   
ref|XP_001782171.1|  predicted protein                                  143   4e-38   
ref|XP_009415753.1|  PREDICTED: glyoxalase domain-containing prot...    142   5e-38   
ref|XP_006652586.1|  PREDICTED: uncharacterized protein LOC102704697    143   5e-38   
ref|XP_006346650.1|  PREDICTED: uncharacterized protein LOC102599142    142   6e-38   
ref|XP_003592932.1|  Metallothiol transferase fosB                      143   7e-38   
emb|CAN76551.1|  hypothetical protein VITISV_004420                     142   2e-37   
gb|KDP46698.1|  hypothetical protein JCGZ_06486                         142   2e-37   
gb|KDP46699.1|  hypothetical protein JCGZ_06487                         142   3e-37   
ref|XP_002970945.1|  hypothetical protein SELMODRAFT_94230              140   3e-37   
ref|XP_010545777.1|  PREDICTED: uncharacterized protein LOC104818034    140   3e-37   
ref|NP_001053434.1|  Os04g0538900                                       140   7e-37   
ref|XP_007150729.1|  hypothetical protein PHAVU_005G176100g             141   8e-37   
ref|XP_006340705.1|  PREDICTED: lactoylglutathione lyase-like           140   1e-36   
ref|XP_004232464.1|  PREDICTED: lactoylglutathione lyase-like           139   1e-36   
ref|XP_008357640.1|  PREDICTED: uncharacterized protein LOC103421393    143   3e-36   
gb|EMS60611.1|  hypothetical protein TRIUR3_34137                       141   4e-36   
ref|XP_001769353.1|  predicted protein                                  136   1e-35   
ref|XP_006343374.1|  PREDICTED: uncharacterized protein LOC102590728    136   3e-35   
ref|XP_003597869.1|  hypothetical protein MTR_2g103460                  135   4e-35   
ref|XP_001782990.1|  predicted protein                                  134   6e-35   
ref|XP_006416913.1|  hypothetical protein EUTSA_v10008912mg             135   6e-35   
gb|KHN22460.1|  hypothetical protein glysoja_024969                     134   8e-35   
ref|XP_009403272.1|  PREDICTED: uncharacterized protein LOC103986843    134   9e-35   
ref|XP_002967188.1|  hypothetical protein SELMODRAFT_439738             134   2e-34   
ref|XP_011025918.1|  PREDICTED: uncharacterized protein LOC105126680    132   9e-34   
ref|XP_010919439.1|  PREDICTED: uncharacterized protein LOC105043568    131   1e-33   
ref|XP_010459071.1|  PREDICTED: uncharacterized protein LOC104740...    130   2e-33   
dbj|BAJ99951.1|  predicted protein                                      129   6e-33   
gb|KCW82516.1|  hypothetical protein EUGRSUZ_C03913                     129   2e-32   
gb|ABD28405.2|  Glyoxalase/bleomycin resistance protein/dioxygenase     126   2e-31   
ref|XP_004976384.1|  PREDICTED: uncharacterized protein LOC101777224    124   6e-31   
ref|XP_002446863.1|  hypothetical protein SORBIDRAFT_06g023890          124   7e-31   
ref|XP_008791704.1|  PREDICTED: uncharacterized protein LOC103708522    123   1e-30   
gb|KDO80293.1|  hypothetical protein CISIN_1g036243mg                   122   1e-30   
ref|XP_009629333.1|  PREDICTED: uncharacterized protein LOC104119517    122   4e-30   
ref|XP_001695866.1|  hypothetical protein CHLREDRAFT_104003             121   5e-30   
gb|KEH44439.1|  lactoylglutathione lyase/glyoxalase I family protein    121   5e-30   
gb|KCW68975.1|  hypothetical protein EUGRSUZ_F02538                     120   8e-30   
gb|EMT24670.1|  hypothetical protein F775_19881                         121   2e-29   
ref|XP_006854877.1|  hypothetical protein AMTR_s00182p00048530          118   2e-28   
ref|XP_005646543.1|  Glyoxalase/Bleomycin resistance protein/Dihy...    115   4e-28   
gb|KHN36051.1|  hypothetical protein glysoja_003174                     115   8e-28   
ref|XP_002952841.1|  hypothetical protein VOLCADRAFT_62902              115   1e-27   
dbj|BAK05838.1|  predicted protein                                      114   2e-27   
ref|XP_010313702.1|  PREDICTED: uncharacterized protein LOC101264...    112   6e-27   
gb|EMS52469.1|  hypothetical protein TRIUR3_27380                       111   1e-26   
ref|XP_005847028.1|  hypothetical protein CHLNCDRAFT_31396              111   1e-25   
gb|ABK26156.1|  unknown                                                 107   2e-24   
ref|NP_001077851.1|  GLYOXYLASE I 7                                     104   1e-23   
gb|KDO43371.1|  hypothetical protein CISIN_1g0429452mg                  103   1e-23   
gb|KCW82223.1|  hypothetical protein EUGRSUZ_C03639                     103   3e-23   
ref|XP_010930833.1|  PREDICTED: uncharacterized protein LOC105051...    103   6e-23   
ref|XP_010930834.1|  PREDICTED: uncharacterized protein LOC105051...    102   6e-23   
ref|XP_006425533.1|  hypothetical protein CICLE_v10026552mg             102   1e-22   
ref|XP_008671456.1|  PREDICTED: uncharacterized protein LOC103648836  98.6    2e-21   
ref|XP_008644824.1|  PREDICTED: uncharacterized protein LOC103626202  96.3    3e-21   
ref|XP_006279353.1|  hypothetical protein CARUB_v10008045mg           95.9    7e-21   
ref|XP_006450971.1|  hypothetical protein CICLE_v10009574mg           95.5    1e-20   
gb|KDO80291.1|  hypothetical protein CISIN_1g029305mg                 95.5    1e-20   
ref|XP_009782478.1|  PREDICTED: uncharacterized protein LOC104231221  95.9    1e-20   
ref|XP_007202864.1|  hypothetical protein PRUPE_ppa015560mg           94.7    1e-20   
gb|KCW53108.1|  hypothetical protein EUGRSUZ_J02400                   91.7    4e-19   
ref|XP_006279294.1|  hypothetical protein CARUB_v10016526mg           90.9    5e-19   
gb|KHN47166.1|  hypothetical protein glysoja_022467                   88.2    2e-18   
gb|AFK34097.1|  unknown                                               88.6    2e-18   
ref|XP_011016833.1|  PREDICTED: uncharacterized protein LOC105120369  87.4    4e-18   
ref|XP_005707253.1|  hypothetical protein Gasu_19720                  83.2    4e-16   
emb|CDY65249.1|  BnaC07g50510D                                        80.9    8e-16   
tpg|DAA36659.1|  TPA: hypothetical protein ZEAMMB73_840050            79.3    5e-15   
ref|WP_002654663.1|  hypothetical protein                             78.6    1e-14   
gb|KDD76200.1|  hypothetical protein H632_c317p0                      79.7    1e-14   
ref|NP_001148141.1|  lactoylglutathione lyase                         78.6    2e-14   
ref|XP_007202916.1|  hypothetical protein PRUPE_ppa016181mg           76.3    2e-14   
gb|KHN32396.1|  hypothetical protein glysoja_026290                   74.7    6e-14   
gb|ACG48997.1|  lactoylglutathione lyase                              74.3    4e-13   
ref|WP_007918513.1|  Glyoxalase/bleomycin resistance protein/diox...  72.0    3e-12   
ref|XP_004486233.1|  PREDICTED: uncharacterized protein LOC101498649  70.1    7e-12   
gb|EWM21285.1|  lactoylglutathione lyase glyoxalase i-like protein    73.9    1e-11   
ref|XP_009603155.1|  PREDICTED: uncharacterized protein LOC104098188  69.3    2e-11   
ref|XP_009620487.1|  PREDICTED: uncharacterized protein LOC104112312  67.8    5e-11   
gb|KGN65311.1|  hypothetical protein Csa_1G313810                     67.0    1e-10   
gb|KHN11710.1|  hypothetical protein glysoja_006163                   65.5    1e-10   
gb|ACJ84047.1|  unknown                                               66.2    2e-10   
ref|WP_035341625.1|  glyoxalase                                       66.6    2e-10   
ref|XP_004343324.1|  glyoxalase family protein                        67.0    8e-10   
ref|XP_005842954.1|  hypothetical protein CHLNCDRAFT_141766           65.9    8e-10   
ref|WP_012876198.1|  glyoxalase/bleomycin resistance protein/diox...  63.9    2e-09   
ref|WP_035862524.1|  glyoxalase                                       63.5    3e-09   
ref|XP_006489402.1|  PREDICTED: lactoylglutathione lyase-like         63.5    3e-09   
ref|WP_008080807.1|  hypothetical protein                             63.5    4e-09   
ref|WP_020157717.1|  hypothetical protein                             63.2    5e-09   
ref|XP_010024279.1|  PREDICTED: uncharacterized protein LOC104414796  63.2    5e-09   
ref|WP_028349801.1|  glyoxalase                                       62.8    9e-09   
gb|ABK25860.1|  unknown                                               61.2    9e-09   
ref|XP_008390907.1|  PREDICTED: methylmalonyl-CoA epimerase, mito...  62.0    1e-08   
ref|WP_036279261.1|  hypothetical protein                             61.6    2e-08   
gb|ADD24468.1|  Lactoylglutathione lyase                              63.9    2e-08   
ref|WP_027583469.1|  glyoxalase                                       62.0    2e-08   
ref|WP_029928282.1|  glyoxalase                                       62.0    2e-08   
ref|WP_034469987.1|  glyoxalase                                       61.2    2e-08   
ref|WP_036001594.1|  glyoxalase                                       61.6    2e-08   
ref|WP_024510718.1|  glyoxalase                                       61.6    2e-08   
ref|WP_017725883.1|  hypothetical protein                             61.2    2e-08   
ref|WP_014496211.1|  glyoxalase                                       61.2    3e-08   
ref|XP_008347914.1|  PREDICTED: uncharacterized protein LOC103411046  60.8    3e-08   
ref|WP_027538958.1|  glyoxalase                                       61.2    3e-08   
ref|XP_009335334.1|  PREDICTED: lactoylglutathione lyase              60.8    3e-08   
ref|WP_039799280.1|  glyoxalase                                       61.2    3e-08   
ref|WP_038954992.1|  glyoxalase                                       60.8    3e-08   
ref|WP_039815734.1|  glyoxalase                                       60.8    4e-08   
ref|WP_012823152.1|  glyoxalase                                       60.5    4e-08   
ref|WP_036297927.1|  glyoxalase                                       60.5    4e-08   
ref|WP_036254111.1|  glyoxalase                                       60.5    4e-08   
ref|WP_034891195.1|  diguanylate cyclase                              60.5    4e-08   
ref|XP_010024271.1|  PREDICTED: uncharacterized protein LOC104414793  60.5    5e-08   
ref|WP_038572046.1|  glyoxalase                                       60.5    6e-08   
ref|XP_010317742.1|  PREDICTED: uncharacterized protein LOC104646188  60.5    6e-08   
ref|WP_018459390.1|  glyoxalase                                       60.1    6e-08   
ref|XP_004511363.1|  PREDICTED: lactoylglutathione lyase-like         60.1    7e-08   
ref|WP_034193603.1|  glyoxalase                                       60.5    7e-08   
ref|WP_020054797.1|  hypothetical protein                             60.1    7e-08   
gb|AIO39057.1|  glyoxalase/Bleomycin resistance /Dioxygenase supe...  59.7    7e-08   
ref|WP_027517244.1|  MULTISPECIES: glyoxalase                         60.1    7e-08   
ref|WP_038946261.1|  glyoxalase                                       60.1    8e-08   
ref|WP_025576425.1|  glyoxalase                                       60.1    8e-08   
ref|WP_007608751.1|  glyoxalase                                       60.1    8e-08   
ref|WP_019308302.1|  glyoxalase                                       59.3    9e-08   
ref|WP_012043568.1|  glyoxalase                                       59.7    9e-08   
ref|WP_024338371.1|  glyoxalase                                       59.7    1e-07   
ref|WP_019422567.1|  hypothetical protein                             59.3    1e-07   
gb|AFK34573.1|  unknown                                               59.3    1e-07   
ref|XP_001764314.1|  predicted protein                                59.7    1e-07   
ref|WP_028097443.1|  hypothetical protein                             59.7    1e-07   
ref|WP_029118610.1|  glyoxalase                                       59.3    1e-07   
ref|WP_028167049.1|  glyoxalase                                       59.3    1e-07   
ref|WP_028145311.1|  MULTISPECIES: glyoxalase                         59.3    1e-07   
ref|WP_038971002.1|  glyoxalase                                       59.3    1e-07   
ref|WP_029374004.1|  glyoxalase                                       59.3    1e-07   
ref|WP_025035540.1|  glyoxalase                                       58.9    2e-07   
ref|WP_009797386.1|  glyoxalase                                       58.9    2e-07   
ref|WP_014899283.1|  diguanylate cyclase                              58.9    2e-07   
ref|XP_005646329.1|  Glyoxalase/Bleomycin resistance protein/Dihy...  59.7    2e-07   
ref|WP_024516119.1|  glyoxalase                                       58.9    2e-07   
ref|WP_014351942.1|  glyoxalase                                       58.9    2e-07   
ref|WP_027544554.1|  glyoxalase                                       58.9    2e-07   
ref|WP_006609966.1|  glyoxalase                                       58.9    2e-07   
ref|WP_020100021.1|  glyoxalase                                       58.9    2e-07   
ref|WP_036243736.1|  glyoxalase                                       58.5    2e-07   
ref|WP_024582308.1|  glyoxalase                                       58.5    2e-07   
emb|CAN75175.1|  hypothetical protein VITISV_031575                   57.0    3e-07   
ref|WP_011314505.1|  glyoxalase                                       58.2    3e-07   
ref|WP_007592597.1|  glyoxalase                                       58.5    3e-07   
ref|WP_011880434.1|  MULTISPECIES: glyoxalase                         58.5    3e-07   
ref|WP_011509984.1|  glyoxalase                                       58.2    3e-07   
ref|WP_020021186.1|  hypothetical protein                             58.2    3e-07   
ref|WP_018953112.1|  glyoxalase                                       57.8    3e-07   
ref|WP_028159844.1|  glyoxalase                                       58.2    3e-07   
ref|WP_022726099.1|  hypothetical protein                             58.2    3e-07   
ref|WP_028146756.1|  glyoxalase                                       58.2    3e-07   
ref|XP_004296757.1|  PREDICTED: methylmalonyl-CoA epimerase, mito...  58.2    3e-07   
gb|EGD05229.1|  glyoxalase/bleomycin resistance protein/dioxygenase   58.2    4e-07   
ref|WP_011658895.1|  diguanylate cyclase                              58.2    4e-07   
ref|WP_035701527.1|  glyoxalase                                       57.8    4e-07   
ref|WP_015686981.1|  glyoxalase                                       57.8    4e-07   
ref|WP_021082301.1|  2,5-diketo-D-gluconate reductase                 57.8    4e-07   
ref|WP_039280944.1|  bleomycin resistance protein                     57.8    4e-07   
ref|WP_009470552.1|  hypothetical protein                             57.4    5e-07   
ref|WP_012637725.1|  glyoxalase                                       57.4    5e-07   
ref|WP_018319974.1|  glyoxalase                                       57.8    5e-07   
ref|WP_011086522.1|  MULTISPECIES: glyoxalase                         57.8    5e-07   
ref|WP_017524778.1|  hypothetical protein                             57.8    5e-07   
ref|WP_028170827.1|  MULTISPECIES: glyoxalase                         57.8    5e-07   
ref|WP_014020498.1|  glyoxalase                                       57.4    5e-07   
ref|WP_035964432.1|  glyoxalase                                       57.8    5e-07   
ref|WP_016843272.1|  glyoxalase                                       57.8    5e-07   
ref|WP_011493152.1|  extradiol dioxygenase                            57.8    5e-07   
ref|WP_026461943.1|  glyoxalase                                       57.4    6e-07   
ref|WP_010509293.1|  glyoxalase                                       57.0    6e-07   
ref|WP_006751821.1|  diguanylate cyclase                              57.4    6e-07   
ref|WP_012366129.1|  diguanylate cyclase                              57.0    7e-07   
ref|WP_037069588.1|  lactoylglutathione lyase                         57.0    7e-07   
ref|WP_036538108.1|  glyoxalase                                       57.4    7e-07   
ref|WP_027555885.1|  glyoxalase                                       57.4    7e-07   
ref|WP_025039660.1|  diguanylate cyclase                              57.0    7e-07   
ref|WP_039223610.1|  glyoxalase                                       57.4    8e-07   
ref|WP_020891843.1|  hypothetical protein                             57.0    8e-07   
ref|WP_013930223.1|  glyoxalase                                       57.0    8e-07   
ref|WP_026312391.1|  glyoxalase                                       57.0    8e-07   
ref|WP_012960829.1|  glyoxalase                                       56.6    8e-07   
dbj|GAJ82191.1|  putative lactoylglutathione lyase                    57.0    9e-07   
ref|XP_009418946.1|  PREDICTED: lactoylglutathione lyase              56.6    9e-07   
ref|WP_012374073.1|  glyoxalase                                       57.0    1e-06   
ref|WP_006757564.1|  diguanylate cyclase                              56.6    1e-06   
ref|WP_030174823.1|  glyoxalase                                       57.0    1e-06   
ref|WP_029582239.1|  glyoxalase                                       56.6    1e-06   
ref|WP_035956791.1|  glyoxalase                                       57.0    1e-06   
ref|XP_011026622.1|  PREDICTED: lactoylglutathione lyase              56.6    1e-06   
ref|XP_003610727.1|  Lactoylglutathione lyase                         56.6    1e-06   
ref|WP_015666069.1|  hypothetical protein                             56.6    1e-06   
ref|WP_026673291.1|  glyoxalase                                       56.2    1e-06   
ref|WP_010558573.1|  lactoylglutathione lyase                         56.6    1e-06   
ref|WP_027557207.1|  MULTISPECIES: glyoxalase                         56.6    1e-06   
ref|WP_027532141.1|  glyoxalase                                       56.6    1e-06   
ref|WP_035975661.1|  glyoxalase                                       56.6    1e-06   
ref|WP_008636440.1|  MULTISPECIES: glyoxalase/bleomycin resistanc...  56.2    1e-06   



>ref|XP_010679102.1| PREDICTED: uncharacterized protein LOC104894542 [Beta vulgaris 
subsp. vulgaris]
Length=189

 Score =   251 bits (641),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 143/176 (81%), Gaps = 6/176 (3%)
 Frame = +2

Query  71   REERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAW  250
            RE+    +K EE DE P MALNHVSRLCRSVKDS++FYTKVLG V +ERP AFD FDGAW
Sbjct  9    REDDESGKKDEEKDELPLMALNHVSRLCRSVKDSIEFYTKVLGFVVIERPHAFD-FDGAW  67

Query  251  LFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMK  430
            LFNYGVGIHLVQ+KD  +DRLP   D  +LDPMDNHISFQC+ MEA+E RLKE  VKYMK
Sbjct  68   LFNYGVGIHLVQSKD--EDRLPSKKD--TLDPMDNHISFQCEDMEAIEERLKEFNVKYMK  123

Query  431  RTVGEGEGE-AIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            RTV + E + +IDQLFF DPDGFMIEICNCEN+ LVP  S+GKIKLP DRH PP++
Sbjct  124  RTVEDEENKTSIDQLFFNDPDGFMIEICNCENLKLVPAGSMGKIKLPVDRHNPPIE  179



>ref|XP_004229676.1| PREDICTED: lactoylglutathione lyase [Solanum lycopersicum]
Length=191

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = +2

Query  56   KMQSLREERSHSR-KLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFD  232
            K +  +E R H       +DE P MALNHVSRLC++V+ SV+FYTKVLG V +ERP AFD
Sbjct  8    KKEQEKEIRDHENDNKNNEDEIPLMALNHVSRLCKNVEKSVEFYTKVLGFVLIERPQAFD  67

Query  233  GFDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKEL  412
             FDGAWLFNYGVGIHLV AKD +  +LP+ TD  +LDPMDNHISFQ + ME M +RL+E 
Sbjct  68   -FDGAWLFNYGVGIHLVHAKDDEDYKLPNHTD--NLDPMDNHISFQSEDMEGMVQRLEEF  124

Query  413  KVKYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
            K+KY+KRTVGE EG AIDQLFFKDPDGFMIEICNCEN+ LVPQ S+G+IK PSDRH PPV
Sbjct  125  KIKYLKRTVGEEEGAAIDQLFFKDPDGFMIEICNCENVKLVPQRSIGRIKFPSDRHNPPV  184

Query  593  Q  595
            +
Sbjct  185  E  185



>ref|XP_009790866.1| PREDICTED: uncharacterized protein LOC104238246 [Nicotiana sylvestris]
Length=203

 Score =   247 bits (631),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 139/165 (84%), Gaps = 5/165 (3%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            E+ +E P MALNHVSRLC++VK+S DFYTKVLG V +ERP AFD F+GAWLFNYGVGIHL
Sbjct  33   EQQNEIPLMALNHVSRLCKNVKESEDFYTKVLGFVLIERPQAFD-FNGAWLFNYGVGIHL  91

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            VQAK+  +DRLP+ TD  +LDPMDNHISFQ + ME M  RLK+L +KY+KRTVGE EG A
Sbjct  92   VQAKE--EDRLPNNTD--TLDPMDNHISFQSEDMEGMVERLKQLNIKYLKRTVGEEEGAA  147

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            IDQLFFKDPDG MIEICNCEN+ LVPQ S+G+IKLP +RH PPV+
Sbjct  148  IDQLFFKDPDGHMIEICNCENVKLVPQRSIGRIKLPFNRHIPPVE  192



>gb|KDP43609.1| hypothetical protein JCGZ_16896 [Jatropha curcas]
Length=207

 Score =   247 bits (630),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 133/161 (83%), Gaps = 6/161 (4%)
 Frame = +2

Query  113  ETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAK  292
            E P MALNHVSRLCR+VK+S+DFYT VLG+V  ERP AFD FDGAWLFNYGVGIHLVQAK
Sbjct  15   EPPLMALNHVSRLCRNVKESIDFYTNVLGMVLTERPQAFD-FDGAWLFNYGVGIHLVQAK  73

Query  293  DGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQL  472
            DGDQ   PH     +LDPMDNHISFQC+ +EAME+RLKE  VKYMKRTV E  G  IDQL
Sbjct  74   DGDQFPDPH----HNLDPMDNHISFQCEDIEAMEKRLKEFNVKYMKRTVDE-HGTKIDQL  128

Query  473  FFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            FF DPDGFMIEICNCEN+ LVP  SLGKIKLP DRHTPPV+
Sbjct  129  FFNDPDGFMIEICNCENLKLVPAASLGKIKLPMDRHTPPVE  169



>ref|XP_009602386.1| PREDICTED: lactoylglutathione lyase [Nicotiana tomentosiformis]
Length=202

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 141/169 (83%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            ++ +E P MALNHVSRLC++VK+SVDFYTKVLG V +ERP AFD F+GAWLFNYGVGIHL
Sbjct  31   DKQNEIPLMALNHVSRLCKNVKESVDFYTKVLGFVLIERPQAFD-FNGAWLFNYGVGIHL  89

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            VQAKD  +DRLP  TD  +LDPMDNHISFQ + ME M  R+K+L VKY+KRTVGE EG A
Sbjct  90   VQAKD--EDRLPSDTD--TLDPMDNHISFQSEDMEGMVERVKQLNVKYLKRTVGEEEGAA  145

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEK  607
            IDQLFF+DPDG MIEICNCEN+ LVPQ S+G+IKLP DRH PP++  +K
Sbjct  146  IDQLFFRDPDGHMIEICNCENVKLVPQRSIGRIKLPFDRHIPPLELGKK  194



>ref|XP_006345488.1| PREDICTED: lactoylglutathione lyase-like, partial [Solanum tuberosum]
Length=174

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  116  TPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKD  295
            TP MALNHVSRLC++V+ SV+FYTKVLG V +ERP AF  FDGAWLFNYGVGIHLV AKD
Sbjct  10   TPLMALNHVSRLCKNVEKSVEFYTKVLGFVLIERPQAF-VFDGAWLFNYGVGIHLVHAKD  68

Query  296  GDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLF  475
             + D+L + TD  +LDPMDNHISFQ + ME M +RL++ K+KY+KRTVGE EG AIDQLF
Sbjct  69   NEDDKLTNHTD--NLDPMDNHISFQSEDMEGMVQRLEKFKIKYLKRTVGEEEGAAIDQLF  126

Query  476  FKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            FKDPDGFMIEICNCEN+ LVPQ S+G+IK PSDRH PPV+
Sbjct  127  FKDPDGFMIEICNCENVKLVPQRSIGRIKFPSDRHNPPVE  166



>ref|XP_011091777.1| PREDICTED: uncharacterized protein LOC105172134 [Sesamum indicum]
Length=185

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 142/173 (82%), Gaps = 8/173 (5%)
 Frame = +2

Query  74   EERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWL  253
            EER H    EE +  P MALNHVSR+CRSV+ SV+FYTKVLG V +ERP +FD FDGAWL
Sbjct  5    EERRHG---EEKETPPLMALNHVSRVCRSVEKSVEFYTKVLGFVLIERPESFD-FDGAWL  60

Query  254  FNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKR  433
            FNYGVGIHLVQ KD  +++LP   D+ SLDPMDNHISFQC++ME ME++LK+L VKYMKR
Sbjct  61   FNYGVGIHLVQCKD--EEKLPR--DKDSLDPMDNHISFQCESMEEMEKKLKDLDVKYMKR  116

Query  434  TVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
            TVGE EG  IDQLFF DPDGFM+EICNCEN+ LVPQ S+GKIKLPS +H PP+
Sbjct  117  TVGEEEGAPIDQLFFNDPDGFMVEICNCENLKLVPQRSIGKIKLPSGKHHPPL  169



>ref|XP_008375286.1| PREDICTED: uncharacterized protein LOC103438528 [Malus domestica]
Length=211

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 147/185 (79%), Gaps = 8/185 (4%)
 Frame = +2

Query  44   SDH*KMQSLREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPP  223
            +DH + Q   +E+   +  EEDD  P MALNHVSRLCR+V++SVDFYTK LG V++ERPP
Sbjct  22   TDHEEQQKHSKEKDEQK--EEDDSLPLMALNHVSRLCRNVEESVDFYTKXLGFVKIERPP  79

Query  224  AFDGFDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRL  403
            AFD FDGAWLFNYGVG HLVQ++D  ++RLP   +Q  LDPMDNHISFQC+ MEA ER+L
Sbjct  80   AFD-FDGAWLFNYGVGXHLVQSED--EERLP--PNQDHLDPMDNHISFQCEDMEAXERKL  134

Query  404  KELKVKYMKRTVGEGE-GEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRH  580
            K+L +KY+KR V + E G  IDQLFF DPDGFM+E+CNCEN+ LVP  SLG+IKLP DRH
Sbjct  135  KKLDIKYIKRAVEDDENGTTIDQLFFNDPDGFMVEMCNCENLKLVPAGSLGRIKLPVDRH  194

Query  581  TPPVQ  595
            TPPV+
Sbjct  195  TPPVE  199



>ref|NP_029429.1| lactoylglutathione lyase / glyoxalase I-like protein [Arabidopsis 
thaliana]
 gb|AAD20684.1| expressed protein [Arabidopsis thaliana]
 gb|AEC08120.1| lactoylglutathione lyase / glyoxalase I-like protein [Arabidopsis 
thaliana]
Length=184

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 141/179 (79%), Gaps = 5/179 (3%)
 Frame = +2

Query  74   EERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWL  253
            EE+      E + + P MALNHVSRLC+ VK S++FYTKVLG VE+ERP +FD FDGAWL
Sbjct  2    EEKKKKGDDELNSKPPLMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPASFD-FDGAWL  60

Query  254  FNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKR  433
            FNYGVGIHLVQAKD  QD+LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+KVKY+KR
Sbjct  61   FNYGVGIHLVQAKD--QDKLPSDTDH--LDPMDNHISFQCEDMEALEKRLKEVKVKYIKR  116

Query  434  TVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKS  610
            TVG+ +  AIDQLFF DPDGFM+EICNCEN+ LVP  S   I+LP DRH PPV  P+ S
Sbjct  117  TVGDEKDAAIDQLFFNDPDGFMVEICNCENLELVPCHSADAIRLPEDRHAPPVALPDSS  175



>gb|AAK97724.1| At2g28420/T1B3.6 [Arabidopsis thaliana]
 gb|AAL31129.1| At2g28420/T1B3.6 [Arabidopsis thaliana]
Length=184

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 140/179 (78%), Gaps = 5/179 (3%)
 Frame = +2

Query  74   EERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWL  253
            EE+      E + + P MALNHVSRLC+ VK S+ FYTKVLG VE+ERP +FD FDGAWL
Sbjct  2    EEKKKKGDDELNSKPPLMALNHVSRLCKDVKKSLKFYTKVLGFVEIERPASFD-FDGAWL  60

Query  254  FNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKR  433
            FNYGVGIHLVQAKD  QD+LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+KVKY+KR
Sbjct  61   FNYGVGIHLVQAKD--QDKLPSDTDH--LDPMDNHISFQCEDMEALEKRLKEVKVKYIKR  116

Query  434  TVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKS  610
            TVG+ +  AIDQLFF DPDGFM+EICNCEN+ LVP  S   I+LP DRH PPV  P+ S
Sbjct  117  TVGDEKDAAIDQLFFNDPDGFMVEICNCENLELVPCHSADAIRLPEDRHAPPVALPDSS  175



>ref|XP_009368069.1| PREDICTED: uncharacterized protein LOC103957616 [Pyrus x bretschneideri]
Length=214

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 147/185 (79%), Gaps = 8/185 (4%)
 Frame = +2

Query  44   SDH*KMQSLREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPP  223
            +DH + Q   +E+   +  EE D  P MALNHVSRLCR+V+ SVDFYTKVLG V++ERPP
Sbjct  22   TDHEEQQKHSKEKDEQK--EEGDSLPLMALNHVSRLCRNVEQSVDFYTKVLGFVKIERPP  79

Query  224  AFDGFDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRL  403
            AFD FDGAWLFNYG+GIHLVQ++D  ++RLP   +Q  LDPMDNHISFQC+ MEA+ER+L
Sbjct  80   AFD-FDGAWLFNYGIGIHLVQSED--EERLP--PNQDHLDPMDNHISFQCEDMEAIERKL  134

Query  404  KELKVKYMKRTVGEGE-GEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRH  580
            K+L + Y+KR V + E G  IDQLFF DPDGFM+E+CNCEN+ LVP  SLG+IKLP DRH
Sbjct  135  KDLDIHYIKRAVDDDENGTTIDQLFFNDPDGFMVEMCNCENLKLVPAGSLGRIKLPVDRH  194

Query  581  TPPVQ  595
            TPPV+
Sbjct  195  TPPVE  199



>ref|XP_002880927.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57186.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = +2

Query  74   EERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWL  253
            EE+      E + + P MALNHVSRLC+ VK S++FYTKVLG VE+ERP +FD F+GAWL
Sbjct  2    EEKKKKGDDESNSKAPLMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPASFD-FNGAWL  60

Query  254  FNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKR  433
            FNYGVGIHLVQAKD  QD+LP  +D   LDPMDNHISFQC+ MEA+E+R+KE+KVKY+KR
Sbjct  61   FNYGVGIHLVQAKD--QDKLP--SDTNHLDPMDNHISFQCEDMEALEKRIKEVKVKYIKR  116

Query  434  TVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPE  604
            TVG+ +  AIDQLFF DPDGFM+EICNCEN+ LVP+ S   I LP DRH PPV  P+
Sbjct  117  TVGDEKDAAIDQLFFNDPDGFMVEICNCENLELVPRHSADAIHLPEDRHAPPVTLPD  173



>ref|XP_010103284.1| hypothetical protein L484_007953 [Morus notabilis]
 gb|EXB95309.1| hypothetical protein L484_007953 [Morus notabilis]
Length=173

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 131/157 (83%), Gaps = 6/157 (4%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            MALNHVSRLCR +K+S++FYTKVLG+V +ERPPAFD FDGAWLFN+GVGIHLVQ+KD  +
Sbjct  1    MALNHVSRLCRDLKESIEFYTKVLGMVLIERPPAFD-FDGAWLFNFGVGIHLVQSKD--E  57

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE-GEAIDQLFFK  481
            DRLPH  D   LDPMDNHISFQC+ MEAME RLKE  +KYMKR V + E G AIDQLFF 
Sbjct  58   DRLPH--DSHHLDPMDNHISFQCENMEAMEERLKEFNIKYMKRAVEDDENGTAIDQLFFN  115

Query  482  DPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
            DPDG MIEICNCEN+ LVP  +LGKIKLP DRH PPV
Sbjct  116  DPDGLMIEICNCENLKLVPAGTLGKIKLPFDRHNPPV  152



>ref|XP_002527954.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF34443.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=201

 Score =   239 bits (610),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNHVSRLCR V+ S+DFYTKVLG+V  ERP AFD F+GAWLFNYGVGIHLVQAKD 
Sbjct  35   PLMALNHVSRLCRDVQKSIDFYTKVLGMVLTERPQAFD-FEGAWLFNYGVGIHLVQAKD-  92

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
             +DRLP P   QSLDPMDNHISFQC+ +EAME+RLKE KV+Y+KRTV E  G  IDQLFF
Sbjct  93   -EDRLPDP--HQSLDPMDNHISFQCEDIEAMEKRLKEHKVEYIKRTVDEN-GTKIDQLFF  148

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
             DPDGFMIEICNCEN+ L P  S+GKIKLP DRH PPV
Sbjct  149  DDPDGFMIEICNCENLKLAPAGSIGKIKLPKDRHIPPV  186



>ref|XP_008231537.1| PREDICTED: uncharacterized protein LOC103330708 [Prunus mume]
Length=190

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 140/171 (82%), Gaps = 6/171 (4%)
 Frame = +2

Query  83   SHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNY  262
            +  R   E+++ P MALNHVSRLCR+V++SVDFYTKVLG V++ERPPAFD FDGAWLFNY
Sbjct  14   AKERSKHEEEQLPPMALNHVSRLCRNVEESVDFYTKVLGFVKIERPPAFD-FDGAWLFNY  72

Query  263  GVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVG  442
            G+GIHLVQ++D  + RLP  TD   LDPMDNHISFQC+ MEA+ER+LK+L +KY+KR+V 
Sbjct  73   GIGIHLVQSED--EKRLPANTDH--LDPMDNHISFQCEDMEAIERKLKDLNLKYIKRSVD  128

Query  443  EGEGEA-IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
            + E +  IDQLFF DPDGFMIE+CNCENI LVP   LG IKLP DRHTPPV
Sbjct  129  DDENKTTIDQLFFNDPDGFMIEMCNCENIKLVPVGPLGSIKLPVDRHTPPV  179



>ref|XP_007220131.1| hypothetical protein PRUPE_ppa020131mg [Prunus persica]
 gb|EMJ21330.1| hypothetical protein PRUPE_ppa020131mg [Prunus persica]
Length=187

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 142/171 (83%), Gaps = 6/171 (4%)
 Frame = +2

Query  83   SHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNY  262
            +  R   E++E P MALNHVSRLCR+V++SVDFYTKVLG V++ERPPAFD FDGAWLFNY
Sbjct  11   AKERSKHEEEELPLMALNHVSRLCRNVEESVDFYTKVLGFVKIERPPAFD-FDGAWLFNY  69

Query  263  GVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVG  442
            G+GIHLVQ++D  ++RLP  TD+  LDP+DNHISFQC+ MEA+E++LK+L +KY+KR+V 
Sbjct  70   GIGIHLVQSED--EERLPADTDR--LDPVDNHISFQCEDMEAIEQKLKDLNIKYIKRSVE  125

Query  443  EGEGEA-IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
            + E +  IDQLFF DPDGFMIE+CNCENI LVP   LG IKLP DRHTPPV
Sbjct  126  DDENKTTIDQLFFNDPDGFMIEMCNCENIKLVPAGPLGNIKLPVDRHTPPV  176



>ref|XP_010279599.1| PREDICTED: uncharacterized protein LOC104613472 [Nelumbo nucifera]
Length=186

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MA+NH+SRLCRSVKDSVDFY KVLG V +ERPPAFD FDGAWLFNYGVGIHL+QAKD 
Sbjct  22   PLMAINHLSRLCRSVKDSVDFYVKVLGFVLIERPPAFD-FDGAWLFNYGVGIHLIQAKD-  79

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
             +D LP  TD   LDPMDNH+SFQC+ M+AME++LK++ +KY+KRTV + +  +IDQLFF
Sbjct  80   -EDGLPDSTDH--LDPMDNHVSFQCEDMDAMEQKLKDMNIKYIKRTVEDKDNTSIDQLFF  136

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKS  610
             DPDGFMIEICNCEN+ LVP  SLG+IKLP D H PP++   K+
Sbjct  137  NDPDGFMIEICNCENLKLVPAGSLGRIKLPMDHHNPPLELDHKN  180



>emb|CBI28596.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 132/165 (80%), Gaps = 4/165 (2%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +++   P MALNHVSRLCRSVK+S+DFY KVLG V ++RP     FDGAWLFNYGVGIHL
Sbjct  50   KQEHALPPMALNHVSRLCRSVKESIDFYVKVLGFVLIQRPQVLH-FDGAWLFNYGVGIHL  108

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            VQAK+ D  RLP   D+  LDPMDNHISFQC+ MEAME+RLK+  +KYMKRT+ +  G A
Sbjct  109  VQAKEEDYCRLP---DRDHLDPMDNHISFQCEDMEAMEQRLKDFNIKYMKRTIKDEHGTA  165

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            IDQLFF DPDGFMIEICNCEN+ LVP  SLG+IKLP DRH PPV+
Sbjct  166  IDQLFFNDPDGFMIEICNCENLKLVPAGSLGQIKLPLDRHNPPVE  210



>ref|XP_006295738.1| hypothetical protein CARUB_v10024857mg [Capsella rubella]
 gb|EOA28636.1| hypothetical protein CARUB_v10024857mg [Capsella rubella]
Length=220

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            E + + P MALNHVSRLC+ VK S++FYTKVLG VE+ERP +FD F+GAWLFNYGVGIHL
Sbjct  47   ESNSKPPLMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPASFD-FNGAWLFNYGVGIHL  105

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            VQAKD  +D+LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+KVKY+KRTVG+ +  A
Sbjct  106  VQAKD--EDKLPSNTDH--LDPMDNHISFQCEDMEALEKRLKEVKVKYIKRTVGDQKDAA  161

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
            IDQLFF DPDGFM+EICNCEN+ LVP+ S   I LP DRH PPV
Sbjct  162  IDQLFFNDPDGFMVEICNCENLELVPRNSADAIHLPEDRHAPPV  205



>ref|XP_002271319.1| PREDICTED: uncharacterized protein LOC100244855 [Vitis vinifera]
Length=188

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 132/165 (80%), Gaps = 4/165 (2%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +++   P MALNHVSRLCRSVK+S+DFY KVLG V ++RP     FDGAWLFNYGVGIHL
Sbjct  13   KQEHALPPMALNHVSRLCRSVKESIDFYVKVLGFVLIQRPQVLH-FDGAWLFNYGVGIHL  71

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            VQAK+ D  RLP   D+  LDPMDNHISFQC+ MEAME+RLK+  +KYMKRT+ +  G A
Sbjct  72   VQAKEEDYCRLP---DRDHLDPMDNHISFQCEDMEAMEQRLKDFNIKYMKRTIKDEHGTA  128

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            IDQLFF DPDGFMIEICNCEN+ LVP  SLG+IKLP DRH PPV+
Sbjct  129  IDQLFFNDPDGFMIEICNCENLKLVPAGSLGQIKLPLDRHNPPVE  173



>ref|XP_009103687.1| PREDICTED: uncharacterized protein LOC103829741 [Brassica rapa]
 emb|CDY04563.1| BnaA07g13890D [Brassica napus]
Length=184

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 131/164 (80%), Gaps = 5/164 (3%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNHVSRLCR VK S++FYTKVLG VE ERP + D FDGAWLFNYGVGIHLVQAKD 
Sbjct  13   PLMALNHVSRLCRDVKKSLEFYTKVLGFVETERPASLD-FDGAWLFNYGVGIHLVQAKD-  70

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
             +++LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+ VKY+KRTVGE E  AIDQLFF
Sbjct  71   -EEKLPSNTDH--LDPMDNHISFQCEDMEALEKRLKEVDVKYIKRTVGEQEDAAIDQLFF  127

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKS  610
             DPDGFM+EICNCEN+ L P+ S   I+LP DRH PPV  P  S
Sbjct  128  NDPDGFMVEICNCENLELKPRDSADAIRLPGDRHAPPVSLPGSS  171



>gb|EYU42982.1| hypothetical protein MIMGU_mgv1a025275mg [Erythranthe guttata]
Length=164

 Score =   233 bits (593),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 10/162 (6%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            MALNHVSR+CRSVK+SV+FYTK+LG V +ERP + D FDGAWLFNYGVGIHLVQ+KD  +
Sbjct  1    MALNHVSRVCRSVKESVEFYTKILGFVVIERPESLD-FDGAWLFNYGVGIHLVQSKD--E  57

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGE-----AIDQ  469
            ++LP   D+  LDPMDNHISFQC+ MEAME++LKE+ +K MKRTVGE  G      AIDQ
Sbjct  58   EKLPR--DKDRLDPMDNHISFQCEDMEAMEQKLKEMNIKCMKRTVGEDGGGGGGGTAIDQ  115

Query  470  LFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            LFFKDPDGFMIEICNCEN+ LVPQ S+G+IKLPSD+H PPV+
Sbjct  116  LFFKDPDGFMIEICNCENLKLVPQNSIGRIKLPSDKHNPPVE  157



>gb|KFK32298.1| hypothetical protein AALP_AA6G224300 [Arabis alpina]
Length=177

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 134/167 (80%), Gaps = 5/167 (3%)
 Frame = +2

Query  92   RKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVG  271
            +K E D + P MALNHVSRLCR VK S++FYTKVLG VE ERP A D FDGAWLFNYGVG
Sbjct  3    KKDEHDSKAPLMALNHVSRLCRDVKKSLEFYTKVLGFVETERPAALD-FDGAWLFNYGVG  61

Query  272  IHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE  451
            IHLVQ KD  +++LP  TD   LDPMDNHISFQC+ MEA+E RLKE+ V+Y+KRTVG+ +
Sbjct  62   IHLVQVKD--EEKLPSNTDH--LDPMDNHISFQCEDMEALEERLKEVDVRYIKRTVGDQK  117

Query  452  GEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
              AI+QLFF DPDGFM+EICNCEN+ LVP+ S   I++P +RHTPPV
Sbjct  118  DAAINQLFFNDPDGFMVEICNCENLELVPRNSADAIQIPDNRHTPPV  164



>ref|XP_010414525.1| PREDICTED: lactoylglutathione lyase-like [Camelina sativa]
Length=183

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 129/158 (82%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNHVSRLC+ VK S++FYTKVLG VE+ERP A D FDGAWLFNYGVGIHLVQ KD 
Sbjct  16   PLMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPAALD-FDGAWLFNYGVGIHLVQVKD-  73

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
             +D+LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+ VKY+KRTVG+ +  AIDQLFF
Sbjct  74   -EDKLPSNTDH--LDPMDNHISFQCEDMEALEKRLKEVNVKYIKRTVGDQKDAAIDQLFF  130

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
             DPDGFM+EICNCEN+ LVP+ S   I LP DRH PPV
Sbjct  131  NDPDGFMVEICNCENLELVPRHSADAIHLPEDRHAPPV  168



>ref|XP_011025508.1| PREDICTED: lactoylglutathione lyase [Populus euphratica]
Length=187

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 132/165 (80%), Gaps = 6/165 (4%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +E+D  P MALNHVSRLCR VK+S+DFY+KVLGLV +ERPPAF+ FDGAWLFNYGVG+HL
Sbjct  19   KEEDRIPQMALNHVSRLCRDVKESIDFYSKVLGLVLIERPPAFE-FDGAWLFNYGVGVHL  77

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE-GE  457
            +QAKD D      P   + LDPMDNHISFQC+ MEA+E+RLK+  VKY KRTV + + G 
Sbjct  78   IQAKDEDS----LPKADRRLDPMDNHISFQCEDMEALEQRLKQFNVKYTKRTVDDDKNGT  133

Query  458  AIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
             IDQLFF DPDG+MIE+CNCEN+ LVP  SLG IKLP DRH PPV
Sbjct  134  TIDQLFFCDPDGYMIEMCNCENLKLVPAGSLGSIKLPCDRHNPPV  178



>ref|XP_006409867.1| hypothetical protein EUTSA_v10017750mg [Eutrema salsugineum]
 gb|ESQ51320.1| hypothetical protein EUTSA_v10017750mg [Eutrema salsugineum]
Length=183

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 134/173 (77%), Gaps = 5/173 (3%)
 Frame = +2

Query  92   RKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVG  271
            +K  ++   P MALNHVSRLC+ V  S++FYTKVLG VE ERP + D F+GAWLFNYGVG
Sbjct  4    KKKGDESRPPLMALNHVSRLCKDVNKSLEFYTKVLGFVETERPASLD-FNGAWLFNYGVG  62

Query  272  IHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE  451
            IHLVQAKD  +D+LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+ VKY+KRTVG+ +
Sbjct  63   IHLVQAKD--EDKLPSNTDH--LDPMDNHISFQCEDMEALEKRLKEVNVKYIKRTVGDEK  118

Query  452  GEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKS  610
              AIDQLFF DPDGFM+EICNCEN+ LVP+ S   I LP DRH PPV  P  S
Sbjct  119  DAAIDQLFFNDPDGFMVEICNCENLELVPRDSADAIYLPGDRHAPPVAIPGSS  171



>ref|XP_002313326.1| hypothetical protein POPTR_0009s06040g [Populus trichocarpa]
 gb|EEE87281.1| hypothetical protein POPTR_0009s06040g [Populus trichocarpa]
Length=187

 Score =   231 bits (588),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 131/165 (79%), Gaps = 6/165 (4%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +E+D  P MALNHVSRLCR VK+S+DFY+KVLGLV +ERPPAF+ FDGAWLFNYGVG+HL
Sbjct  19   KEEDRVPQMALNHVSRLCRDVKESIDFYSKVLGLVLIERPPAFE-FDGAWLFNYGVGVHL  77

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGE-GEGE  457
            +QAKD D      P   + LDP DNHISFQC+ MEA+E+RLK+  VKY KRT+ E  +G 
Sbjct  78   IQAKDEDS----LPKTDRVLDPRDNHISFQCEDMEALEQRLKQFNVKYTKRTIDEDKKGT  133

Query  458  AIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
             IDQLFF DPDG+MIE+CNCEN+ LVP  SLG IKLP DRH PPV
Sbjct  134  KIDQLFFCDPDGYMIEMCNCENLKLVPAGSLGNIKLPCDRHNPPV  178



>ref|XP_010470082.1| PREDICTED: lactoylglutathione lyase-like [Camelina sativa]
Length=184

 Score =   231 bits (588),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 129/158 (82%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNHVSRLC+ VK S++FYTKVLG VE+ERP A + FDGAWLFNYGVGIHLVQ KD 
Sbjct  17   PLMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPAALN-FDGAWLFNYGVGIHLVQVKD-  74

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
             +D+LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+ VKY+KRTVG+ +  AIDQLFF
Sbjct  75   -EDKLPSNTDH--LDPMDNHISFQCEDMEALEKRLKEVDVKYIKRTVGDQKDAAIDQLFF  131

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
             DPDGFM+EICNCEN+ LVP+ S   I LP DRH PPV
Sbjct  132  NDPDGFMVEICNCENLELVPRHSADAIHLPEDRHAPPV  169



>ref|XP_010510624.1| PREDICTED: lactoylglutathione lyase-like [Camelina sativa]
Length=183

 Score =   230 bits (587),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 130/161 (81%), Gaps = 5/161 (3%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNHVSRLC+ VK S++FYTKVLG VE+ERP A + FDGAWLFNYGVGIHLVQ KD 
Sbjct  16   PLMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPAALN-FDGAWLFNYGVGIHLVQVKD-  73

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
             +D+LP  TD   LDPMDNHISFQC+ MEA+E+RLKE+ VKY+KRTVG+ +  AIDQLFF
Sbjct  74   -EDKLPSDTDH--LDPMDNHISFQCEDMEALEKRLKEVDVKYIKRTVGDQKDAAIDQLFF  130

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPP  601
             DPDGFM+EICNCEN+ LVP+ S   I LP DRH PPV  P
Sbjct  131  NDPDGFMVEICNCENLELVPRHSADAIHLPEDRHAPPVALP  171



>gb|KEH17675.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=200

 Score =   231 bits (589),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 3/175 (2%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +E ++TP MALNH+SRLCR VK+S+DFYTKVLG V +ERP   D F+GAWLFNYGVGIHL
Sbjct  29   KESNQTPLMALNHISRLCRDVKESIDFYTKVLGFVLIERPQVLD-FEGAWLFNYGVGIHL  87

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            VQ+K+  + +LP P  Q  LDP DNHISFQC+ ++ ME++LKE+KVKY KR +   +G  
Sbjct  88   VQSKE--EQKLPSPDAQHDLDPQDNHISFQCEDVKGMEKKLKEMKVKYKKRNLEAEDGTT  145

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKSYS*LK  625
            +DQ+FF DPDGFM+EICNCEN+ L P  S GKIK+P DRHTPPV+  +  +  +K
Sbjct  146  MDQIFFNDPDGFMVEICNCENLKLTPADSQGKIKIPMDRHTPPVETNQNEHDNVK  200



>ref|XP_010068955.1| PREDICTED: uncharacterized protein LOC104455948 [Eucalyptus grandis]
Length=195

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 133/160 (83%), Gaps = 6/160 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNHVSRLCRSVKDS++FYTKVLG VE+ERP A D F+GAWLFNYG+GIHLVQ+ D 
Sbjct  35   PLMALNHVSRLCRSVKDSIEFYTKVLGFVEIERPQALD-FEGAWLFNYGIGIHLVQSHD-  92

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE-GEAIDQLF  475
             +DRLP  ++   LDPMDNHISFQC+ M A+E++L+++ ++Y KRTV + E G +IDQLF
Sbjct  93   -EDRLP--SESHPLDPMDNHISFQCENMGAVEQKLRDMGIEYKKRTVDDEESGASIDQLF  149

Query  476  FKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            F DPDGFM+EICNCEN+ LVP  S+GKIKLP DRH PPV+
Sbjct  150  FTDPDGFMVEICNCENLKLVPAGSMGKIKLPFDRHNPPVE  189



>gb|KCW65990.1| hypothetical protein EUGRSUZ_G03282, partial [Eucalyptus grandis]
Length=175

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 133/160 (83%), Gaps = 6/160 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNHVSRLCRSVKDS++FYTKVLG VE+ERP A D F+GAWLFNYG+GIHLVQ+ D 
Sbjct  15   PLMALNHVSRLCRSVKDSIEFYTKVLGFVEIERPQALD-FEGAWLFNYGIGIHLVQSHD-  72

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE-GEAIDQLF  475
             +DRLP  ++   LDPMDNHISFQC+ M A+E++L+++ ++Y KRTV + E G +IDQLF
Sbjct  73   -EDRLP--SESHPLDPMDNHISFQCENMGAVEQKLRDMGIEYKKRTVDDEESGASIDQLF  129

Query  476  FKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            F DPDGFM+EICNCEN+ LVP  S+GKIKLP DRH PPV+
Sbjct  130  FTDPDGFMVEICNCENLKLVPAGSMGKIKLPFDRHNPPVE  169



>ref|XP_004959863.1| PREDICTED: uncharacterized protein LOC101765502 [Setaria italica]
Length=202

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 129/172 (75%), Gaps = 4/172 (2%)
 Frame = +2

Query  83   SHSRKLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFN  259
            + S KL ED    P MALNH+SRLC+SV DSV FY K LG V + RPPA D F GAWLFN
Sbjct  26   ADSAKLYEDVPPMPLMALNHISRLCKSVDDSVRFYVKALGFVLIHRPPALD-FSGAWLFN  84

Query  260  YGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTV  439
            YGVGIHLVQ  D    R P  +    LDPMDNHISFQC+ M  MERRL+E++++YMKRT+
Sbjct  85   YGVGIHLVQRDDAR--RAPDVSPAGELDPMDNHISFQCEDMGMMERRLREMRIRYMKRTI  142

Query  440  GEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
             E EG  IDQLFFKDPDGFMIEICNCEN+ LVP  +LG+++LP DRH PPV+
Sbjct  143  NEEEGSPIDQLFFKDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPVR  194



>ref|XP_004305407.1| PREDICTED: lactoylglutathione lyase-like [Fragaria vesca subsp. 
vesca]
Length=206

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 132/165 (80%), Gaps = 7/165 (4%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +E+ + P MALNHVSRLC +V++SV FYT VLG V++ERP AFD FD  WLFNYGVGIHL
Sbjct  38   KEEHQLPLMALNHVSRLCSNVEESVKFYTTVLGFVKIERPLAFD-FDDDWLFNYGVGIHL  96

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTV-GEGEGE  457
            VQ+KD  +DRLPH   Q  LDPMDNHISFQC+ M+AM ++L+EL ++YMKRTV  +  G 
Sbjct  97   VQSKD--EDRLPH---QNHLDPMDNHISFQCEDMDAMVKKLEELNIEYMKRTVEDDKNGA  151

Query  458  AIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
             IDQLFF DPDGFM+EICNCEN+ LVP  S+GKIKLP DRH PP+
Sbjct  152  KIDQLFFNDPDGFMVEICNCENLKLVPAGSMGKIKLPFDRHNPPM  196



>ref|XP_008653417.1| PREDICTED: uncharacterized protein LOC103633514 [Zea mays]
 tpg|DAA63953.1| TPA: lactoylglutathione lyase [Zea mays]
Length=217

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +2

Query  89   SRKLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYG  265
            S KL ED   TP MALNH+SRLC SV  SV FY K LG V ++RPPA D F GAWLFNYG
Sbjct  43   SAKLYEDVPATPMMALNHISRLCESVDASVRFYVKALGFVLIQRPPALD-FSGAWLFNYG  101

Query  266  VGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGE  445
            VGIHLVQ  D  +     P ++  LDPMDNH+SFQC+ M AMERRL+E++V+YMKRT+ E
Sbjct  102  VGIHLVQRDDARRAPDVRP-EEAELDPMDNHVSFQCEDMGAMERRLREMRVRYMKRTINE  160

Query  446  GEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
             EG  IDQLFF+DPDGFMIEICNCEN+ LVP  + G+++LP DRH PPV+
Sbjct  161  EEGSPIDQLFFRDPDGFMIEICNCENLELVPAGAFGRLRLPRDRHNPPVR  210



>gb|EAZ04990.1| hypothetical protein OsI_27170 [Oryza sativa Indica Group]
Length=209

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 130/172 (76%), Gaps = 5/172 (3%)
 Frame = +2

Query  83   SHSRKLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFN  259
            S S KL ED  E P MALNH+SRLC+S+  SV FY K LG V + RPPA D F+GAWLFN
Sbjct  33   SSSAKLYEDVPEMPLMALNHISRLCKSIDASVRFYVKALGFVLIHRPPALD-FNGAWLFN  91

Query  260  YGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTV  439
            YGVGIHLVQ  D  +    +P D   LDPMDNHISFQC+ ME ME+RL E+ ++YMKRT+
Sbjct  92   YGVGIHLVQRDDARRAADVNPGD---LDPMDNHISFQCEDMEMMEKRLNEMGIEYMKRTI  148

Query  440  GEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
             E EG  IDQLFFKDPDGFMIEICNCEN+ LVP  +LG+++LP DRH PP++
Sbjct  149  NEEEGSPIDQLFFKDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPLR  200



>ref|XP_002463313.1| hypothetical protein SORBIDRAFT_02g041630 [Sorghum bicolor]
 gb|EER99834.1| hypothetical protein SORBIDRAFT_02g041630 [Sorghum bicolor]
Length=210

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 126/170 (74%), Gaps = 4/170 (2%)
 Frame = +2

Query  89   SRKLEEDDET-PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYG  265
            S KL ED    P MALNH+SRLC SV  SV FY K LG V + RPPA D F GAWLFNYG
Sbjct  37   SAKLYEDVPAFPMMALNHISRLCESVDASVRFYVKALGFVLIHRPPALD-FSGAWLFNYG  95

Query  266  VGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGE  445
            VGIHLVQ  D    R P    +  LDPMDNH+SFQC+ M AMERRL+EL ++YMKRT+ E
Sbjct  96   VGIHLVQRDDAR--RAPDVRPETELDPMDNHVSFQCEDMGAMERRLQELHIRYMKRTINE  153

Query  446  GEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
             EG  IDQLFF+DPDGFMIEICNCEN+ LVP  +LG+++LP DRH PPV+
Sbjct  154  EEGSPIDQLFFRDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPVR  203



>ref|NP_001152631.1| lactoylglutathione lyase [Zea mays]
 gb|ACG48639.1| lactoylglutathione lyase [Zea mays]
Length=218

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  89   SRKLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYG  265
            S KL ED   TP MALNH+SRLC SV  SV FY K LG V ++RPPA D F GAWLFNYG
Sbjct  44   SAKLYEDVPATPMMALNHISRLCESVDASVRFYVKALGFVLIQRPPALD-FSGAWLFNYG  102

Query  266  VGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGE  445
            VGIH VQ  D  +     P ++  LDPMDNH+SFQC+ M AMERRL+E++V+YMKRT+ E
Sbjct  103  VGIHFVQRDDARRAPBVRP-EEAELDPMDNHVSFQCEDMGAMERRLREMRVRYMKRTINE  161

Query  446  GEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
             EG  IDQLFF+DPDGFMIEICNCEN+ LVP  + G+++LP DRH PPV
Sbjct  162  EEGSXIDQLFFRDPDGFMIEICNCENLELVPAGAFGRLRLPRDRHNPPV  210



>ref|NP_001060509.1| Os07g0657100 [Oryza sativa Japonica Group]
 dbj|BAC83945.1| glyoxalase family-like protein [Oryza sativa Japonica Group]
 dbj|BAF22423.1| Os07g0657100 [Oryza sativa Japonica Group]
 gb|EAZ40942.1| hypothetical protein OsJ_25424 [Oryza sativa Japonica Group]
Length=209

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 129/172 (75%), Gaps = 5/172 (3%)
 Frame = +2

Query  83   SHSRKLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFN  259
            S S KL ED  E P MALNH+SRLC+S+  SV FY K LG V + RPPA D F+GAWLFN
Sbjct  33   SSSAKLYEDVPEMPLMALNHISRLCKSIDASVRFYVKALGFVLIHRPPALD-FNGAWLFN  91

Query  260  YGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTV  439
            YGVGIHLVQ  D  +    +P D   LDPMDNHISFQC+ M  ME+RL E+ ++YMKRT+
Sbjct  92   YGVGIHLVQRDDARRAPDVNPGD---LDPMDNHISFQCEDMGMMEKRLNEMGIEYMKRTI  148

Query  440  GEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
             E EG  IDQLFFKDPDGFMIEICNCEN+ LVP  +LG+++LP DRH PP++
Sbjct  149  NEEEGSPIDQLFFKDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPLR  200



>ref|XP_007052436.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOX96593.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=265

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 127/165 (77%), Gaps = 5/165 (3%)
 Frame = +2

Query  95   KLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGI  274
            + EE   TP ++L+HVSRLCR VK S+DFYTKVLG V VER  A D FDGAWLFNYGVGI
Sbjct  90   RTEEASPTPILSLHHVSRLCRDVKHSIDFYTKVLGFVLVERTLALD-FDGAWLFNYGVGI  148

Query  275  HLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEG  454
            HLVQ+KD  +DRLP  TD   LD  DNHISFQC+AME  ERRLKE   KY+KRT+ +  G
Sbjct  149  HLVQSKD--EDRLPSDTDH--LDLKDNHISFQCEAMEETERRLKEFNTKYIKRTIEDESG  204

Query  455  EAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPP  589
              IDQLFF DPDGFM+EICNCE++ LVP  S+GKIKLPS+ H PP
Sbjct  205  TKIDQLFFNDPDGFMVEICNCEDLKLVPAGSVGKIKLPSNHHNPP  249



>ref|XP_003559863.1| PREDICTED: uncharacterized protein LOC100829748 [Brachypodium 
distachyon]
Length=206

 Score =   221 bits (563),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 133/182 (73%), Gaps = 3/182 (2%)
 Frame = +2

Query  74   EERSHSRKLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAW  250
            +E + + KL ED    P MALNH+SRLC+SV  SV FY + LG V + RPPA D F GAW
Sbjct  24   DEAAAAEKLYEDVPPMPLMALNHISRLCKSVDASVRFYVRALGFVLIHRPPALD-FSGAW  82

Query  251  LFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMK  430
            LFNYGVGIHLVQ  D  +     P   + LDPMDNHISFQC+ M AMERRLKE+ +K+MK
Sbjct  83   LFNYGVGIHLVQRDDARRAPDVSPAAGE-LDPMDNHISFQCEDMGAMERRLKEMGIKHMK  141

Query  431  RTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKS  610
            RT+ E EG  IDQLFFKDPDGFMIEICNCEN+ LVP  +LG+++LP DRH PP++ P  +
Sbjct  142  RTINEEEGSPIDQLFFKDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPLRIPTDA  201

Query  611  YS  616
             +
Sbjct  202  AA  203



>ref|XP_008461357.1| PREDICTED: lactoylglutathione lyase [Cucumis melo]
Length=201

 Score =   221 bits (562),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 141/181 (78%), Gaps = 2/181 (1%)
 Frame = +2

Query  56   KMQSLREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDG  235
            ++Q+  EE   +++ +E+   P MALNHVSR+C++VKDSV FYT VLG V +ERP +FD 
Sbjct  17   EIQANNEESQETKRKQEEHPLPLMALNHVSRVCKNVKDSVHFYTNVLGFVLIERPQSFD-  75

Query  236  FDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELK  415
            F+GAWLFNYGVGIHL+Q+++ D       +D+  LDPMDNHISFQC+ MEAME RLKEL 
Sbjct  76   FEGAWLFNYGVGIHLMQSEEDDDSVGVRGSDKDHLDPMDNHISFQCEDMEAMEERLKELG  135

Query  416  VKYMKRTV-GEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPV  592
            VKYM+RT+  E +GE I+QLFF DPDGFMIEICNCEN+ LVP  S GKI+LP+ RH PP+
Sbjct  136  VKYMRRTLEEEEKGETIEQLFFNDPDGFMIEICNCENLKLVPAGSSGKIRLPAGRHNPPL  195

Query  593  Q  595
            +
Sbjct  196  E  196



>gb|EMT24138.1| hypothetical protein F775_26104 [Aegilops tauschii]
Length=192

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = +2

Query  95   KLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVG  271
            KL ED    P MALNH+SRLC+SV  SV FY K LG V + RPPA D F GAWLFNYG+G
Sbjct  23   KLYEDVPPMPLMALNHISRLCKSVDASVRFYVKALGFVLIHRPPALD-FSGAWLFNYGIG  81

Query  272  IHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE  451
            IHLVQ  D    R     +   LDPMDNHISFQC+ M AMERRLKE+ ++YMKRT+ E E
Sbjct  82   IHLVQRDDA---RRAADVNPGELDPMDNHISFQCEDMGAMERRLKEMGIRYMKRTINEEE  138

Query  452  GEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            G  IDQLFFKDPDGFMIEICNCEN+ LVP  +LG+++LP DRH PP++
Sbjct  139  GSPIDQLFFKDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPLR  186



>ref|XP_006658057.1| PREDICTED: uncharacterized protein LOC102717631 [Oryza brachyantha]
Length=202

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 129/173 (75%), Gaps = 4/173 (2%)
 Frame = +2

Query  77   ERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLF  256
            E +  R  E+    P MALNH+SRLC+SV  S+ FY + LG V + RPPA D F GAWLF
Sbjct  26   ESAEQRLYEDVPAMPLMALNHISRLCKSVDASLRFYVRALGFVLIHRPPALD-FTGAWLF  84

Query  257  NYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRT  436
            NYGVGIHLVQ  D  +    +P D   LDPMDNHISFQC+ M+A+E+RL E++++YMKRT
Sbjct  85   NYGVGIHLVQRDDARRAPDVNPGD---LDPMDNHISFQCEDMDAVEKRLSEMRIRYMKRT  141

Query  437  VGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            + E EG  IDQLFFKDPDGFMIEICNCEN+ LVP  +LG+++LP DRH PP++
Sbjct  142  INEEEGSPIDQLFFKDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPLR  194



>gb|EMS48558.1| hypothetical protein TRIUR3_13403 [Triticum urartu]
Length=162

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 121/159 (76%), Gaps = 4/159 (3%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNH+SRLC+SV  SV FY K LG V + RPPA D F GAWLFNYG+GIHLVQ  D 
Sbjct  2    PLMALNHISRLCKSVDASVRFYVKALGFVLIHRPPALD-FSGAWLFNYGIGIHLVQRDDA  60

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
               R     +   LDPMDNHISFQC+ M AMERRLKE+ ++Y+KRT+ E EG  IDQLFF
Sbjct  61   ---RRAADVNPGELDPMDNHISFQCEDMGAMERRLKEMGIRYVKRTINEEEGSPIDQLFF  117

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            KDPDGFMIEICNCEN+ LVP  +LG+++LP DRH PP++
Sbjct  118  KDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPLR  156



>gb|ACF74334.1| lactoylglutathione lyase [Arachis hypogaea]
Length=200

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 131/176 (74%), Gaps = 5/176 (3%)
 Frame = +2

Query  74   EERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWL  253
            +E++  +  + +   P +ALNHVSRLCR+VK+S++FYTKVLG V +ERP   D F+GAWL
Sbjct  28   DEKAEDKGHDNETAAPLLALNHVSRLCRNVKESIEFYTKVLGFVPIERPQVLD-FEGAWL  86

Query  254  FNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKR  433
            FNYGVGIHLVQ+    +DRLP  +D Q LDP DNHISFQC+ ME MER+LKE+ +KY K 
Sbjct  87   FNYGVGIHLVQSNH--EDRLP--SDPQHLDPQDNHISFQCEDMEEMERKLKEMNIKYKKG  142

Query  434  TVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPP  601
            T+   EG AIDQLFFKDPDGFM+EICNCEN+ LVP  SLGKIKLP     P    P
Sbjct  143  TLETEEGIAIDQLFFKDPDGFMVEICNCENLKLVPTDSLGKIKLPMGSSHPTRGTP  198



>ref|XP_004136133.1| PREDICTED: lactoylglutathione lyase-like [Cucumis sativus]
 ref|XP_004158227.1| PREDICTED: lactoylglutathione lyase-like [Cucumis sativus]
Length=198

 Score =   216 bits (549),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = +2

Query  68   LREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGA  247
            ++     + + +E+   P MALNHVSR+C++VKDSV FYTKVLG V +ERP +FD F+GA
Sbjct  18   IQANNEETTRKQEEHPLPLMALNHVSRVCKNVKDSVHFYTKVLGFVLIERPQSFD-FEGA  76

Query  248  WLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYM  427
            WLFNYGVGIHL+Q ++ D       +D+  LDPMDNHISFQC+ MEAME RLKEL VKYM
Sbjct  77   WLFNYGVGIHLMQTEEDDDSVGVRGSDKDHLDPMDNHISFQCEDMEAMEERLKELGVKYM  136

Query  428  KRTV-GEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            +RT+  E +GE I+QLFF DPDGFMIEICNCEN+ LVP  S GKI+LP+ RH PP++
Sbjct  137  RRTLEEEEKGETIEQLFFNDPDGFMIEICNCENLKLVPAGSSGKIRLPAGRHNPPLE  193



>ref|XP_010926993.1| PREDICTED: uncharacterized protein LOC105049128 isoform X2 [Elaeis 
guineensis]
Length=209

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 129/177 (73%), Gaps = 12/177 (7%)
 Frame = +2

Query  89   SRKLEEDDE---TPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFN  259
            +++L+E D    TP +ALNHVSRLC+SV+ S+DFY KVLG V + RPP FD FDGAWLFN
Sbjct  23   TKQLKEYDTIPPTPLIALNHVSRLCKSVQASIDFYVKVLGFVLIHRPPTFD-FDGAWLFN  81

Query  260  YGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTV  439
            YGVGIHL+Q KDG       P     LDP+DNH+SFQC+ ME ME+RLKE  +KY+KRTV
Sbjct  82   YGVGIHLIQKKDGGSLMDARP---DKLDPLDNHVSFQCEDMEVMEKRLKETNIKYLKRTV  138

Query  440  G-----EGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            G     E E   IDQLFF DPDGFMIEICNCEN+ LVP  SLG+I+LP   H PP+ 
Sbjct  139  GGEEEEEEEASPIDQLFFNDPDGFMIEICNCENLELVPAGSLGRIRLPRHHHNPPLH  195



>gb|KGN45087.1| hypothetical protein Csa_7G420800 [Cucumis sativus]
Length=260

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = +2

Query  68   LREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGA  247
            ++     + + +E+   P MALNHVSR+C++VKDSV FYTKVLG V +ERP +FD F+GA
Sbjct  80   IQANNEETTRKQEEHPLPLMALNHVSRVCKNVKDSVHFYTKVLGFVLIERPQSFD-FEGA  138

Query  248  WLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYM  427
            WLFNYGVGIHL+Q ++ D       +D+  LDPMDNHISFQC+ MEAME RLKEL VKYM
Sbjct  139  WLFNYGVGIHLMQTEEDDDSVGVRGSDKDHLDPMDNHISFQCEDMEAMEERLKELGVKYM  198

Query  428  KRTV-GEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQ  595
            +RT+  E +GE I+QLFF DPDGFMIEICNCEN+ LVP  S GKI+LP+ RH PP++
Sbjct  199  RRTLEEEEKGETIEQLFFNDPDGFMIEICNCENLKLVPAGSSGKIRLPAGRHNPPLE  255



>ref|XP_004516235.1| PREDICTED: lactoylglutathione lyase-like, partial [Cicer arietinum]
Length=169

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = +2

Query  71   REERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAW  250
            + ER  S   EE+++ P MALNHVSRLCR+VK+S++FYTKVLG V +ERP   D F+GAW
Sbjct  19   KNEREGSEGKEENNQAPLMALNHVSRLCRNVKESIEFYTKVLGFVLIERPQVLD-FEGAW  77

Query  251  LFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMK  430
            LFNYGVGIHLVQ+K+  ++RLP   D Q LDP DNHISFQC+ +EAME++LKE+ V+Y K
Sbjct  78   LFNYGVGIHLVQSKE--EERLPQ--DTQHLDPQDNHISFQCEDVEAMEKKLKEMNVRYKK  133

Query  431  RTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVP  538
            RT+   +G  +DQLFF DPDGFM+EICNCEN+ L+P
Sbjct  134  RTLEAEDGTTMDQLFFNDPDGFMVEICNCENLKLIP  169



>ref|XP_008354674.1| PREDICTED: uncharacterized protein LOC103418323, partial [Malus 
domestica]
Length=207

 Score =   206 bits (523),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 124/156 (79%), Gaps = 6/156 (4%)
 Frame = +2

Query  92   RKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVG  271
            +K E+DD  P MALNHVS LCR+V++SVDFYTKVLG V+ ERPPAFD FDGAWLFNYGVG
Sbjct  2    QKEEDDDSLPLMALNHVSXLCRNVEESVDFYTKVLGFVKXERPPAFD-FDGAWLFNYGVG  60

Query  272  IHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE  451
            IHLVQ++  D++RLPH  D   LDPMD HIS QC+ MEA+ER+LKEL +KYMK+ V + E
Sbjct  61   IHLVQSE--DEERLPHNPDH--LDPMDXHISXQCEDMEAVERKLKELDIKYMKKAVEDDE  116

Query  452  -GEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGK  556
             G  IDQLFF  PDGFM+E+CNCEN+ LVP  S  K
Sbjct  117  NGTKIDQLFFNVPDGFMVEMCNCENLKLVPAGSCRK  152



>gb|KDO83290.1| hypothetical protein CISIN_1g047907mg, partial [Citrus sinensis]
Length=153

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 5/153 (3%)
 Frame = +2

Query  71   REERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAW  250
            +E+ +     E++ E P M+LNHVSRLCR+V+DS+DFYTKVLG V +ERPPAFD F GAW
Sbjct  5    KEDNNKKEADEKEPELPLMSLNHVSRLCRNVEDSIDFYTKVLGFVLIERPPAFD-FAGAW  63

Query  251  LFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMK  430
            LF+YGVG+HLVQ+   D+D+L  P D   LD MDNHISFQC  MEA+E+RLKEL VKY+K
Sbjct  64   LFSYGVGVHLVQS--NDEDKLS-PPDSAHLDSMDNHISFQCGNMEAIEKRLKELDVKYIK  120

Query  431  RTVGEGE-GEAIDQLFFKDPDGFMIEICNCENI  526
            RTV + + G AIDQ+FF DPDGFMIEICNCEN+
Sbjct  121  RTVKDDQSGNAIDQMFFDDPDGFMIEICNCENL  153



>ref|XP_010926992.1| PREDICTED: uncharacterized protein LOC105049128 isoform X1 [Elaeis 
guineensis]
Length=237

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 129/205 (63%), Gaps = 40/205 (20%)
 Frame = +2

Query  89   SRKLEEDDE---TPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAW---  250
            +++L+E D    TP +ALNHVSRLC+SV+ S+DFY KVLG V + RPP FD FDGAW   
Sbjct  23   TKQLKEYDTIPPTPLIALNHVSRLCKSVQASIDFYVKVLGFVLIHRPPTFD-FDGAWSQL  81

Query  251  -------------------------LFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDN  355
                                     LFNYGVGIHL+Q KDG       P     LDP+DN
Sbjct  82   TSLQPNFLSIPLFNRTTFSSFWGCRLFNYGVGIHLIQKKDGGSLMDARP---DKLDPLDN  138

Query  356  HISFQCDAMEAMERRLKELKVKYMKRTVG-----EGEGEAIDQLFFKDPDGFMIEICNCE  520
            H+SFQC+ ME ME+RLKE  +KY+KRTVG     E E   IDQLFF DPDGFMIEICNCE
Sbjct  139  HVSFQCEDMEVMEKRLKETNIKYLKRTVGGEEEEEEEASPIDQLFFNDPDGFMIEICNCE  198

Query  521  NITLVPQPSLGKIKLPSDRHTPPVQ  595
            N+ LVP  SLG+I+LP   H PP+ 
Sbjct  199  NLELVPAGSLGRIRLPRHHHNPPLH  223



>ref|XP_009392743.1| PREDICTED: uncharacterized protein LOC103978621 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 122/177 (69%), Gaps = 9/177 (5%)
 Frame = +2

Query  62   QSLREERSHSRKLEEDDET----PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAF  229
            Q L  E+   R    D  T    P MALNHVSRLCRSV+ SV+FYT VLG V   RPP  
Sbjct  53   QQLHNEKEEDRPQNHDSSTNRPMPLMALNHVSRLCRSVEASVEFYTAVLGFVPTGRPPTL  112

Query  230  DGFDGAWL-FNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLK  406
            D F+GAWL FNY VGIHLVQ +DG    LP  +  + LDPMDNHISFQC+ M AME+RLK
Sbjct  113  D-FNGAWLWFNYDVGIHLVQEEDGGD--LPDASLDR-LDPMDNHISFQCEDMGAMEQRLK  168

Query  407  ELKVKYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDR  577
            +L VKY++RT+ E EG  IDQLFF DPDGFMIEICNCEN+ LVP   LG+   P  +
Sbjct  169  DLGVKYLRRTINEEEGSPIDQLFFNDPDGFMIEICNCENLELVPAGFLGRSTTPRSK  225



>ref|XP_003568834.1| PREDICTED: uncharacterized protein LOC100821708 [Brachypodium 
distachyon]
 ref|XP_010231663.1| PREDICTED: uncharacterized protein LOC100821708 [Brachypodium 
distachyon]
Length=207

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 110/140 (79%), Gaps = 6/140 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV++S+DFY  VLG + + RP +FD FDGAWLFNYG+GIHL+QA+D 
Sbjct  16   PLASLNHISIVCRSVEESLDFYMNVLGFMPIRRPGSFD-FDGAWLFNYGIGIHLLQAED-  73

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              + LP  T +  ++P DNHISFQC++M A+ERRLKEL + Y++R V EG G  +DQ+FF
Sbjct  74   -PESLPEKTAR--INPKDNHISFQCESMVAVERRLKELGIAYIQRCVEEG-GIYVDQIFF  129

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFMIEICNC+N+ +VP
Sbjct  130  HDPDGFMIEICNCDNLPVVP  149



>ref|XP_006655044.1| PREDICTED: uncharacterized protein LOC102706197 [Oryza brachyantha]
Length=228

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV++S+ FY  VLG V V RP +FD FDGAWLFNYG+GIHL+QA+D 
Sbjct  38   PLASLNHISIVCRSVQESLQFYADVLGFVPVRRPGSFD-FDGAWLFNYGIGIHLLQAED-  95

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              D LP  T+   ++P DNHISFQC++M A+ERRLKEL + +++R V EG G  +DQ+FF
Sbjct  96   -PDSLPGKTE---INPKDNHISFQCESMAAVERRLKELGIPHVQRCVEEG-GIYVDQIFF  150

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFMIEICNC+N+ +VP
Sbjct  151  HDPDGFMIEICNCDNLPVVP  170



>ref|NP_001054776.1| Os05g0171900 [Oryza sativa Japonica Group]
 gb|AAU44337.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16690.1| Os05g0171900 [Oryza sativa Japonica Group]
 gb|EAY96717.1| hypothetical protein OsI_18636 [Oryza sativa Indica Group]
 dbj|BAG91620.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62498.1| hypothetical protein OsJ_17296 [Oryza sativa Japonica Group]
Length=208

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRS+++S+ FYT VLG   V RP +FD FDGAWLFNYG+GIHL+QA+D 
Sbjct  19   PLASLNHISIVCRSLQESLTFYTDVLGFFPVRRPGSFD-FDGAWLFNYGIGIHLLQAED-  76

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              D LP  T+   ++P DNHISFQC++M A+ERRLKEL + Y++R V EG G  +DQ+FF
Sbjct  77   -PDSLPGKTE---INPKDNHISFQCESMVAVERRLKELGIPYIQRCVEEG-GIYVDQIFF  131

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFMIEICNC+N+ +VP
Sbjct  132  HDPDGFMIEICNCDNLPVVP  151



>ref|XP_004960819.1| PREDICTED: uncharacterized protein LOC101757142 [Setaria italica]
Length=206

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 114/154 (74%), Gaps = 13/154 (8%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV++S+ FYT VLG V + RP +FD FDGAWLFNYG+GIHL+Q++D 
Sbjct  16   PLASLNHISIVCRSVEESLSFYTDVLGFVPIRRPGSFD-FDGAWLFNYGIGIHLLQSED-  73

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                LP   +++ ++P DNHISFQC++M A+ERRLKE+ + Y++R V EG G  +DQ+FF
Sbjct  74   -PGSLP---EKREINPKDNHISFQCESMAAVERRLKEMGIPYVQRCVEEG-GINVDQIFF  128

Query  479  KDPDGFMIEICNCENITLVP------QPSLGKIK  562
             DPDGFMIEICNC+N+ ++P       P LG  K
Sbjct  129  HDPDGFMIEICNCDNLPVIPLAGGDRAPVLGACK  162



>gb|ABR17137.1| unknown [Picea sitchensis]
Length=204

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 119/164 (73%), Gaps = 13/164 (8%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS +CRS++DS+ FY  VLG V V+RP +FD F+GAWLFNYG+GIHL+Q+KD   D
Sbjct  19   SLNHVSFVCRSIEDSIKFYENVLGFVRVKRPGSFD-FNGAWLFNYGIGIHLLQSKD--PD  75

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP  T+   ++P DNHISFQC+ ++ +ER+L+E+ VKY+KR V +G G  +DQLF  DP
Sbjct  76   SLPKKTE---INPRDNHISFQCEDVQVVERKLQEMNVKYVKRIVEDG-GIYVDQLFIHDP  131

Query  488  DGFMIEICNCENITLVPQPSLGK----IKLPSDRHTPPVQPPEK  607
            DGFM+E+CNCEN  +  +P +G     ++ PS   +PP+   EK
Sbjct  132  DGFMVEVCNCENFPV--EPIVGSAPACVRRPSHIPSPPIGTTEK  173



>gb|AEW07933.1| hypothetical protein 0_14804_01, partial [Pinus radiata]
 gb|AFG69122.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69123.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69124.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69125.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69126.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69127.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69128.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69129.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69130.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69132.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69133.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69134.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69135.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69136.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69137.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
Length=140

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 106/132 (80%), Gaps = 7/132 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS +CRS++DS+ FY  VLG V V+RP +FD F+GAWLFNYG+GIHL+Q+   D D
Sbjct  15   SLNHVSLVCRSIEDSIKFYENVLGFVRVKRPGSFD-FNGAWLFNYGIGIHLLQS--ADPD  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQCD+++++ER+L+ELK+KY+KR V +G G  +DQLF  DP
Sbjct  72   NVPKKTE---INPRDNHISFQCDSVQSVERKLQELKIKYVKRIVEDG-GIYVDQLFIHDP  127

Query  488  DGFMIEICNCEN  523
            DGFM+EICNCEN
Sbjct  128  DGFMLEICNCEN  139



>dbj|BAJ85628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV++S+DFY  VLG   + RP +FD FDGAWLFNYG+GIHL+Q++  
Sbjct  19   PLASLNHISIVCRSVEESLDFYMNVLGFTPIRRPGSFD-FDGAWLFNYGIGIHLLQSEH-  76

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              + LP    ++ ++P DNHISFQC++M A+ERRLKEL ++Y+KR V EG G  +DQ+FF
Sbjct  77   -PESLP---AKKEINPKDNHISFQCESMVAVERRLKELGIQYIKRCVEEG-GINVDQIFF  131

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFMIEICNC+N+ +VP
Sbjct  132  HDPDGFMIEICNCDNLPVVP  151



>ref|XP_006856971.1| hypothetical protein AMTR_s00190p00012330 [Amborella trichopoda]
 gb|ERN18438.1| hypothetical protein AMTR_s00190p00012330 [Amborella trichopoda]
Length=166

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 101/130 (78%), Gaps = 6/130 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P MALNH+SRLCRSV+ S++FY KVLG V ++R   F  F GAWLFNYG+GIHLVQ+K+ 
Sbjct  25   PLMALNHISRLCRSVEKSMEFYEKVLGFVLIKRSEVFK-FSGAWLFNYGMGIHLVQSKNP  83

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
             ++      D + LDPMDNHISFQC+ M  +E +LKE+K+KYM+RTV EG G  IDQ+FF
Sbjct  84   QEE----IDDTKPLDPMDNHISFQCEDMGVVEEKLKEMKIKYMRRTVEEG-GCTIDQMFF  138

Query  479  KDPDGFMIEI  508
            KDPDGFMIEI
Sbjct  139  KDPDGFMIEI  148



>ref|NP_001149571.1| lactoylglutathione lyase [Zea mays]
 gb|ACF84216.1| unknown [Zea mays]
 gb|ACG35892.1| lactoylglutathione lyase [Zea mays]
 gb|AFW81390.1| lactoylglutathione lyase [Zea mays]
Length=221

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 106/140 (76%), Gaps = 6/140 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV+ S+ FYT VLG V + RP +FD F GAWLFNYG+GIHL+Q++D 
Sbjct  19   PLASLNHISIVCRSVEASLRFYTDVLGFVPIRRPGSFD-FGGAWLFNYGIGIHLLQSEDP  77

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P ++  ++P DNHISFQC++M A+ERRLKE+ + Y++R V EG G  +DQ+FF
Sbjct  78   GS----LPPEKGEINPKDNHISFQCESMVAVERRLKEIGIPYVQRCVEEG-GINVDQIFF  132

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFMIEICNC+N+ +VP
Sbjct  133  HDPDGFMIEICNCDNLPVVP  152



>gb|AFG69131.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
Length=140

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 105/132 (80%), Gaps = 7/132 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS +CRS++DS+ FY  VLG V V+RP +FD F+GAWLFNYG+GIHL+Q+   D D
Sbjct  15   SLNHVSLVCRSIEDSIKFYENVLGFVRVKRPGSFD-FNGAWLFNYGIGIHLLQS--ADPD  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQCD+++++ER+L+ELK+KY+KR V +G G  +DQLF  DP
Sbjct  72   NVPKKTE---INPRDNHISFQCDSVQSVERKLQELKIKYVKRIVEDG-GIYVDQLFIHDP  127

Query  488  DGFMIEICNCEN  523
            D FM+EICNCEN
Sbjct  128  DRFMLEICNCEN  139



>gb|AGT16646.1| lactoylglutathione lyase [Saccharum hybrid cultivar R570]
Length=232

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 105/140 (75%), Gaps = 6/140 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  ALNH+S +CR ++ S+ FY  VLG V + RP +FD FDGAWLFNYG+G+HL+QA+D 
Sbjct  16   PLAALNHISVVCRCLESSLRFYRDVLGFVPIRRPGSFD-FDGAWLFNYGIGVHLLQAEDP  74

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P  +  ++P DNHISFQC++MEA++RRLKEL ++Y++R V EG G  +DQLFF
Sbjct  75   AS----MPPKKTEINPKDNHISFQCESMEAVQRRLKELGIRYVQRRVEEG-GIYVDQLFF  129

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFM+E+C C+N+ +VP
Sbjct  130  HDPDGFMVEVCTCDNLPIVP  149



>ref|XP_002517606.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF44770.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=172

 Score =   166 bits (420),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 110/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+DFY  VLG V + RP +FD FDGAWLF +G+GIHL+Q++D   +
Sbjct  13   SLNHISLLCRSVEESIDFYQNVLGFVPIRRPGSFD-FDGAWLFGFGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  ++   ++P DNHISFQC++M A+E++LKE+++KY++ TV EG G  +DQLFF DP
Sbjct  70   NMPKKSE---INPKDNHISFQCESMGAVEKKLKEMEIKYVRATVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_002439371.1| hypothetical protein SORBIDRAFT_09g005270 [Sorghum bicolor]
 gb|EES17801.1| hypothetical protein SORBIDRAFT_09g005270 [Sorghum bicolor]
Length=219

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 113/151 (75%), Gaps = 9/151 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CR+V+ S+ FYT VLG V + RP +FD FDGAWLFNYG+GIHL+Q++D 
Sbjct  22   PLASLNHISIVCRNVEASLRFYTDVLGFVPIRRPGSFD-FDGAWLFNYGIGIHLLQSED-  79

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                LP   ++  ++P DNHISFQC++M A+ERRLKE+ + Y++R V EG G  +DQ+FF
Sbjct  80   -PGSLP---EKGEINPKDNHISFQCESMVAVERRLKEMGIPYVQRCVEEG-GINVDQIFF  134

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPS  571
             DPDGFMIEICNC+N+ ++P    G ++L S
Sbjct  135  HDPDGFMIEICNCDNLPVIPLA--GAVQLGS  163



>gb|EAY72730.1| hypothetical protein OsI_00595 [Oryza sativa Indica Group]
Length=216

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 6/157 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P   LNHVS LCRS+  S+ FY   LG V V RP +FD FDGAWLFNYG+GIHL+QA+D 
Sbjct  18   PLSTLNHVSLLCRSLSTSLTFYRDFLGFVSVRRPGSFD-FDGAWLFNYGIGIHLLQAEDP  76

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            +      P +++ ++P DNHISF C++MEA++RRLKE+ V+Y++R V EG G  +DQ+FF
Sbjct  77   ES----MPPNKKEINPKDNHISFTCESMEAVQRRLKEMGVRYVQRRVEEG-GVYVDQIFF  131

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPP  589
             DPD FMIEIC C+ + +VP  +     + + R  PP
Sbjct  132  HDPDSFMIEICTCDKLPVVPLDAAAAHSIFAGRSPPP  168



>emb|CDO98135.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 15/165 (9%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C+SV  S+DFYT VLG V V RP +F+ FDGAWLF+YG+GIHL+QA++ D  
Sbjct  13   SLNHISLICKSVGKSMDFYTSVLGFVPVRRPGSFN-FDGAWLFSYGIGIHLLQAENPDD-  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T    ++P DNHISFQCD+M A+E+ L E+++KY ++ V EG G  +DQLFF DP
Sbjct  71   -MPEKT---VINPKDNHISFQCDSMAAVEKMLAEMEIKYARQRVEEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVPQP-----SLGKIKL---PSDRHTPPVQP  598
            DGFMIEICNC+N+ ++P       S  ++ L    + +H P V+P
Sbjct  126  DGFMIEICNCDNLPVIPLAGEMIRSCSRVNLQMMQAQQHLPVVRP  170



>ref|XP_010061928.1| PREDICTED: uncharacterized protein LOC104449460 [Eucalyptus grandis]
 gb|KCW68974.1| hypothetical protein EUGRSUZ_F02538 [Eucalyptus grandis]
Length=167

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 110/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS ++S++FY  VLG V + RP +FD FDGAWLF +GVGIHL++A+D   +
Sbjct  10   SLNHISFVCRSAEESINFYQNVLGFVPIRRPGSFD-FDGAWLFGFGVGIHLLEAED--PE  66

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQC++MEA+E++LKE++++Y++ TV EG G  +DQLFF DP
Sbjct  67   NMPKKTE---INPKDNHISFQCESMEAVEKKLKEMEIEYVRATVEEG-GIQVDQLFFHDP  122

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  123  DGFMIEICNCDSLPVIP  139



>ref|XP_004968374.1| PREDICTED: uncharacterized protein LOC101776223 [Setaria italica]
Length=227

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 104/140 (74%), Gaps = 6/140 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  ALNH+S +CRS+  S  FY  VLG + + RP +FD FDGAWLFNYG+GIHL+QA+D 
Sbjct  17   PLAALNHISVVCRSLDSSQRFYRDVLGFIPIRRPGSFD-FDGAWLFNYGIGIHLLQAEDP  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            +      P  +  ++P DNHISFQC++MEA++RRLKEL V+Y++R V EG G  +DQLFF
Sbjct  76   ES----MPPKKTEINPKDNHISFQCESMEAVQRRLKELGVRYVQRRVEEG-GIYVDQLFF  130

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFM+E+C C+ + +VP
Sbjct  131  HDPDGFMVEVCTCDKLPVVP  150



>ref|NP_001152619.1| lactoylglutathione lyase [Zea mays]
 gb|ACG48601.1| lactoylglutathione lyase [Zea mays]
 gb|AFW77327.1| lactoylglutathione lyase [Zea mays]
Length=222

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 105/140 (75%), Gaps = 6/140 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV+ S+ FY  VLG V + RP +FD FDGAWLFNYG+G+HL+Q++D 
Sbjct  17   PLASLNHISIVCRSVEASLRFYADVLGFVPIRRPGSFD-FDGAWLFNYGIGVHLLQSEDP  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P ++  ++P DNHISFQC++M A+ERRLKE+ + Y++R V EG G  +DQ+FF
Sbjct  76   GS----LPENKGEINPKDNHISFQCESMVAVERRLKEMGIPYVQRCVEEG-GINVDQIFF  130

Query  479  KDPDGFMIEICNCENITLVP  538
             DPD FMIE+CNC+N+ +VP
Sbjct  131  HDPDAFMIEVCNCDNLPVVP  150



>ref|XP_002285087.1| PREDICTED: uncharacterized protein LOC100244070 [Vitis vinifera]
 emb|CAN63501.1| hypothetical protein VITISV_011676 [Vitis vinifera]
 emb|CBI28173.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV+ S+DFY KVLG   + RP +FD FDGAWL+NYG+GIHL+Q++D D  
Sbjct  13   SVNHISLVCRSVEKSLDFYQKVLGFFSIRRPGSFD-FDGAWLYNYGMGIHLLQSEDPDN-  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                P   Q ++P DNHISFQC++M  +E++LKE+K++Y++  V EG G  +DQLFF DP
Sbjct  71   ---MPKISQQINPKDNHISFQCESMATVEKKLKEMKIEYVQSRVEEG-GICVDQLFFHDP  126

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+N+ ++P
Sbjct  127  DGSMIEICNCDNLPVIP  143



>ref|XP_002457260.1| hypothetical protein SORBIDRAFT_03g004330 [Sorghum bicolor]
 gb|EES02380.1| hypothetical protein SORBIDRAFT_03g004330 [Sorghum bicolor]
Length=233

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 104/140 (74%), Gaps = 6/140 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  ALNH+S +CR ++ S+ FY  VLG V + RP +FD F GAWLFNYG+G+HL+QA+D 
Sbjct  17   PLAALNHISVVCRCLESSLRFYRDVLGFVPIRRPGSFD-FHGAWLFNYGIGVHLLQAEDP  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P  +  ++P DNHISFQC++MEA++RRLKEL ++Y++R V EG G  +DQLFF
Sbjct  76   AS----MPPKKTEINPKDNHISFQCESMEAVQRRLKELGIRYVQRRVEEG-GIYVDQLFF  130

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFM+E+C C+N+ +VP
Sbjct  131  HDPDGFMVEVCTCDNLPIVP  150



>ref|XP_010097255.1| hypothetical protein L484_025804 [Morus notabilis]
 gb|EXB67322.1| hypothetical protein L484_025804 [Morus notabilis]
Length=180

 Score =   163 bits (413),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS+ +S+DFY  VLG V + RP +FD FDGAWLF +G+GIHL+Q++D   D
Sbjct  13   SLNHISLVCRSLVESIDFYQNVLGFVPIRRPGSFD-FDGAWLFGHGIGIHLLQSED--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P    +  ++P DNHISFQC++M A+E++LKE+++KY++  V EG G  +DQLFF DP
Sbjct  70   NMPR---KSVINPKDNHISFQCESMGAVEKKLKEMEIKYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+N+ +VP
Sbjct  126  DGFMIEICNCDNLPVVP  142



>ref|NP_001042158.1| Os01g0173600 [Oryza sativa Japonica Group]
 dbj|BAB62552.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF04072.1| Os01g0173600 [Oryza sativa Japonica Group]
Length=215

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 7/157 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P   LNHVS +CRS+  S+ FY   LG V V RP +FD FDGAWLFNYG+GIHL+QA+D 
Sbjct  18   PLSTLNHVSLVCRSLSTSLTFYRDFLGFVSVRRPGSFD-FDGAWLFNYGIGIHLLQAED-  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              + +P     + ++P DNHISF C++MEA++RRLKE+ V+Y++R V EG G  +DQ+FF
Sbjct  76   -PESMP---PNKEINPKDNHISFTCESMEAVQRRLKEMGVRYVQRRVEEG-GVYVDQIFF  130

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPP  589
             DPDGFMIEIC C+ + +VP  +     + + R  PP
Sbjct  131  HDPDGFMIEICTCDKLPVVPLDAAAAHSIFAGRSPPP  167



>gb|EAZ10730.1| hypothetical protein OsJ_00566 [Oryza sativa Japonica Group]
Length=215

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 7/157 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P   LNHVS +CRS+  S+ FY   LG V V RP +FD FDGAWLFNYG+GIHL+QA+D 
Sbjct  18   PLSTLNHVSLVCRSLSTSLTFYRDFLGFVSVRRPGSFD-FDGAWLFNYGIGIHLLQAED-  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              + +P     + ++P DNHISF C++MEA++RRLKE+ V+Y++R V EG G  +DQ+FF
Sbjct  76   -PESMP---PNKEINPKDNHISFTCESMEAVQRRLKEMGVRYVQRRVEEG-GVYVDQIFF  130

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPP  589
             DPDGFMIEIC C+ + +VP  +     + + R  PP
Sbjct  131  HDPDGFMIEICTCDKLPVVPLDAAAAHSIFAGRSPPP  167



>ref|XP_010914889.1| PREDICTED: uncharacterized protein LOC105040176 [Elaeis guineensis]
Length=189

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 109/147 (74%), Gaps = 7/147 (5%)
 Frame = +2

Query  98   LEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIH  277
            L      P  +LNH+S +CRSV+ S+DFY  VLG V V RP +FD FDGAWLFNYG+GIH
Sbjct  2    LHNAGALPLTSLNHISLVCRSVEMSLDFYQNVLGFVPVRRPGSFD-FDGAWLFNYGIGIH  60

Query  278  LVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGE  457
            L+Q++D   + +P  T+   ++P D+HISFQC++M  +E++LKE+ + Y++R V EG G 
Sbjct  61   LLQSED--PENMPKKTE---INPKDDHISFQCESMTLVEKKLKEMGIPYIQRRVEEG-GI  114

Query  458  AIDQLFFKDPDGFMIEICNCENITLVP  538
             +DQLFF DPDGFMIEICNC+N+ ++P
Sbjct  115  YVDQLFFHDPDGFMIEICNCDNLPVIP  141



>ref|XP_009801533.1| PREDICTED: uncharacterized protein LOC104247275 [Nicotiana sylvestris]
Length=212

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 117/181 (65%), Gaps = 12/181 (7%)
 Frame = +2

Query  56   KMQSLREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDG  235
            K ++  E   +    EE  + P +ALNHVS +C+SV  SV FY +VLG V ++RP +FD 
Sbjct  7    KAETAEETTFNWSSDEEITKMPLLALNHVSFVCKSVPKSVQFYEQVLGFVLIQRPSSFD-  65

Query  236  FDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELK  415
            FDGAWLFN+G+GIHL+  +D        P+ +  ++P DNHISFQC  M  +  RL+ELK
Sbjct  66   FDGAWLFNHGIGIHLLGKEDA-------PSKKGKINPKDNHISFQCSDMNLIIERLEELK  118

Query  416  VKYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS--LGKI-KLPSDRHTP  586
            ++Y+  TV EG G  +DQLFF DPDG MIEICNC+NI ++P  S  L K  K P+   T 
Sbjct  119  IEYVTATVKEG-GVTVDQLFFHDPDGNMIEICNCQNIPILPLSSCPLKKFNKYPTFNQTM  177

Query  587  P  589
            P
Sbjct  178  P  178



>dbj|BAJ53235.1| JHL06P13.16 [Jatropha curcas]
 gb|KDP37108.1| hypothetical protein JCGZ_06164 [Jatropha curcas]
Length=172

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LC+SV+ SVDFY  VLG V + RP +FD FDGAWL+ YG+GIHL+Q++D   D
Sbjct  13   SLNHISHLCKSVEQSVDFYENVLGFVPIRRPGSFD-FDGAWLYGYGIGIHLLQSED--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQC++M A+E++LKE+ +K+++  V EG G  +DQLFF DP
Sbjct  70   NMPKKTE---INPKDNHISFQCESMGAVEKKLKEMGIKHVRAMVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>emb|CAP72290.1| Glyoxalase [Triticum aestivum]
 emb|CDM81975.1| unnamed protein product [Triticum aestivum]
Length=243

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 107/141 (76%), Gaps = 7/141 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRS++ S+ FY  VLG +++ RP +FD FDGAWLFN+G+G+HL+QA   
Sbjct  24   PLASLNHISVVCRSLESSLSFYRDVLGFIQIRRPGSFD-FDGAWLFNFGIGVHLLQA---  79

Query  299  DQDRLPHPTDQQSLDPMDNHISFQ-CDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLF  475
             +DR   P  +  ++P DNHISF  C++MEA++RRLKEL ++Y++R V EG G  +DQ+F
Sbjct  80   -EDRASLPPKKAEINPKDNHISFTTCESMEAVQRRLKELGIRYVQRRVEEG-GIHVDQIF  137

Query  476  FKDPDGFMIEICNCENITLVP  538
            F DPDGFMIE+C C+N+ ++P
Sbjct  138  FHDPDGFMIEVCTCDNLPVIP  158



>ref|XP_002270473.1| PREDICTED: uncharacterized protein LOC100242353 [Vitis vinifera]
 emb|CBI36286.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C+SV +S+DFY   LG V + RP +FD FDGAWLF+YG+GIHL+Q++D   +
Sbjct  13   SLNHISLVCKSVPESIDFYQNTLGFVPIRRPGSFD-FDGAWLFSYGLGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQC++++A+E+ LKE+++ Y+++ V EG G  +DQLFF DP
Sbjct  70   NMPKKTE---INPKDNHISFQCESIDAVEKNLKEMEIHYVRKKVTEG-GFEVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+NI +VP
Sbjct  126  DGFMIEICNCDNIPIVP  142



>ref|XP_009348777.1| PREDICTED: uncharacterized protein LOC103940388 [Pyrus x bretschneideri]
Length=172

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S++FY  VLG V + RP +FD FDGAWLF YG+GIHL+Q++D   +
Sbjct  13   SLNHISLICRSVEESINFYQNVLGFVPIRRPGSFD-FDGAWLFGYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQC++M A+E++LKE+++KY +  V EG G  +DQLFF DP
Sbjct  70   NMPRKTE---INPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ +VP
Sbjct  126  DGFMIEICDCDNLPVVP  142



>ref|XP_008357276.1| PREDICTED: uncharacterized protein LOC103421019 [Malus domestica]
Length=172

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S++FY  VLG V + RP +FD FDGAWLF YG+GIHL+Q++D   +
Sbjct  13   SLNHISLICRSVEESINFYQNVLGFVPIRRPGSFD-FDGAWLFGYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQC++M A+E++LKE+++KY +  V EG G  +DQLFF DP
Sbjct  70   NMPKKTE---INPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ +VP
Sbjct  126  DGFMIEICDCDNLPVVP  142



>ref|XP_008792059.1| PREDICTED: uncharacterized protein LOC103708766 [Phoenix dactylifera]
Length=186

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 108/147 (73%), Gaps = 7/147 (5%)
 Frame = +2

Query  98   LEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIH  277
            L      P  +LNH+S +CRSV+ S+DFY  VLG V V RP +FD FDGAWLFNYG+GIH
Sbjct  2    LHNAGALPLTSLNHISLVCRSVEMSLDFYQNVLGFVPVRRPGSFD-FDGAWLFNYGIGIH  60

Query  278  LVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGE  457
            L+Q++D   + +P  T+   ++P D+HISFQC++M  +E++LKE+ + Y++R V E  G 
Sbjct  61   LLQSED--PENMPRKTE---INPKDDHISFQCESMALVEKKLKEMGINYIQRRVEEA-GI  114

Query  458  AIDQLFFKDPDGFMIEICNCENITLVP  538
             +DQLFF DPDGFMIEICNC+N+ ++P
Sbjct  115  YVDQLFFHDPDGFMIEICNCDNLPVIP  141



>gb|ABK24179.1| unknown [Picea sitchensis]
Length=170

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 109/143 (76%), Gaps = 7/143 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +C+SV++S +FY KVLG V V+RP +FD FDGAWLF+YGVGIHL+Q+++ 
Sbjct  11   PLTSLNHISLVCKSVEESRNFYEKVLGFVTVKRPASFD-FDGAWLFSYGVGIHLLQSRNP  69

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            +        ++  ++P DNH+SFQC++M+  +RRL+++++KY+KR V E EG  +DQLF 
Sbjct  70   EDL-----GEKSEINPRDNHVSFQCESMQLAKRRLQDMRIKYVKRRV-EEEGLYVDQLFI  123

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDGFMIE+C CEN+ +VP  S
Sbjct  124  HDPDGFMIEMCTCENLPVVPLAS  146



>ref|XP_003565402.1| PREDICTED: uncharacterized protein LOC100842326 [Brachypodium 
distachyon]
Length=228

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 104/138 (75%), Gaps = 6/138 (4%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            ++LNHVS +CRS++ S+ FY  VLG V + RP +F GFDGAWLFN+G+G+HL+QA+D   
Sbjct  27   VSLNHVSLVCRSLESSLAFYRNVLGFVPIRRPGSF-GFDGAWLFNFGIGVHLLQAEDPAN  85

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKD  484
                 P  +  ++P DNHISF C++ME ++RRLKE+ ++Y++R V EG G  +DQLFF D
Sbjct  86   ----MPAKKAEINPKDNHISFTCESMETVQRRLKEMGIRYVQRRVEEG-GIYVDQLFFHD  140

Query  485  PDGFMIEICNCENITLVP  538
            PDGFMIE+C C+N+ ++P
Sbjct  141  PDGFMIEVCTCDNLPVIP  158



>ref|XP_009362525.1| PREDICTED: uncharacterized protein LOC103952618 [Pyrus x bretschneideri]
 ref|XP_009362538.1| PREDICTED: uncharacterized protein LOC103952628 [Pyrus x bretschneideri]
Length=172

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S++FY  VLG V + RP +FD FDGAWLF YG+GIHL+Q++D   +
Sbjct  13   SLNHISLICRSVEESINFYQNVLGFVPIRRPGSFD-FDGAWLFGYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T    ++P DNHISFQC++M A+E++LKE+++KY +  V EG G  +DQLFF DP
Sbjct  70   NMPRKT---VINPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ +VP
Sbjct  126  DGFMIEICDCDNLPVVP  142



>ref|XP_004236038.1| PREDICTED: uncharacterized protein LOC101250492 [Solanum lycopersicum]
Length=178

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 109/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S++FY  VLG V V RP +F+ F+GAWLF+YG+GIHL+Q++D   +
Sbjct  13   SLNHISLVCRSVEKSIEFYKNVLGFVPVRRPGSFN-FNGAWLFSYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P  T+   ++P DNHISFQC++++A+E++L E+ +KY ++ V EG G  +DQLFF DP
Sbjct  70   KMPKKTE---INPKDNHISFQCESIDAVEKKLTEMGIKYARQLVEEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFM+EICNC+N+ ++P
Sbjct  126  DGFMVEICNCDNLPVIP  142



>ref|XP_008243712.1| PREDICTED: uncharacterized protein LOC103341942 [Prunus mume]
Length=168

 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S+DFY  VLG V + RP +F+ FDGAWLF YG+GIHL+Q++D   +
Sbjct  13   SLNHISLICRSVEQSIDFYQNVLGFVPIRRPGSFN-FDGAWLFGYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQC++M A+E++LKE+++KY +  V EG G  +DQLFF DP
Sbjct  70   SMPKKTE---INPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ ++P
Sbjct  126  DGFMIEICDCDNLPVIP  142



>ref|XP_004302970.1| PREDICTED: metallothiol transferase FosB-like [Fragaria vesca 
subsp. vesca]
Length=170

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S+ FY  VLG V + RP +FD FDGAWLF YG+GIHL+Q+++   +
Sbjct  13   SLNHISLICRSVEESIAFYQNVLGFVPIRRPGSFD-FDGAWLFGYGIGIHLLQSEE--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P  T+   ++P DNHISFQC++M A+E++LKE+++KY +  V EG G  +DQLFF DP
Sbjct  70   KMPKKTE---INPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ ++P
Sbjct  126  DGFMIEICDCDNLPVIP  142



>ref|XP_006302910.1| hypothetical protein CARUB_v10021045mg [Capsella rubella]
 gb|EOA35808.1| hypothetical protein CARUB_v10021045mg [Capsella rubella]
Length=171

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + D+ 
Sbjct  13   SLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFD-FDGAWLFGHGIGIHLLQSPEPDKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++MEA+ER+LKE++++Y++  V EG G  +DQLFF DP
Sbjct  72   -----VKKSEINPKDNHISFQCESMEAVERKLKEMEIEYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_007215072.1| hypothetical protein PRUPE_ppa012380mg [Prunus persica]
 gb|EMJ16271.1| hypothetical protein PRUPE_ppa012380mg [Prunus persica]
Length=172

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S+DFY  VLG V + RP +F+ FDGAWLF YG+GIHL+Q++D   +
Sbjct  13   SLNHISLICRSVEQSIDFYQNVLGFVPIRRPGSFN-FDGAWLFGYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T+   ++P DNHISFQC++M A+E++LKE+++KY +  V EG G  +DQLFF DP
Sbjct  70   SMPKKTE---INPKDNHISFQCESMGAVEKKLKEMELKYKRAMVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ ++P
Sbjct  126  DGFMIEICDCDNLPVIP  142



>ref|XP_007023869.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOY26491.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=170

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 109/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS +CRSV++S++FY  +LG V + RP +FD F+GAWLF YG+GIHL+Q++D   D
Sbjct  13   SLNHVSLVCRSVEESINFYQNILGFVPIRRPGSFD-FNGAWLFGYGIGIHLLQSED--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P    ++ ++P DNHISFQC++M A+E++LKE++++Y++  V EG G  ++QLFF DP
Sbjct  70   NMP---KKKKINPKDNHISFQCESMGAVEKKLKEMELEYVRAMVEEG-GIYVEQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+N+ ++P
Sbjct  126  DGFMIEICNCDNLPVIP  142



>gb|KHG29618.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=200

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 110/152 (72%), Gaps = 10/152 (7%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SV  SV FY +VLG V ++RP +F+ F+GAWLFNYG+GIHL++++  
Sbjct  24   PLLSLNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFN-FEGAWLFNYGIGIHLLESESV  82

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   PT ++ ++P DNHISFQC  ME + R+L+ +K++Y+   V EG G  +DQLFF
Sbjct  83   -------PTKKEKINPKDNHISFQCSDMEQVIRKLEAMKIEYVTGVVEEG-GIQVDQLFF  134

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSD  574
             DPDG+MIEICNC+N+ ++P  S   +KLPS 
Sbjct  135  HDPDGYMIEICNCQNLPVLPLTSC-TLKLPSS  165



>ref|XP_004506908.1| PREDICTED: uncharacterized protein YwkD-like [Cicer arietinum]
Length=171

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 114/150 (76%), Gaps = 9/150 (6%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV++S+DFY  VLG   + RP +FD FDGAWLF YG+GIHL++A++   +
Sbjct  13   SVNHISLICRSVEESMDFYQNVLGFFPIRRPGSFD-FDGAWLFGYGIGIHLLEAEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    ++ ++P DNHISFQC++M A+E++LKE+++ Y++ TV EG G  +DQLFF DP
Sbjct  70   KLPR---KKEINPKDNHISFQCESMGAVEKKLKEMEIDYVRATVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVPQPSLGKIKLPSDR  577
            DGFMIEICNC+++ ++  P +G +  P  R
Sbjct  126  DGFMIEICNCDSLPVI--PLVGDLARPCSR  153



>ref|XP_009594193.1| PREDICTED: uncharacterized protein LOC104090726 [Nicotiana tomentosiformis]
Length=177

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 109/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S++FY  VLG V V RP +F+ F+GAWLF+YG+GIHL+Q++D   +
Sbjct  13   SLNHISLVCRSVEQSIEFYKNVLGFVPVRRPGSFN-FNGAWLFSYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P  T+   ++P DNHISFQC+++ A+E++L E+ +KY+++ V EG G  +DQLFF DP
Sbjct  70   KMPKKTE---INPKDNHISFQCESIGAVEKKLTEMGIKYVRQLVEEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFM+EICNC+N+ ++P
Sbjct  126  DGFMVEICNCDNLPVIP  142



>gb|KDP42432.1| hypothetical protein JCGZ_00229 [Jatropha curcas]
Length=208

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 112/150 (75%), Gaps = 10/150 (7%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P+++LNHVS +C+SV +SV FY  VLG V ++RP +FD F+GAWLFN+GVGIHL++A++ 
Sbjct  27   PNLSLNHVSFVCKSVPESVRFYEDVLGFVLIKRPSSFD-FEGAWLFNHGVGIHLLEAENA  85

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P  + +++P DNHISFQC  M+ + RRL+E K++Y+  TV EG G  +DQLFF
Sbjct  86   -------PHKKGAINPKDNHISFQCSDMDLLVRRLEEKKIEYVTATVEEG-GITVDQLFF  137

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLP  568
             DPDG+M+EICNC+N+ ++P  S+  +KLP
Sbjct  138  HDPDGYMVEICNCQNLPVLPL-SVCPLKLP  166



>ref|XP_009802082.1| PREDICTED: uncharacterized protein LOC104247701 [Nicotiana sylvestris]
Length=177

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 109/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S++FY  +LG V V RP +F+ F+GAWLF+YG+GIHL+Q++D   +
Sbjct  13   SLNHISLVCRSVEQSIEFYKNILGFVPVRRPGSFN-FNGAWLFSYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P  T+   ++P DNHISFQC++++A+E++L E+ +KY ++ V EG G  +DQLFF DP
Sbjct  70   KMPKKTE---INPKDNHISFQCESIDAVEKKLTEMGIKYARQLVEEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFM+EICNC+N+ ++P
Sbjct  126  DGFMVEICNCDNLPVIP  142



>ref|XP_010065333.1| PREDICTED: uncharacterized protein LOC104452578 [Eucalyptus grandis]
 gb|KCW62752.1| hypothetical protein EUGRSUZ_G00342 [Eucalyptus grandis]
Length=220

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 116/173 (67%), Gaps = 13/173 (8%)
 Frame = +2

Query  98   LEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIH  277
            + E  + P ++LNHVS +C+SV ++V FY +VLG V ++RP +FD F+GAWLFNYG+GIH
Sbjct  29   VHEQPKLPLLSLNHVSFVCKSVAETVRFYERVLGFVLIKRPSSFD-FEGAWLFNYGIGIH  87

Query  278  LVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGE  457
            L++ +D        P  + +++P DNHISFQC  M+ + ++L+E+ ++Y+   V EG G 
Sbjct  88   LLEVEDV-------PAKKAAINPKDNHISFQCSDMKLVMKKLEEMNIEYVTAVVEEG-GI  139

Query  458  AIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKSYS  616
             +DQLFF DPDG+MIEICNC+N+ ++P  S   +KLP     P    P   YS
Sbjct  140  QVDQLFFHDPDGYMIEICNCDNLPVLPLSSC-PLKLPKTNKAP---SPSTLYS  188



>gb|EMT20922.1| hypothetical protein F775_15409 [Aegilops tauschii]
Length=186

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 106/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +C SV++S+ FY  VLG + + RP +F+ F+GAWLFNYG+GIHL+Q ++ 
Sbjct  8    PLASLNHISIVCSSVEESLRFYMNVLGFIPIRRPGSFN-FNGAWLFNYGIGIHLLQCEE-  65

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                LP  T+   ++P DNHISFQC++M A+ERRLKEL + Y++R V EG G  +DQ+FF
Sbjct  66   -PRSLPGKTE---INPKDNHISFQCESMVAVERRLKELGIPYIQRCVEEG-GIYVDQIFF  120

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDGFMIEICNC+N+ ++P
Sbjct  121  HDPDGFMIEICNCDNLPVIP  140



>gb|KCW79803.1| hypothetical protein EUGRSUZ_C01137 [Eucalyptus grandis]
Length=149

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 104/136 (76%), Gaps = 7/136 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
             LNH+S  CRSV++S++FY  VLG V + RP +FD FDGAWLFNYG+GIHL++++D   D
Sbjct  12   CLNHISMQCRSVEESINFYCNVLGFVSIRRPSSFD-FDGAWLFNYGIGIHLIKSED--LD  68

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP   +   ++P D HISFQC++ME +E++L+E+K++++   V EG G A+DQLFF DP
Sbjct  69   GLP---EVGQINPKDRHISFQCESMETVEKKLREMKIEFVNGQVVEG-GIAVDQLFFHDP  124

Query  488  DGFMIEICNCENITLV  535
            DG MIE+CNCENI +V
Sbjct  125  DGLMIEVCNCENIPVV  140



>ref|XP_002889306.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65565.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  14   SLNHISLLCRSVEESISFYHNVLGFLPIRRPGSFD-FDGAWLFGHGIGIHLLQSPEPEK-  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++MEA+E++LKEL++KY++  V EG G  +DQLFF DP
Sbjct  72   ----LLKKTEINPKDNHISFQCESMEAVEKKLKELEIKYVRAVVEEG-GIQVDQLFFHDP  126

Query  488  DGFMIEICNCENITLVP  538
            D FMIEICNC+++ +VP
Sbjct  127  DAFMIEICNCDSLPVVP  143



>gb|ABK26885.1| unknown [Picea sitchensis]
Length=197

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 107/139 (77%), Gaps = 13/139 (9%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P +++NH+S +CRSV+DS+DFY  VLG   ++RP +F+ FDGAWLF+YG+GIHL+Q+   
Sbjct  19   PLVSVNHISLVCRSVQDSMDFYEHVLGFFPIKRPGSFN-FDGAWLFSYGMGIHLLQS---  74

Query  299  DQDRLPHP---TDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQ  469
                 P+P     +Q ++PMDNH+SFQC++M+ +E +L E+ +K++KRTV EG G ++DQ
Sbjct  75   -----PNPGAMPKKQEINPMDNHMSFQCESMQVVESKLVEMNIKFVKRTVEEG-GISVDQ  128

Query  470  LFFKDPDGFMIEICNCENI  526
            LFF DPD FMIEICNC+N+
Sbjct  129  LFFHDPDDFMIEICNCDNL  147



>ref|XP_009604167.1| PREDICTED: uncharacterized protein LOC104099009 [Nicotiana tomentosiformis]
Length=163

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S+DFY  +LG   + RP +F+ FDGAWLFNYG+GIHL+Q++D   +
Sbjct  9    SLNHISVVCRSVEKSLDFYQNILGFFPIRRPGSFN-FDGAWLFNYGIGIHLLQSED--PE  65

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  +   +++P DNHISFQC++M  +E+RLKE++++Y+K  V EG G  +DQLFF DP
Sbjct  66   NMPKIS---TINPKDNHISFQCESMVTVEKRLKEMEIEYIKSRVEEG-GIYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+N+ ++P
Sbjct  122  DGMMIEICNCDNLPVIP  138



>ref|NP_001235416.1| uncharacterized protein LOC100305695 [Glycine max]
 gb|ACU13513.1| unknown [Glycine max]
Length=173

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 107/143 (75%), Gaps = 7/143 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +C SVK+S++FY  +LG   + RP +FD FDGAWLF YG+GIHL+QA+D   D
Sbjct  13   SVNHISLICTSVKESINFYQNLLGFFPIRRPGSFD-FDGAWLFGYGIGIHLLQAED--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T    ++P DNHISFQC++M A+E++L E++++Y+  TV EG G  +DQLFF DP
Sbjct  70   NVPRKT---KINPKDNHISFQCESMGAVEKKLGEMEIEYVHATVEEG-GIKVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVPQPSLGK  556
            DGFMIEICNC+++ ++P  + G 
Sbjct  126  DGFMIEICNCDSLPVIPLAASGN  148



>ref|XP_009608053.1| PREDICTED: uncharacterized protein LOC104102125 [Nicotiana tomentosiformis]
Length=220

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 111/166 (67%), Gaps = 12/166 (7%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            EE    P +ALNHVS +C+SV  SV FY +VLG V ++RP +FD FDGAWLFN+G+GIHL
Sbjct  30   EEITRMPLLALNHVSFVCKSVSKSVQFYEQVLGFVLIQRPSSFD-FDGAWLFNHGIGIHL  88

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            +  +D         + +  ++P DNHISFQC  M+ +  RL+ELK++Y+  TV EG    
Sbjct  89   LGKEDA-------ASKKGKINPKDNHISFQCSDMDLIIERLEELKIEYVTTTVKEGR-VT  140

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPS--LGKI-KLPSDRHTPP  589
            +DQLFF DPDG MIEICNC+NI ++P  S  L K  K P+ + T P
Sbjct  141  VDQLFFHDPDGNMIEICNCQNIPILPLSSCPLKKFNKYPTFKQTMP  186



>ref|XP_009778075.1| PREDICTED: uncharacterized protein LOC104227516 [Nicotiana sylvestris]
Length=163

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S+DFY  +LG   + RP +F+ FDGAWLFNYG+GIHL+Q++D +  
Sbjct  9    SLNHISVVCRSVEKSLDFYQNILGFFPIRRPGSFN-FDGAWLFNYGIGIHLLQSEDPEN-  66

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P     + ++P DNHISFQC++M  +E+RLKE++++Y+K  V EG G  +DQLFF DP
Sbjct  67   -MP---KIRIINPKDNHISFQCESMTTVEKRLKEMEIEYIKSRVEEG-GIYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+N+ ++P
Sbjct  122  DGMMIEICNCDNLPVIP  138



>ref|XP_010532163.1| PREDICTED: uncharacterized protein LOC104808228 [Tarenaya hassleriana]
Length=167

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S++FY  VLG + + RP +FD FDGAWLF +G+GIHL+++ +   +
Sbjct  9    SLNHISLLCRSVEESMNFYQNVLGFIPIRRPGSFD-FDGAWLFGHGIGIHLLRSPE--PE  65

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P    ++ ++P DNH+SFQC+ MEA+E++LK++K++Y++  V EG G  +DQLFF DP
Sbjct  66   KMP---KKEEINPKDNHVSFQCECMEAVEKKLKDMKIRYVRAVVEEG-GIQVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNCE + ++P
Sbjct  122  DGFMIEICNCECLPVIP  138



>gb|KHG30572.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=170

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 109/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S++FY  +LG V + RP +FD F+GAWLF YG+GIHL+Q++D   +
Sbjct  13   SLNHISLVCRSVEESMNFYQDILGFVPIRRPGSFD-FNGAWLFGYGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    ++ ++P DNHISFQC++M A+E++LKE++++Y++  V EG G  ++QLFF DP
Sbjct  70   SLP---KKKEINPKDNHISFQCESMGAVEKKLKEMELEYVRAIVEEG-GIYVEQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+N+ +VP
Sbjct  126  DGFMIEICNCDNLPVVP  142



>ref|XP_006364200.1| PREDICTED: uncharacterized protein LOC102594644 [Solanum tuberosum]
Length=178

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S++FY  VLG V V RP +F+ F+GAWLF+YG+GIHL+Q++D ++ 
Sbjct  13   SLNHISLVCRSVEKSIEFYKNVLGFVPVRRPGSFN-FNGAWLFSYGIGIHLLQSEDPEEM  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +      +  ++P DNHISFQC++++A+E++L E+ +KY +  V EG G  +DQLFF DP
Sbjct  72   Q-----KKTEINPKDNHISFQCESIDAVEKKLTEMGIKYARHLVEEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFM+EICNC+N+ ++P
Sbjct  126  DGFMVEICNCDNLPVIP  142



>ref|XP_010430002.1| PREDICTED: uncharacterized protein LOC104714363 isoform X2 [Camelina 
sativa]
Length=158

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFD-FDGAWLFGHGMGIHLLQSSEPEK-  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++ME +E++LKE+++KY++  V EG G  +DQLFF DP
Sbjct  71   ----LLKKSEINPKDNHISFQCESMETVEKKLKEMEIKYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_010472977.1| PREDICTED: uncharacterized protein LOC104752515 [Camelina sativa]
 ref|XP_010472978.1| PREDICTED: uncharacterized protein LOC104752515 [Camelina sativa]
Length=170

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFD-FDGAWLFGHGMGIHLLQSSEPEK-  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++ME +E++LKE+++KY++  V EG G  +DQLFF DP
Sbjct  71   ----LLKKSEINPKDNHISFQCESMETVEKKLKEMEIKYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_007135739.1| hypothetical protein PHAVU_010G154400g [Phaseolus vulgaris]
 gb|ESW07733.1| hypothetical protein PHAVU_010G154400g [Phaseolus vulgaris]
Length=227

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV++S+DFY  VLG   + RP +FD FDGAWLF YG+GIHL++A++   +
Sbjct  67   SVNHISLICRSVEESMDFYQNVLGFFPIRRPGSFD-FDGAWLFGYGIGIHLLEAEN--PE  123

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    ++ ++P DNHISFQC++M A+E++LKE+ + Y++ TV EG G  +DQLFF DP
Sbjct  124  KLPK---KKEINPKDNHISFQCESMGAVEKKLKEMDIAYVRATVEEG-GIQVDQLFFHDP  179

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  180  DGFMIEICNCDSLPVIP  196



>ref|XP_010417742.1| PREDICTED: uncharacterized protein LOC104703428 [Camelina sativa]
 ref|XP_010430000.1| PREDICTED: uncharacterized protein LOC104714363 isoform X1 [Camelina 
sativa]
 ref|XP_010430001.1| PREDICTED: uncharacterized protein LOC104714363 isoform X1 [Camelina 
sativa]
Length=170

 Score =   158 bits (400),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFD-FDGAWLFGHGMGIHLLQSSEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++ME +E++LKE+++KY++  V EG G  +DQLFF DP
Sbjct  72   -----LKKSEINPKDNHISFQCESMETVEKKLKEMEIKYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_009606733.1| PREDICTED: uncharacterized protein LOC104101037 [Nicotiana tomentosiformis]
Length=221

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 111/166 (67%), Gaps = 12/166 (7%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            EE    P +ALNHVS +C+SV  SV F+ +VLG V ++RP +FD F+GAWLFN+G+GIHL
Sbjct  31   EEITRMPLLALNHVSYVCKSVPTSVQFFEQVLGFVLIQRPSSFD-FEGAWLFNHGIGIHL  89

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            +  +D         + ++ ++P DNHISFQC  M+ +  RLKELK++Y+  TV EG G  
Sbjct  90   LGKEDAK-------SKKERINPKDNHISFQCSDMDLIIERLKELKIEYVTATVKEG-GVT  141

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPS--LGKI-KLPSDRHTPP  589
            +DQLFF DPDG MIEICNC+ I ++P  S  L K  K P+   T P
Sbjct  142  VDQLFFHDPDGNMIEICNCQTIPILPLSSCPLKKFNKYPTFNQTIP  187



>ref|XP_009388525.1| PREDICTED: uncharacterized protein LOC103975318 [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 113/156 (72%), Gaps = 9/156 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV+ S+DFY  VLG + V RP +FD FDGAWLFNYG+GIHL+Q++D 
Sbjct  10   PLASLNHISIVCRSVERSLDFYHNVLGFLPVRRPVSFD-FDGAWLFNYGIGIHLLQSEDP  68

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            +      PT ++ ++P DNHISFQC+++  +E++L+E+ + Y++  V EG G  +DQ+FF
Sbjct  69   EN----MPTKRE-INPKDNHISFQCESLALVEKKLREMGIPYIQSRVEEG-GIYVDQMFF  122

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTP  586
             DPDGFMIEICNCEN+ ++     G++ +   R +P
Sbjct  123  HDPDGFMIEICNCENLPVISLS--GELIMACKRVSP  156



>ref|XP_009785992.1| PREDICTED: uncharacterized protein LOC104234167 [Nicotiana sylvestris]
Length=222

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 106/159 (67%), Gaps = 11/159 (7%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P +ALNHVS +C+SV  S  FY +VLG V ++RP +FD FDGAWLFN+G+GIHL+  +D 
Sbjct  37   PLLALNHVSYVCKSVARSAQFYEQVLGFVLIKRPSSFD-FDGAWLFNHGIGIHLLGKEDA  95

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                    + +  ++P DNHISFQC  M+ +  RL ELK++Y+  TV EG G  +DQLFF
Sbjct  96   Q-------SKKGKINPKDNHISFQCSDMDLIIERLDELKIEYVTATVKEG-GVTVDQLFF  147

Query  479  KDPDGFMIEICNCENITLVPQPS--LGKIKLPSDRHTPP  589
             DPDG MIEICNC+NI ++P  S  L K   P+   T P
Sbjct  148  HDPDGNMIEICNCQNIPILPLSSCPLKKFATPTFNQTMP  186



>gb|ACF74315.1| lactoylglutathione lyase [Arachis hypogaea]
Length=181

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S+DFY  VLG   + RP +FD FDGAWLF +G+GIHL+QA+D   +
Sbjct  13   SLNHISLVCRSVEQSMDFYQNVLGFFPIRRPGSFD-FDGAWLFGFGIGIHLLQAED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    ++ ++P DNHISFQC+ MEA+E++LKE+ + +++  V EG G  +DQLFF DP
Sbjct  70   KLP---KKKEINPKDNHISFQCECMEAVEKKLKEMDINHVRARVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFM+EICNCE + ++P
Sbjct  126  DGFMVEICNCECLPVIP  142



>gb|KEH28697.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=175

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV++S+DFY  VLG   + RP +FD FDGAWLF YG+GIHL++A++   +
Sbjct  13   SVNHISLICRSVEESIDFYQNVLGFFPIRRPGSFD-FDGAWLFGYGIGIHLLEAEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    ++ ++P DNHISFQC++M A+E++LKE+++ Y++  V EG G  +DQLFF DP
Sbjct  70   TLPR---KKEINPKDNHISFQCESMGAVEKKLKEMEINYVRARVEEG-GIEVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_008673641.1| PREDICTED: uncharacterized protein LOC103649687 [Zea mays]
 tpg|DAA53228.1| TPA: lactoylglutathione lyase [Zea mays]
Length=239

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 100/135 (74%), Gaps = 6/135 (4%)
 Frame = +2

Query  134  NHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQDRL  313
            NH+S +CR ++ S+ FY  VLG   + RP +FD FDGAWLFNYG+GIHL+QA+D      
Sbjct  29   NHISVVCRCLESSLRFYRDVLGFAPIRRPGSFD-FDGAWLFNYGIGIHLLQAEDPAS---  84

Query  314  PHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDPDG  493
              P  +  ++P DNH+SFQC++MEA++RRL EL ++Y++R V EG G  +DQLFF DPDG
Sbjct  85   -MPPKKTEINPKDNHVSFQCESMEAVQRRLTELGIRYVQRRVEEG-GIYVDQLFFHDPDG  142

Query  494  FMIEICNCENITLVP  538
            FM+E+C C+N+ +VP
Sbjct  143  FMVEVCTCDNLPIVP  157



>ref|XP_009402147.1| PREDICTED: uncharacterized protein LOC103986010 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 106/139 (76%), Gaps = 7/139 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV+ S+DFY  VLG + + RP +FD F GAWLFNYG+GIHL+Q++D 
Sbjct  10   PLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFD-FTGAWLFNYGIGIHLLQSED-  67

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              +++P    ++ ++P DNHISFQC+++  +E +LKE+ + Y++R V EG G  +DQLFF
Sbjct  68   -PEKMPR---KKEINPKDNHISFQCESLSMVEGKLKEMGIPYIQRRVEEG-GIYVDQLFF  122

Query  479  KDPDGFMIEICNCENITLV  535
             DPDGFMIEICNC+N+ ++
Sbjct  123  HDPDGFMIEICNCDNLPVI  141



>ref|XP_010691164.1| PREDICTED: uncharacterized protein LOC104904575 [Beta vulgaris 
subsp. vulgaris]
Length=171

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S LCRSV++S++FY  VLG   + RP +FD FDGAWLF YG+GIHL+QA   + +
Sbjct  13   SINHISLLCRSVEESINFYQDVLGFFPIRRPGSFD-FDGAWLFGYGIGIHLLQA--AEPE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T+   ++P DNHISFQC++M A+E++L+++ +K+++  V EG G  +DQLFF DP
Sbjct  70   KLPQKTE---INPKDNHISFQCESMGAVEKKLRDMGIKHVRARVEEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ ++P
Sbjct  126  DGFMIEICDCDNLPVIP  142



>gb|ACU18440.1| unknown [Glycine max]
Length=172

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV+ S+DFY  VLG   + RP + D FDGAWLF YG+GIHL++A++   +
Sbjct  13   SVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLD-FDGAWLFGYGIGIHLLEAEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    ++ ++P DNHISFQC++M A+E++LKE+++ Y++ TV EG G  +DQLFF DP
Sbjct  70   KLP---KKKEINPKDNHISFQCESMVAVEKKLKEMEIDYVRATVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_009402148.1| PREDICTED: uncharacterized protein LOC103986012 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402149.1| PREDICTED: uncharacterized protein LOC103986014 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 106/139 (76%), Gaps = 7/139 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV+ S+DFY  VLG + + RP +FD F GAWLFNYG+GIHL+Q++D 
Sbjct  10   PLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFD-FTGAWLFNYGIGIHLLQSED-  67

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              +++P    ++ ++P DNHISFQC+++  +E +LKE+ + Y++R V EG G  +DQLFF
Sbjct  68   -PEKMPR---KKEINPKDNHISFQCESLSMVEGKLKEMGIPYIQRRVEEG-GIYVDQLFF  122

Query  479  KDPDGFMIEICNCENITLV  535
             DPDGFMIEICNC+N+ ++
Sbjct  123  HDPDGFMIEICNCDNLPVI  141



>ref|XP_010250045.1| PREDICTED: uncharacterized protein LOC104592394 [Nelumbo nucifera]
Length=197

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 7/136 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRSVK S+ FY  VLG + V RP + + F+GAWLF YG+GIHL+QA  G+ +
Sbjct  15   SLNHVSMLCRSVKKSLHFYQHVLGFIPVRRPESLN-FEGAWLFAYGIGIHLLQA--GNPE  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    +  ++P DNHISFQC+ M  +ER+LKE+ ++Y++  V EG G  +DQLFF DP
Sbjct  72   SLP---TKSEINPKDNHISFQCENMTVVERKLKEMGIEYVQNRVEEG-GIYVDQLFFHDP  127

Query  488  DGFMIEICNCENITLV  535
            DGFMIEICNCEN+ +V
Sbjct  128  DGFMIEICNCENLPVV  143



>gb|KHN01342.1| hypothetical protein glysoja_009548 [Glycine soja]
Length=172

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV+ S+DFY  VLG   + RP + D FDGAWLF YG+GIHL++A++   +
Sbjct  13   SVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLD-FDGAWLFGYGIGIHLLEAEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    ++ ++P DNHISFQC++M A+E++LKE+++ Y++ TV EG G  +DQLFF DP
Sbjct  70   KLP---KKKEINPKDNHISFQCESMVAVEKKLKEMEIDYVRATVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_006450972.1| hypothetical protein CICLE_v10009574mg [Citrus clementina]
 gb|ESR64212.1| hypothetical protein CICLE_v10009574mg [Citrus clementina]
Length=194

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 8/149 (5%)
 Frame = +2

Query  98   LEEDDETPSM--ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVG  271
            ++E  E P    +LNH+S +CRSV+ S+DFY  VLG   + RP +FD FDGAWLFNYG+G
Sbjct  1    MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFD-FDGAWLFNYGMG  59

Query  272  IHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE  451
            IHL+++++ D      P   ++++P DNHISFQC+ M  +ERRLKE+K+ Y+K  V EG 
Sbjct  60   IHLLKSEEPDN----LPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEG-  114

Query  452  GEAIDQLFFKDPDGFMIEICNCENITLVP  538
            G  +DQLFF DPDG MIEICNC+ + +VP
Sbjct  115  GINVDQLFFHDPDGSMIEICNCDVLPVVP  143



>ref|XP_009402188.1| PREDICTED: uncharacterized protein LOC103986041 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 106/139 (76%), Gaps = 7/139 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV+ S+DFY  VLG + + RP +FD F GAWLFNYG+GIHL+Q++D 
Sbjct  10   PLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFD-FTGAWLFNYGIGIHLLQSED-  67

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              +++P    ++ ++P DNHISFQC+++  +E +LKE+ + Y++R V EG G  +DQLFF
Sbjct  68   -PEKMPR---KREINPKDNHISFQCESLSLVEGKLKEMGIPYIQRRVEEG-GIYVDQLFF  122

Query  479  KDPDGFMIEICNCENITLV  535
             DPDGFMIEICNC+N+ ++
Sbjct  123  HDPDGFMIEICNCDNLPVI  141



>ref|XP_006475817.1| PREDICTED: uncharacterized protein LOC102622259 [Citrus sinensis]
 gb|KDO80290.1| hypothetical protein CISIN_1g029305mg [Citrus sinensis]
Length=194

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 8/149 (5%)
 Frame = +2

Query  98   LEEDDETPSM--ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVG  271
            ++E  E P    +LNH+S +CRSV+ S+DFY  VLG   + RP +FD FDGAWLFNYG+G
Sbjct  1    MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFD-FDGAWLFNYGMG  59

Query  272  IHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE  451
            IHL+++++ D      P   ++++P DNHISFQC+ M  +ERRLKE+K+ Y+K  V EG 
Sbjct  60   IHLLKSEEPDN----LPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEG-  114

Query  452  GEAIDQLFFKDPDGFMIEICNCENITLVP  538
            G  +DQLFF DPDG MIEICNC+ + +VP
Sbjct  115  GINVDQLFFHDPDGSMIEICNCDVLPVVP  143



>ref|NP_565231.1| GLYOXYLASE I 7 [Arabidopsis thaliana]
 gb|AAM63332.1| unknown [Arabidopsis thaliana]
 gb|ACF88486.1| At1g80160 [Arabidopsis thaliana]
 dbj|BAH19863.1| AT1G80160 [Arabidopsis thaliana]
 gb|AEE36364.1| GLYOXYLASE I 7 [Arabidopsis thaliana]
Length=167

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFD-FDGAWLFGHGIGIHLLQSPEPEK-  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++MEA+E++LKE++++Y++  V EG G  +DQLFF DP
Sbjct  71   ----LLKKTEINPKDNHISFQCESMEAVEKKLKEMEIEYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            D FMIEICNC+++ ++P
Sbjct  126  DAFMIEICNCDSLPVIP  142



>ref|XP_011035678.1| PREDICTED: uncharacterized protein LOC105133400 [Populus euphratica]
Length=172

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 119/166 (72%), Gaps = 12/166 (7%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+DFY  VLG V + RP +F+ FDGAWLF +G+GIHL+Q+++   +
Sbjct  13   SLNHISLLCRSVEESIDFYQDVLGFVPIRRPGSFN-FDGAWLFGFGIGIHLLQSEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P  ++   ++P DNHISFQC +M A+E++LK+L +++++  V EG G  ++QLFF DP
Sbjct  70   KMPKKSE---INPKDNHISFQCGSMAAVEKKLKDLGIQHVRALVEEG-GIQVEQLFFHDP  125

Query  488  DGFMIEICNCENITLVPQP-----SLGKIKLPSDRHTPPVQPPEKS  610
            DGFMIEICNC+N+ ++P       S   + L + +   P+ P E++
Sbjct  126  DGFMIEICNCDNLPVIPLAGDVARSCSCLNLQTMQQERPMLPQERA  171



>emb|CAN75608.1| hypothetical protein VITISV_040444 [Vitis vinifera]
Length=169

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C SV++S++FY  VLG V + RP +FD F+GAWLF+YG+GIHL+Q+ D   +
Sbjct  13   SLNHISLVCSSVEESINFYQNVLGFVPIRRPDSFD-FNGAWLFSYGIGIHLLQSDD--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P    ++ ++P DNHISFQC++M A+E++LKE+ ++Y ++ V EG G  +DQLFF DP
Sbjct  70   KMP---KKKEINPKDNHISFQCESMSAVEKKLKEMGMEYTRQKVVEG-GIEVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFM EICNC+N+ ++P
Sbjct  126  DGFMXEICNCDNLPVIP  142



>ref|NP_001237532.1| uncharacterized protein LOC100306100 [Glycine max]
 gb|ACU14119.1| unknown [Glycine max]
Length=172

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV+ S+DFY  VLG   + RP + D FDGAWLF YG+GIHL++A++   +
Sbjct  13   SVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLD-FDGAWLFGYGIGIHLLEAEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    ++ ++P DNHISFQC++M A+E++LKE+++ Y + TV EG G  +DQLFF DP
Sbjct  70   KLP---KKKEINPKDNHISFQCESMVAVEKKLKEMEIDYARATVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_006349336.1| PREDICTED: uncharacterized protein LOC102593899 [Solanum tuberosum]
Length=207

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 10/157 (6%)
 Frame = +2

Query  80   RSHSRKLEED-DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLF  256
            RS S  +  D +  P +ALNHVS +C+SV  SV FY +VLG   ++RP +F  F+GAWLF
Sbjct  7    RSESSTISNDMNSMPMLALNHVSYICKSVPKSVKFYEQVLGFTLIQRPSSFQ-FEGAWLF  65

Query  257  NYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRT  436
            N+G+GIHL+  +D   ++         ++P DNHISFQC  M+ + +RL ++ V+Y+  T
Sbjct  66   NHGIGIHLLGKEDAQSNK-------GKINPKDNHISFQCTDMDIIIQRLNDMNVEYVTAT  118

Query  437  VGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS  547
            V EG G  +DQLFF DPDG MIEICNC+NI ++P  S
Sbjct  119  VKEG-GATVDQLFFHDPDGNMIEICNCQNIPIIPLSS  154



>gb|EYU26486.1| hypothetical protein MIMGU_mgv1a013702mg [Erythranthe guttata]
Length=212

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 109/153 (71%), Gaps = 9/153 (6%)
 Frame = +2

Query  113  ETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAK  292
            E P +ALNHVS +C+S+K SV+FY +VLG V ++RP +FD F+GAWLFN+G+GIHL+QA+
Sbjct  31   EMPLLALNHVSFVCKSIKKSVEFYVQVLGFVLIKRPSSFD-FEGAWLFNHGIGIHLLQAE  89

Query  293  DGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQL  472
            + ++ +         ++P D HISFQC  M  +  +L+E+ ++Y+   V EG G  +DQ+
Sbjct  90   NIEKKK-------SKINPKDCHISFQCTDMNLIISQLEEMNIEYVTAVVTEG-GIIVDQI  141

Query  473  FFKDPDGFMIEICNCENITLVPQPSLGKIKLPS  571
            FF DPDG+M+EICNC+N+ ++P  S    K+PS
Sbjct  142  FFHDPDGYMVEICNCQNLPVLPLSSCPLKKMPS  174



>ref|XP_009621424.1| PREDICTED: uncharacterized protein LOC104113047 [Nicotiana tomentosiformis]
Length=223

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 108/160 (68%), Gaps = 12/160 (8%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P +ALNHVS +C+SV  S  FY +VLG V ++RP +FD FDGAWLFN+G+GIHL+  +D 
Sbjct  37   PLLALNHVSYVCKSVARSAQFYEQVLGFVLIKRPSSFD-FDGAWLFNHGIGIHLLGKEDA  95

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            +  +         ++P DNHISFQC  M+ +  RL+ELK++Y+  TV EG G  +DQLFF
Sbjct  96   EAKK-------GKINPKDNHISFQCSDMDLIIERLEELKIEYVTATVKEG-GVTVDQLFF  147

Query  479  KDPDGFMIEICNCENITLVPQPS--LGKI-KLPSDRHTPP  589
             DPDG MIEICNC+NI ++P  S  L K  K P+   T P
Sbjct  148  HDPDGNMIEICNCQNIPILPLSSCPLKKFNKYPTFNQTMP  187



>ref|XP_010088321.1| hypothetical protein L484_005835 [Morus notabilis]
 gb|EXB33937.1| hypothetical protein L484_005835 [Morus notabilis]
Length=175

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRS++ S+DFY  VLG   + RP +FD FDGAWLF+YG+GIHL+Q +D   +
Sbjct  13   SLNHISLLCRSLEKSLDFYRSVLGFFPIRRPDSFD-FDGAWLFSYGIGIHLLQCED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP     + ++P DNHISFQC++M  +ER+L+E+ + Y+K  V EG G  +DQLFF DP
Sbjct  70   KLP---KIKRINPKDNHISFQCESMSTVERKLQEMGIIYVKTRVEEG-GIHVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+N+ +VP
Sbjct  126  DGLMIEICNCDNLPVVP  142



>ref|XP_002298106.2| hypothetical protein POPTR_0001s17160g [Populus trichocarpa]
 gb|EEE82911.2| hypothetical protein POPTR_0001s17160g [Populus trichocarpa]
Length=225

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV +S+DFY  VLG V + RP +F+ FDGAWLF +G+GIHL+Q+++   +
Sbjct  66   SLNHISLLCRSVVESIDFYQDVLGFVPIRRPGSFN-FDGAWLFGFGIGIHLLQSEN--PE  122

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P  ++   ++P DNHISFQC++M A+E++LKEL +++++  V EG G  ++QLFF DP
Sbjct  123  KMPKKSE---INPKDNHISFQCESMGAVEKKLKELGIQHVRALVEEG-GIQVEQLFFHDP  178

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+N+ ++P
Sbjct  179  DGFMIEICNCDNLPVIP  195



>gb|KFK42418.1| hypothetical protein AALP_AA2G253600 [Arabis alpina]
Length=170

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMSFYQNVLGFLPIRRPGSFD-FDGAWLFGHGIGIHLLQSPEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++MEA+E++LKE+++++++  V EG G  +DQLFF DP
Sbjct  72   -----LKKTEINPKDNHISFQCESMEAVEKKLKEMEIEHVRAAVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_002270395.1| PREDICTED: uncharacterized protein LOC100247488 [Vitis vinifera]
 emb|CBI36287.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C SV++S++FY  VLG V + RP +FD F+GAWLF+YG+GIHL+Q+ +   +
Sbjct  13   SLNHISLVCSSVEESINFYQNVLGFVPIRRPDSFD-FNGAWLFSYGIGIHLLQSDN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P    ++ ++P DNHISFQC++M A+E++LKE+ ++Y ++ V EG G  +DQLFF DP
Sbjct  70   KMP---KKKEINPKDNHISFQCESMGAVEKKLKEMGMEYTRQKVVEG-GIEVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFM+EICNC+N+ ++P
Sbjct  126  DGFMVEICNCDNLPVIP  142



>ref|XP_009770635.1| PREDICTED: uncharacterized protein LOC104221297 [Nicotiana sylvestris]
Length=222

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 111/165 (67%), Gaps = 12/165 (7%)
 Frame = +2

Query  104  EDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLV  283
            E+   P +ALNHVS +C+SV  SV FY +VLG V ++RP +FD F+GAWLFN+G+GIHL+
Sbjct  33   EETRMPLLALNHVSYVCKSVPTSVQFYEQVLGFVLIQRPSSFD-FEGAWLFNHGIGIHLL  91

Query  284  QAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAI  463
              +D +       + +  ++P DNHISFQC  M+   +RL E+K++Y+  TV EG G  +
Sbjct  92   GKEDAE-------SKKGKINPKDNHISFQCSDMDLSIQRLDEMKIEYVTATVKEG-GVTV  143

Query  464  DQLFFKDPDGFMIEICNCENITLVPQPS--LGKI-KLPSDRHTPP  589
            DQLFF DPDG MIEICNC+NI ++P  S  L K  K P+   T P
Sbjct  144  DQLFFHDPDGNMIEICNCQNIPILPLSSCPLKKFNKYPTFNQTMP  188



>emb|CDY37573.1| BnaA02g19970D [Brassica napus]
Length=167

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S++FY  VLG + + RP +FD FDGAWLF +GVGIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMNFYQHVLGFLPIRRPGSFD-FDGAWLFGHGVGIHLLQSTEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++M A+E++LKE+ ++Y++  V EG G  +DQLFF DP
Sbjct  72   -----LKKTEINPKDNHISFQCESMGAVEKKLKEMGIEYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_010033948.1| PREDICTED: uncharacterized protein LOC104423170 [Eucalyptus grandis]
 gb|KCW53813.1| hypothetical protein EUGRSUZ_J03055 [Eucalyptus grandis]
Length=174

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 109/137 (80%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS+++S++FY  VLG V + RP +FD FDGAWLF +G+G+HL+Q++D   +
Sbjct  14   SLNHISLVCRSLEESMNFYQNVLGFVPIRRPGSFD-FDGAWLFGHGIGMHLLQSED--PE  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P  ++   ++P DNHISFQC++MEA+E++LKE+ + Y++  V EG G  ++QLFF DP
Sbjct  71   KMPKKSE---INPKDNHISFQCESMEAVEKKLKEMGMDYVRAAVEEG-GIQVEQLFFHDP  126

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  127  DGFMIEICNCDSLPVIP  143



>ref|XP_010049980.1| PREDICTED: glyoxalase domain-containing protein 5-like [Eucalyptus 
grandis]
 gb|KCW82813.1| hypothetical protein EUGRSUZ_C04184 [Eucalyptus grandis]
Length=170

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS++ +VDFY KVLG V V RP +FD F+GAWLFNYG+GIHL+QA+D  Q 
Sbjct  9    SLNHISLVCRSLERTVDFYQKVLGFVPVRRPGSFD-FEGAWLFNYGIGIHLLQAEDPHQ-  66

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P       ++P DNHISFQC++M  +E++L+E++++Y+K  V EG G  +DQ+FF DP
Sbjct  67   -MP---AAGGINPKDNHISFQCESMATVEKKLEEMEIEYVKSRVEEG-GIYVDQIFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIE+CNC+ + ++P
Sbjct  122  DGLMIEVCNCDILPVIP  138



>gb|AAD55473.1|AC009322_13 Hypothetical protein [Arabidopsis thaliana]
Length=208

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  54   SLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFD-FDGAWLFGHGIGIHLLQSPEPEK-  111

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++MEA+E++LKE++++Y++  V EG G  +DQLFF DP
Sbjct  112  ----LLKKTEINPKDNHISFQCESMEAVEKKLKEMEIEYVRAVVEEG-GIQVDQLFFHDP  166

Query  488  DGFMIEICNCENITLVP  538
            D FMIEICNC+++ ++P
Sbjct  167  DAFMIEICNCDSLPVIP  183



>gb|KHN15103.1| hypothetical protein glysoja_011721 [Glycine soja]
Length=161

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (74%), Gaps = 11/141 (8%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKD--GD  301
            +LNH+S +C SV+ SVDFY  VLG   ++RP + D F+GAWLFNYG+GIHL+Q++D  G 
Sbjct  9    SLNHISIVCASVEKSVDFYVNVLGFSPIKRPSSLD-FNGAWLFNYGIGIHLLQSEDPEGM  67

Query  302  QDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFK  481
               +P       ++P DNHISFQC+++ A+E+RL+++K++Y+K  V E  G  +DQLFF 
Sbjct  68   PKLVP-------INPKDNHISFQCESIAAVEKRLQQMKIEYVKNRVEES-GIFVDQLFFH  119

Query  482  DPDGFMIEICNCENITLVPQP  544
            DPDG MIEICNC+NI +VP P
Sbjct  120  DPDGMMIEICNCDNIPVVPLP  140



>gb|AFK41458.1| unknown [Lotus japonicus]
 gb|AFK49461.1| unknown [Lotus japonicus]
Length=172

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV++S+ FY  VLG   + RP +FD FDGAWLF YG+GIHL++A++   +
Sbjct  13   SVNHISLICRSVEESMAFYQDVLGFFPIRRPGSFD-FDGAWLFGYGIGIHLLEAEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    ++ ++P DNHISFQC++M A+E++LK++++ Y++ TV EG G  +DQLFF DP
Sbjct  70   KLPR---KKEINPKDNHISFQCESMGAVEKKLKDMEIAYVRATVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ ++P
Sbjct  126  DGFMIEICNCDSLPVIP  142



>ref|XP_009128447.1| PREDICTED: uncharacterized protein LOC103853278 [Brassica rapa]
Length=167

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +GVGIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMSFYQHVLGFLPIRRPGSFD-FDGAWLFGHGVGIHLLQSTEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++M A+E++LKE+ ++Y++  V EG G  +DQLFF DP
Sbjct  72   -----LKKTEINPKDNHISFQCESMGAVEKKLKEMGIEYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_009403405.1| PREDICTED: uncharacterized protein LOC103986970 [Musa acuminata 
subsp. malaccensis]
Length=254

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 106/139 (76%), Gaps = 7/139 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRSV+ S+DFY  VLG + + RP +F  FDGAWLFNYG+GIHL+Q++D 
Sbjct  84   PLASLNHISIVCRSVETSLDFYQNVLGFLPIRRPGSFK-FDGAWLFNYGIGIHLLQSED-  141

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              +++P    ++ ++P DNHISFQC+++  +E++LKE+ + Y++  V EG G  +DQLFF
Sbjct  142  -PEKMPR---KREINPKDNHISFQCESLALVEKKLKEMVIPYIQNRVEEG-GIYVDQLFF  196

Query  479  KDPDGFMIEICNCENITLV  535
             DPDGFMIEICNCEN+ ++
Sbjct  197  HDPDGFMIEICNCENLPVI  215



>ref|XP_008461098.1| PREDICTED: uncharacterized protein LOC103499788 [Cucumis melo]
Length=169

 Score =   155 bits (392),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S LCRSV++S++FY  +LG   + RP +F  FDGAWLF YG+GIHL+Q++    +
Sbjct  13   SINHISLLCRSVEESIEFYQNILGFFPIRRPGSFK-FDGAWLFGYGIGIHLLQSEK--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    +  ++P DNHISFQC++M A+E++LKE+++ Y++  V EG G  +DQLFF DP
Sbjct  70   NLP---KKGEINPKDNHISFQCESMGAVEKKLKEMEIDYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+N+ ++P
Sbjct  126  DGFMIEICNCDNLPVIP  142



>ref|XP_004230457.1| PREDICTED: uncharacterized protein LOC101243831 [Solanum lycopersicum]
Length=224

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 109/163 (67%), Gaps = 11/163 (7%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +E++  P +ALNHVS +C+SV  S  FY +VLG V ++RP +FD FDGAWLFN+G+GIHL
Sbjct  33   DEENRMPLLALNHVSYVCKSVPKSAQFYEQVLGFVLIKRPSSFD-FDGAWLFNHGIGIHL  91

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            +  +D    R         ++P DNHISFQC  M+ + +RL ++ V+Y+  TV EG G  
Sbjct  92   LGKEDVQSKR-------GKINPKDNHISFQCTDMDLIIQRLNDMNVEYVTATVKEG-GVT  143

Query  461  IDQLFFKDPDGFMIEICNCENITLVPQPS--LGKIKLPSDRHT  583
            +DQLFF DPDG MIEICNC+N+ ++P  S  L K+  P+   T
Sbjct  144  VDQLFFHDPDGNMIEICNCQNLPVLPLSSCPLKKMSSPTFNQT  186



>ref|XP_008781506.1| PREDICTED: uncharacterized protein LOC103701277 [Phoenix dactylifera]
Length=204

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 6/143 (4%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P M+LNHVS +CRSV  SV FY +VLG V ++RP +F+ F GAWLFNYGVGIHL+Q    
Sbjct  17   PLMSLNHVSFVCRSVSRSVKFYEEVLGFVSIKRPSSFN-FHGAWLFNYGVGIHLLQCNSP  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            D      P  +  ++P DNHISFQC  +  ++R+LKE+ ++Y+   V E  G  +DQLFF
Sbjct  76   DDV----PKKKGVINPKDNHISFQCSDINLLKRKLKEMGIEYVTAVV-EDSGIQVDQLFF  130

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDG+M+EICNCEN+ ++P  S
Sbjct  131  HDPDGYMVEICNCENLPMLPLSS  153



>emb|CDY38650.1| BnaC02g23290D [Brassica napus]
Length=167

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S++FY  VLG + + RP +FD FDGAWLF +GVGIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMNFYQHVLGFLPIRRPGSFD-FDGAWLFGHGVGIHLLQSTEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++M A+E++L E+ ++Y+ R VGE  G  +DQLFF DP
Sbjct  72   -----LKKTEINPKDNHISFQCESMGAVEKKLNEMGIEYV-RAVGEEGGIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_008784259.1| PREDICTED: uncharacterized protein LOC103703257 [Phoenix dactylifera]
Length=204

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 102/153 (67%), Gaps = 7/153 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P M+LNHVS +CRSV  SV FY +VLG V V+RP +F+ F GAWLFNYGVGIHL+Q    
Sbjct  17   PLMSLNHVSFVCRSVSRSVKFYEEVLGFVSVKRPSSFN-FHGAWLFNYGVGIHLLQCNSP  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            D      P  +  ++P DNHISFQC  +  ++R+LKE+ ++Y+   V E     +DQLFF
Sbjct  76   DDV----PKKKGVINPKDNHISFQCSDISLLKRKLKEMSIEYVTSVV-EDSAIQVDQLFF  130

Query  479  KDPDGFMIEICNCENITLVPQPSLG-KIKLPSD  574
             DPDG+M+EICNCEN+ ++P  S   K   P D
Sbjct  131  HDPDGYMVEICNCENLPVLPLSSFPLKFPYPKD  163



>ref|XP_003609290.1| hypothetical protein MTR_4g114080 [Medicago truncatula]
 gb|AES91487.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
 gb|AFK35867.1| unknown [Medicago truncatula]
Length=168

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 99/137 (72%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS+  SVDFY  VLG   ++RP +   F+GAWLFNYG+GIHL+Q+ D +  
Sbjct  9    SLNHISLVCRSLDKSVDFYVNVLGFFPIKRPTSL-AFNGAWLFNYGIGIHLLQSDDPES-  66

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                 T    ++P DNHISFQC++M A+E +L+++K++Y+K  V E  G  +DQLFF DP
Sbjct  67   ----MTKNVHINPKDNHISFQCESMAAVENKLQQMKIEYVKNLVEEN-GIYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+NI +VP
Sbjct  122  DGTMIEICNCDNIPIVP  138



>ref|NP_001236449.1| uncharacterized protein LOC100305770 [Glycine max]
 gb|ACU13626.1| unknown [Glycine max]
Length=163

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C SV+ SVDFY  VLG   ++RP + D F+GAWLFNYG+GIHL+Q+++ +  
Sbjct  9    SLNHISIVCASVEKSVDFYVNVLGFSPIKRPSSLD-FNGAWLFNYGIGIHLLQSENPEGM  67

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                P     ++P DNHISFQC+++ A+E+RL+++K++Y+K  V E  G  +DQLFF DP
Sbjct  68   PKTAP-----INPKDNHISFQCESIAAVEKRLQQVKIEYVKNRVEES-GTYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+NI +VP
Sbjct  122  DGMMIEICNCDNIPVVP  138



>gb|KHG26581.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=169

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S++FY K LG V + RP +FD F+GAWLF YG GIHL+Q++D   D
Sbjct  13   SLNHISLVCRSVEESINFYQKTLGFVPIRRPGSFD-FNGAWLFGYGFGIHLLQSED--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    +  ++P DNHISFQC+ M  +E +LKE++++Y +  V EG G  ++QLFF DP
Sbjct  70   NLP---KKWKINPKDNHISFQCENMGCVENKLKEMEMEYERAIVEEG-GICVEQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+N+ +VP
Sbjct  126  DGFMIEICNCDNLPVVP  142



>ref|XP_006593342.1| PREDICTED: uncharacterized protein LOC100305770 isoform X1 [Glycine 
max]
Length=167

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C SV+ SVDFY  VLG   ++RP + D F+GAWLFNYG+GIHL+Q+++ +  
Sbjct  9    SLNHISIVCASVEKSVDFYVNVLGFSPIKRPSSLD-FNGAWLFNYGIGIHLLQSENPEGM  67

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                P     ++P DNHISFQC+++ A+E+RL+++K++Y+K  V E  G  +DQLFF DP
Sbjct  68   PKTAP-----INPKDNHISFQCESIAAVEKRLQQMKIEYVKNRVEES-GTYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+NI +VP
Sbjct  122  DGMMIEICNCDNIPVVP  138



>ref|XP_004512116.1| PREDICTED: uncharacterized protein LOC101496496 [Cicer arietinum]
Length=202

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = +2

Query  59   MQSLREERSHSRKLEEDDET---PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAF  229
            M +  +E+    ++EE  ET   P ++LNHVS LC SV DS+ FY +VLG V ++RP +F
Sbjct  3    MLASLKEQEWKMEIEEICETQALPLLSLNHVSLLCSSVLDSMKFYEEVLGFVPIKRPSSF  62

Query  230  DGFDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKE  409
              F+GAW +NYG+GIHL+Q  + D+    +  + + ++P DNHISFQC  +E +++RL+E
Sbjct  63   K-FNGAWFYNYGIGIHLIQNPEIDEFD-TYINESRPINPKDNHISFQCTDVELVKKRLEE  120

Query  410  LKVKYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS  547
              +KY+   V EG G  +DQ+FF DPDG+MIE+CNCENI ++P  S
Sbjct  121  KGMKYVTAVVDEG-GIQVDQVFFHDPDGYMIELCNCENIPIIPVSS  165



>ref|XP_010263898.1| PREDICTED: uncharacterized protein LOC104602042 [Nelumbo nucifera]
Length=197

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 112/169 (66%), Gaps = 12/169 (7%)
 Frame = +2

Query  104  EDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLV  283
            E+   P ++LNHVS LC+SV ++  FY +VLG V V+RP +FD F+GAWLFNYG+GIHL+
Sbjct  8    ENSALPFLSLNHVSFLCKSVTETAKFYQEVLGFVLVKRPSSFD-FEGAWLFNYGIGIHLL  66

Query  284  QAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAI  463
            Q  D   D L  P+    + P DNHISFQC  +E ++R+L+E+ +KY+     EGE + +
Sbjct  67   QC-DSVDDVLQKPS---IIKPKDNHISFQCTDVELVKRKLEEMGMKYVTAVDEEGEIK-V  121

Query  464  DQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKS  610
            DQLFF DPDG+MIEICNCE + ++P  S       S + +    PP +S
Sbjct  122  DQLFFHDPDGYMIEICNCEKLPVLPLSSC------SLKRSSTWIPPSRS  164



>ref|XP_006349333.1| PREDICTED: uncharacterized protein LOC102593019 [Solanum tuberosum]
Length=221

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 110/168 (65%), Gaps = 21/168 (13%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +E++  P +ALNHVS +C+SV  S  FY +VLG V ++RP +FD FDGAWLFN+G+GIHL
Sbjct  30   DEENRMPLLALNHVSYVCKSVPKSAQFYEQVLGFVLIKRPSSFD-FDGAWLFNHGIGIHL  88

Query  281  -----VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGE  445
                 VQ+K G             ++P DNHISFQC  M+ + +RL ++ V+Y+  TV E
Sbjct  89   LGKEDVQSKTG------------KINPKDNHISFQCTDMDLIIQRLNDMNVEYVTATVKE  136

Query  446  GEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS--LGKIKLPSDRHT  583
            G G  +DQLFF DPDG MIEICNC+N+ ++P  S  L K+  P+   T
Sbjct  137  G-GVTVDQLFFHDPDGNMIEICNCQNLPVLPLSSCPLKKMSTPTFNQT  183



>gb|AFK47459.1| unknown [Medicago truncatula]
Length=207

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 111/168 (66%), Gaps = 8/168 (5%)
 Frame = +2

Query  59   MQSLREERSHSRKLE-----EDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPP  223
            MQ L   R    K+E     E    P ++LNHVS LCRSV +S+ FY  VLG V ++RP 
Sbjct  1    MQLLDSLREQELKMEIEEVCEAQALPLLSLNHVSLLCRSVLESMQFYEDVLGFVPIKRPS  60

Query  224  AFDGFDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRL  403
            +F  F GAW +NYG+GIHL+Q  D D+    +  + + ++P DNHISFQC  +E +++RL
Sbjct  61   SFK-FTGAWFYNYGIGIHLIQNPDIDEFD-TYMNESRPINPKDNHISFQCTDVELVKKRL  118

Query  404  KELKVKYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS  547
            +E  ++Y+  T+ E EG  +DQ+FF DPDG+MIE+CNCENI ++P  S
Sbjct  119  EEKGMRYVT-TLVEDEGIKVDQVFFHDPDGYMIELCNCENIPIIPISS  165



>ref|XP_007041249.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOX97080.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=201

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 108/156 (69%), Gaps = 10/156 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SV  SV FY +VLG V ++RP +F  F+GAWLFNYG+GIHL++++  
Sbjct  21   PLLSLNHVSFVCKSVSRSVRFYEEVLGFVLIKRPSSFK-FEGAWLFNYGIGIHLLESESV  79

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   PT ++ ++P DNHISFQC  M  + ++L+E+ ++Y+   V EG G  +DQLFF
Sbjct  80   -------PTKKEKINPKDNHISFQCSDMNLVMQKLEEMNIEYVTAVVEEG-GIKVDQLFF  131

Query  479  KDPDGFMIEICNCENITLVPQPSLG-KIKLPSDRHT  583
             DPDG+M+EICNC+N+ ++P  S   K+  PS  H 
Sbjct  132  HDPDGYMVEICNCQNLPVLPLSSCPLKLPNPSSNHA  167



>ref|XP_010912492.1| PREDICTED: uncharacterized protein LOC105038392 [Elaeis guineensis]
Length=204

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 103/150 (69%), Gaps = 7/150 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P M+LNHVS +CRSV  SV FY +VLG V V+RP +F+ F GAWLFNYGVGIHL+Q    
Sbjct  17   PLMSLNHVSFVCRSVSRSVKFYEEVLGFVSVKRPSSFN-FHGAWLFNYGVGIHLLQCNSL  75

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            D      P  +  ++P DNHISFQC  +  ++R+L+E+ ++Y+   V E  G  +DQLFF
Sbjct  76   DDV----PKKKGVINPKDNHISFQCSDINLLKRKLEEMGIEYVTAVV-EDSGIQVDQLFF  130

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLP  568
             DPDG+M+EICNCEN+ ++P  S   +K P
Sbjct  131  HDPDGYMVEICNCENLPVLPLSSF-PLKFP  159



>ref|XP_007013389.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOY31008.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=168

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
             LNHVS +CRS++ S+DFY  VLG   ++RP +FD F GAWLFNYG+GIHL+Q+++   D
Sbjct  9    CLNHVSLVCRSIEKSLDFYQNVLGFFPIKRPGSFD-FSGAWLFNYGIGIHLLQSEN--PD  65

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P       ++P DNHISFQC+ M  +E++LKE+K++Y+K  V +G G  +DQLFF DP
Sbjct  66   NMPK---IGRINPKDNHISFQCECMATVEKKLKEMKLEYVKGGVEDG-GIRVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVPQP  544
            DG MIE+CNC+N+ +VP P
Sbjct  122  DGTMIEVCNCDNLPVVPLP  140



>emb|CDY71329.1| BnaC02g46640D [Brassica napus]
Length=167

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S++FY  VLG + + RP +FD FDGAWLF +GVGIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMNFYQHVLGFLPIRRPGSFD-FDGAWLFGHGVGIHLLQSTEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC++M A+E++L E+ ++Y++  V EG G  +DQLFF DP
Sbjct  72   -----LKKTEINPKDNHISFQCESMGAVEKKLNEMGIEYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_004252486.1| PREDICTED: uncharacterized protein LOC101249440 [Solanum lycopersicum]
Length=173

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+SR+C S+++S+DFY  +LG V V RP +F+ F+GAWLF +G+GIHL+Q +D   +
Sbjct  14   SLNHISRVCTSLEESIDFYKNILGFVPVRRPTSFN-FNGAWLFGHGIGIHLLQLED--SE  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T+   ++P DNH+SFQC++++ +E++L E+ ++Y+K+ V EG G  +DQLFF DP
Sbjct  71   KLPKKTE---INPKDNHMSFQCESIDGVEKKLIEMGIEYIKQLVEEG-GIHVDQLFFHDP  126

Query  488  DGFMIEICNCENITLVP  538
            DGFM+EICNC+ + ++P
Sbjct  127  DGFMVEICNCDKLPIIP  143



>ref|XP_006389762.1| hypothetical protein EUTSA_v10019227mg [Eutrema salsugineum]
 gb|ESQ27048.1| hypothetical protein EUTSA_v10019227mg [Eutrema salsugineum]
Length=168

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRSV++S+ FY  VLG + + RP +FD FDGAWLF +G+GIHL+Q+ + ++ 
Sbjct  13   SLNHISLLCRSVEESMSFYQNVLGFLPIRRPGSFD-FDGAWLFGHGIGIHLLQSPEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                   +  ++P DNHISFQC+ MEA+E++LKE++++ ++  V EG G  +DQLFF DP
Sbjct  72   -----LKKTEINPKDNHISFQCENMEAVEKKLKEMEIENVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_009407659.1| PREDICTED: uncharacterized protein LOC103990300 [Musa acuminata 
subsp. malaccensis]
Length=179

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 105/139 (76%), Gaps = 7/139 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P  +LNH+S +CRS+  S+DFY  VLG + V RP +FD FDGAWLFNYG+GIHL+Q++D 
Sbjct  10   PLASLNHISVVCRSLVRSLDFYQNVLGFLPVRRPGSFD-FDGAWLFNYGIGIHLLQSED-  67

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              + +P    ++ ++P DNHISFQC+++  +E++LKE+ + Y++  V EG G  +DQLFF
Sbjct  68   -PENMP---KKREINPKDNHISFQCESLALVEKQLKEMGIPYIQSGVEEG-GIYVDQLFF  122

Query  479  KDPDGFMIEICNCENITLV  535
             DPDGFMIEICNC+N+ ++
Sbjct  123  HDPDGFMIEICNCDNLPVI  141



>ref|XP_004135860.1| PREDICTED: uncharacterized protein LOC101209593 [Cucumis sativus]
 ref|XP_004158775.1| PREDICTED: uncharacterized LOC101209593 [Cucumis sativus]
 gb|KGN45284.1| Lactoylglutathione lyase [Cucumis sativus]
Length=169

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S LC+SV++S+ FY  +LG   + RP +F  FDGAWLF YG+GIHL+Q++    +
Sbjct  13   SINHISLLCKSVEESIYFYQNILGFFPIRRPGSFK-FDGAWLFGYGIGIHLLQSEK--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    +  ++P DNHISFQC++M A+E++LKE++++Y++  V EG G  +DQLFF DP
Sbjct  70   NLP---KKGKINPKDNHISFQCESMGAVEKKLKEMEIEYVRAVVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+N+ ++P
Sbjct  126  DGFMIEICNCDNLPVIP  142



>ref|XP_006425532.1| hypothetical protein CICLE_v10026552mg [Citrus clementina]
 ref|XP_006466913.1| PREDICTED: lactoylglutathione lyase-like [Citrus sinensis]
 gb|ESR38772.1| hypothetical protein CICLE_v10026552mg [Citrus clementina]
 gb|KDO71122.1| hypothetical protein CISIN_1g029033mg [Citrus sinensis]
Length=191

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 108/154 (70%), Gaps = 10/154 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS LCRSV DSV FY  VLG V ++RP +F+ F+GAWL+NYG+GIHL++  + 
Sbjct  15   PLLSLNHVSLLCRSVWDSVRFYEDVLGFVLIKRPSSFN-FNGAWLYNYGIGIHLIE--NP  71

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
              D     T+ + ++P DNHISFQC  +  ++RRL+++ ++Y+   V E +G  +DQ+FF
Sbjct  72   SIDDFDTVTEPRPINPKDNHISFQCTDVALVKRRLEDMGMRYVTAVV-EDDGTRVDQVFF  130

Query  479  KDPDGFMIEICNCENITLVP------QPSLGKIK  562
             DPDG+MIE+CNCENI ++P      +P +G  K
Sbjct  131  HDPDGYMIELCNCENIPIIPLYSCSFKPRMGSFK  164



>gb|AES95089.2| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=207

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 110/168 (65%), Gaps = 8/168 (5%)
 Frame = +2

Query  59   MQSLREERSHSRKLE-----EDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPP  223
            MQ L   R    K+E     E    P ++LNHVS LCRSV +S+ FY  VLG V ++RP 
Sbjct  1    MQLLDSLREQELKMEIEEVCEAQALPLLSLNHVSLLCRSVLESMQFYEDVLGFVPIKRPS  60

Query  224  AFDGFDGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRL  403
            +F  F GAW +NYG+GIHL+Q  D D+    +  + + ++P DNHISFQC  +E +++RL
Sbjct  61   SFK-FTGAWFYNYGIGIHLIQNPDIDEFD-TYMNESRPINPKDNHISFQCTDVELVKKRL  118

Query  404  KELKVKYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS  547
            +E  ++Y+   V E EG  +DQ+FF DPDG+MIE+CNCENI ++P  S
Sbjct  119  EEKGMRYVTALV-EDEGIKVDQVFFHDPDGYMIELCNCENIPIIPISS  165



>ref|XP_006438925.1| hypothetical protein CICLE_v10033699mg, partial [Citrus clementina]
 gb|ESR52165.1| hypothetical protein CICLE_v10033699mg, partial [Citrus clementina]
Length=100

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            M+LNHVSRLCR+V+DS +FYTKVLG V +ERPPAFD F GAWLFNYGVGIHLVQ+   ++
Sbjct  1    MSLNHVSRLCRNVEDSSNFYTKVLGFVLIERPPAFD-FAGAWLFNYGVGIHLVQS--NNE  57

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRT  436
            D+L  P D   LDP DNHISFQC+ MEA+E+RLKEL VKY+KRT
Sbjct  58   DKLS-PPDSAHLDPTDNHISFQCENMEAIEKRLKELDVKYIKRT  100



>ref|XP_010271470.1| PREDICTED: uncharacterized protein LOC104607512 [Nelumbo nucifera]
Length=191

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 5/143 (3%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS LCRSV  SV FY  VLG + ++RP +F+ F GAWLFNYGVGIHL++    
Sbjct  13   PLLSLNHVSLLCRSVSTSVRFYEDVLGFILIKRPSSFN-FHGAWLFNYGVGIHLLENNSV  71

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            D      P+  + ++P DNHISFQC  +  ++ RL+E+ +KY+   V EG G  +DQ+FF
Sbjct  72   DAHI---PSVSRPINPKDNHISFQCTDVGLVKMRLREMGMKYVTAVVEEG-GIKVDQVFF  127

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDG+MIEICNC+NI +VP  S
Sbjct  128  HDPDGYMIEICNCDNIPVVPLSS  150



>emb|CDO97602.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 107/152 (70%), Gaps = 9/152 (6%)
 Frame = +2

Query  113  ETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAK  292
            + P ++LNHVS +C+SV  SV FY +VLG V ++RP +FD F+GAWLFN+G+GIHL++  
Sbjct  46   QLPLLSLNHVSFVCKSVSRSVRFYEEVLGFVLIKRPSSFD-FEGAWLFNHGIGIHLLEVT  104

Query  293  DGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQL  472
            D        P+ +  ++P DNHISFQC  +E + ++L+++ ++Y+   V EG G  +DQL
Sbjct  105  DV-------PSKKGKINPKDNHISFQCTNVEVIMQKLEDMNIEYVTAVVKEG-GITVDQL  156

Query  473  FFKDPDGFMIEICNCENITLVPQPSLGKIKLP  568
            FF DPDG+MIEICNC+N+ ++P  S    KLP
Sbjct  157  FFHDPDGYMIEICNCQNLPVLPLSSCPLKKLP  188



>ref|XP_006476111.1| PREDICTED: uncharacterized protein LOC102629469 [Citrus sinensis]
Length=178

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 101/137 (74%), Gaps = 6/137 (4%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH S +CRSV+ S+DFY  V+G + + RP +FD F GAWLFNYG+GIHL++ +D D+ 
Sbjct  13   SLNHFSLVCRSVEKSLDFYQNVIGFLPIRRPGSFD-FHGAWLFNYGIGIHLLKCEDPDR-  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                P+  + ++P DNHISFQC+ M  +ER+L E+K++Y+K  V EG G  +DQ+FF DP
Sbjct  71   ---MPSISKIINPKDNHISFQCENMATVERKLTEMKIEYVKSRVEEG-GIYVDQVFFHDP  126

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+ + +VP
Sbjct  127  DGSMIEICNCDVLPVVP  143



>ref|XP_010263899.1| PREDICTED: uncharacterized protein LOC104602043 [Nelumbo nucifera]
Length=211

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 106/155 (68%), Gaps = 9/155 (6%)
 Frame = +2

Query  95   KLEEDDETPS----MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNY  262
            ++EE   +PS    ++LNHVS LCRS+  SV FY  VLG   ++RP +F  F+GAWLFNY
Sbjct  2    EIEELSSSPSTLPLLSLNHVSFLCRSISTSVRFYEDVLGFASIKRPSSFK-FNGAWLFNY  60

Query  263  GVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVG  442
            GVGIHL++    D + L    + + ++P DNHISFQC  +E ++ +LKE  +KY+   V 
Sbjct  61   GVGIHLLENTSVDANIL---KESRPINPKDNHISFQCTDVEVVKMKLKEWGMKYVTAVVE  117

Query  443  EGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS  547
            EG G  +DQ+FF DPDG+MIEICNC+N+ ++P  S
Sbjct  118  EG-GIKVDQVFFHDPDGYMIEICNCDNLPVLPLSS  151



>ref|XP_007200863.1| hypothetical protein PRUPE_ppa027137mg [Prunus persica]
 gb|EMJ02062.1| hypothetical protein PRUPE_ppa027137mg [Prunus persica]
Length=166

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 100/133 (75%), Gaps = 6/133 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV+ S+DFY  VLG   + RP +FD F GAWLFNYG+GIHL+Q++D   D
Sbjct  13   SLNHISLVCRSVEKSLDFYQSVLGFFPIRRPGSFD-FIGAWLFNYGIGIHLLQSED--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P    Q  + P DNHISFQC++M  +E+ LKE++++Y+KR V +G G  +DQLFF DP
Sbjct  70   KMPKKITQ--IKPKDNHISFQCESMVTVEKNLKEMEIEYVKRRVEKG-GIYVDQLFFHDP  126

Query  488  DGFMIEICNCENI  526
            D  MIEICNC+N+
Sbjct  127  DATMIEICNCDNL  139



>ref|XP_002531512.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF30866.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=189

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 111/163 (68%), Gaps = 16/163 (10%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS LCRSV  SV FY  VLG V ++RP +F+ F+GAWL+NYG+GIHL++    
Sbjct  13   PLLSLNHVSLLCRSVWASVRFYEDVLGFVMIKRPSSFN-FNGAWLYNYGIGIHLIENPAL  71

Query  299  DQ-DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLF  475
            D+ D +  P   + ++P DNHISFQC  +  ++RRL+E+ ++Y+   V E  G  +DQ+F
Sbjct  72   DEFDPIIEP---RPINPKDNHISFQCTDVGLVKRRLQEMGMRYVTAVV-EDAGNKVDQVF  127

Query  476  FKDPDGFMIEICNCENITLVP------QPSLGKIKLPSDRHTP  586
            F DPDG+M+EICNCENI ++P      +PS+G  K    R TP
Sbjct  128  FHDPDGYMVEICNCENIPIIPLSSCIFRPSMGSFK----RATP  166



>ref|XP_010256292.1| PREDICTED: uncharacterized protein LOC104596717 [Nelumbo nucifera]
Length=207

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 111/175 (63%), Gaps = 8/175 (5%)
 Frame = +2

Query  74   EERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWL  253
            EE         +   P M+LNHVS LC+SVK SV FY +VLG V ++RP +F  F+GAWL
Sbjct  13   EEEKMLNGYSSEATMPLMSLNHVSFLCKSVKKSVKFYEEVLGFVLIKRPSSFK-FEGAWL  71

Query  254  FNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKR  433
            FNYG+GIHL++    +  R      +  ++P DNHISFQC  M+ + R+L+ + + Y+  
Sbjct  72   FNYGIGIHLLECSSPNDKR----EKKAVINPKDNHISFQCTDMKLVMRKLEVMNIDYVTA  127

Query  434  TVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLG-KIKLPSDR-HTPPV  592
             V EG G  +DQLFF DPDG+MIEICNC+N+ ++P  S   K   P ++ HT P+
Sbjct  128  VVEEG-GLKVDQLFFHDPDGYMIEICNCDNLPVLPLSSCPLKPSYPIEKNHTAPL  181



>ref|XP_010476624.1| PREDICTED: uncharacterized protein LOC104755853 [Camelina sativa]
Length=175

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRSV +S+ FY KVLG + + RP + + F+GAWLF +G+GIHL+++ +   +
Sbjct  13   SLNHVSLLCRSVDESMSFYHKVLGFIPIRRPESLN-FEGAWLFGHGIGIHLLRSPE--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T   +++P DNHISFQC++M A+E++L+E++++Y++  V EG G  +DQLFF DP
Sbjct  70   KLPKKT---AINPKDNHISFQCESMGAVEKKLEEMEIEYVRALVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_011040040.1| PREDICTED: uncharacterized protein LOC105136415 [Populus euphratica]
 ref|XP_011015871.1| PREDICTED: uncharacterized protein LOC105119430 [Populus euphratica]
Length=169

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LC+S+++S+DFY  VLG V + RP +F+ FDGAWLF YG+GIHL+Q+++ ++ 
Sbjct  9    SLNHISLLCKSLEESIDFYEDVLGFVPIRRPGSFN-FDGAWLFGYGIGIHLLQSENPEKM  67

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +      +  ++P DNHISFQC++M A+E++LKE+ +++++  V EG G  ++QLFF DP
Sbjct  68   Q-----KKGKINPKDNHISFQCESMAAVEKKLKEMGIQHVRALVEEG-GIQVEQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ ++P
Sbjct  122  DGFMIEICDCDNLPVIP  138



>ref|XP_002524466.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF37906.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=193

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS+K S+DFY  VLG   V RP +FD FDGAWLFNYG+GIHL+Q++D +  
Sbjct  14   SLNHISVVCRSLKKSIDFYQDVLGFFPVRRPGSFD-FDGAWLFNYGIGIHLLQSEDPEN-  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                P   Q ++P DNHISFQC++M  +E+RL+E+KV+ +K  V EG G  +DQLFF DP
Sbjct  72   ---MPKINQ-INPKDNHISFQCESMATVEKRLQEMKVECVKGRVEEG-GIYVDQLFFHDP  126

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+ + ++P
Sbjct  127  DGSMIEICNCDVLPVIP  143



>ref|XP_007046744.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOX90901.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=190

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 113/165 (68%), Gaps = 9/165 (5%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQ-  286
            +  P ++LNHVS LCRSV DSV FY +VLG V ++RP +F  F+GAWL+NYG+GIHL++ 
Sbjct  11   EALPLLSLNHVSLLCRSVWDSVRFYEEVLGFVLIKRPSSFK-FNGAWLYNYGIGIHLIEN  69

Query  287  -AKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAI  463
             A D D D +  P   + ++P DNHISFQC  +  ++RRL+E+ +KY+   V E +G  +
Sbjct  70   PAID-DFDTIVEP---RPINPKDNHISFQCTDVGLVKRRLQEMGMKYVTAVV-EDDGNRV  124

Query  464  DQLFFKDPDGFMIEICNCENITLVPQPSLG-KIKLPSDRHTPPVQ  595
            DQ+FF DPDG+MIE+CNCENI ++P  S   K +L S +   P  
Sbjct  125  DQVFFHDPDGYMIELCNCENIPILPLSSCSFKPRLSSFKKAAPAN  169



>ref|XP_010459070.1| PREDICTED: uncharacterized protein LOC104740226 isoform X1 [Camelina 
sativa]
Length=175

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRSV +S+ FY KVLG + + RP + + F+GAWLF +G+GIHL+++ +   +
Sbjct  13   SLNHVSLLCRSVDESMSFYHKVLGFIPIRRPESLN-FEGAWLFGHGIGIHLLRSPE--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T   +++P DNHISFQC++M A+E++L+++++KY++  V EG G  +DQLFF DP
Sbjct  70   KLPKKT---AINPKDNHISFQCESMGAVEKKLEDMEIKYVRALVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_007154988.1| hypothetical protein PHAVU_003G163400g [Phaseolus vulgaris]
 gb|ESW26982.1| hypothetical protein PHAVU_003G163400g [Phaseolus vulgaris]
Length=167

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C S++ SV+FY  VLG   ++RP + D F+GAWLFNYG+GIHL+Q++D    
Sbjct  9    SLNHISIVCASLEKSVEFYVNVLGFSPIQRPSSLD-FNGAWLFNYGIGIHLLQSED--PR  65

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  T    ++P DNHISFQC+++ A+E+RLK+++++Y+K  V E  G  +DQLFF DP
Sbjct  66   GMPKTT---PINPKDNHISFQCESIAAVEKRLKQMEIEYVKSRVEES-GIYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+NI +VP
Sbjct  122  DGMMIEICNCDNIPVVP  138



>ref|XP_009598365.1| PREDICTED: uncharacterized protein LOC104094188, partial [Nicotiana 
tomentosiformis]
Length=196

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S+DFY  VLG V V RP +F+ F+GAWLF +G+GIHL+Q++  D +
Sbjct  30   SLNHISLVCRSVEESIDFYKYVLGFVPVRRPGSFN-FNGAWLFGHGIGIHLLQSE--DPE  86

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T+   ++P DNHISFQC++++A+E++L E+ ++Y+++ V EG G  +DQLFF DP
Sbjct  87   KLPKKTE---INPKDNHISFQCESIDAVEKKLTEMGIEYVRQLVEEG-GIYVDQLFFHDP  142

Query  488  DGFMIEICNCENITLVP  538
            D FM+EICNC+ + ++P
Sbjct  143  DDFMVEICNCDKLPVIP  159



>ref|XP_006842870.1| hypothetical protein AMTR_s00081p00168190 [Amborella trichopoda]
 gb|ERN04545.1| hypothetical protein AMTR_s00081p00168190 [Amborella trichopoda]
Length=171

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 107/142 (75%), Gaps = 10/142 (7%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWL--FNYGVGIHLVQAK  292
            P  +LNH+S +CRSV++S+DFY  +LG + + RP +FD F+GAWL  FNY +GIHL+QA+
Sbjct  10   PLTSLNHISLICRSVEESLDFYQNILGFIPIRRP-SFD-FNGAWLYNFNYSMGIHLLQAE  67

Query  293  DGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQL  472
            +   D LP  T+   ++P DNHISFQC++M A+ R LK++ +KY++R V EG G  + Q+
Sbjct  68   N--PDSLPKKTE---INPKDNHISFQCESMAAVARGLKDMGIKYIEREVEEG-GIFVSQI  121

Query  473  FFKDPDGFMIEICNCENITLVP  538
            FF DPDGFM+EIC+CEN+ +VP
Sbjct  122  FFHDPDGFMVEICDCENLPVVP  143



>ref|XP_006598804.1| PREDICTED: uncharacterized protein LOC102662470 [Glycine max]
Length=182

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 104/143 (73%), Gaps = 9/143 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SV +SV FY  VLG V ++RP +F  F+GAWLFNYG+GIHL++++  
Sbjct  8    PLLSLNHVSFVCKSVSESVKFYQDVLGFVLIKRPSSFK-FEGAWLFNYGIGIHLLESEKV  66

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P +++ ++P +NHISFQC  M+ + ++L  +K++Y++  V EG G  +DQLFF
Sbjct  67   -------PVEKREINPKENHISFQCSDMKVIMQKLDAMKIEYVRAVVEEG-GIKVDQLFF  118

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDG+MIEICNC+N+ ++P  S
Sbjct  119  HDPDGYMIEICNCQNLPVLPISS  141



>gb|KHG15596.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=190

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQA  289
            +  P ++LNHVS LCRSV DSV FY  VLG V ++RP +F  F+GAWL+NYG+GIHL++ 
Sbjct  11   EALPLLSLNHVSLLCRSVWDSVRFYEDVLGFVSIKRPSSFK-FNGAWLYNYGIGIHLIEN  69

Query  290  KDGDQ-DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAID  466
               D  D +  P   + ++P DNHISFQC  +  + RRL+++ +KY+   V E +G  +D
Sbjct  70   PSIDDFDTIVEP---RPINPKDNHISFQCTDVGLVMRRLQDMGMKYVTAVV-EDQGNRVD  125

Query  467  QLFFKDPDGFMIEICNCENITLVPQPSLG-KIKLPSDRHTPPVQ  595
            Q+FF DPDG+M+E+CNCENI ++P  S   K +L S   + P +
Sbjct  126  QVFFHDPDGYMVELCNCENIPIIPLSSCSFKQRLSSFYKSAPAK  169



>ref|XP_004231328.1| PREDICTED: glyoxalase domain-containing protein 5-like [Solanum 
lycopersicum]
Length=201

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 99/148 (67%), Gaps = 9/148 (6%)
 Frame = +2

Query  104  EDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLV  283
            E    P +ALNHVS +C+SV  SV FY +VLG   ++RP +F  F+GAWLFN+G+GIHL+
Sbjct  9    ESSTMPMLALNHVSYICKSVPKSVKFYEQVLGFSLIQRPSSFQ-FEGAWLFNHGIGIHLL  67

Query  284  QAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAI  463
              +D    R         ++P DNHISFQC  M+ + +RL E+ V+Y+  TV EG G  +
Sbjct  68   GKEDVQSKR-------GKINPKDNHISFQCTDMDLIIQRLNEMNVEYVTATVKEG-GVNV  119

Query  464  DQLFFKDPDGFMIEICNCENITLVPQPS  547
            DQLFF DPDG MIEICNC+NI ++P  S
Sbjct  120  DQLFFHDPDGNMIEICNCQNIPIIPLSS  147



>ref|XP_009117831.1| PREDICTED: uncharacterized protein LOC103842901 [Brassica rapa]
Length=172

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 112/150 (75%), Gaps = 9/150 (6%)
 Frame = +2

Query  95   KLEEDDETPS--MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGV  268
            K++E+   P    +LNHVS LCRS+++S++FY KVLG   V RP + D F+GAWLF +G+
Sbjct  5    KMKENAVNPLRLTSLNHVSLLCRSLEESMNFYQKVLGFFPVRRPESLD-FEGAWLFGHGI  63

Query  269  GIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEG  448
            GIHL+++ +   ++LP  T   +++  DNHISFQC++M A+E++L E++++Y++  V EG
Sbjct  64   GIHLLRSTE--PEKLPKKT---AINSKDNHISFQCESMAAVEKKLDEMEIEYVREIV-EG  117

Query  449  EGEAIDQLFFKDPDGFMIEICNCENITLVP  538
             G  +DQ+FF DPDGFMIEICNC+++ +VP
Sbjct  118  RGIKVDQIFFHDPDGFMIEICNCDSLPVVP  147



>ref|XP_009402190.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Musa acuminata 
subsp. malaccensis]
Length=701

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 107/146 (73%), Gaps = 7/146 (5%)
 Frame = +2

Query  98   LEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIH  277
            L      P  +LNH+S +CRSV+ S+DFY  VLG + + RP +FD F GAWLFNYG+GIH
Sbjct  353  LSRSGALPLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFD-FTGAWLFNYGIGIH  411

Query  278  LVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGE  457
            L+Q++D   +++P    ++ ++P DNHISFQC+++  +E +LKE+ + Y++R V EG G 
Sbjct  412  LLQSED--PEKMPR---KKEINPKDNHISFQCESLSMVEGKLKEMGIPYIQRRVEEG-GI  465

Query  458  AIDQLFFKDPDGFMIEICNCENITLV  535
             +DQLFF DPDGFMIEICNC+N+ ++
Sbjct  466  YVDQLFFHDPDGFMIEICNCDNLPVI  491



>gb|KHN39666.1| Metallothiol transferase fosB, partial [Glycine soja]
Length=187

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 104/143 (73%), Gaps = 9/143 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SV +SV FY  VLG V ++RP +F  F+GAWLFNYG+GIHL++++  
Sbjct  13   PLLSLNHVSFVCKSVSESVKFYQDVLGFVLIKRPSSFK-FEGAWLFNYGIGIHLLESEKV  71

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P +++ ++P +NHISFQC  M+ + ++L  +K++Y++  V EG G  +DQLFF
Sbjct  72   -------PVEKREINPKENHISFQCSDMKVIMQKLDAMKIEYVRAVVEEG-GIKVDQLFF  123

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDG+MIEICNC+N+ ++P  S
Sbjct  124  HDPDGYMIEICNCQNLPVLPISS  146



>ref|XP_006305709.1| hypothetical protein CARUB_v10010450mg [Capsella rubella]
 gb|EOA38607.1| hypothetical protein CARUB_v10010450mg [Capsella rubella]
Length=174

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRSV +S++FY KVLG + + RP + + F+GAWLF +G+GIHL+++ +   +
Sbjct  13   SLNHVSLLCRSVDESMNFYHKVLGFIPIRRPESLN-FEGAWLFGHGIGIHLLRSPE--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T   +++P DNHISFQC++M A+E++L++++++Y++  V EG G  +DQLFF DP
Sbjct  70   KLPKKT---AINPKDNHISFQCESMGAVEKKLEDMEIEYVRSLVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_009402807.1| PREDICTED: uncharacterized protein LOC103986514 [Musa acuminata 
subsp. malaccensis]
Length=207

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = +2

Query  95   KLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGI  274
            +++E +ETP ++LNHVS +CRSV  SV FY +VLG   ++RP +F+ F GAWLFNYG+GI
Sbjct  2    EMQEVEETPLVSLNHVSFVCRSVTRSVKFYEEVLGFASIKRPSSFN-FHGAWLFNYGIGI  60

Query  275  HLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEG  454
            HL+Q    +      P  +  ++P ++HISFQC  M+A++R+L+   V+Y+   V EG  
Sbjct  61   HLLQCNSEEG----MPKKKAVINPKEDHISFQCSNMQALKRKLERTGVEYVTAVVEEGSV  116

Query  455  EAIDQLFFKDPDGFMIEICNCENITLVPQPSL-GKIKL  565
            + + QLFF DPDG MIEICNCE++ ++P  S   K+KL
Sbjct  117  Q-VRQLFFHDPDGHMIEICNCEDLPVLPLSSCPVKLKL  153



>ref|XP_011088117.1| PREDICTED: uncharacterized protein LOC105169423 [Sesamum indicum]
Length=141

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 101/139 (73%), Gaps = 9/139 (6%)
 Frame = +2

Query  101  EEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL  280
            +E  E P +ALNHVS +C+SV  SV+FY +VLG V ++RP +FD F+GAWLFN+G+GIHL
Sbjct  10   KEMREMPFLALNHVSFVCKSVAKSVEFYEQVLGFVLIKRPSSFD-FEGAWLFNHGIGIHL  68

Query  281  VQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
            +QA +           +  ++P DNHISFQC  M+ + ++L+E+K++Y+K  V EG G  
Sbjct  69   LQADNV-------AGKKGKINPKDNHISFQCSDMDMIMKQLEEMKIEYVKAVVREG-GII  120

Query  461  IDQLFFKDPDGFMIEICNC  517
            +DQ+FF DPDG+MIEICNC
Sbjct  121  VDQIFFHDPDGYMIEICNC  139



>emb|CDY39639.1| BnaC05g11680D [Brassica napus]
Length=174

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRS+++S+ FY  VLG   + RP + + F+GAWLF +G+GIHL+  +  + +
Sbjct  13   SLNHVSLLCRSIEESMVFYQTVLGFFPIRRPESLN-FEGAWLFGHGIGIHLL--RSSEPE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T+   ++P DNHISFQC++M A+E++L+E++++Y++  V EG G  +DQLFF DP
Sbjct  70   KLPKKTE---INPKDNHISFQCESMSAVEKKLEEMEIEYVRAIVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>emb|CDY55981.1| BnaA09g56790D [Brassica napus]
Length=167

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRS+++S++FY KVLG   V RP + D F+GAWLF +G+GIHL+++ +   +
Sbjct  13   SLNHVSLLCRSLEESMNFYQKVLGFFPVRRPESLD-FEGAWLFGHGIGIHLLRSTE--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T   +++  DNHISFQC++M A+E++L E++++Y++  V EG G  +DQ+FF DP
Sbjct  70   KLPKKT---AINSKDNHISFQCESMAAVEKKLDEMEIEYVREIV-EGRGIKVDQIFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_004287347.1| PREDICTED: metallothiol transferase FosB-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=195

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS++ S+DFY  VLG   V RP + D F+GAWLFNYG+GIHL+QA+D +  
Sbjct  13   SLNHISLVCRSLEKSLDFYQNVLGFFPVRRPDSLD-FNGAWLFNYGIGIHLLQAEDPET-  70

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP  +    ++P DNHISFQC++M  +E +LKE+ ++Y+  +V EG G  +DQLFF DP
Sbjct  71   -LPKIS---HINPKDNHISFQCESMIRVENKLKEMGIEYVTSSVEEG-GINVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+N+ ++P
Sbjct  126  DGTMIEICNCDNLPVIP  142



>gb|EPS59665.1| hypothetical protein M569_15140, partial [Genlisea aurea]
Length=168

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 112/163 (69%), Gaps = 11/163 (7%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C+SV++S DFY +VLG + V+RP +   FDGAWLF +G+GIH++Q++     
Sbjct  16   SLNHISLVCKSVEESADFYHRVLGFIPVKRPGSLK-FDGAWLFGHGIGIHIIQSEA----  70

Query  308  RLPHPTDQQS-LDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKD  484
              PH   +++ +DP D HISFQC++M  +E++LK++ + +++  V EG G  +DQLFF D
Sbjct  71   --PHKMIKKTVIDPKDTHISFQCESMATVEKKLKQMGIDWVRARVEEG-GVYVDQLFFHD  127

Query  485  PDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPPEKSY  613
            PDGFMIEICNC+NI +VP    G++         P Q P+ S+
Sbjct  128  PDGFMIEICNCDNIPVVPLA--GEVVHACSVLRLPAQQPQISF  168



>ref|XP_004287830.1| PREDICTED: uncharacterized protein LOC101304803 [Fragaria vesca 
subsp. vesca]
Length=192

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 112/165 (68%), Gaps = 8/165 (5%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQA  289
            +  P ++LNHVS LCRSV DS+ FY +VLG V ++RP +F+ F+GAWL+NYG+GIHL+++
Sbjct  12   EALPLLSLNHVSLLCRSVWDSMRFYEEVLGFVLIKRPSSFN-FNGAWLYNYGIGIHLIES  70

Query  290  KDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQ  469
                +D      + + ++P DNHISFQC  +  ++R+L+E+ ++Y+   V E +G  +DQ
Sbjct  71   PAAMED-----CELRPINPKDNHISFQCTDVGLVKRKLQEMGMRYVTAVV-EDDGVKVDQ  124

Query  470  LFFKDPDGFMIEICNCENITLVPQPSLG-KIKLPSDRHTPPVQPP  601
            +FF DPDG+MIE+CNCENI ++P  S   K ++ S    P    P
Sbjct  125  VFFHDPDGYMIELCNCENIPIIPVSSCAFKPRVSSFTKAPTACGP  169



>ref|XP_010497101.1| PREDICTED: uncharacterized protein LOC104774130 [Camelina sativa]
Length=175

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRSV +S+ FY KVLG + + RP + + F+GAWLF +G+GIHL+++ +   +
Sbjct  13   SLNHVSLLCRSVDESMSFYHKVLGFIPIRRPESLN-FEGAWLFGHGIGIHLLRSPE--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T   +++P DNHISFQC++M A+E++L++++++Y++  V EG G  +DQLFF DP
Sbjct  70   KLPKKT---AINPKDNHISFQCESMGAVEKKLEDMEIEYVRALVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_010254369.1| PREDICTED: uncharacterized protein LOC104595363 [Nelumbo nucifera]
Length=195

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 105/136 (77%), Gaps = 7/136 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRSV++S+ FY  VLG + V RP +   F+GAWLF YG+GIHL+Q+++   +
Sbjct  13   SLNHISIVCRSVEESLKFYQDVLGFIPVRRPESLK-FEGAWLFGYGIGIHLLQSEN--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P  ++   ++P DNHISFQC++M A+E +LKE+ ++Y++RTV EG G  +DQLFF DP
Sbjct  70   GMPRKSE---INPKDNHISFQCESMVAVEVKLKEIGIEYVQRTVKEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLV  535
            DGFM+E+CNCEN+ +V
Sbjct  126  DGFMVELCNCENLPVV  141



>ref|XP_007223440.1| hypothetical protein PRUPE_ppa011519mg [Prunus persica]
 gb|EMJ24639.1| hypothetical protein PRUPE_ppa011519mg [Prunus persica]
Length=207

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 114/175 (65%), Gaps = 10/175 (6%)
 Frame = +2

Query  59   MQSLREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGF  238
            M++ RE     R +    + P + LNHVS +C+SV  SV FY +VLG V ++RP +F  F
Sbjct  1    MRNAREFEDTERWIS-SSKLPQLCLNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFK-F  58

Query  239  DGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKV  418
            +GAWLFNYG+GIHL+++          P  +  ++P DNHISFQC  M  + ++L+E+K+
Sbjct  59   EGAWLFNYGIGIHLLESDKNI------PEKKGKINPKDNHISFQCSDMGMVMQKLEEMKI  112

Query  419  KYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHT  583
            +Y+   V EG G  +DQLFF DPDG+M+EICNC+N+ ++P  S   IKL ++ + 
Sbjct  113  EYVTAKVEEG-GVIVDQLFFHDPDGYMVEICNCQNLPVLPISSC-PIKLITNTNA  165



>ref|XP_002303256.2| lactoylglutathione lyase family protein [Populus trichocarpa]
 gb|EEE78235.2| lactoylglutathione lyase family protein [Populus trichocarpa]
Length=169

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LC+S+++S+DFY  VLG V + RP +F+ FDGAWLF YG+GIHL+Q+++ ++ 
Sbjct  9    SLNHISLLCKSLEESIDFYEDVLGFVPIRRPGSFN-FDGAWLFGYGIGIHLLQSENPEKM  67

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +      +  ++P DNHISFQC++M A+E++LK++ +++++  V EG G  ++QLFF DP
Sbjct  68   Q-----KKGKINPKDNHISFQCESMAAVEKKLKDMGIQHVRALVEEG-GIQVEQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ ++P
Sbjct  122  DGFMIEICDCDNLPVIP  138



>ref|XP_010087426.1| hypothetical protein L484_018453 [Morus notabilis]
 gb|EXB29036.1| hypothetical protein L484_018453 [Morus notabilis]
Length=247

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 115/168 (68%), Gaps = 10/168 (6%)
 Frame = +2

Query  80   RSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFN  259
            RS++R      + P ++LNHVS +C+SV +S  FY +VLG V ++RP +F  F+GAWLFN
Sbjct  16   RSNTRT-NLSSKMPLLSLNHVSFVCKSVSNSARFYEQVLGFVLIKRPSSFK-FEGAWLFN  73

Query  260  YGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTV  439
            YG+GIHL+++     + +P P   + ++P DNHISFQC  M+ + ++L+E+ ++Y    V
Sbjct  74   YGIGIHLLES-----NTIP-PKKGKKINPKDNHISFQCSDMKLVMQKLEEMNIEYATAVV  127

Query  440  GEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHT  583
             E  G  +DQLFF DPDG+MIEICNC+N+ ++P  S   +KLPS  +T
Sbjct  128  EEC-GVTVDQLFFHDPDGYMIEICNCQNLPVLPL-SACPLKLPSSTNT  173



>gb|ABK22105.1| unknown [Picea sitchensis]
 gb|ABK25204.1| unknown [Picea sitchensis]
 gb|ABK25471.1| unknown [Picea sitchensis]
 gb|ABK26824.1| unknown [Picea sitchensis]
 gb|ABR17047.1| unknown [Picea sitchensis]
 gb|ACN40589.1| unknown [Picea sitchensis]
Length=199

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 101/140 (72%), Gaps = 7/140 (5%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SVK S  FY  +LG   V+RP +FD F+G WLFNYGVGIHL+Q K  
Sbjct  15   PLLSLNHVSFVCKSVKASTKFYETILGFQVVKRPSSFD-FEGVWLFNYGVGIHLLQCKPS  73

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            D   +P    +  ++P DNHISFQC  + ++E +L+EL +KY KR V E +G  ++QLFF
Sbjct  74   DD--IPK---KSVINPRDNHISFQCPDIFSVESKLQELDIKYEKRIV-EDDGLFVNQLFF  127

Query  479  KDPDGFMIEICNCENITLVP  538
             DPDG+M+EICNCEN+ ++P
Sbjct  128  HDPDGYMVEICNCENLPVIP  147



>emb|CDX81709.1| BnaC08g38920D [Brassica napus]
Length=173

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 111/150 (74%), Gaps = 9/150 (6%)
 Frame = +2

Query  95   KLEEDDETPS--MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGV  268
            K++E+   P    +LNHVS LCRS+++S++FY KVLG   V RP + D F+GAWLF +G+
Sbjct  6    KMKENAVNPLRLTSLNHVSLLCRSLEESMNFYQKVLGFFPVRRPESLD-FEGAWLFGHGI  64

Query  269  GIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEG  448
            GIHL+ + +   ++LP  T   +++  DNHISFQC++M A+E++L E++++Y++  V EG
Sbjct  65   GIHLLGSTE--PEKLPKKT---AINSKDNHISFQCESMAAVEKKLDEMEIEYVREIV-EG  118

Query  449  EGEAIDQLFFKDPDGFMIEICNCENITLVP  538
             G  +DQ+FF DPDGFMIEICNC+++ +VP
Sbjct  119  RGIKVDQIFFHDPDGFMIEICNCDSLPVVP  148



>ref|XP_003612131.1| Lactoylglutathione lyase [Medicago truncatula]
Length=194

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = +2

Query  104  EDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLV  283
            E    P ++LNHVS LCRSV +S+ FY  VLG V ++RP +F  F GAW +NYG+GIHL+
Sbjct  8    EAQALPLLSLNHVSLLCRSVLESMQFYEDVLGFVPIKRPSSFK-FTGAWFYNYGIGIHLI  66

Query  284  QAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAI  463
            Q  D D+    +  + + ++P DNHISFQC  +E +++RL+E  ++Y+   V E EG  +
Sbjct  67   QNPDIDEFD-TYMNESRPINPKDNHISFQCTDVELVKKRLEEKGMRYVTALV-EDEGIKV  124

Query  464  DQLFFKDPDGFMIEICNCENITLVPQPS  547
            DQ+FF DPDG+MIE+CNCENI ++P  S
Sbjct  125  DQVFFHDPDGYMIELCNCENIPIIPISS  152



>gb|KHF99790.1| Lactoylglutathione lyase [Gossypium arboreum]
Length=190

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 111/164 (68%), Gaps = 7/164 (4%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQA  289
            +  P ++LNHVS LCRSV DS+ FY ++LG V ++RP +F  F+GAWL+NYG+GIHL++ 
Sbjct  11   EALPLLSLNHVSLLCRSVLDSMRFYEEILGFVLIKRPSSFK-FNGAWLYNYGIGIHLIEN  69

Query  290  KDGDQ-DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAID  466
               D  D +  P   + ++P DNHISFQC  +  ++RRL+++ +KY+   V E EG  +D
Sbjct  70   PSIDDFDTIVEP---RPINPKDNHISFQCRDVGLVKRRLEDMGMKYVTAVV-EDEGNRVD  125

Query  467  QLFFKDPDGFMIEICNCENITLVPQPSLG-KIKLPSDRHTPPVQ  595
            Q+FF DPDG+MIE+CNCENI ++P  S   K +L S     P +
Sbjct  126  QVFFHDPDGYMIELCNCENIPILPLSSCSFKPRLSSFNRAAPTK  169



>ref|XP_004508519.1| PREDICTED: uncharacterized protein YwkD-like [Cicer arietinum]
Length=168

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 101/137 (74%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS++ SVDFY  VLG   ++RP + + F+GAWLFNYG+GIHL+Q+ D +  
Sbjct  9    SLNHISLVCRSLEKSVDFYVNVLGFFPIKRPTSLN-FNGAWLFNYGIGIHLLQSDDPEG-  66

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                 T    ++P D+HISFQC++M A+E +L+++K++Y+K  V E  G  +DQLFF DP
Sbjct  67   ----MTRNLHINPKDSHISFQCESMGAVENKLQQMKIEYVKNRVEEN-GIYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+NI +VP
Sbjct  122  DGSMIEICNCDNIPVVP  138



>gb|AFK37770.1| unknown [Lotus japonicus]
Length=169

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 101/137 (74%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C SV+ SVDFY  VLG + ++RP + D F+GAWLFNYG+GIHL+Q+   D +
Sbjct  9    SLNHISLVCGSVEKSVDFYVNVLGFIPIKRPSSLD-FNGAWLFNYGIGIHLLQS--NDPE  65

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P       ++P DNHISFQC+ + A+E +L++LK++Y+K  V E  G  +DQLFF DP
Sbjct  66   GMP---KHAHINPKDNHISFQCENIAAVENKLQQLKIEYVKSKVEES-GIYVDQLFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC++I +VP
Sbjct  122  DGSMIEICNCDSIPVVP  138



>ref|XP_010277693.1| PREDICTED: uncharacterized protein LOC104612074 [Nelumbo nucifera]
Length=215

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 109/165 (66%), Gaps = 10/165 (6%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQA  289
            +  P +ALNHVS +CRSVK+SV FY + LG V ++RP +F  F+GAWLFNYG+GIHL+Q 
Sbjct  35   ETMPLLALNHVSFVCRSVKESVRFYEEALGFVMIKRPSSFK-FEGAWLFNYGIGIHLLQC  93

Query  290  KDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQ  469
               D      P  ++ ++P DNHISFQC  M  + ++L+++ + Y+   V E  G  +DQ
Sbjct  94   NSPDDV----PEKKEVINPKDNHISFQCSDMRLVMKKLEKVNIDYVTAVV-EDSGIKVDQ  148

Query  470  LFFKDPDGFMIEICNCENITLVPQPSLGKIKLP---SDRHTPPVQ  595
            LFF DPDG+M+EICNC+N+ ++P  S   +KLP    D H  P+ 
Sbjct  149  LFFHDPDGYMVEICNCDNLPVLPLYSC-PLKLPYPSKDNHILPLS  192



>ref|XP_010930831.1| PREDICTED: uncharacterized protein LOC105051884 isoform X1 [Elaeis 
guineensis]
Length=204

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 107/163 (66%), Gaps = 12/163 (7%)
 Frame = +2

Query  59   MQSLREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGF  238
            ++ + EE S +  L      P M+LNHVS +CRSV  SV FY +VLG V ++RP +F+ F
Sbjct  3    LEIVEEELSAALPL------PLMSLNHVSFVCRSVGRSVKFYEEVLGFVSIKRPASFN-F  55

Query  239  DGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKV  418
             GAWLFNYGVGIHL+Q    D      P  +  ++P DNHISFQC  +  ++ +L+E+ +
Sbjct  56   HGAWLFNYGVGIHLLQCNSPDDV----PKKKGVINPKDNHISFQCSDINLLKHKLEEMGI  111

Query  419  KYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS  547
            +Y+   V E  G  +DQLFF DPDG+M+EICNCEN+ ++P  S
Sbjct  112  EYVTAVV-EDSGIQVDQLFFHDPDGYMVEICNCENLPVLPLSS  153



>ref|XP_010271469.1| PREDICTED: uncharacterized protein LOC104607511 [Nelumbo nucifera]
Length=210

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 5/135 (4%)
 Frame = +2

Query  134  NHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQDRL  313
            NHVS LCRSV +SV FY +VLG V ++RP +F+ F GAWLFNYGVGIHL++    + +  
Sbjct  19   NHVSLLCRSVSNSVRFYEQVLGFVSIKRPSSFN-FHGAWLFNYGVGIHLLENTSENANV-  76

Query  314  PHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDPDG  493
              P   + ++P DNHISFQC  +  ++ +L+E+ +KY+   V E EG  +DQ+FF DPDG
Sbjct  77   --PNQSRPINPKDNHISFQCTDVGIVKMKLQEMGMKYVTALVEE-EGNKVDQVFFHDPDG  133

Query  494  FMIEICNCENITLVP  538
            +MIEICNCENI +VP
Sbjct  134  YMIEICNCENIPVVP  148



>ref|XP_011047942.1| PREDICTED: uncharacterized protein LOC105142135 [Populus euphratica]
Length=211

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 102/148 (69%), Gaps = 9/148 (6%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            ++LNH+S +C+SV +SV FY  VLG V ++RP +F  F+GAWLFNYG+GIHL+++     
Sbjct  30   LSLNHISFVCKSVPESVKFYEDVLGFVLIKRPSSFK-FEGAWLFNYGIGIHLLESDKA--  86

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKD  484
                 PT +  ++P DNHISFQC  M  + + L++  ++Y+   V EG G  +DQLFF D
Sbjct  87   -----PTKKSKINPKDNHISFQCSDMNLVIKELEKKNIEYVTAVVEEG-GITVDQLFFHD  140

Query  485  PDGFMIEICNCENITLVPQPSLGKIKLP  568
            PDG+M+EICNC+N+ ++P PS   IK P
Sbjct  141  PDGYMVEICNCQNLPVLPLPSCPLIKSP  168



>ref|XP_010930832.1| PREDICTED: uncharacterized protein LOC105051884 isoform X2 [Elaeis 
guineensis]
Length=203

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 107/163 (66%), Gaps = 12/163 (7%)
 Frame = +2

Query  59   MQSLREERSHSRKLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGF  238
            ++ + EE S +  L      P M+LNHVS +CRSV  SV FY +VLG V ++RP +F+ F
Sbjct  3    LEIVEEELSAALPL------PLMSLNHVSFVCRSVGRSVKFYEEVLGFVSIKRPASFN-F  55

Query  239  DGAWLFNYGVGIHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKV  418
             GAWLFNYGVGIHL+Q    D      P  +  ++P DNHISFQC  +  ++ +L+E+ +
Sbjct  56   HGAWLFNYGVGIHLLQCNSPDDV----PKKKGVINPKDNHISFQCSDINLLKHKLEEMGI  111

Query  419  KYMKRTVGEGEGEAIDQLFFKDPDGFMIEICNCENITLVPQPS  547
            +Y+   V E  G  +DQLFF DPDG+M+EICNCEN+ ++P  S
Sbjct  112  EYVTAVV-EDSGIQVDQLFFHDPDGYMVEICNCENLPVLPLSS  153



>ref|XP_009110487.1| PREDICTED: uncharacterized protein LOC103836030 [Brassica rapa]
Length=174

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRS+++S++FY KVLG   + RP + + F+GAWLF +G+GIHL++A +   +
Sbjct  13   SLNHVSLLCRSIEESMNFYQKVLGFFPIRRPESLN-FEGAWLFGHGIGIHLLRALE--LE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    +  ++P DNHISFQC++M A+E++L E+++ Y++  V EG G  +DQLFF DP
Sbjct  70   KLP---KKNEINPKDNHISFQCESMGAVEKKLDEMEIDYVRSKVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPIVP  142



>emb|CDX83979.1| BnaC08g16660D [Brassica napus]
Length=174

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRS+++S++FY KVLG   + RP + + F+GAWLF +G+GIHL++A + ++ 
Sbjct  13   SLNHVSLLCRSIEESMNFYRKVLGFFPIRRPESLN-FEGAWLFGHGIGIHLLRALEPEKL  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                 + +  ++P DNHISFQC++M A+E++L+E+++ Y++  V EG G  +DQLFF DP
Sbjct  72   -----STKNEINPKDNHISFQCESMGAVEKKLEEMEIDYVRSKVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPIVP  142



>ref|XP_009148927.1| PREDICTED: uncharacterized protein LOC103872329 [Brassica rapa]
 emb|CDY36553.1| BnaA06g10060D [Brassica napus]
Length=174

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRS+++S+ FY  VLG   + RP + + F+GAWLF +G+GIHL+  +  + +
Sbjct  13   SLNHVSLLCRSIEESMVFYQTVLGFFPIRRPESLN-FEGAWLFGHGIGIHLL--RSSEPE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T+   ++P DNHISFQC++M A+E++L+E++++Y++  V EG G  +DQLFF DP
Sbjct  70   KLPKKTE---INPKDNHISFQCESMSAVEKKLEEMEIEYVRAIVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|XP_004509342.1| PREDICTED: uncharacterized protein LOC101515606 [Cicer arietinum]
Length=193

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS LCRSV  S+ FY +VLG V ++RP +F  F+GAWL+NYG+GIHL++  D 
Sbjct  15   PLLSLNHVSLLCRSVLHSMRFYEEVLGFVLIKRPSSFK-FNGAWLYNYGIGIHLIENPDN  73

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
            D    P   + + ++P DNHISFQC  +  +++RL+++ ++Y+   V + EG  ++Q+FF
Sbjct  74   DDFDTPM-NESRPINPKDNHISFQCTDVSIVKKRLEDMAMRYVTALVDD-EGNKVEQVFF  131

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDG+MIE+CNCENI +VP  S
Sbjct  132  HDPDGYMIELCNCENIPIVPISS  154



>gb|KDP32380.1| hypothetical protein JCGZ_13305 [Jatropha curcas]
Length=194

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S LCRS++ S+DFY  VLG   V+RP +FD FDGAWLF+YG+GIHL+Q++D +  
Sbjct  14   SLNHISILCRSLEKSLDFYQNVLGFFPVKRPGSFD-FDGAWLFSYGIGIHLLQSEDPEN-  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
                P   Q ++P DNHISFQC+ M  +E++LKE+K++++K  V EG G  +DQLFF DP
Sbjct  72   ---MPKINQ-INPKDNHISFQCENMAMVEKKLKEMKIEHVKGRVEEG-GINVDQLFFHDP  126

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+ + ++P
Sbjct  127  DGSMIEICNCDVLPVIP  143



>ref|XP_002890101.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66360.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRSV +S++FY KVLG + + RP + + F+GAWLF +G+GIHL+ A +   +
Sbjct  13   SLNHVSVLCRSVDESMNFYQKVLGFIPIRRPESLN-FEGAWLFGHGIGIHLLCAPE--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP  T   +++P DNHISFQC++M  +E++L+E+ ++Y++  V EG G  +DQLFF DP
Sbjct  70   KLPKKT---AINPKDNHISFQCESMGVVEKQLEEMGIEYVRALVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPVVP  142



>ref|NP_563973.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
 ref|NP_001031049.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
 gb|AAD39666.1|AC007591_31 Is a member of the PF|00903 gyloxalase family. ESTs gb|T44721, 
gb|T21844 and gb|AA395404 come from this gene [Arabidopsis 
thaliana]
 gb|AAL62369.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47938.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65839.1| unknown [Arabidopsis thaliana]
 dbj|BAH20026.1| AT1G15380 [Arabidopsis thaliana]
 gb|AEE29312.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
 gb|AEE29313.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
Length=174

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 109/149 (73%), Gaps = 9/149 (6%)
 Frame = +2

Query  98   LEEDDETPS--MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVG  271
            ++ED   P    +LNHVS LCRSV +S++FY KVLG + + RP + + F+GAWLF +G+G
Sbjct  1    MKEDAGNPLHLTSLNHVSVLCRSVDESMNFYQKVLGFIPIRRPESLN-FEGAWLFGHGIG  59

Query  272  IHLVQAKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGE  451
            IHL+ A +   ++LP  T   +++P DNHISFQC++M  +E++L+E+ + Y++  V EG 
Sbjct  60   IHLLCAPE--PEKLPKKT---AINPKDNHISFQCESMGVVEKKLEEMGIDYVRALVEEG-  113

Query  452  GEAIDQLFFKDPDGFMIEICNCENITLVP  538
            G  +DQLFF DPDGFMIEICNC+++ +VP
Sbjct  114  GIQVDQLFFHDPDGFMIEICNCDSLPVVP  142



>ref|XP_009781311.1| PREDICTED: lactoylglutathione lyase-like [Nicotiana sylvestris]
Length=195

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHL---VQA  289
            P ++LNHVS L R V +SV FY  VLG   V+RP +F+ F GAWL+NYGVGIHL   V  
Sbjct  16   PLLSLNHVSLLVRDVWNSVRFYEDVLGFCLVKRPSSFN-FHGAWLYNYGVGIHLLENVAM  74

Query  290  KDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQ  469
            +D D    P P     ++P DNHISFQC  +E ++RRL+E+ ++Y+   V E  G  +DQ
Sbjct  75   EDYDAINEPRP-----INPKDNHISFQCTDVEVVKRRLEEMGMRYVSAVV-EDNGIKVDQ  128

Query  470  LFFKDPDGFMIEICNCENITLVPQPSLGKIKL  565
            +FF DPDG+MIEICNCENI L+P  S   +KL
Sbjct  129  VFFHDPDGYMIEICNCENIPLLPISSTCPLKL  160



>gb|KHN47772.1| hypothetical protein glysoja_029190 [Glycine soja]
Length=141

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 103/134 (77%), Gaps = 7/134 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NH+S +CRSV+ S+DFY  VLG   + RP + D FDGAWLF YG+GIHL++A++ +  
Sbjct  14   SVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLD-FDGAWLFGYGIGIHLLEAENPEN-  71

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    ++ ++P DNHISFQC++ME +E++LKE+++ Y++ TV EG  + +DQLFF DP
Sbjct  72   -LPK---KKEINPKDNHISFQCESMEPVEKKLKEMEIDYVRATVEEGRIQ-VDQLFFHDP  126

Query  488  DGFMIEICNCENIT  529
            D FMIEICNC++++
Sbjct  127  DDFMIEICNCDSLS  140



>ref|XP_004251570.1| PREDICTED: uncharacterized protein LOC101264403 isoform X1 [Solanum 
lycopersicum]
Length=165

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 101/137 (74%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +CRS++ S+DFY  +LG   + RP +F+ FDGAWLFNYG+GIHL+Q++D   +
Sbjct  9    SLNHISIVCRSLEKSLDFYQNILGFFPIRRPGSFN-FDGAWLFNYGIGIHLLQSED--PN  65

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             +P       ++P DNHISFQC++M  +E RLKE++ +Y+K  V EG    +DQ+FF DP
Sbjct  66   NMP---KINIINPKDNHISFQCESMTMVENRLKEMETEYIKCRVEEG-NIYVDQIFFHDP  121

Query  488  DGFMIEICNCENITLVP  538
            DG MIEICNC+N+ ++P
Sbjct  122  DGTMIEICNCDNLPVIP  138



>ref|XP_006389541.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
 gb|ERP48455.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
Length=209

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 102/148 (69%), Gaps = 9/148 (6%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            ++LNHVS +C+SV +SV FY  VLG V ++RP +F  F+GAWLF+YG+GIHL+++     
Sbjct  28   LSLNHVSFVCKSVPESVKFYEDVLGFVLIKRPSSFK-FEGAWLFSYGIGIHLLESDKA--  84

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKD  484
                 PT +  ++P DNHISFQC  M  + ++L+E  ++Y+   V EG G  +DQLFF D
Sbjct  85   -----PTKKSKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEG-GITVDQLFFHD  138

Query  485  PDGFMIEICNCENITLVPQPSLGKIKLP  568
            PDG+M+EICNC+N+ ++P  S   IK P
Sbjct  139  PDGYMVEICNCQNLPVLPLSSCPLIKAP  166



>emb|CDX96844.1| BnaA08g23870D [Brassica napus]
Length=174

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 105/137 (77%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNHVS LCRS+++S++FY +VLG   + RP + + F+GAWLF +G+GIHL++A +   +
Sbjct  13   SLNHVSLLCRSIEESMNFYQRVLGFFPIRRPESLN-FEGAWLFGHGIGIHLLRALE--LE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            +LP    +  ++P DNHISFQC++M A+E++L E+++ Y++  V EG G  +DQLFF DP
Sbjct  70   KLP---KKNEINPKDNHISFQCESMGAVEKKLDEMEIDYVRSKVEEG-GIQVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEICNC+++ +VP
Sbjct  126  DGFMIEICNCDSLPIVP  142



>gb|KHG30040.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=192

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 103/146 (71%), Gaps = 10/146 (7%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQ-  286
            +  P ++LNHVS LCRSV DS+ FY +VLG V ++RP +F  F+GAWL+NYG+GIHL++ 
Sbjct  11   ESLPLLSLNHVSLLCRSVWDSMRFYEEVLGFVPIKRPSSFK-FNGAWLYNYGIGIHLIEN  69

Query  287  --AKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEA  460
                D D    P P     ++P DNHISFQC  +E ++ RL+++ +KY+   V E EG  
Sbjct  70   PLIDDFDTIIEPRP-----INPKDNHISFQCRDVEIVKGRLEDMGMKYVTAVV-EDEGNT  123

Query  461  IDQLFFKDPDGFMIEICNCENITLVP  538
            +DQ+FF DPDG+MIE+CNCENI ++P
Sbjct  124  VDQVFFHDPDGYMIELCNCENIPILP  149



>ref|XP_010113383.1| hypothetical protein L484_026715 [Morus notabilis]
 gb|EXC35390.1| hypothetical protein L484_026715 [Morus notabilis]
Length=192

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 105/148 (71%), Gaps = 6/148 (4%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQ-  286
            +  P ++LNHVS LCRSV +S  FY +VLG V ++RP +F+ F+GAWL+NYG+GIHL++ 
Sbjct  11   EALPLLSLNHVSLLCRSVWESTRFYEEVLGFVLIKRPSSFN-FNGAWLYNYGIGIHLIEN  69

Query  287  -AKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAI  463
             A   + D +  P   + ++P DNHISFQC  +  ++RRL+E+ ++Y+   V   +G  +
Sbjct  70   PALVDEYDTMNEP---RPINPKDNHISFQCTDVGLVKRRLQEMGMRYVTALVEADDGIKV  126

Query  464  DQLFFKDPDGFMIEICNCENITLVPQPS  547
            DQ+FF DPDG+MIE+CNCENI ++P  S
Sbjct  127  DQVFFHDPDGYMIELCNCENIPILPLSS  154



>ref|XP_007203893.1| hypothetical protein PRUPE_ppa012053mg [Prunus persica]
 gb|EMJ05092.1| hypothetical protein PRUPE_ppa012053mg [Prunus persica]
Length=185

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 106/150 (71%), Gaps = 12/150 (8%)
 Frame = +2

Query  95   KLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGI  274
            +L   +  P ++LNHVS LCRSV DS+ FY  VLG V ++RP +F+ F+GAWL+NYG+GI
Sbjct  5    ELSNCEALPLLSLNHVSLLCRSVWDSLRFYEDVLGFVVIKRPSSFN-FNGAWLYNYGIGI  63

Query  275  HLVQAKDGDQDRLPHPTDQQS--LDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEG  448
            HL+++        P   D +S  ++P DNHISFQC  +  ++RRL+++ ++Y+   V E 
Sbjct  64   HLIES--------PAMEDYESRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVV-ED  114

Query  449  EGEAIDQLFFKDPDGFMIEICNCENITLVP  538
            +G  +DQ+FF DPDG+MIE+CNCENI ++P
Sbjct  115  DGVKVDQVFFHDPDGYMIELCNCENIPIIP  144



>ref|XP_008218743.1| PREDICTED: uncharacterized protein LOC103319028 isoform X2 [Prunus 
mume]
Length=213

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 107/159 (67%), Gaps = 9/159 (6%)
 Frame = +2

Query  107  DDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQ  286
              E P + LNHVS +C+SV  SV FY +VLG V ++RP +F  F+GAWLFNYG+GIHL++
Sbjct  16   SSELPQLCLNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFK-FEGAWLFNYGIGIHLLE  74

Query  287  AKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAID  466
            +          P  +  ++P DNHISFQC  M  + ++L+E++++Y+   V EG G  +D
Sbjct  75   SDKNI------PEKKGKINPKDNHISFQCSDMGMVIQKLEEMRIEYVTAKVEEG-GVIVD  127

Query  467  QLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHT  583
            QLFF DPDG+M+EICNC+N+ ++P  S   IKL ++ + 
Sbjct  128  QLFFHDPDGYMVEICNCQNLPVLPISSC-PIKLMTNTNA  165



>ref|XP_002526462.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF35957.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=234

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SV +SV FY  VLG V ++RP +F+ F+GAWLFNYG+GIHL++A+D 
Sbjct  24   PLLSLNHVSFVCKSVAESVRFYEDVLGFVLIQRPSSFN-FEGAWLFNYGIGIHLLEAED-  81

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                +PH   +  ++P DNHISFQ   M+ + R L+E  ++Y+   V EG G  +DQLFF
Sbjct  82   ----VPH--KKGPINPKDNHISFQTSDMDLVVRNLEEKNIEYVTAVVEEG-GITVDQLFF  134

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHTPPVQPP  601
             DPDG+M+EICNC+N+ ++P  S   +KLP   +     PP
Sbjct  135  HDPDGYMVEICNCQNLPVLPL-SACPLKLPKAANGNLTPPP  174



>gb|ABK93893.1| unknown [Populus trichocarpa]
Length=209

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 102/148 (69%), Gaps = 9/148 (6%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            ++LNHVS +C+SV +SV FY  VLG V ++RP +F  F+GAWLF+YG+GIHL+++     
Sbjct  28   LSLNHVSFVCKSVPESVKFYEDVLGFVLIKRPSSFK-FEGAWLFSYGIGIHLLESDKA--  84

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKD  484
                 PT +  ++P DNHISFQC  M  + ++L+E  ++Y+   V EG G  +DQLFF D
Sbjct  85   -----PTKKSKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEG-GITVDQLFFHD  138

Query  485  PDGFMIEICNCENITLVPQPSLGKIKLP  568
            PDG+M+EICNC+N+ ++P  S   IK P
Sbjct  139  PDGYMVEICNCQNLPVLPLSSCPLIKAP  166



>ref|XP_008218742.1| PREDICTED: uncharacterized protein LOC103319028 isoform X1 [Prunus 
mume]
Length=216

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 107/159 (67%), Gaps = 9/159 (6%)
 Frame = +2

Query  107  DDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQ  286
              E P + LNHVS +C+SV  SV FY +VLG V ++RP +F  F+GAWLFNYG+GIHL++
Sbjct  16   SSELPQLCLNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFK-FEGAWLFNYGIGIHLLE  74

Query  287  AKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAID  466
            +          P  +  ++P DNHISFQC  M  + ++L+E++++Y+   V EG G  +D
Sbjct  75   SDKNI------PEKKGKINPKDNHISFQCSDMGMVIQKLEEMRIEYVTAKVEEG-GVIVD  127

Query  467  QLFFKDPDGFMIEICNCENITLVPQPSLGKIKLPSDRHT  583
            QLFF DPDG+M+EICNC+N+ ++P  S   IKL ++ + 
Sbjct  128  QLFFHDPDGYMVEICNCQNLPVLPISSC-PIKLMTNTNA  165



>ref|XP_011072230.1| PREDICTED: uncharacterized protein LOC105157526 [Sesamum indicum]
Length=172

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 110/167 (66%), Gaps = 17/167 (10%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LNH+S +C+SV  S  FY  VLG + V RP +F+ FDGAWLF +G+GIHL+Q++D   +
Sbjct  13   SLNHISLVCQSVDQSTHFYHNVLGFMPVRRPGSFN-FDGAWLFGHGIGIHLLQSED--PE  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP  T    ++P DNHISFQC+ M  +E++L E+ + ++++ V EG G  +DQLFF DP
Sbjct  70   SLPKKT---VINPKDNHISFQCENMGMVEKKLTEMGIDWVRQRVEEG-GIYVDQLFFHDP  125

Query  488  DGFMIEICNCENITLVPQP-----SLGKIKLPSDR-----HTPPVQP  598
            DGFMIEICNC+NI ++P P     S  ++ L         H P VQP
Sbjct  126  DGFMIEICNCDNIPVIPLPGEMVRSCSRLNLQQQPQQQQIHVPVVQP  172



>gb|KHN31586.1| hypothetical protein glysoja_043029 [Glycine soja]
Length=184

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 102/143 (71%), Gaps = 9/143 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SV +SV FY  VLG + ++RP +F  F+GAWLFNYG+GIHL++++  
Sbjct  12   PLLSLNHVSFVCKSVSESVKFYEDVLGFLLIKRPSSFK-FEGAWLFNYGIGIHLLESEKV  70

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P  ++ ++P +NHISFQC  M+ + ++L  +K++Y+   V EG G  +DQLFF
Sbjct  71   -------PVKKREINPKENHISFQCSDMKVIMQKLDAMKIEYVTAVVEEG-GIKVDQLFF  122

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDG+MIEICNC+N+ ++P  S
Sbjct  123  HDPDGYMIEICNCQNLPVLPISS  145



>ref|XP_010033467.1| PREDICTED: uncharacterized protein LOC104422744 [Eucalyptus grandis]
 gb|KCW53107.1| hypothetical protein EUGRSUZ_J02400 [Eucalyptus grandis]
Length=196

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 12/158 (8%)
 Frame = +2

Query  110  DETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQA  289
            +  P ++LNHVS +CRSV++SV FY  VLG V ++RP +FD F+GAWL+NYG+GIHL++ 
Sbjct  17   EALPLLSLNHVSLMCRSVRESVRFYEDVLGFVLIKRPSSFD-FNGAWLYNYGIGIHLIEN  75

Query  290  KDGDQ-DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAID  466
               ++ D +  P   + ++P DNH+SFQC  +  ++RRL+E+ ++Y+   V E  G  +D
Sbjct  76   PSIEENDAIDEP---RPINPKDNHMSFQCTDVGLVKRRLQEMGMRYVTAVVEEA-GVKVD  131

Query  467  QLFFKDPDGFMIEICNCENITLVP------QPSLGKIK  562
            Q+FF DPDG+MIEICNC+NI ++P      +P LG   
Sbjct  132  QVFFHDPDGYMIEICNCDNIPILPISSCPFKPKLGSFN  169



>ref|NP_001236582.1| uncharacterized protein LOC100305781 [Glycine max]
 gb|ACU13640.1| unknown [Glycine max]
Length=181

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 102/143 (71%), Gaps = 9/143 (6%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SV +SV FY  VLG + ++RP +F  F+GAWLFNYG+GIHL++++  
Sbjct  9    PLLSLNHVSFVCKSVSESVKFYEDVLGFLLIKRPSSFK-FEGAWLFNYGIGIHLLESEKV  67

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P  ++ ++P +NHISFQC  M+ + ++L  +K++Y+   V EG G  +DQLFF
Sbjct  68   -------PVRKREINPKENHISFQCSDMKVIMQKLDAMKIEYVTAVVEEG-GVKVDQLFF  119

Query  479  KDPDGFMIEICNCENITLVPQPS  547
             DPDG+MIEICNC+N+ ++P  S
Sbjct  120  HDPDGYMIEICNCQNLPVLPISS  142



>ref|XP_006465353.1| PREDICTED: uncharacterized protein LOC102630180 [Citrus sinensis]
 gb|KDO45231.1| hypothetical protein CISIN_1g030972mg [Citrus sinensis]
Length=168

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NHVS +CR++ +S+DFY  VLG V + RP +F+ FDGAWLF +G+GIHL+Q+++   D
Sbjct  13   SVNHVSLVCRNISESIDFYQNVLGFVPIRRPGSFN-FDGAWLFGHGIGIHLLQSEN--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    +  ++P DNH+SFQC+++  +E+ LKE+ +KY++  V EG G  ++QLFF DP
Sbjct  70   SLP---KKSVINPKDNHLSFQCESVGNVEKFLKEMGIKYVRALVEEG-GILVEQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ +VP
Sbjct  126  DGFMIEICDCDNLPVVP  142



>ref|XP_006389542.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
 gb|ERP48456.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
Length=228

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 102/148 (69%), Gaps = 9/148 (6%)
 Frame = +2

Query  125  MALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQ  304
            ++LNHVS +C+SV +SV FY  VLG V ++RP +F  F+GAWLF+YG+GIHL+++     
Sbjct  28   LSLNHVSFVCKSVPESVKFYEDVLGFVLIKRPSSFK-FEGAWLFSYGIGIHLLESDKA--  84

Query  305  DRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKD  484
                 PT +  ++P DNHISFQC  M  + ++L+E  ++Y+   V EG G  +DQLFF D
Sbjct  85   -----PTKKSKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEG-GITVDQLFFHD  138

Query  485  PDGFMIEICNCENITLVPQPSLGKIKLP  568
            PDG+M+EICNC+N+ ++P  S   IK P
Sbjct  139  PDGYMVEICNCQNLPVLPLSSCPLIKAP  166



>ref|XP_006427237.1| hypothetical protein CICLE_v10026643mg [Citrus clementina]
 gb|ESR40477.1| hypothetical protein CICLE_v10026643mg [Citrus clementina]
Length=168

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            ++NHVS +CR++ +S+DFY  VLG V + RP +F+ FDGAWLF +G+GIHL+Q+++   D
Sbjct  13   SVNHVSLVCRNISESIDFYQNVLGFVPIRRPGSFN-FDGAWLFGHGIGIHLLQSEN--PD  69

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
             LP    +  ++P DNH+SFQC+++  +E+ LKE+ +KY++  V EG G  ++QLFF DP
Sbjct  70   SLP---KKSVINPKDNHLSFQCESVGNVEKFLKEMGIKYVRALVEEG-GILVEQLFFHDP  125

Query  488  DGFMIEICNCENITLVP  538
            DGFMIEIC+C+N+ +VP
Sbjct  126  DGFMIEICDCDNLPVVP  142



>ref|XP_009780118.1| PREDICTED: lactoylglutathione lyase-like [Nicotiana sylvestris]
Length=201

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 10/151 (7%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAK--  292
            P ++LNHVS L + V +SV FY  VLG   V+RP +F+ F GAWL+NYG+GIHL++ K  
Sbjct  17   PLLSLNHVSLLVKDVWNSVQFYEAVLGFCLVKRPSSFN-FHGAWLYNYGIGIHLLENKVM  75

Query  293  -DGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQ  469
             D D +  P P     ++P DNHISFQC  +E ++R+LKE+ ++Y+   V E EG  +DQ
Sbjct  76   EDLDVNNEPRP-----INPKDNHISFQCTDVELVKRKLKEMGMRYVTAVV-EDEGIKVDQ  129

Query  470  LFFKDPDGFMIEICNCENITLVPQPSLGKIK  562
            +FF DPDG+MIEICNCEN+ ++P  S  ++K
Sbjct  130  VFFHDPDGYMIEICNCENLPMLPISSNCQLK  160



>ref|XP_008242749.1| PREDICTED: uncharacterized protein LOC103341047 [Prunus mume]
Length=208

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +2

Query  128  ALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDGDQD  307
            +LN +S +CRSV+ S+DFY  VLG   + RP +FD F+GAWLFN G+GIH +Q++D   D
Sbjct  62   SLNPISLVCRSVEKSLDFYQSVLGFFPIRRPGSFD-FNGAWLFNCGIGIHRLQSED--PD  118

Query  308  RLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFFKDP  487
            ++P    Q  ++P DNHISFQC++M  +E+ LKE++++Y+KR V EG G  +DQLFF DP
Sbjct  119  KMPKKIAQ--INPKDNHISFQCESMVTVEKNLKEMEIEYVKRRVEEG-GIYVDQLFFHDP  175

Query  488  DGFMIEICNCENITLVP  538
            D  MIEICNC+N+ ++P
Sbjct  176  DATMIEICNCDNLPVIP  192



>ref|XP_006431676.1| hypothetical protein CICLE_v10002584mg [Citrus clementina]
 gb|ESR44916.1| hypothetical protein CICLE_v10002584mg [Citrus clementina]
Length=190

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 107/151 (71%), Gaps = 11/151 (7%)
 Frame = +2

Query  119  PSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGIHLVQAKDG  298
            P ++LNHVS +C+SVK SV FY +VLG V ++RP +F+ F+GAWLFN+G+GIHL+++   
Sbjct  2    PILSLNHVSFVCKSVKRSVMFYEQVLGFVIIKRP-SFN-FEGAWLFNHGIGIHLLESDKA  59

Query  299  DQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEGEGEAIDQLFF  478
                   P  +  ++P DNHISFQC  M+ + R+L+E+ ++Y    V EG G  +DQLFF
Sbjct  60   -------PEKRGKINPKDNHISFQCSDMKLVMRKLEEMNIEYETAVVEEG-GIRVDQLFF  111

Query  479  KDPDGFMIEICNCENITLVPQPSLGKIKLPS  571
             DPDG+MIEICNC+N+ ++P  S   +KLPS
Sbjct  112  HDPDGYMIEICNCQNLPVLPLSSC-PLKLPS  141



>ref|XP_008241797.1| PREDICTED: lactoylglutathione lyase-like [Prunus mume]
Length=185

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 107/150 (71%), Gaps = 12/150 (8%)
 Frame = +2

Query  95   KLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGI  274
            +L   +  P ++LNHVS LCRSV +S+ FY +VLG V ++RP +F+ F+GAWL+NYG+GI
Sbjct  5    ELNNCEALPLLSLNHVSLLCRSVWNSLRFYEEVLGFVVIKRPSSFN-FNGAWLYNYGIGI  63

Query  275  HLVQAKDGDQDRLPHPTDQQS--LDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEG  448
            HL+++        P   D +S  ++P DNHISFQC  +  ++RRL+++ ++Y+   V E 
Sbjct  64   HLIES--------PAMEDYESRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVV-ED  114

Query  449  EGEAIDQLFFKDPDGFMIEICNCENITLVP  538
            +G  +DQ+FF DPDG+M+E+CNCENI ++P
Sbjct  115  DGVKVDQVFFHDPDGYMVELCNCENIPIIP  144



>ref|XP_006383134.1| hypothetical protein POPTR_0005s11890g [Populus trichocarpa]
 gb|ERP60931.1| hypothetical protein POPTR_0005s11890g [Populus trichocarpa]
Length=192

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 112/164 (68%), Gaps = 13/164 (8%)
 Frame = +2

Query  95   KLEEDDETPSMALNHVSRLCRSVKDSVDFYTKVLGLVEVERPPAFDGFDGAWLFNYGVGI  274
            ++   +  P ++LNHVS LCRSV  SV FY  VLG V ++RP +F+ F+GAWL+NYG+GI
Sbjct  7    EVSSHEALPLLSLNHVSLLCRSVWASVRFYEDVLGFVLIKRPSSFN-FNGAWLYNYGIGI  65

Query  275  HLVQ--AKDGDQDRLPHPTDQQSLDPMDNHISFQCDAMEAMERRLKELKVKYMKRTVGEG  448
            HL++  + D + D +  P   + ++P DNH+SFQC  +  ++RRL+E+ ++Y+   V E 
Sbjct  66   HLIENPSIDHEFDTIVEP---RPINPKDNHMSFQCTDVGLVKRRLQEMGMRYVTAVVEE-  121

Query  449  EGEAIDQLFFKDPDGFMIEICNCENITLVP------QPSLGKIK  562
            +G  +DQ+FF DPDG+M+EICNC+NI ++P      +P +G  K
Sbjct  122  DGIMVDQVFFHDPDGYMVEICNCDNIPILPLSSCPLKPRMGSFK  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1651846923090