BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c116623_g1_i1 len=236 path=[1:0-235]

Length=236
                                                                      Score     E

gb|ABA93896.1|  retrotransposon protein, putative, unclassified         122   4e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG90661.1|  unnamed protein product                                119   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006475543.1|  PREDICTED: uncharacterized protein LOC102610887    122   7e-30   
gb|ACB28472.1|  polyprotein                                             122   7e-30   Ananas comosus
gb|ABA97403.1|  retrotransposon protein, putative, unclassified         119   1e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05990.1|  OSJNBa0004L19.22                                       121   2e-29   Oryza sativa [red rice]
gb|EEE65753.1|  hypothetical protein OsJ_21419                          119   3e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67280.1|  OSIGBa0111L12.7                                        120   4e-29   Oryza sativa [red rice]
gb|ABA98724.1|  retrotransposon protein, putative, unclassified         120   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95319.1|  retrotransposon protein, putative, unclassified         119   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68381.1|  putative polyprotein                                    119   6e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057680.2|  Os06g0493000                                       119   7e-29   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH00815.1|  unnamed protein product                                115   8e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53789.1|  retrotransposon protein, putative, unclassified         119   8e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011075658.1|  PREDICTED: uncharacterized protein LOC105160092    119   1e-28   
emb|CAE03590.1|  OSJNBa0087O24.13                                       119   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAK55448.1|AC069300_3  putative polyprotein                          118   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008657558.1|  PREDICTED: uncharacterized protein LOC103637066    117   2e-28   
emb|CAH66499.1|  H0321H01.8                                             117   7e-28   Oryza sativa [red rice]
gb|ADB85290.1|  putative retrotransposon protein                        115   7e-28   Phyllostachys edulis [kikko-chiku]
emb|CAJ65868.1|  putative integrase                                     108   8e-28   Cucumis melo [Oriental melon]
gb|AAL68644.1|AF458768_1  polyprotein                                   115   1e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AAV24812.1|  putative polyprotein                                    116   1e-27   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH00063.1|  unnamed protein product                                113   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010681945.1|  PREDICTED: uncharacterized protein K02A2.6-like    115   1e-27   
gb|AAL76001.1|AF466646_9  putative gag-pol polyprotein                  115   2e-27   Zea mays [maize]
gb|ABA95339.2|  retrotransposon protein, putative, unclassified         115   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95101.1|  retrotransposon protein, putative, unclassified         115   3e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AAL82521.1|AC084766_7  putative polyprotein                          111   4e-27   Oryza sativa [red rice]
emb|CAJ65867.1|  putative integrase                                     106   5e-27   Cucumis melo [Oriental melon]
ref|XP_004296329.1|  PREDICTED: uncharacterized protein LOC101295505    114   5e-27   
gb|KDP42549.1|  hypothetical protein JCGZ_24323                         107   5e-27   
emb|CAJ65870.1|  putative integrase                                     106   5e-27   Cucumis melo [Oriental melon]
ref|XP_010248242.1|  PREDICTED: uncharacterized protein LOC104591153    111   5e-27   
emb|CAJ65875.1|  putative integrase                                     106   5e-27   Cucumis melo [Oriental melon]
emb|CAJ65876.1|  putative integrase                                     105   7e-27   Cucumis melo [Oriental melon]
gb|ABG22014.1|  retrotransposon protein, putative, unclassified         113   8e-27   
ref|XP_008652480.1|  PREDICTED: transposon Tf2-1 polyprotein isof...    113   8e-27   
gb|KFK40793.1|  hypothetical protein AALP_AA2G041700                    108   9e-27   
emb|CAH67116.1|  H0502G05.7                                             112   1e-26   Oryza sativa [red rice]
dbj|BAG72147.1|  hypothetical protein                                   112   2e-26   Lotus japonicus
emb|CAN63307.1|  hypothetical protein VITISV_010204                     107   2e-26   Vitis vinifera
ref|XP_006584316.1|  PREDICTED: uncharacterized protein LOC102665925    109   2e-26   
gb|AAG13430.1|AC051634_11  putative plant disease resistance poly...    112   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ABD78329.1|  polyprotein                                             109   2e-26   Primula vulgaris
gb|ACE86397.1|  putative retroelement protein                           111   2e-26   Sorghum bicolor [broomcorn]
gb|AAP54937.2|  retrotransposon protein, putative, unclassified         112   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009775498.1|  PREDICTED: uncharacterized protein LOC104225416    109   2e-26   
gb|ABA99961.1|  retrotransposon protein, putative, unclassified         112   2e-26   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG72151.1|  hypothetical protein                                   112   2e-26   Lotus japonicus
dbj|BAG72152.1|  hypothetical protein                                   112   3e-26   Lotus japonicus
dbj|BAG72150.1|  hypothetical protein                                   112   3e-26   Lotus japonicus
ref|XP_010533307.1|  PREDICTED: uncharacterized protein LOC104809111    112   3e-26   
dbj|BAG72154.1|  hypothetical protein                                   112   3e-26   Lotus japonicus
emb|CAE04934.2|  OSJNBa0017P10.11                                       112   3e-26   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG72148.1|  hypothetical protein                                   112   3e-26   Lotus japonicus
emb|CAJ65869.1|  putative integrase                                     104   3e-26   Cucumis melo [Oriental melon]
gb|KFK22868.1|  hypothetical protein AALP_AAs42979U000100               112   3e-26   
ref|XP_007208605.1|  hypothetical protein PRUPE_ppa022027mg             109   4e-26   
gb|ABA97970.1|  retrotransposon protein, putative, unclassified, ...    112   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAL75999.1|AF466646_7  putative polyprotein                          112   4e-26   Zea mays [maize]
emb|CAJ65877.1|  putative integrase                                     103   4e-26   Cucumis melo [Oriental melon]
ref|XP_010097264.1|  Transposon Ty3-I Gag-Pol polyprotein               108   4e-26   
ref|XP_010412474.1|  PREDICTED: uncharacterized protein K02A2.6-like    107   4e-26   
ref|XP_008671739.1|  PREDICTED: uncharacterized protein LOC103649194    111   4e-26   
gb|ABA95357.2|  retrotransposon protein, putative, unclassified         112   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96573.1|  retrotransposon protein, putative, unclassified, ...    111   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAD24647.1|  putative retroelement pol polyprotein                   110   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAP54661.2|  retrotransposon protein, putative, unclassified         110   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004301249.1|  PREDICTED: genome polyprotein-like                 108   5e-26   
ref|XP_008671115.1|  PREDICTED: uncharacterized protein LOC103648418    110   8e-26   
gb|AAS55774.2|  putative polyprotein                                    110   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010655166.1|  PREDICTED: uncharacterized protein LOC104880390    110   1e-25   
gb|ABF94845.1|  retrotransposon protein, putative, unclassified         110   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010650251.1|  PREDICTED: uncharacterized protein LOC100853955    110   1e-25   
emb|CAN70510.1|  hypothetical protein VITISV_023158                     109   1e-25   Vitis vinifera
emb|CAN60890.1|  hypothetical protein VITISV_011880                     110   1e-25   Vitis vinifera
gb|AAO37507.1|  retrotransposon protein, putative, unclassified         110   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96125.1|  retrotransposon protein, putative, unclassified         110   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|ADB85398.1|  putative retrotransposon protein                        110   1e-25   Phyllostachys edulis [kikko-chiku]
emb|CAN67160.1|  hypothetical protein VITISV_039498                     106   1e-25   Vitis vinifera
gb|ABD78322.1|  polyprotein                                             110   2e-25   Primula vulgaris
emb|CAN75226.1|  hypothetical protein VITISV_035857                     106   2e-25   Vitis vinifera
gb|AAG51464.1|AC069160_10  gypsy/Ty3 element polyprotein, putative      109   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51046.1|AC069473_8  gypsy/Ty-3 retroelement polyprotein; 69...    109   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791837.1|  PREDICTED: probable serine/threonine-protein...    109   2e-25   
emb|CAN68669.1|  hypothetical protein VITISV_039388                     109   2e-25   Vitis vinifera
emb|CAN79785.1|  hypothetical protein VITISV_002634                     104   2e-25   Vitis vinifera
gb|ABA97314.2|  retrotransposon protein, putative, unclassified         109   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAK98732.1|AC090485_11  Putative retroelement                        109   3e-25   Oryza sativa [red rice]
ref|XP_004509508.1|  PREDICTED: uncharacterized protein LOC101513325    109   3e-25   
gb|ABF93966.1|  retrotransposon protein, putative, unclassified, ...    109   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAS98496.1|  unknown protein                                         108   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010264998.1|  PREDICTED: uncharacterized protein LOC104602841    108   4e-25   
emb|CAN77085.1|  hypothetical protein VITISV_044282                     108   4e-25   Vitis vinifera
emb|CAN81986.1|  hypothetical protein VITISV_001568                     107   4e-25   Vitis vinifera
ref|XP_010541181.1|  PREDICTED: uncharacterized protein LOC104814705    108   4e-25   
emb|CAN73467.1|  hypothetical protein VITISV_043900                     108   5e-25   Vitis vinifera
emb|CAN80132.1|  hypothetical protein VITISV_012031                     108   5e-25   Vitis vinifera
gb|KFK24528.1|  hypothetical protein AALP_AAs46225U000100               108   5e-25   
ref|XP_010247105.1|  PREDICTED: uncharacterized protein LOC104590232    105   6e-25   
ref|NP_001175365.1|  Os08g0123950                                       107   6e-25   
ref|XP_008650680.1|  PREDICTED: uncharacterized protein LOC103631580    108   6e-25   
ref|XP_008453052.1|  PREDICTED: uncharacterized protein LOC103493874    104   6e-25   
gb|AAG13508.1|AC068924_13  putative gag-pol polyprotein                 108   7e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AFJ66186.1|  hypothetical protein 11M19.5                            108   7e-25   
gb|KFK43794.1|  hypothetical protein AALP_AA1G173500                    107   7e-25   
emb|CAD40196.2|  OSJNBb0043H09.2                                        108   7e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAM51835.1|AC105730_9  Putative plant disease resistance polyp...    107   7e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002450635.1|  hypothetical protein SORBIDRAFT_05g008466          108   8e-25   Sorghum bicolor [broomcorn]
gb|AAU43957.1|  putative polyprotein                                    107   8e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95226.1|  retrotransposon protein, putative, unclassified         107   8e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76793.1|  hypothetical protein VITISV_026680                     107   9e-25   Vitis vinifera
gb|ABA91843.2|  retrotransposon protein, putative, unclassified         107   9e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96796.1|  retrotransposon protein, putative, unclassified         104   9e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010694863.1|  PREDICTED: uncharacterized protein LOC104907605    107   1e-24   
ref|XP_006651601.1|  PREDICTED: uncharacterized protein LOC102715003    107   1e-24   
gb|KFK23032.1|  hypothetical protein AALP_AAs71112U000100               107   1e-24   
gb|KFK34141.1|  hypothetical protein AALP_AA5G106200                    107   1e-24   
ref|XP_011027642.1|  PREDICTED: transposon Ty3-G Gag-Pol polyprotein    107   1e-24   
gb|KFK40399.1|  hypothetical protein AALP_AA3G368400                    106   1e-24   
emb|CAJ65872.1|  putative integrase                                   99.8    2e-24   Cucumis melo [Oriental melon]
gb|KFK43793.1|  hypothetical protein AALP_AA1G173500                    107   2e-24   
ref|XP_010451711.1|  PREDICTED: uncharacterized protein LOC104733878    107   2e-24   
gb|KFK22699.1|  hypothetical protein AALP_AAs67984U000100               107   2e-24   
ref|XP_004170075.1|  PREDICTED: uncharacterized protein LOC101232562    104   2e-24   
gb|ACP30609.1|  disease resistance protein                              106   3e-24   Brassica rapa subsp. pekinensis [bai cai]
gb|ABA97104.1|  retrotransposon protein, putative, unclassified         106   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010646171.1|  PREDICTED: uncharacterized protein LOC104878095    105   3e-24   
gb|KFK38387.1|  hypothetical protein AALP_AA3G106900                    106   3e-24   
gb|ADB85304.1|  putative retrotransposon protein                        102   3e-24   Phyllostachys edulis [kikko-chiku]
ref|XP_008354290.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    106   3e-24   
gb|AAX96513.1|  retrotransposon protein, putative, unclassified         105   3e-24   Oryza sativa Japonica Group [Japonica rice]
gb|ACY01928.1|  hypothetical protein                                    106   3e-24   
emb|CAN64046.1|  hypothetical protein VITISV_040537                     106   3e-24   Vitis vinifera
gb|ABA92870.2|  retrotransposon protein, putative, unclassified         105   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007216306.1|  hypothetical protein PRUPE_ppa019597mg             106   3e-24   
ref|XP_002437407.1|  hypothetical protein SORBIDRAFT_10g026363          106   3e-24   Sorghum bicolor [broomcorn]
emb|CAN70471.1|  hypothetical protein VITISV_013478                     105   4e-24   Vitis vinifera
ref|XP_010484774.1|  PREDICTED: uncharacterized protein LOC104763056    104   4e-24   
emb|CAD40278.2|  OSJNBb0062H02.17                                       105   4e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AFK13856.1|  Ty3/gypsy retrotransposon protein                       105   4e-24   
ref|XP_006365576.1|  PREDICTED: uncharacterized protein LOC102595311    105   4e-24   
gb|AAP55181.2|  retrotransposon protein, putative, unclassified         105   4e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010109691.1|  Sterol 3-beta-glucosyltransferase                  105   4e-24   
emb|CAN60449.1|  hypothetical protein VITISV_036155                     104   4e-24   Vitis vinifera
ref|XP_008655231.1|  PREDICTED: uncharacterized protein LOC100382...    105   4e-24   
emb|CAN66553.1|  hypothetical protein VITISV_018166                     105   5e-24   Vitis vinifera
gb|KFK28310.1|  hypothetical protein AALP_AA8G499800                    105   5e-24   
ref|XP_010548864.1|  PREDICTED: uncharacterized protein LOC104820194    105   5e-24   
emb|CAN64437.1|  hypothetical protein VITISV_011228                     104   5e-24   Vitis vinifera
emb|CAE05274.1|  OSJNBb0014D23.8                                        105   5e-24   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66146.1|  OSIGBa0114M03.4                                        105   5e-24   Oryza sativa [red rice]
ref|XP_002438456.1|  hypothetical protein SORBIDRAFT_10g020014          105   5e-24   Sorghum bicolor [broomcorn]
gb|KFK23310.1|  hypothetical protein AALP_AAs43195U000200               105   6e-24   
emb|CAN81876.1|  hypothetical protein VITISV_034528                     105   6e-24   Vitis vinifera
ref|XP_010680400.1|  PREDICTED: transposon Tf2-1 polyprotein isof...    105   6e-24   
emb|CAH66431.1|  OSIGBa0096P03.5                                        102   7e-24   Oryza sativa [red rice]
gb|KFK36441.1|  hypothetical protein AALP_AA4G124900                    104   7e-24   
gb|ABA93987.1|  retrotransposon protein, putative, unclassified         105   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002438460.1|  hypothetical protein SORBIDRAFT_10g020018          104   9e-24   Sorghum bicolor [broomcorn]
emb|CAN73897.1|  hypothetical protein VITISV_025576                     100   9e-24   Vitis vinifera
ref|XP_002443111.1|  hypothetical protein SORBIDRAFT_08g008675          104   1e-23   Sorghum bicolor [broomcorn]
emb|CAJ00277.1|  hypothetical protein                                   104   1e-23   Lotus japonicus
emb|CAJ00274.1|  hypothetical protein                                   104   1e-23   Lotus japonicus
ref|XP_004150327.1|  PREDICTED: uncharacterized protein LOC101216833    105   1e-23   
emb|CAJ00278.1|  hypothetical protein                                   104   1e-23   Lotus japonicus
gb|KFK36440.1|  hypothetical protein AALP_AA4G124900                    104   1e-23   
ref|XP_009801581.1|  PREDICTED: uncharacterized protein LOC104247310    102   1e-23   
gb|KFK36442.1|  hypothetical protein AALP_AA4G124900                    104   1e-23   
gb|AAP52367.1|  retrotransposon protein, putative, unclassified         100   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KDP33197.1|  hypothetical protein JCGZ_12719                         100   2e-23   
ref|XP_008378706.1|  PREDICTED: uncharacterized protein LOC103441785    102   2e-23   
gb|KFK43656.1|  hypothetical protein AALP_AA1G155400                    103   2e-23   
ref|NP_001052635.1|  Os04g0389000                                       102   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93917.1|  retrotransposon protein, putative, unclassified         103   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AEV42261.1|  hypothetical protein                                    103   2e-23   
ref|XP_004293097.1|  PREDICTED: uncharacterized protein LOC101292971    103   2e-23   
gb|AAS07071.1|  putative integrase, 3'-partial                          100   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364806.1|  PREDICTED: protein ROOT HAIR DEFECTIVE 3 hom...    102   3e-23   
ref|XP_008653833.1|  PREDICTED: uncharacterized protein LOC103633960    103   3e-23   
emb|CAE05536.2|  OSJNBa0053B21.10                                       102   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676069.1|  PREDICTED: uncharacterized protein LOC103652215    103   3e-23   
emb|CAN81740.1|  hypothetical protein VITISV_009674                     102   3e-23   Vitis vinifera
ref|XP_004166527.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   3e-23   
gb|AAK98731.1|AC090485_10  Putative retroelement                        103   4e-23   Oryza sativa [red rice]
emb|CAE02543.1|  OSJNBb0069N01.1                                        103   4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68389.1|  putative polyprotein                                    102   4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98227.1|  retrotransposon protein, putative, unclassified         102   4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KFK43655.1|  hypothetical protein AALP_AA1G155400                    103   4e-23   
ref|XP_010248413.1|  PREDICTED: uncharacterized protein LOC104591303    102   4e-23   
ref|XP_010501553.1|  PREDICTED: uncharacterized protein LOC104778823    102   5e-23   
ref|XP_009762104.1|  PREDICTED: uncharacterized protein LOC104214174    101   5e-23   
ref|XP_010418661.1|  PREDICTED: uncharacterized protein LOC104704240    102   5e-23   
gb|AAL82656.1|AC092387_4  retrotransposon protein, putative, uncl...    102   6e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47037.1|  retrotransposon protein, putative, unclassified, ...    102   6e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KFK35335.1|  hypothetical protein AALP_AA5G271700                    102   6e-23   
ref|XP_010513516.1|  PREDICTED: uncharacterized protein LOC104789530    101   6e-23   
ref|XP_010233012.1|  PREDICTED: uncharacterized protein LOC104583042    101   8e-23   
ref|XP_010104920.1|  Transposon Ty3-I Gag-Pol polyprotein             99.0    8e-23   
gb|AAF13073.1|AC011621_1  putative retroelement pol polyprotein         102   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216187.1|  hypothetical protein PRUPE_ppa015897mg             101   9e-23   
gb|ACL52843.1|  unknown                                               98.2    1e-22   Zea mays [maize]
ref|XP_008356102.1|  PREDICTED: uncharacterized protein LOC103419752    101   1e-22   
ref|XP_008343455.1|  PREDICTED: uncharacterized protein LOC103406229    101   1e-22   
ref|XP_007220353.1|  hypothetical protein PRUPE_ppa015255mg           99.8    1e-22   
ref|NP_001052201.1|  Os04g0191000                                       101   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAM01152.2|AC113336_4  Putative retroelement                         100   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAP44617.1|  putative polyprotein                                    100   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006575970.1|  PREDICTED: uncharacterized protein LOC100803389    101   2e-22   
ref|XP_010445386.1|  PREDICTED: uncharacterized protein LOC104728041    100   2e-22   
gb|EMT23862.1|  Alpha-L-fucosidase 2                                    100   2e-22   
emb|CAN72998.1|  hypothetical protein VITISV_043958                     100   2e-22   Vitis vinifera
emb|CCI55401.1|  PH01B015M02.2                                          100   2e-22   
ref|XP_008777107.1|  PREDICTED: uncharacterized protein LOC103697100    100   2e-22   
gb|ABA94261.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779305.1|  PREDICTED: transposon Ty3-G Gag-Pol polyprotein    100   3e-22   
ref|XP_010497069.1|  PREDICTED: uncharacterized protein LOC104774101    100   4e-22   
ref|XP_004142023.1|  PREDICTED: uncharacterized protein LOC101222087    100   4e-22   
ref|XP_004499590.1|  PREDICTED: uncharacterized protein LOC101506525  96.3    5e-22   
ref|XP_002463949.1|  hypothetical protein SORBIDRAFT_01g009436        99.8    5e-22   Sorghum bicolor [broomcorn]
ref|XP_004489081.1|  PREDICTED: uncharacterized protein LOC101488814  99.8    6e-22   
emb|CAE04958.2|  OSJNBa0070D17.9                                      96.7    6e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABN06064.1|  RNA-directed DNA polymerase (Reverse transcriptas...  99.4    7e-22   Medicago truncatula
gb|KFK39596.1|  hypothetical protein AALP_AA3G264600                  99.4    7e-22   
ref|XP_010468466.1|  PREDICTED: uncharacterized protein LOC104748542  99.8    7e-22   
gb|AAK70635.1|AC091238_13  Putative polyprotein                       99.0    8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97714.2|  retrotransposon protein, putative, unclassified       99.0    9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107707.1|  PREDICTED: uncharacterized protein LOC103833373  97.4    1e-21   
gb|AAO17006.1|  Hypothetical protein                                  96.7    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002443132.1|  hypothetical protein SORBIDRAFT_08g010830        98.6    1e-21   Sorghum bicolor [broomcorn]
emb|CAE05104.1|  OSJNBa0009K15.24                                     98.6    1e-21   Oryza sativa [red rice]
dbj|BAB02140.1|  unnamed protein product                              97.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAF71149.1|  pol protein integrase region                          91.7    2e-21   Abies alba [abete-blanco]
ref|XP_008680288.1|  PREDICTED: uncharacterized protein LOC103655285  97.1    2e-21   
ref|XP_006593038.1|  PREDICTED: uncharacterized protein LOC100791656  98.2    3e-21   
gb|AAF71197.1|  pol protein integrase region                          91.3    3e-21   Pinus brutia [Calabrian pine]
ref|XP_008382786.1|  PREDICTED: uncharacterized protein LOC103445548  97.8    3e-21   
gb|AAF71195.1|  pol protein integrase region                          91.3    3e-21   Pinus brutia [Calabrian pine]
ref|XP_008650732.1|  PREDICTED: uncharacterized protein LOC103631648  97.4    3e-21   
gb|KFK22215.1|  hypothetical protein AALP_AAs67613U000200             97.4    3e-21   
ref|XP_010930470.1|  PREDICTED: uncharacterized protein LOC105051646  95.9    5e-21   
emb|CAN71306.1|  hypothetical protein VITISV_018194                   93.6    5e-21   Vitis vinifera
pir||T18348  probable pol polyprotein, truncated - rice blast fun...  96.7    6e-21
emb|CDR00358.1|  unnamed protein product                              92.8    1e-20   
ref|XP_008456800.1|  PREDICTED: uncharacterized protein LOC103496640  95.5    1e-20   
gb|AAF71147.1|  pol protein integrase region                          89.4    2e-20   Abies alba [abete-blanco]
gb|KFK40544.1|  hypothetical protein AALP_AA2G009700                  95.5    2e-20   
ref|XP_011083470.1|  PREDICTED: uncharacterized protein LOC105165998  94.4    2e-20   
gb|AAO23078.1|  polyprotein                                           95.5    2e-20   Glycine max [soybeans]
emb|CAN83399.1|  hypothetical protein VITISV_017240                   90.9    3e-20   Vitis vinifera
ref|XP_009112589.1|  PREDICTED: uncharacterized protein LOC103837947  91.7    3e-20   
emb|CAN64356.1|  hypothetical protein VITISV_020633                   94.7    3e-20   Vitis vinifera
gb|AAX92789.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  89.4    3e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CDJ28185.1|  Retrotransposon nucleocapsid protein, related        91.3    3e-20   
gb|KGK35698.1|  hypothetical protein JL09_g5152                       92.4    5e-20   
emb|CAN80491.1|  hypothetical protein VITISV_042679                   94.4    5e-20   Vitis vinifera
ref|XP_006588232.1|  PREDICTED: uncharacterized protein LOC102668853  90.9    5e-20   
ref|XP_007044383.1|  DNA/RNA polymerases superfamily protein          94.0    6e-20   
gb|EJT50328.1|  retrotransposon nucleocapsid protein                  94.0    7e-20   
gb|KGK36096.1|  hypothetical protein JL09_g4754                       92.4    7e-20   
gb|AAV31288.1|  putative polyprotein                                  94.0    7e-20   Oryza sativa Japonica Group [Japonica rice]
gb|KFK23991.1|  hypothetical protein AALP_AAs48021U000700             93.6    7e-20   
gb|KFK23993.1|  hypothetical protein AALP_AAs48021U000700             93.6    7e-20   
dbj|BAH80071.1|  putative retrotransposon protein                     92.0    8e-20   Oryza sativa Indica Group [Indian rice]
emb|CDJ33009.1|  Retrotransposon nucleocapsid protein, related        91.3    8e-20   
ref|XP_004145488.1|  PREDICTED: uncharacterized protein LOC101209704  93.6    8e-20   
ref|XP_002443120.1|  hypothetical protein SORBIDRAFT_08g009530        93.6    8e-20   Sorghum bicolor [broomcorn]
ref|XP_002443119.1|  hypothetical protein SORBIDRAFT_08g009520        93.6    8e-20   Sorghum bicolor [broomcorn]
gb|AAF71145.1|  pol protein integrase region                          87.4    1e-19   Abies alba [abete-blanco]
gb|ABA97779.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.9    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006589833.1|  PREDICTED: uncharacterized protein LOC102662523  92.8    1e-19   
emb|CAH66134.1|  H0622G10.3                                           92.4    1e-19   Oryza sativa [red rice]
gb|KGK36429.1|  hypothetical protein JL09_g4430                       92.4    1e-19   
gb|AAM14678.1|AC097446_7  Putative polyprotein                        90.5    1e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CAH65910.1|  OSIGBa0102O13.1                                      92.8    1e-19   Oryza sativa [red rice]
gb|ABA96052.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005460658.1|  PREDICTED: uncharacterized protein LOC102082911  91.3    2e-19   
emb|CAE02080.2|  OSJNBa0074B10.8                                      90.1    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|ABG22421.1|  retrotransposon protein, putative, Ty3-gypsy subc...  92.8    2e-19   
gb|ABA97773.1|  retrotransposon protein, putative, Ty3-gypsy subc...  92.4    2e-19   
gb|AAX95203.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  92.4    2e-19   
ref|XP_004305746.1|  PREDICTED: uncharacterized protein LOC101308702  92.4    2e-19   
gb|KGK36179.1|  hypothetical protein JL09_g4670                       91.3    2e-19   
gb|ABF95989.1|  retrotransposon protein, putative, Ty3-gypsy subc...  92.4    2e-19   
gb|ABD33394.2|  FAR1; Polynucleotidyl transferase, Ribonuclease H...  91.7    2e-19   
gb|AAF71153.1|  pol protein integrase region                          86.3    2e-19   
emb|CAH67940.1|  H0211F06-OSIGBa0153M17.12                            92.0    2e-19   
ref|XP_008777132.1|  PREDICTED: uncharacterized protein LOC103697116  91.7    2e-19   
emb|CAH66282.1|  OSIGBa0116O04.4                                      92.0    2e-19   
emb|CAN82867.1|  hypothetical protein VITISV_015468                   89.0    3e-19   
emb|CAH66015.1|  OSIGBa0093M15.5                                      92.0    3e-19   
gb|KFK41015.1|  hypothetical protein AALP_AA2G074100                  92.0    3e-19   
ref|XP_007022613.1|  Uncharacterized protein TCM_033423               91.7    3e-19   
gb|ABA92233.1|  retrotransposon protein, putative, Ty3-gypsy subc...  92.0    3e-19   
emb|CAH66139.1|  H0616A11.3                                           92.0    3e-19   
gb|ABA93644.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    3e-19   
emb|CDJ29444.1|  Retrotransposon nucleocapsid protein, related        90.5    3e-19   
emb|CAH66018.1|  OSIGBa0105N24.2                                      92.0    3e-19   
emb|CAH67149.1|  OSIGBa0122F23.6                                      91.7    3e-19   
emb|CAH66749.1|  H0409D10.7                                           92.0    3e-19   
emb|CAH66048.1|  OSIGBa0131F24.2                                      91.7    3e-19   
dbj|BAH80025.1|  putative retrotransposon protein                     92.0    3e-19   
gb|AAV43974.1|  putative polyprotein                                  91.7    3e-19   
gb|AAX94879.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  90.5    4e-19   
gb|AAX96226.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  91.7    4e-19   
gb|ABA97812.1|  retrotransposon protein, putative, Ty3-gypsy subc...  91.7    4e-19   
ref|XP_007027109.1|  Uncharacterized protein TCM_021998               91.3    4e-19   
emb|CAH67706.1|  H0512B01.1                                           91.7    4e-19   
emb|CAN84168.1|  hypothetical protein VITISV_018884                   87.8    4e-19   
emb|CAH67938.1|  H0211F06-OSIGBa0153M17.10                            91.7    4e-19   
gb|AAV24823.1|  putative polyprotein                                  91.7    4e-19   
emb|CAH65890.1|  OSIGBa0096I22.3                                      89.4    4e-19   
gb|AAM01169.1|AC113336_21  Putative retroelement                      91.7    4e-19   
ref|XP_007049871.1|  Uncharacterized protein TCM_003100               89.0    4e-19   
emb|CAH66284.1|  OSIGBa0161P06.1                                      91.7    4e-19   
emb|CAH65904.1|  H0207B04.5                                           91.7    4e-19   
gb|AAM74397.1|AC119149_12  Putative retroelement                      91.7    4e-19   
gb|ABA95946.1|  retrotransposon protein, putative, unclassified       86.3    4e-19   
dbj|BAH80026.1|  putative retrotransposon protein                     91.7    4e-19   
emb|CAH65834.1|  OSIGBa0124C14.1                                      91.3    5e-19   
emb|CAH68019.1|  H0807C06-H0308C08.6                                  91.3    5e-19   
gb|AAO45752.1|  pol protein                                           90.9    5e-19   
emb|CAE02081.2|  OSJNBa0074B10.9                                      91.3    5e-19   
gb|ABF94161.1|  retrotransposon protein, putative, unclassified       91.3    5e-19   
ref|XP_007033074.1|  Uncharacterized protein TCM_019247               90.1    5e-19   
emb|CAN68499.1|  hypothetical protein VITISV_041099                   91.3    5e-19   
gb|AAM14693.1|AC097446_22  Putative polyprotein                       91.3    5e-19   
gb|ABB47119.1|  retrotransposon protein, putative, Ty3-gypsy subc...  91.3    5e-19   
ref|XP_002453806.1|  hypothetical protein SORBIDRAFT_04g018075        91.3    5e-19   
emb|CAH65748.1|  OSIGBa0102B11.2                                      90.5    5e-19   
emb|CAH66252.1|  OSIGBa0139I12.1                                      91.3    6e-19   
emb|CAE02978.3|  OSJNBa0086B14.15                                     91.3    6e-19   
emb|CAH66120.1|  OSIGBa0146N20.5                                      91.3    6e-19   
gb|AAP43915.1|  integrase                                             88.2    6e-19   
gb|AAF71196.1|  pol protein integrase region                          85.1    6e-19   
gb|AAX94824.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  90.1    6e-19   
gb|EKD04365.1|  retrotransposon nucleocapsid protein                  91.3    6e-19   
ref|XP_007049837.1|  DNA/RNA polymerases superfamily protein          90.5    6e-19   
ref|XP_007049949.1|  DNA/RNA polymerases superfamily protein          90.9    6e-19   
gb|AAM01143.1|AC108884_25  Putative retroelement                      90.9    7e-19   
ref|XP_009524309.1|  hypothetical protein PHYSODRAFT_247331           90.9    7e-19   
emb|CAE02078.2|  OSJNBa0074B10.6                                      90.9    7e-19   
emb|CDJ29491.1|  Retrotransposon nucleocapsid protein, related        87.4    7e-19   
gb|ABA94346.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.5    8e-19   
tpe|CBF82238.1|  TPA: conserved hypothetical protein                  89.7    8e-19   
gb|ABA98406.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.9    8e-19   
gb|AAF71152.1|  pol protein integrase region                          85.1    8e-19   
gb|EKV18173.1|  hypothetical protein PDIG_11210                       90.5    8e-19   
ref|XP_662857.1|  hypothetical protein AN5253.2                       89.0    8e-19   
ref|XP_008812486.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.9    8e-19   
emb|CAH66257.1|  OSIGBa0139I12.6                                      90.9    8e-19   
gb|AAP53840.2|  retrotransposon protein, putative, Ty3-gypsy subc...  90.5    8e-19   
emb|CAD41428.2|  OSJNBb0032E06.10                                     90.9    8e-19   
ref|XP_002145184.1|  retrovirus polyprotein, putative                 88.6    8e-19   
ref|XP_009145562.1|  PREDICTED: uncharacterized protein LOC103869247  90.5    9e-19   
gb|AAM74239.1|AC074355_1  Putative retroelement                       90.5    9e-19   
dbj|BAH80066.1|  putative retrotransposon protein                     90.5    9e-19   
ref|XP_003963825.1|  PREDICTED: uncharacterized protein LOC101072383  90.5    9e-19   
gb|ABA98151.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.5    9e-19   
ref|XP_010666315.1|  PREDICTED: uncharacterized protein LOC104883483  86.7    9e-19   
ref|XP_009614564.1|  PREDICTED: uncharacterized protein LOC104107452  87.0    9e-19   
emb|CAH66151.1|  OSIGBa0097I11.3                                      90.5    9e-19   
gb|AAM74253.1|AC074355_15  Putative retroelement                      90.5    9e-19   
emb|CAH67488.1|  H0306B06.3                                           90.5    9e-19   
gb|AAV32173.1|  putative polyprotein                                  90.5    9e-19   
gb|AAV25060.1|  putative polyprotein                                  90.5    1e-18   
gb|EKD00111.1|  retrotransposon nucleocapsid protein                  90.5    1e-18   
emb|CAH67814.1|  OSIGBa0138H21-OSIGBa0138E01.5                        90.5    1e-18   
gb|ABA92240.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.5    1e-18   
emb|CAE02926.1|  OSJNBb0108J11.19                                     90.5    1e-18   
gb|AAK92588.1|AC074354_22  Putative retroelement                      90.5    1e-18   
gb|AAV25059.1|  putative polyprotein                                  90.5    1e-18   
gb|AAV43973.1|  hypothetical protein                                  90.1    1e-18   
gb|AAK92543.1|AC051624_1  Putative retroelement                       90.5    1e-18   
gb|AAX96450.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  90.5    1e-18   
emb|CAD41692.1|  OSJNBb0015D13.7                                      90.5    1e-18   
gb|AAP53928.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.5    1e-18   
gb|AAD27547.1|AF111709_1  polyprotein                                 90.5    1e-18   
emb|CAH66289.1|  OSIGBa0161P06.6                                      90.5    1e-18   
emb|CAE02432.2|  OSJNBa0039G19.3                                      90.5    1e-18   
emb|CAD40170.2|  OSJNBa0061A09.9                                      90.5    1e-18   
gb|AAT77372.1|  putative polyprotein                                  90.5    1e-18   
gb|ABF95982.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.5    1e-18   
gb|ABA97250.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
gb|ABA97536.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.5    1e-18   
emb|CAE03176.2|  OSJNBa0070O11.7                                      90.1    1e-18   
gb|AAV44031.1|  putative polyprotein                                  90.1    1e-18   
gb|AAX96295.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  90.5    1e-18   
emb|CDJ29330.1|  Retrotransposon nucleocapsid protein, related        89.7    1e-18   
gb|AAM74295.1|AC083944_13  Putative retroelement                      89.0    1e-18   
emb|CAH66138.1|  H0616A11.2                                           90.1    1e-18   
emb|CAH66283.1|  OSIGBa0116O04.5                                      90.1    1e-18   
emb|CAH66190.1|  OSIGBa0144J05.2                                      90.5    1e-18   
emb|CAN73669.1|  hypothetical protein VITISV_003711                   90.1    1e-18   
emb|CAH66150.1|  OSIGBa0097I11.2                                      90.1    1e-18   
emb|CAH66206.1|  OSIGBa0096F13.1                                      90.1    1e-18   
gb|ABA98204.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
gb|AAV25053.1|  putative polyprotein                                  90.1    1e-18   
gb|ADN34141.1|  ty3-gypsy retrotransposon protein                     90.1    1e-18   
gb|ABA97516.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
gb|AAT73689.1|  putative polyprotein                                  90.1    1e-18   
gb|AAV59390.1|  hypothetical protein                                  90.1    1e-18   
gb|ABA98765.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
gb|ABA92051.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
gb|AAM08795.1|AC090486_5  Putative retroelement                       90.1    1e-18   
gb|AAN16322.1|  putative polyprotein                                  90.1    1e-18   
emb|CAD40516.1|  OSJNBa0023J03.1                                      90.1    1e-18   
emb|CAJ65878.1|  putative integrase                                   84.3    1e-18   
gb|AAX95140.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  90.1    1e-18   
gb|AAV25052.1|  putative polyprotein                                  90.1    1e-18   
gb|ABA98437.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
ref|XP_009149945.1|  PREDICTED: uncharacterized protein LOC103873274  87.0    1e-18   
gb|AAT93968.1|  putative polyprotein                                  90.1    1e-18   
emb|CAH66198.1|  OSIGBa0148D14.4                                      90.1    1e-18   
emb|CAH66117.1|  OSIGBa0146N20.2                                      90.1    1e-18   
emb|CAH66288.1|  OSIGBa0161P06.5                                      90.1    1e-18   
gb|ABA98029.2|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
emb|CAH66141.1|  H0616A11.5                                           90.1    1e-18   
gb|AAL78107.1|AC093568_17  Putative polyprotein                       90.1    1e-18   
gb|ABA94569.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    1e-18   
emb|CAH66904.1|  H0823A09.5                                           90.1    1e-18   
emb|CAH68016.1|  H0807C06-H0308C08.3                                  89.7    2e-18   
gb|ABA96803.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|AAX95471.1|  Retrotransposon gag protein, putative                 89.7    2e-18   
gb|AAV24913.1|  putative polyprotein                                  90.1    2e-18   
gb|ABG66013.1|  retrotransposon protein, putative, Ty3-gypsy subc...  90.1    2e-18   
gb|AAX95470.1|  Retrotransposon gag protein, putative                 89.7    2e-18   
gb|ABF96568.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
dbj|BAB62635.1|  putative polyprotein                                 89.7    2e-18   
gb|AAT69650.1|  putative polyprotein                                  89.7    2e-18   
ref|XP_007049935.1|  Gag protease polyprotein                         86.3    2e-18   
gb|AAX95481.1|  Integrase core domain, putative                       89.4    2e-18   
gb|ABA96940.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|ACE86410.1|  putative retroelement protein                         89.7    2e-18   
ref|NP_001067531.1|  Os11g0224300                                     87.4    2e-18   
gb|AAP53008.2|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|EKV18466.1|  hypothetical protein PDIG_07800                       89.7    2e-18   
gb|ABA95223.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
emb|CAH65747.1|  OSIGBa0102B11.1                                      89.7    2e-18   
ref|NP_001064331.1|  Os10g0317000                                     89.7    2e-18   
gb|AAX95749.1|  Retrotransposon gag protein, putative                 89.7    2e-18   
gb|AAV31273.1|  putative polyprotein                                  89.7    2e-18   
gb|ABA98207.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
emb|CAH66529.1|  H0502B11.9                                           89.7    2e-18   
gb|AAF71151.1|  pol protein integrase region                          84.0    2e-18   
gb|AAX96265.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  89.7    2e-18   
gb|AAL31078.1|AC091749_7  putative polyprotein                        89.7    2e-18   
gb|ABA98108.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.4    2e-18   
emb|CAE05578.3|  OSJNBa0032N05.6                                      89.7    2e-18   
gb|AAK13123.1|AC080019_15  Similar to Transposon MAGGYgagandpolge...  89.7    2e-18   
gb|ABA97778.2|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
ref|XP_005720569.1|  PREDICTED: uncharacterized protein LOC102214915  89.4    2e-18   
gb|AAT47081.1|  putative polyprotein                                  89.7    2e-18   
gb|ABA98232.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
emb|CAH65959.1|  OSIGBa0113D21.4                                      89.4    2e-18   
gb|ABA98580.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|AAL86492.1|AC077693_31  putative polyprotein                       89.7    2e-18   
emb|CAD40212.2|  OSJNBa0019J05.10                                     89.7    2e-18   
gb|ABA97776.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|ABA99219.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|AAM93458.1|  putative polyprotein                                  89.7    2e-18   
gb|AAL86497.1|AC099040_1  putative polyprotein                        89.7    2e-18   
emb|CAH65865.1|  OSIGBa0132I10.1                                      89.7    2e-18   
gb|AAV31385.1|  putative polyprotein                                  89.7    2e-18   
gb|AAQ56454.1|  putative polyprotein                                  89.7    2e-18   
emb|CAD40451.2|  OSJNBa0041M21.9                                      89.7    2e-18   
emb|CAD40075.1|  OSJNBa0085C10.28                                     89.7    2e-18   
gb|AAX96525.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  89.7    2e-18   
emb|CAH66687.1|  OSIGBa0097A15.2                                      89.7    2e-18   
emb|CAD40062.3|  OSJNBa0085C10.14                                     89.0    2e-18   
emb|CAE02516.2|  OSJNBb0003A12.3                                      89.7    2e-18   
gb|AAP55099.2|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|AAV43988.1|  putative polyprotein                                  89.7    2e-18   
gb|AAO73263.1|  putative gag-pol polyprotein                          89.7    2e-18   
emb|CAD40208.2|  OSJNBa0019J05.6                                      89.7    2e-18   
ref|XP_008805391.1|  PREDICTED: cysteine synthase, chloroplastic/...  85.9    2e-18   
emb|CAD40090.2|  OSJNBb0012A12.12                                     89.7    2e-18   
emb|CAE04776.3|  OSJNBb0115I21.3                                      89.7    2e-18   
gb|AAM14679.1|AC097446_8  Putative polyprotein                        89.4    2e-18   
gb|ABF96299.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|AAP52698.2|  retrotransposon protein, putative, Ty3-gypsy subc...  89.7    2e-18   
gb|AAN09852.1|  putative polyprotein                                  89.7    2e-18   
ref|XP_007049932.1|  Uncharacterized protein TCM_003206               89.0    2e-18   
gb|AAT85127.1|  putative polyprotein                                  89.4    2e-18   
gb|ABA98194.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.4    2e-18   
emb|CAE04652.2|  OSJNBa0061G20.8                                      89.4    2e-18   
gb|AAV31373.1|  putative polyprotein                                  89.7    2e-18   
emb|CAE04932.2|  OSJNBa0017P10.9                                      89.4    2e-18   
emb|CAE05093.3|  OSJNBa0009K15.13                                     89.4    2e-18   
gb|AAL83344.1|AC074282_11  Putative polyprotein                       89.4    2e-18   
gb|ABA97301.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.4    2e-18   
emb|CAH66267.1|  OSIGBa0136B09.3                                      89.4    2e-18   
gb|AAQ56285.1|  putative gag-pol protein                              88.2    2e-18   
gb|AAS98511.1|  putative polyprotein                                  89.4    2e-18   
gb|ABA99486.2|  retrotransposon protein, putative, Ty3-gypsy subc...  89.4    2e-18   
gb|ABA98266.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.4    2e-18   
emb|CAH67735.1|  H0522A01.6                                           89.4    2e-18   
gb|ABG22001.1|  retrotransposon protein, putative, Ty3-gypsy subc...  89.4    2e-18   
gb|AAN01260.1|  Putative retroelement                                 89.4    2e-18   



>gb|ABA93896.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=897

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P+QAW  VS+DFIEGLPKS+G D ILVVVD+F++YAHF+ LAHPFTA  VA 
Sbjct  537  GLLQPLPVPDQAWETVSLDFIEGLPKSSGFDCILVVVDKFSRYAHFLGLAHPFTAFDVAF  596

Query  54   LYMENVYKLHGLPQGIVS  1
            LY+ NVYKLHGLP  I+S
Sbjct  597  LYLNNVYKLHGLPLTIIS  614



>dbj|BAG90661.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96273.1| unnamed protein product [Oryza sativa Japonica Group]
Length=459

 Score =   119 bits (299),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AWV VS+DFIEGLP S G D ILVVVD+F+KYAHF++L HPFTA  VA 
Sbjct  231  GLLQPLPVPEHAWVTVSLDFIEGLPSSAGFDCILVVVDKFSKYAHFLALVHPFTAFDVAL  290

Query  54   LYMENVYKLHGLPQGIVS  1
             Y+ NVYKL+GLP  I+S
Sbjct  291  AYLNNVYKLYGLPHHIIS  308



>ref|XP_006475543.1| PREDICTED: uncharacterized protein LOC102610887 [Citrus sinensis]
Length=1274

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IPE  W  +SMDFIEGLPKS+GK +I VVVDR +KYAHFM L+HP+TA  VA 
Sbjct  964   GLLQPLPIPEHNWTDISMDFIEGLPKSSGKQIIFVVVDRLSKYAHFMPLSHPYTALDVAQ  1023

Query  54    LYMENVYKLHGLPQGIVS  1
             L+++NVYKLHGLP  IVS
Sbjct  1024  LFLDNVYKLHGLPNSIVS  1041



>gb|ACB28472.1| polyprotein [Ananas comosus]
Length=953

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPE  W ++SMDFIEGLP S GK+VI+VVVDR +KYAHF++L+HP+TA  VA 
Sbjct  765  GLLQPLPIPEGIWTEISMDFIEGLPNSQGKEVIMVVVDRLSKYAHFIALSHPYTASSVAQ  824

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++N+YKLHG+P+ IVS
Sbjct  825  LFLDNIYKLHGMPRSIVS  842



>gb|ABA97403.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=562

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL +PE AW  +SMDFIEGLPKS+ KDVI V+VDRFTKYAHF++L+HPFTA+++  
Sbjct  364  GLLHPLPVPEMAWTHISMDFIEGLPKSDNKDVIWVIVDRFTKYAHFVALSHPFTADQIVT  423

Query  54   LYMENVYKLHGLPQGIVS  1
             ++EN YK HGLP  IVS
Sbjct  424  QFVENYYKHHGLPAVIVS  441



>emb|CAE05990.1| OSJNBa0004L19.22 [Oryza sativa Japonica Group]
Length=1586

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+ AW  ++MDF+EGLPKSNGKDVILVVVDR TKYAHF+++AHP+T E+V  
Sbjct  1226  GLLDPLEVPDMAWAHITMDFVEGLPKSNGKDVILVVVDRLTKYAHFIAMAHPYTVEQVVE  1285

Query  54    LYMENVYKLHGLPQGIVS  1
             L+M N+++LHG+P  I++
Sbjct  1286  LFMNNIHRLHGMPMAIIT  1303



>gb|EEE65753.1| hypothetical protein OsJ_21419 [Oryza sativa Japonica Group]
Length=645

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AW  ++MDF+EGLPKS GKDVI V+VDRFTKYAHF+ L+HPFTA+++  
Sbjct  285  GLLQPLPLPEMAWSHITMDFVEGLPKSEGKDVIWVIVDRFTKYAHFIPLSHPFTADQILT  344

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E+ YKLHGLP  IVS
Sbjct  345  QFLEHFYKLHGLPTVIVS  362



>emb|CAH67280.1| OSIGBa0111L12.7 [Oryza sativa Indica Group]
Length=940

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P+ AW  +SMDFIEGLP+SN +D ILVVVD+F+KYAHFM+L+HPF+A  VA 
Sbjct  781  GLLQPLPVPDGAWQIISMDFIEGLPRSNKQDCILVVVDKFSKYAHFMTLSHPFSAMDVAK  840

Query  54   LYMENVYKLHGLPQGIVS  1
            ++M NVY+LHGLPQ I+S
Sbjct  841  VFMLNVYELHGLPQAIIS  858



>gb|ABA98724.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1269

 Score =   120 bits (300),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            G LQPL +PE AW  VS+DFIEGLP S+G D ILVVVD+F+KYAHF++LAHPFTA  VA 
Sbjct  863  GFLQPLPVPEHAWQTVSLDFIEGLPSSSGFDCILVVVDKFSKYAHFVALAHPFTAFDVAL  922

Query  54   LYMENVYKLHGLPQGIVS  1
             Y+ NVYK+HGLPQ ++S
Sbjct  923  AYLNNVYKMHGLPQHLIS  940



>gb|ABA95319.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=955

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL +P+ AW  +SMDF+EGLPKS GKDVILVVVDR TKYAHF++L+HP+T E+V  
Sbjct  595  GLLNPLEVPDMAWTHISMDFVEGLPKSKGKDVILVVVDRLTKYAHFIALSHPYTVEEVVQ  654

Query  54   LYMENVYKLHGLPQGIVS  1
            ++M+N++KLHG+P  IV+
Sbjct  655  VFMDNIHKLHGMPIAIVT  672



>gb|AAP68381.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF98230.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1118

 Score =   119 bits (299),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AW  VS+DFIEGLP S G + ILVVVD+F++YAHF++LAHPFTA  VA 
Sbjct  745  GLLQPLPVPEHAWQVVSLDFIEGLPLSLGFNCILVVVDKFSRYAHFIALAHPFTAFDVAL  804

Query  54   LYMENVYKLHGLPQGIVS  1
             YM+NVYKLHGLPQ ++S
Sbjct  805  AYMQNVYKLHGLPQSMIS  822



>ref|NP_001057680.2| Os06g0493000 [Oryza sativa Japonica Group]
 dbj|BAF19594.2| Os06g0493000 [Oryza sativa Japonica Group]
Length=866

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AW  ++MDF+EGLPKS GKDVI V+VDRFTKYAHF+ L+HPFTA+++  
Sbjct  506  GLLQPLPLPEMAWSHITMDFVEGLPKSEGKDVIWVIVDRFTKYAHFIPLSHPFTADQILT  565

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E+ YKLHGLP  IVS
Sbjct  566  QFLEHFYKLHGLPTVIVS  583



>dbj|BAH00815.1| unnamed protein product [Oryza sativa Japonica Group]
Length=371

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AW  +SMDFIEGLP+S   D ILV+VD+F+KYAHF+ L+HP+TA  VA 
Sbjct  54   GLLQPLPVPEGAWQIISMDFIEGLPRSFRYDCILVIVDKFSKYAHFLPLSHPYTAIDVAK  113

Query  54   LYMENVYKLHGLPQGIVS  1
            L+M NVYKLHGLPQ I+S
Sbjct  114  LFMVNVYKLHGLPQTIIS  131



>gb|AAP53789.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1611

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+ AW  ++MDFIEGLPKS GKDVILVVVDR TKYAHF++L+HP+T E+V  
Sbjct  1251  GLLNPLEVPDMAWTHITMDFIEGLPKSQGKDVILVVVDRLTKYAHFLALSHPYTVEQVVQ  1310

Query  54    LYMENVYKLHGLPQGIVS  1
             ++M+N++KLHG+P  IV+
Sbjct  1311  IFMDNIHKLHGMPMVIVT  1328



>ref|XP_011075658.1| PREDICTED: uncharacterized protein LOC105160092 [Sesamum indicum]
Length=1216

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PEQAW  VSMDFIEGLP S+GKD ILVVVDR  KY+HF++L HP+TA  +A 
Sbjct  1022  GLLQPLPVPEQAWSCVSMDFIEGLPNSDGKDSILVVVDRLPKYSHFLALKHPYTATSIAK  1081

Query  54    LYMENVYKLHGLPQGIVS  1
             ++ +N+YKLHGLP  I+S
Sbjct  1082  VFFDNIYKLHGLPISIIS  1099



>emb|CAE03590.1| OSJNBa0087O24.13 [Oryza sativa Japonica Group]
Length=1311

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL IPE AW  +SMDFIEGLPKS+ KDVI V+VDRFTKYAHF++L+HPFTA+++  
Sbjct  951   GLLHPLPIPEMAWTHISMDFIEGLPKSDNKDVIWVIVDRFTKYAHFVALSHPFTADQIVT  1010

Query  54    LYMENVYKLHGLPQGIVS  1
              ++EN YK HGLP  IVS
Sbjct  1011  QFVENYYKHHGLPAVIVS  1028



>gb|AAK55448.1|AC069300_3 putative polyprotein [Oryza sativa Japonica Group]
 gb|AAP54986.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1409

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+ AW  ++MDFIEGLPKS GKDVILVVVDR TKYAHF++L HP++ E+V  
Sbjct  1147  GLLNPLEVPDMAWTHITMDFIEGLPKSKGKDVILVVVDRLTKYAHFLALTHPYSVEQVVE  1206

Query  54    LYMENVYKLHGLPQGIVS  1
             ++M+N++KLHG+P  I++
Sbjct  1207  VFMDNIHKLHGMPMAIIT  1224



>ref|XP_008657558.1| PREDICTED: uncharacterized protein LOC103637066 [Zea mays]
Length=888

 Score =   117 bits (294),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL +P  AW  +SMDFIEGLPKS   D ILVVVDRF+KY HF++L+HPFTA KVA 
Sbjct  476  GLLAPLPVPPHAWHSISMDFIEGLPKSGAADCILVVVDRFSKYGHFLALSHPFTAPKVAK  535

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ VY+LHG+P  IVS
Sbjct  536  LFLDQVYRLHGMPDNIVS  553



>emb|CAH66499.1| H0321H01.8 [Oryza sativa Indica Group]
Length=1602

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PE +W  VS+DFIEGLPKS G + ILVVVDRF+KYAHF++L HPFTA  VA 
Sbjct  1164  GLLQPLPVPEGSWQAVSLDFIEGLPKSAGYNCILVVVDRFSKYAHFVALKHPFTAIDVAQ  1223

Query  54    LYMENVYKLHGLPQGIVS  1
              YM ++YKLHGLPQ IVS
Sbjct  1224  AYMFHIYKLHGLPQTIVS  1241



>gb|ADB85290.1| putative retrotransposon protein [Phyllostachys edulis]
Length=592

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQP+ IPE AW  +SMDFIEGLPKS  K+VILVVVDRFTKY+HF++L+HPFT + V  
Sbjct  361  GLLQPIPIPEMAWTHISMDFIEGLPKSEDKEVILVVVDRFTKYSHFIALSHPFTVQHVVK  420

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++NV+K HGLP  I++
Sbjct  421  VFVDNVFKHHGLPSVIIT  438



>emb|CAJ65868.1| putative integrase [Cucumis melo]
Length=134

 Score =   108 bits (269),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPLSIP + W  +SMDF+EGLP+S G D ILVVVDR +KYAHF++L HPF+A+ VA 
Sbjct  28   GLLQPLSIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL  87

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  88   VFVKEVVRLHGYPRSIVS  105



>gb|AAL68644.1|AF458768_1 polyprotein [Oryza sativa Japonica Group]
Length=933

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P+ AW  +SMDFIEGLPKS  +D ILVVVD+F+KYAHFM L+HPF+A  VA 
Sbjct  520  GLLQPLPVPDGAWQIISMDFIEGLPKSYHQDCILVVVDKFSKYAHFMPLSHPFSALDVAK  579

Query  54   LYMENVYKLHGLPQGIVS  1
            ++M NVYKLHGLPQ I+S
Sbjct  580  VFMLNVYKLHGLPQIIIS  597



>gb|AAV24812.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1475

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL IP+ AW  ++MDFIEGLPKS GKDVILVVVDR TKYAHF++LAHP+  E+V  
Sbjct  1115  GLLNPLEIPDMAWTHITMDFIEGLPKSQGKDVILVVVDRLTKYAHFIALAHPYDVEQVVE  1174

Query  54    LYMENVYKLHGLPQGIVS  1
              +M N++KLHG+P  I++
Sbjct  1175  AFMNNIHKLHGMPMVIIT  1192



>dbj|BAH00063.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score =   113 bits (282),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            G LQPL +P+Q W  VS+DFIEGLP+S   + ILVVVD+F+KYAHF++LAHPFTA +VA 
Sbjct  254  GFLQPLPVPDQYWQVVSLDFIEGLPRSASFNCILVVVDKFSKYAHFVALAHPFTALEVAE  313

Query  54   LYMENVYKLHGLPQGIVS  1
             Y++N+++LHGLPQ I+S
Sbjct  314  SYVQNIHRLHGLPQVIIS  331



>ref|XP_010681945.1| PREDICTED: uncharacterized protein K02A2.6-like [Beta vulgaris 
subsp. vulgaris]
Length=993

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   WV +SMDFI GLPKS GK+VILVVVDR +KY HF++L HP+TA +VA 
Sbjct  678  GLLQPLPIPTVVWVDISMDFITGLPKSQGKEVILVVVDRLSKYGHFLALKHPYTAMEVAQ  737

Query  54   LYMENVYKLHGLPQGIVS  1
            +Y+++V+KLHG PQ IVS
Sbjct  738  VYLDSVFKLHGWPQSIVS  755



>gb|AAL76001.1|AF466646_9 putative gag-pol polyprotein [Zea mays]
Length=2396

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P QAW  +S+DFIEGLP+S   + ILVVVD+F+KY HF+ L HPFTA KVA 
Sbjct  1182  GLLQPLEVPPQAWHTISLDFIEGLPRSAHYNCILVVVDKFSKYGHFLPLLHPFTAAKVAR  1241

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++NVYKLHGLP  I+S
Sbjct  1242  VFLDNVYKLHGLPVNIIS  1259



>gb|ABA95339.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1348

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PE AW  ++MDF+EGLPKS   + ILVVVD+F+KYAHF+ L HPFTAE VA 
Sbjct  946   GLLQPLPVPEGAWQTITMDFLEGLPKSERYNCILVVVDKFSKYAHFVPLTHPFTAETVAT  1005

Query  54    LYMENVYKLHGLPQGIVS  1
              +M+N+YKLHG+P+ IVS
Sbjct  1006  AFMKNIYKLHGMPRVIVS  1023



>gb|AAX95101.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA91669.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1314

 Score =   115 bits (287),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            G LQPL +PE AW  VS+DFIEGLP S+  D ++VVVD+F+KYAHF++LAHPF+A  VA 
Sbjct  793  GFLQPLPVPEHAWQMVSLDFIEGLPVSSRFDCVMVVVDKFSKYAHFVALAHPFSAFDVAQ  852

Query  54   LYMENVYKLHGLPQGIVS  1
             Y+ N+YKLHGLPQ ++S
Sbjct  853  AYLTNIYKLHGLPQSLIS  870



>gb|AAL82521.1|AC084766_7 putative polyprotein [Oryza sativa Japonica Group]
Length=408

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP++AWV +SMDFIEGLPKS+G  VILVVVDRFTK+AHF+ L HPFTA +VAN
Sbjct  130  GLLTPLPIPKEAWVDISMDFIEGLPKSDGFTVILVVVDRFTKFAHFIPLRHPFTASQVAN  189

Query  54   LYMENVYKLHGLPQGI  7
               + V+K HG+P  I
Sbjct  190  AVDKTVFKTHGIPHSI  205



>emb|CAJ65867.1| putative integrase [Cucumis melo]
Length=134

 Score =   106 bits (264),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PLSIP + W  +SMDF+EGLP+S G D ILVVVDR +KYAHF++L HPF+A+ VA 
Sbjct  28   GLLHPLSIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL  87

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  88   VFVKEVVRLHGYPRSIVS  105



>ref|XP_004296329.1| PREDICTED: uncharacterized protein LOC101295505 [Fragaria vesca 
subsp. vesca]
Length=2814

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPLSIPE+AW ++SMDFI+GLPKS GK  + V+VD+ TKYAHF+ LAHP+TA  +A 
Sbjct  1772  GLLQPLSIPERAWSEISMDFIDGLPKSEGKTTVWVIVDKLTKYAHFIPLAHPYTAATLAQ  1831

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ ++KLHG+P  I+S
Sbjct  1832  IFVKEIFKLHGMPDNIIS  1849



>gb|KDP42549.1| hypothetical protein JCGZ_24323 [Jatropha curcas]
Length=182

 Score =   107 bits (268),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   W  +S+DFI GLPKSNG D ++VVVDR +KYAHF+ L HPFTA+KVA 
Sbjct  104  GLLQPLPIPSLIWADISLDFITGLPKSNGFDCLMVVVDRLSKYAHFIPLRHPFTAKKVAA  163

Query  54   LYMENVYKLHGLPQGIVS  1
            ++   + +LHGLP  I+S
Sbjct  164  IFANEIIRLHGLPHSIIS  181



>emb|CAJ65870.1| putative integrase [Cucumis melo]
Length=134

 Score =   106 bits (264),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  +SMDF+EGLP+S G D ILVVVDR +KYAHF++L HPF+A+ VA 
Sbjct  28   GLLQPLPIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL  87

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  88   VFIKEVVRLHGYPRSIVS  105



>ref|XP_010248242.1| PREDICTED: uncharacterized protein LOC104591153 [Nelumbo nucifera]
Length=462

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPEQ W  +SMDFI GLP+S GK+VI+VVVDR TKY+HF +L HP+TA  VA+
Sbjct  345  GLLQPLKIPEQVWEDLSMDFITGLPRSAGKEVIMVVVDRLTKYSHFSALPHPYTAAMVAD  404

Query  54   LYMENVYKLHGLPQGIVS  1
            +++ ++ KLHG P+ IVS
Sbjct  405  IFIRDMAKLHGTPRSIVS  422



>emb|CAJ65875.1| putative integrase [Cucumis melo]
Length=134

 Score =   106 bits (264),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  +SMDF+EGLP+S G D ILVVVDR +KYAHF++L HPF+A+ VA 
Sbjct  28   GLLQPLPIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL  87

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  88   VFVKEVVRLHGYPRSIVS  105



>emb|CAJ65876.1| putative integrase [Cucumis melo]
Length=134

 Score =   105 bits (263),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  +SMDF+EGLP+S G D ILVVVDR +KYAHF++L HPF+A+ VA 
Sbjct  28   GLLQPLPIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL  87

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  88   VFVKEVVRLHGYPRSIVS  105



>gb|ABG22014.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1422

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL+IP+ AW  ++MDFIE LP S GKDVILVVVDR TKYAHF++L+HP+T E+V  
Sbjct  1094  GLLDPLAIPDMAWSHITMDFIERLPISRGKDVILVVVDRLTKYAHFLALSHPYTVEQVVE  1153

Query  54    LYMENVYKLHGLPQGIVS  1
             ++M N++KLHG+P  I++
Sbjct  1154  VFMNNIHKLHGMPTAIIT  1171


 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKV  61
             GLL PL+IP+ AW  ++MDFIEGLP S GKDVILV+VDR TKYAHF++L+HP+T E+V
Sbjct  1018  GLLDPLAIPDMAWSHITMDFIEGLPVSRGKDVILVMVDRLTKYAHFLALSHPYTVEQV  1075



>ref|XP_008652480.1| PREDICTED: transposon Tf2-1 polyprotein isoform X1 [Zea mays]
 ref|XP_008652482.1| PREDICTED: transposon Tf2-1 polyprotein isoform X1 [Zea mays]
Length=1567

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP+ +W  +SMDFIEGLPKSNG  VILVVVDR TKYAHF+++ HPFTA  +A+
Sbjct  1180  GLLQPLPIPQSSWQDLSMDFIEGLPKSNGYSVILVVVDRLTKYAHFLAVKHPFTASHIAH  1239

Query  54    LYMENVYKLHGLPQGIVS  1
             L+   V KLHG P  IVS
Sbjct  1240  LFFSQVVKLHGFPHTIVS  1257



>gb|KFK40793.1| hypothetical protein AALP_AA2G041700 [Arabis alpina]
Length=271

 Score =   108 bits (271),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP+Q W  +SMDF+EGLPKS G DV++VVVDR TKYAHF+ ++HP+ A +VA 
Sbjct  27   GLLQPLPIPKQVWEDISMDFMEGLPKSEGFDVVMVVVDRLTKYAHFIKMSHPYEAAEVAL  86

Query  54   LYMENVYKLHGLPQGIVS  1
             +++ V +LHG P+ IVS
Sbjct  87   TFIKEVVRLHGYPRTIVS  104



>emb|CAH67116.1| H0502G05.7 [Oryza sativa Indica Group]
Length=642

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AW  +S+DFIEGLP+S+  + ILVVVD+F+KYAHF+ L+HPFTA  VA 
Sbjct  199  GLLQPLPVPEGAWQVISLDFIEGLPRSDHSNCILVVVDKFSKYAHFLPLSHPFTALSVAK  258

Query  54   LYMENVYKLHGLPQGIVS  1
            L+M++++KLHGLP  I+S
Sbjct  259  LFMKHIFKLHGLPLVIIS  276



>dbj|BAG72147.1| hypothetical protein [Lotus japonicus]
 dbj|BAG72149.1| hypothetical protein [Lotus japonicus]
Length=1520

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G LQPL IP Q W  +SMDFI GLPK+ GKD ILVVVDRFTKYAHF++L+HP+ A+++A 
Sbjct  1123  GFLQPLPIPSQGWTDISMDFIGGLPKAMGKDTILVVVDRFTKYAHFIALSHPYNAKEIAE  1182

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V KLHG P  IVS
Sbjct  1183  VFIKEVVKLHGFPTSIVS  1200



>emb|CAN63307.1| hypothetical protein VITISV_010204 [Vitis vinifera]
Length=248

 Score =   107 bits (268),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPLSIP Q W  +SMDFIEG+P SNG  VI+VV+DR +KYAHF+ L HP TA  VA 
Sbjct  113  GLLQPLSIPTQIWSNISMDFIEGMPTSNGHSVIMVVMDRLSKYAHFIPLKHPSTAVSVAK  172

Query  54   LYMENVYKLHGLPQGIVS  1
             ++ NV +LHG+P  IVS
Sbjct  173  AFVSNVVRLHGIPTSIVS  190



>ref|XP_006584316.1| PREDICTED: uncharacterized protein LOC102665925 [Glycine max]
Length=434

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P QAW  ++MDFI GLPKSNGK +ILVV+DR+TKYAHF++L HP  A K+A 
Sbjct  105  GLLQPLPVPTQAWQCLAMDFIVGLPKSNGKTIILVVIDRYTKYAHFVALRHPINAAKIAQ  164

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ + KLHG P  IVS
Sbjct  165  VFIDTIVKLHGWPSEIVS  182



>gb|AAG13430.1|AC051634_11 putative plant disease resistance polyprotein [Oryza sativa Japonica 
Group]
Length=921

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP++AW  +SMDFIEGLP+S+G + ILVVVDRFTKYA+F+ L HPFTA +VA+
Sbjct  538  GLLAPLPIPKEAWQDISMDFIEGLPRSDGYNAILVVVDRFTKYANFIPLCHPFTASQVAH  597

Query  54   LYMENVYKLHGLPQGIVS  1
            L  + V+K HG+P+ IVS
Sbjct  598  LVDKTVFKTHGIPRSIVS  615



>gb|ABD78329.1| polyprotein [Primula vulgaris]
Length=383

 Score =   109 bits (272),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PEQ W ++SMDFI GLP S   + I VVVDR TKYAHF+ L HPF A+++AN
Sbjct  52   GLLQPLPMPEQTWSEISMDFINGLPTSKNYNCIWVVVDRLTKYAHFIPLKHPFGAKELAN  111

Query  54   LYMENVYKLHGLPQGIVS  1
             +++N++KLHGLP+ I+S
Sbjct  112  EFLQNIFKLHGLPKKIIS  129



>gb|ACE86397.1| putative retroelement protein [Sorghum bicolor]
Length=732

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P Q W  +SMDFI+ LPK +GK VIL VVDRF+KYAHF++L+HP+TA  VA 
Sbjct  404  GLLQPLDVPSQVWADISMDFIDALPKVHGKSVILTVVDRFSKYAHFIALSHPYTAASVAR  463

Query  54   LYMENVYKLHGLPQGIVS  1
             + E + +LHG P  IVS
Sbjct  464  AFFEGIVRLHGFPTSIVS  481



>gb|AAP54937.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1477

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P+ AW  +SMDFIEGLP S+  + ILVVVD+F+KYAHF+ L HPFTA  VA 
Sbjct  1137  GLLQPLPVPKGAWQVISMDFIEGLPTSDKYNCILVVVDKFSKYAHFLPLTHPFTAFSVAT  1196

Query  54    LYMENVYKLHGLPQGIVS  1
             ++M+NVYKLHG+PQ I+S
Sbjct  1197  VFMKNVYKLHGMPQVIIS  1214



>ref|XP_009775498.1| PREDICTED: uncharacterized protein LOC104225416 [Nicotiana sylvestris]
Length=399

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQP+ IP+QAW  +SMDFIEGLPKS+GKDVI VVVDR TK AHFM+LA+PFT+ +VAN 
Sbjct  208  LLQPIHIPDQAWRHISMDFIEGLPKSHGKDVIFVVVDRLTKSAHFMALAYPFTSLEVANK  267

Query  51   YMENVYKLHGLPQGIV  4
            + + V+ LH  P+ IV
Sbjct  268  FWKRVHTLHSSPETIV  283



>gb|ABA99961.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1619

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G+LQPL +PEQ+W  VS+DFIEGLP+S+  + ILVVVD+F+KYAHF++LAHPFT  +VA 
Sbjct  1202  GMLQPLPVPEQSWQIVSLDFIEGLPRSSTFNCILVVVDKFSKYAHFVALAHPFTTLEVAE  1261

Query  54    LYMENVYKLHGLPQGIVS  1
              YM+++++LHGLP+ I+S
Sbjct  1262  AYMQHIHRLHGLPEAIIS  1279



>dbj|BAG72151.1| hypothetical protein [Lotus japonicus]
Length=1558

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G LQPL IP Q W  +SMDFI GLPK+ GKD ILVVVDRFTKYAHF++L+HP+ A+++A 
Sbjct  1161  GFLQPLPIPSQGWTDISMDFIGGLPKTMGKDTILVVVDRFTKYAHFIALSHPYNAKEIAE  1220

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V +LHG P  IVS
Sbjct  1221  VFIKEVVRLHGFPTSIVS  1238



>dbj|BAG72152.1| hypothetical protein [Lotus japonicus]
Length=1369

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G LQPL IP Q W  +SMDFI GLPK+ GKD ILVVVDRFTKYAHF++L+HP+ A+++A 
Sbjct  972   GFLQPLPIPSQGWTDISMDFIGGLPKAMGKDTILVVVDRFTKYAHFIALSHPYNAKEIAE  1031

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V +LHG P  IVS
Sbjct  1032  VFIKEVVRLHGFPTSIVS  1049



>dbj|BAG72150.1| hypothetical protein [Lotus japonicus]
Length=1558

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G LQPL IP Q W  +SMDFI GLPK+ GKD ILVVVDRFTKYAHF++L+HP+ A+++A 
Sbjct  1161  GFLQPLPIPSQGWTDISMDFIGGLPKAMGKDTILVVVDRFTKYAHFIALSHPYNAKEIAE  1220

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V +LHG P  IVS
Sbjct  1221  VFIKEVVRLHGFPTSIVS  1238



>ref|XP_010533307.1| PREDICTED: uncharacterized protein LOC104809111 [Tarenaya hassleriana]
Length=1195

 Score =   112 bits (279),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P+Q W  +S+DFIEGLPKS+G +VILVVVDR +KYAHF++L HPF+A +VA 
Sbjct  907  GLLQPLPVPQQVWEDISLDFIEGLPKSSGCNVILVVVDRLSKYAHFLALRHPFSALEVAR  966

Query  54   LYMENVYKLHGLPQGIVS  1
             +++++ +LHG P+ IVS
Sbjct  967  AFVKDIVRLHGFPKSIVS  984



>dbj|BAG72154.1| hypothetical protein [Lotus japonicus]
Length=1558

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G LQPL IP Q W  +SMDFI GLPK+ GKD ILVVVDRFTKYAHF++L+HP+ A+++A 
Sbjct  1161  GFLQPLPIPSQGWTDISMDFIGGLPKAMGKDTILVVVDRFTKYAHFIALSHPYNAKEIAE  1220

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V +LHG P  IVS
Sbjct  1221  VFIKEVVRLHGFPTSIVS  1238



>emb|CAE04934.2| OSJNBa0017P10.11 [Oryza sativa Japonica Group]
Length=1012

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AW  VS+DFIEGLPKS+G + ILVVVD+F+KYAHF+ L HPFT   VA 
Sbjct  576  GLLQPLPVPEGAWQVVSLDFIEGLPKSHGFNCILVVVDKFSKYAHFIPLYHPFTTASVAQ  635

Query  54   LYMENVYKLHGLPQGIVS  1
             +M +VYKLHGLP+ I+S
Sbjct  636  EFMTHVYKLHGLPRTIIS  653



>dbj|BAG72148.1| hypothetical protein [Lotus japonicus]
 dbj|BAG72153.1| hypothetical protein [Lotus japonicus]
Length=1558

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G LQPL IP Q W  +SMDFI GLPK+ GKD ILVVVDRFTKYAHF++L+HP+ A+++A 
Sbjct  1161  GFLQPLPIPSQGWTDISMDFIGGLPKAMGKDTILVVVDRFTKYAHFIALSHPYNAKEIAE  1220

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V +LHG P  IVS
Sbjct  1221  VFIKEVVRLHGFPTSIVS  1238



>emb|CAJ65869.1| putative integrase [Cucumis melo]
Length=134

 Score =   104 bits (259),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  +SMDF+EGLP S G D ILVVVDR +KYAHF++L HPF+A+ VA 
Sbjct  28   GLLQPLPIPNRIWEDISMDFVEGLPCSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL  87

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  88   VFVKEVVRLHGYPRSIVS  105



>gb|KFK22868.1| hypothetical protein AALP_AAs42979U000100, partial [Arabis alpina]
Length=1309

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPLSIPEQ W  +S+DF+EGLPKS G +V++VVVDR TKYAHF+S+ HPFTA  VA 
Sbjct  942   GLLQPLSIPEQVWEDISLDFVEGLPKSEGFEVVMVVVDRLTKYAHFISMKHPFTAADVAL  1001

Query  54    LYMENVYKLHGLPQGIVS  1
              ++  V +LHG P+ IVS
Sbjct  1002  TFITEVVRLHGFPKTIVS  1019



>ref|XP_007208605.1| hypothetical protein PRUPE_ppa022027mg, partial [Prunus persica]
 gb|EMJ09804.1| hypothetical protein PRUPE_ppa022027mg, partial [Prunus persica]
Length=497

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP  +W  +S DFIEGLP S GK VI+VVVDR TKYAHF  LAHPF+A+ +A 
Sbjct  222  GLLQPLPIPAASWQSISTDFIEGLPHSKGKSVIMVVVDRLTKYAHFTVLAHPFSAKNIAA  281

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V+KL GLPQ I+S
Sbjct  282  VFIQEVFKLRGLPQSIIS  299



>gb|ABA97970.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1548

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP  AW  +SMDFIEGLP S G DVILVVVDRFTKYAHF+ L HPFTA +VA+
Sbjct  1162  GLLQPLPIPTGAWQDISMDFIEGLPLSKGSDVILVVVDRFTKYAHFLPLKHPFTAVQVAD  1221

Query  54    LYMENVYKLHGLPQGIVS  1
              Y+  V  L+G+P+ IVS
Sbjct  1222  NYLSKVASLYGMPKSIVS  1239



>gb|AAL75999.1|AF466646_7 putative polyprotein [Zea mays]
Length=2749

 Score =   112 bits (279),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P Q W  +SMDFIEGLPK  GK VIL VVDRF+KYAHF+ L HP+TA  VA 
Sbjct  1482  GLLQPLQVPSQVWADISMDFIEGLPKVGGKSVILTVVDRFSKYAHFIPLGHPYTAASVAR  1541

Query  54    LYMENVYKLHGLPQGIVS  1
              + + + +LHG P  IVS
Sbjct  1542  AFFDGIVRLHGFPSSIVS  1559



>emb|CAJ65877.1| putative integrase [Cucumis melo]
Length=134

 Score =   103 bits (258),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  +SMDF+E LP+S G D ILVVVDR +KYAHF++L HPF+A+ VA 
Sbjct  28   GLLQPLPIPNRIWEDISMDFVESLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL  87

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  88   VFIKEVVRLHGYPRSIVS  105



>ref|XP_010097264.1| Transposon Ty3-I Gag-Pol polyprotein [Morus notabilis]
 gb|EXB67331.1| Transposon Ty3-I Gag-Pol polyprotein [Morus notabilis]
Length=439

 Score =   108 bits (270),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP+  W  VSM+F+ GLPKS G D ILVVVDR +KYAHF  LAHP+ A++VA 
Sbjct  58   GLLQPLPIPDLVWDDVSMNFVGGLPKSGGFDTILVVVDRLSKYAHFCPLAHPYAAKQVAA  117

Query  54   LYMENVYKLHGLPQGIVS  1
            L++ ++ KLHG+P+ IVS
Sbjct  118  LFVSHIVKLHGVPRSIVS  135



>ref|XP_010412474.1| PREDICTED: uncharacterized protein K02A2.6-like [Camelina sativa]
Length=314

 Score =   107 bits (268),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            G LQPL IPE+ W  +SMDF+EGLPKS G + ILVVVDR +KY HF+ L  PFTA  VAN
Sbjct  49   GHLQPLPIPEKIWEDLSMDFVEGLPKSGGNNAILVVVDRLSKYTHFLRLKQPFTAADVAN  108

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ + K+HG PQ IVS
Sbjct  109  LFVQEIIKIHGFPQSIVS  126



>ref|XP_008671739.1| PREDICTED: uncharacterized protein LOC103649194 [Zea mays]
Length=968

 Score =   111 bits (277),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P  AW  V+MDF+EGLP S  K+ ++VVVD+F+K++HF++L HPFTA  VA 
Sbjct  599  GLLQPLPVPSGAWQTVTMDFVEGLPLSGAKNCVMVVVDKFSKFSHFIALQHPFTAMTVAK  658

Query  54   LYMENVYKLHGLPQGIVS  1
             +M+NVYKLHG+P  IVS
Sbjct  659  AFMQNVYKLHGMPVAIVS  676



>gb|ABA95357.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2811

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P Q+W  ++MDFIEGLPKS   D ILV+VD+F+K+AHF+ L HPFTA  VA 
Sbjct  2402  GLLQPLEVPSQSWQVITMDFIEGLPKSASFDCILVIVDKFSKFAHFLPLKHPFTAFGVAQ  2461

Query  54    LYMENVYKLHGLPQGIVS  1
             L+ME+++ +HGLPQ IVS
Sbjct  2462  LFMEHIHSIHGLPQAIVS  2479



>gb|ABF96573.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1481

 Score =   111 bits (278),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL IP++AW  +SMDFIEGLP+S+G + ILVVVDRFTKYA+F+ L HPFTA +VA+
Sbjct  1113  GLLAPLPIPKEAWQDISMDFIEGLPRSDGYNAILVVVDRFTKYANFIPLRHPFTASQVAH  1172

Query  54    LYMENVYKLHGLPQGIVS  1
             L  + V+K HG+P+ IVS
Sbjct  1173  LVDKTVFKTHGIPRSIVS  1190



>gb|AAD24647.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=780

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP++ W  VSMDFI+GLP SNGK VI+VVVDR +K AHF++LAHP++A  VA 
Sbjct  532  GLLQPLPIPDRIWSDVSMDFIDGLPLSNGKTVIMVVVDRLSKAAHFIALAHPYSAMTVAQ  591

Query  54   LYMENVYKLHGLPQGIV  4
             Y++NV+KLHG P  IV
Sbjct  592  AYLDNVFKLHGCPSSIV  608



>gb|AAP54661.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=760

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP++AW  +SMDFIEGLP+S+G + ILVVVDRFTKYA+F+ L HPFTA +VA+
Sbjct  377  GLLAPLPIPKEAWQDISMDFIEGLPRSDGYNAILVVVDRFTKYANFIPLCHPFTASQVAH  436

Query  54   LYMENVYKLHGLPQGIVS  1
            L  + V+K HG+P+ IVS
Sbjct  437  LVDKTVFKTHGIPRSIVS  454



>ref|XP_004301249.1| PREDICTED: genome polyprotein-like [Fragaria vesca subsp. vesca]
Length=449

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQP++IP++AW  ++MDFIEGLPKS GK VI VVVD+ TK AHF+ L+HP+TA  +AN
Sbjct  247  GLLQPINIPDKAWSVITMDFIEGLPKSQGKTVIWVVVDKLTKVAHFILLSHPYTAASLAN  306

Query  54   LYMENVYKLHGLPQGIVS  1
            +++  V++LHG+P  I+S
Sbjct  307  VFVSEVFRLHGMPDAIIS  324



>ref|XP_008671115.1| PREDICTED: uncharacterized protein LOC103648418 [Zea mays]
Length=1853

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL IP+ AW  ++MDFIE LP+S G D ILVVVDRFTKYAHF++L HPFTA +VA 
Sbjct  1244  GLLHPLPIPQGAWQDITMDFIEKLPQSGGCDTILVVVDRFTKYAHFIALKHPFTASQVAQ  1303

Query  54    LYMENVYKLHGLPQGIVS  1
             + ++ V +LHGLP+ IVS
Sbjct  1304  VILDQVVRLHGLPKSIVS  1321



>gb|AAS55774.2| putative polyprotein [Oryza sativa Japonica Group]
Length=2108

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQP+ IPE AW  +SMDFIEGLP+S   + ILV+VD+FTK+AHF+ L+HPFTA  VA 
Sbjct  1813  GLLQPVQIPEHAWQVISMDFIEGLPRSASYNSILVIVDKFTKFAHFLPLSHPFTAVSVAQ  1872

Query  54    LYMENVYKLHGLPQGIVS  1
             L+M+ ++ +HGLPQ I+S
Sbjct  1873  LFMDRIHSIHGLPQAIIS  1890



>ref|XP_010655166.1| PREDICTED: uncharacterized protein LOC104880390 [Vitis vinifera]
Length=1314

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  +++DFIEGLP S+GKD ILVVVDR +K+AHF+ L HPFT + VA 
Sbjct  925   GLLQPLPIPAQVWEDITLDFIEGLPTSHGKDTILVVVDRLSKFAHFIPLTHPFTTKVVAE  984

Query  54    LYMENVYKLHGLPQGIVS  1
              ++E V KLHG+P+ I+S
Sbjct  985   KFIEGVVKLHGMPRSIIS  1002



>gb|ABF94845.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=937

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP++AW  +SMDFIEGLP+S+G + ILVVVDRFTKYA+F+ L HPFTA +VA+
Sbjct  554  GLLAPLPIPKEAWQDISMDFIEGLPRSDGYNAILVVVDRFTKYANFIPLRHPFTASQVAH  613

Query  54   LYMENVYKLHGLPQGIVS  1
            L  + V+K HG+P+ IVS
Sbjct  614  LVDKTVFKTHGIPRSIVS  631



>ref|XP_010650251.1| PREDICTED: uncharacterized protein LOC100853955 [Vitis vinifera]
Length=1805

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  +S+DFI+GLP S GKD I+VVVDR +KYAHF++L+HPF+A+ +A 
Sbjct  1044  GLLQPLPIPCLVWDDISLDFIDGLPSSQGKDSIMVVVDRLSKYAHFIALSHPFSAKMIAE  1103

Query  54    LYMENVYKLHGLPQGIVS  1
              ++EN+ KLHG+P+ I+S
Sbjct  1104  KFVENIIKLHGMPKSIIS  1121



>emb|CAN70510.1| hypothetical protein VITISV_023158 [Vitis vinifera]
Length=790

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P Q W+ VSMDFIEGLP SNG   I+VVVDR TKYAHF++L HPFTA  +A 
Sbjct  445  GLLQPLPVPTQMWIDVSMDFIEGLPSSNGYTSIMVVVDRLTKYAHFVALKHPFTAVIIAK  504

Query  54   LYMENVYKLHGLPQGIVS  1
             ++ NV +LHG+P  IVS
Sbjct  505  AFVANVVRLHGIPTSIVS  522



>emb|CAN60890.1| hypothetical protein VITISV_011880 [Vitis vinifera]
Length=1378

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PE  +  ++MDFIEGLPKSNGK  I VVVDR TKY HFM L HP+TA+ VA 
Sbjct  1048  GLLQPLPVPEGVFTDITMDFIEGLPKSNGKTTIFVVVDRLTKYGHFMLLPHPYTAKMVAQ  1107

Query  54    LYMENVYKLHGLPQGIVS  1
             +++++VYKLHGLP  I  
Sbjct  1108  VFLDSVYKLHGLPHSITC  1125



>gb|AAO37507.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1155

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP++AW  +SMDFIEGLP+S+G + ILVVVDRFTKYA+F+ L HPFTA +VA+
Sbjct  855  GLLAPLPIPKEAWQDISMDFIEGLPRSDGYNAILVVVDRFTKYANFIPLRHPFTASQVAH  914

Query  54   LYMENVYKLHGLPQGIVS  1
            L  + V+K HG+P+ IVS
Sbjct  915  LVDKTVFKTHGIPRSIVS  932



>gb|AAX96125.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA93497.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1448

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P  AW  V+MDFIEGLPKS   + I+VVVD+ ++YAHF+ LAHPF+A  VA 
Sbjct  1024  GLLQPLLVPSGAWQTVTMDFIEGLPKSRRFNCIMVVVDKLSRYAHFLPLAHPFSAADVAQ  1083

Query  54    LYMENVYKLHGLPQGIVS  1
             LYME V+KLHGLP  +VS
Sbjct  1084  LYMEGVFKLHGLPLAVVS  1101



>gb|ADB85398.1| putative retrotransposon protein [Phyllostachys edulis]
Length=1348

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL+PL IP+ AW  +SMDFIEGLP S GK+VI VVVDRFTKYAH + L+HP++ + VA 
Sbjct  976   GLLEPLPIPDMAWTHISMDFIEGLPSSKGKEVIFVVVDRFTKYAHSVPLSHPYSVQLVAQ  1035

Query  54    LYMENVYKLHGLPQGIVS  1
              +++N++KLHG P  IVS
Sbjct  1036  AFIDNIFKLHGFPIAIVS  1053



>emb|CAN67160.1| hypothetical protein VITISV_039498 [Vitis vinifera]
Length=359

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   W  ++MDFIEGLP SNGK+ ILVVVDR +K AHF +LAHPFTA+ V  
Sbjct  27   GLLQPLPIPCLVWDDITMDFIEGLPTSNGKNTILVVVDRLSKSAHFFALAHPFTAKMVVE  86

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E V KLHG+P+ I+S
Sbjct  87   KFVEGVVKLHGMPKSIIS  104



>gb|ABD78322.1| polyprotein [Primula vulgaris]
Length=1359

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PEQ W ++SMDFI GLP S   + I VVVDR TKYAHF+ L HPF A+++AN
Sbjct  1028  GLLQPLPMPEQTWSEISMDFINGLPTSKNYNCIWVVVDRLTKYAHFIPLKHPFGAKELAN  1087

Query  54    LYMENVYKLHGLPQGIVS  1
              +++N++KLHGLP+ I+S
Sbjct  1088  EFLQNIFKLHGLPKKIIS  1105



>emb|CAN75226.1| hypothetical protein VITISV_035857 [Vitis vinifera]
Length=422

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   W  ++MDFIEGLP SNGK+ ILVVVDR +K AHF++LAHPF A+ VA 
Sbjct  98   GLLQPLPIPCLVWDDITMDFIEGLPTSNGKNTILVVVDRLSKSAHFLALAHPFIAKMVAE  157

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E V KLHG+P+ I+S
Sbjct  158  KFVEGVVKLHGMPKSIIS  175



>gb|AAG51464.1|AC069160_10 gypsy/Ty3 element polyprotein, putative [Arabidopsis thaliana]
Length=1447

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP++ W  VSMDFIEGLP S GK VI+VVVDR +K AHF++LAHP++A  VA 
Sbjct  1112  GLLQPLPIPDKIWCDVSMDFIEGLPNSGGKSVIMVVVDRLSKAAHFVALAHPYSALTVAQ  1171

Query  54    LYMENVYKLHGLPQGIVS  1
              +++NVYK HG P  IVS
Sbjct  1172  AFLDNVYKHHGCPTSIVS  1189



>gb|AAG51046.1|AC069473_8 gypsy/Ty-3 retroelement polyprotein; 69905-74404 [Arabidopsis 
thaliana]
 dbj|BAB03109.1| retroelement pol polyprotein [Arabidopsis thaliana]
Length=1499

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP+  W +VSMDFIEGLP S GK VI+VVVDR +K AHF++L+HP++A  VA+
Sbjct  1141  GLLQPLPIPDTIWSEVSMDFIEGLPVSGGKTVIMVVVDRLSKAAHFIALSHPYSALTVAH  1200

Query  54    LYMENVYKLHGLPQGIVS  1
              Y++NV+KLHG P  IVS
Sbjct  1201  AYLDNVFKLHGCPTSIVS  1218



>ref|XP_008791837.1| PREDICTED: probable serine/threonine-protein kinase GCN2 [Phoenix 
dactylifera]
Length=1569

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL I  Q W  +SMDFIEGLP S G +V+LVVVDR  KYAHF+ + HPFTA+ +A 
Sbjct  704  GLLQPLPILNQIWEDISMDFIEGLPSSKGYEVVLVVVDRLNKYAHFIPVQHPFTAKSIAQ  763

Query  54   LYMENVYKLHGLPQGIVS  1
             ++EN+ KLHG+P+ I+S
Sbjct  764  TFVENIIKLHGVPRSIIS  781



>emb|CAN68669.1| hypothetical protein VITISV_039388 [Vitis vinifera]
Length=1360

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  231   LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
             LLQPL IP Q W  VSMDFIEGLP SNG   I+VVVDR TKYAHF++L HPFTA  VA  
Sbjct  1048  LLQPLPIPHQMWTDVSMDFIEGLPSSNGYTTIMVVVDRLTKYAHFIALKHPFTAVTVAKA  1107

Query  51    YMENVYKLHGLPQGIVS  1
             ++ NV +LHG+P  IVS
Sbjct  1108  FVANVVRLHGIPTSIVS  1124



>emb|CAN79785.1| hypothetical protein VITISV_002634 [Vitis vinifera]
Length=245

 Score =   104 bits (260),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P Q W  +SMDFI+ LP SNGK  I VVVDR +KYA+F++++HP+TA  VA 
Sbjct  96   GLLQPLPVPTQVWEDISMDFIDSLPHSNGKSTIFVVVDRLSKYAYFIAISHPYTAFGVAR  155

Query  54   LYMENVYKLHGLPQGIV  4
            ++ +++++LHG+P+ IV
Sbjct  156  IFFDSIFRLHGVPRSIV  172



>gb|ABA97314.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1219

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G+LQPL +PE AW  VS+DFIEGLPKS   + ILVVVD+F+KY+HF+ L+HPFTA  VA 
Sbjct  1012  GMLQPLPVPEHAWQVVSLDFIEGLPKSATFNCILVVVDKFSKYSHFVPLSHPFTAMDVAE  1071

Query  54    LYMENVYKLHGLPQGIVS  1
              YM+ ++KLHGLPQ ++S
Sbjct  1072  AYMQFIHKLHGLPQSLIS  1089



>gb|AAK98732.1|AC090485_11 Putative retroelement [Oryza sativa Japonica Group]
Length=1923

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPE AW  VS+DFIEGLPKS   + ILVVVD+F++YAHF+ L+HPF+A  VA 
Sbjct  617  GLLQPLPIPEGAWQVVSLDFIEGLPKSERYNCILVVVDKFSRYAHFVPLSHPFSALDVAV  676

Query  54   LYMENVYKLHGLPQGIVS  1
             YM+N+YKLHG+P+ ++S
Sbjct  677  SYMKNIYKLHGMPKVLIS  694



>ref|XP_004509508.1| PREDICTED: uncharacterized protein LOC101513325 [Cicer arietinum]
Length=1436

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL+IP+  W  ++MDFIEGLP S GK VI V+VDR +K AHF+SLAHP+TA  VA 
Sbjct  759  GLLQPLTIPDHVWQHITMDFIEGLPISYGKQVIFVIVDRLSKAAHFISLAHPYTASIVAQ  818

Query  54   LYMENVYKLHGLPQGIVS  1
             +++N++KLHG P+ I S
Sbjct  819  AFLDNIFKLHGFPESITS  836



>gb|ABF93966.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1920

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPE AW  VS+DFIEGLPKS   + ILVVVD+F++YAHF+ L+HPF+A  VA 
Sbjct  617  GLLQPLPIPEGAWQVVSLDFIEGLPKSERYNCILVVVDKFSRYAHFVPLSHPFSALDVAV  676

Query  54   LYMENVYKLHGLPQGIVS  1
             YM+N+YKLHG+P+ ++S
Sbjct  677  SYMKNIYKLHGMPKVLIS  694



>gb|AAS98496.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT73663.1| hypothetical protein [Oryza sativa Japonica Group]
Length=915

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL+PL IP+ AW  ++MDFI  LP S GKDV LVVVDR TKYAHF++L+HP+T + V  
Sbjct  686  GLLEPLEIPDMAWSHITMDFIVDLPLSRGKDVTLVVVDRLTKYAHFLALSHPYTVQMVVE  745

Query  54   LYMENVYKLHGLPQGIVS  1
            ++M+N++KLHG+P  I++
Sbjct  746  IFMDNIHKLHGMPTAIIT  763



>ref|XP_010264998.1| PREDICTED: uncharacterized protein LOC104602841 [Nelumbo nucifera]
Length=1957

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IPEQ W  ++MDFIE LPKS G D I+VVVDR +KYAHF+ L+HPF+A  VA 
Sbjct  1260  GLLQPLPIPEQIWEDIAMDFIEALPKSKGFDTIMVVVDRLSKYAHFIPLSHPFSALTVAQ  1319

Query  54    LYMENVYKLHGLPQGIVS  1
              ++ N+ +LHG+P+ IVS
Sbjct  1320  AFLHNIVRLHGIPRSIVS  1337



>emb|CAN77085.1| hypothetical protein VITISV_044282 [Vitis vinifera]
Length=1520

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  ++++FIEGLP S GKD ILVVVDR +K+ HF+SL HPFTA+ VA 
Sbjct  1300  GLLQPLPIPCQGWDDITLNFIEGLPPSQGKDTILVVVDRLSKFTHFLSLTHPFTAKGVAE  1359

Query  54    LYMENVYKLHGLPQGIVS  1
              ++E + KLHGLP+ I+S
Sbjct  1360  KFVEGIIKLHGLPKSIIS  1377



>emb|CAN81986.1| hypothetical protein VITISV_001568 [Vitis vinifera]
Length=672

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE  +  ++MDFIEGLPKSNGK  I VVVDR TKY HFM L HP+T + VA 
Sbjct  242  GLLQPLPVPEGVFTDITMDFIEGLPKSNGKTAIFVVVDRLTKYGHFMLLPHPYTTKMVAQ  301

Query  54   LYMENVYKLHGLPQGIVS  1
            +++++VYKLHGLP  I  
Sbjct  302  VFLDSVYKLHGLPYSITC  319



>ref|XP_010541181.1| PREDICTED: uncharacterized protein LOC104814705 [Tarenaya hassleriana]
Length=1805

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IPE  W  +SMDFIEGLP+S G +V+LVVVDR +KYAHF++L HPFTA  VA 
Sbjct  1395  GLLQPLPIPEHIWEDISMDFIEGLPRSAGYNVVLVVVDRLSKYAHFIALKHPFTAMVVAK  1454

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V +LHG P+ IVS
Sbjct  1455  VFVQEVVRLHGFPKSIVS  1472



>emb|CAN73467.1| hypothetical protein VITISV_043900 [Vitis vinifera]
Length=1593

 Score =   108 bits (270),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  ++MDFI+GLP+S+GK  I+VVVDR +K AHF+++AHP+TA+ +AN
Sbjct  970   GLLQPLPIPCQVWDDITMDFIDGLPRSDGKTSIMVVVDRLSKSAHFIAIAHPYTAKTLAN  1029

Query  54    LYMENVYKLHGLPQGIVS  1
              ++E V KLHG+P+ I+S
Sbjct  1030  KFVEGVVKLHGMPRSIIS  1047



>emb|CAN80132.1| hypothetical protein VITISV_012031 [Vitis vinifera]
Length=1371

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PE  +  ++MDFIEGLPKSNGK  I VVVDR TKY HFM L HP+TA+ VA 
Sbjct  1104  GLLQPLPVPEGVFTDITMDFIEGLPKSNGKTEIFVVVDRLTKYGHFMLLPHPYTAKMVAQ  1163

Query  54    LYMENVYKLHGLPQGIVS  1
             +++++VYKLHGLP  I  
Sbjct  1164  VFLDSVYKLHGLPYSITC  1181



>gb|KFK24528.1| hypothetical protein AALP_AAs46225U000100, partial [Arabis alpina]
Length=1552

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP+Q W  +SMDF+EGLPKS G +V++VVVDR TKYAHF+S+ HP TA +VA 
Sbjct  1181  GLLQPLPIPDQVWEDISMDFVEGLPKSEGFEVVMVVVDRLTKYAHFISMKHPVTAVEVAL  1240

Query  54    LYMENVYKLHGLPQGIVS  1
             ++ + V KLHG P+ IVS
Sbjct  1241  IFTKEVVKLHGFPKTIVS  1258



>ref|XP_010247105.1| PREDICTED: uncharacterized protein LOC104590232 [Nelumbo nucifera]
Length=401

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQPL +PEQ W  ++MDFIE LPKS G D I+VVVDR +KYAHF+ L+HPF+A  VA  
Sbjct  80   LLQPLPVPEQIWEDIAMDFIEALPKSKGFDTIMVVVDRLSKYAHFIPLSHPFSALTVAQA  139

Query  51   YMENVYKLHGLPQGIVS  1
            ++ N+ +LHG+P+ IVS
Sbjct  140  FLHNIDRLHGIPRSIVS  156



>ref|NP_001175365.1| Os08g0123950 [Oryza sativa Japonica Group]
 dbj|BAH94093.1| Os08g0123950, partial [Oryza sativa Japonica Group]
Length=783

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQPL +P+ AW  +S+DFIEGLP+S+  + ILVVVD+F+KY+HF+ L HPFTA  VA  
Sbjct  350  LLQPLPVPKGAWQTISLDFIEGLPRSSHYNCILVVVDKFSKYSHFIPLRHPFTAIDVAKA  409

Query  51   YMENVYKLHGLPQGIVS  1
            +M NVYKLHGLPQ I+S
Sbjct  410  FMSNVYKLHGLPQIIIS  426



>ref|XP_008650680.1| PREDICTED: uncharacterized protein LOC103631580 [Zea mays]
Length=1789

 Score =   108 bits (270),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +  Q W  +SMDFIEGLPK  GK VIL VVDRF+KYAHF++L HP+TA  VA 
Sbjct  1407  GLLQPLEVSSQVWADISMDFIEGLPKVAGKSVILTVVDRFSKYAHFIALGHPYTASSVAR  1466

Query  54    LYMENVYKLHGLPQGIVS  1
              + + + +LHG P  IVS
Sbjct  1467  AFFDGIVRLHGFPLSIVS  1484



>ref|XP_008453052.1| PREDICTED: uncharacterized protein LOC103493874 [Cucumis melo]
Length=322

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP+Q W  +SMDFI+GLPK+ G +V+ VV+DR +KY+HFM+L HP+T + VA+
Sbjct  27   GLLTPLEIPQQVWSDISMDFIDGLPKAKGFEVVFVVIDRLSKYSHFMALKHPYTTKSVAD  86

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P  IVS
Sbjct  87   VFVKEVVRLHGFPSSIVS  104



>gb|AAG13508.1|AC068924_13 putative gag-pol polyprotein [Oryza sativa Japonica Group]
Length=1608

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P  AW  +S+DFIEGLP+S+  + ILVVVD+F+KY+HF+ L+HPF A  VA 
Sbjct  1180  GLLQPLPVPAGAWQTISLDFIEGLPRSSHYNCILVVVDKFSKYSHFIPLSHPFNAGGVAQ  1239

Query  54    LYMENVYKLHGLPQGIVS  1
              +M+N+YKLHGLP+ I+S
Sbjct  1240  EFMKNIYKLHGLPRAIIS  1257



>gb|AFJ66186.1| hypothetical protein 11M19.5 [Arabidopsis halleri]
Length=1557

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P   W  +SMDFIEGLP S GK  ILVV+DR +K AHFM+L+HP+TA +VA 
Sbjct  1197  GLLQPLPVPNGVWECISMDFIEGLPPSAGKHCILVVIDRLSKNAHFMALSHPYTAIEVAQ  1256

Query  54    LYMENVYKLHGLPQGIVS  1
              Y++NV+KLHG+P+ I S
Sbjct  1257  AYLDNVFKLHGMPKDITS  1274



>gb|KFK43794.1| hypothetical protein AALP_AA1G173500 [Arabis alpina]
Length=669

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P+Q W  +SMDF+EGLPKS+G DV++VVVDR TKYAHF+ L+HP+ +  VA 
Sbjct  260  GLLQPLPVPKQVWEDISMDFVEGLPKSDGYDVVMVVVDRLTKYAHFIKLSHPYESPDVAL  319

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ + +LHG P  IVS
Sbjct  320  LFVKEIVRLHGYPMTIVS  337



>emb|CAD40196.2| OSJNBb0043H09.2 [Oryza sativa Japonica Group]
Length=1409

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PE AW  +S+DFIEGLP+S   + ILVVVD+F+KY+HF+ L HPFTA  VA 
Sbjct  987   GLLQPLPVPEGAWQTLSLDFIEGLPRSGHYNCILVVVDKFSKYSHFIPLTHPFTANGVAT  1046

Query  54    LYMENVYKLHGLPQGIVS  1
              +M+++YKLHGLP+ I+S
Sbjct  1047  EFMKHIYKLHGLPKVIIS  1064



>gb|AAM51835.1|AC105730_9 Putative plant disease resistance polyprotein [Oryza sativa Japonica 
Group]
 gb|ABF94061.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1159

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP++AW  +SMDFIEGLP+S+G + ILVVVDRFTKYA F+ L HPFTA +VA+
Sbjct  338  GLLAPLPIPKEAWQDISMDFIEGLPRSDGYNAILVVVDRFTKYADFIPLRHPFTASQVAH  397

Query  54   LYMENVYKLHGLPQGIVS  1
            L  + V+K  G+P+ IVS
Sbjct  398  LVDKTVFKTQGIPRSIVS  415



>ref|XP_002450635.1| hypothetical protein SORBIDRAFT_05g008466 [Sorghum bicolor]
 gb|EES09623.1| hypothetical protein SORBIDRAFT_05g008466 [Sorghum bicolor]
Length=1507

 Score =   108 bits (269),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P   W  + +DFIE LPK  GK VIL VVDRF+KY HF+ LAHP+TAE VA 
Sbjct  1126  GLLQPLPVPSAVWADIGIDFIEALPKVQGKTVILSVVDRFSKYCHFIPLAHPYTAESVAQ  1185

Query  54    LYMENVYKLHGLPQGIVS  1
              +  +V +LHG+PQ IVS
Sbjct  1186  AFFADVVRLHGVPQSIVS  1203



>gb|AAU43957.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1263

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQP+ IPE AW  +SMDFIEGLP+S   + ILV+VD+FTK+AHF+ L+HPFTA  VA 
Sbjct  1130  GLLQPVQIPEHAWQVISMDFIEGLPRSASYNSILVIVDKFTKFAHFLPLSHPFTAVSVAQ  1189

Query  54    LYMENVYKLHGLPQGIVS  1
             L+M+ ++ +HGLP  I+S
Sbjct  1190  LFMDRIHSIHGLPLAIIS  1207



>gb|AAX95226.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1513

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL + + AW  ++MDFIEGLPKS  KD ILVVVDR TKYAHF++L+HP++ E+V  
Sbjct  1185  GLLNPLEVLDMAWTHITMDFIEGLPKSKWKDAILVVVDRLTKYAHFLALSHPYSVEQVVE  1244

Query  54    LYMENVYKLHGLPQGIV  4
             ++M N+++LHG+P  I+
Sbjct  1245  IFMNNIHRLHGMPMAII  1261



>emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera]
Length=1469

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP + W  +S+DFIEGLP S    VI+VVVDR +KYAHF+ ++HP+TA K+A 
Sbjct  1106  GLLQPLPIPTKVWTDISLDFIEGLPNSESYSVIMVVVDRLSKYAHFIPISHPYTASKIAQ  1165

Query  54    LYMENVYKLHGLPQGIVS  1
             +++ N++KLHGLP  IV+
Sbjct  1166  VFLANIFKLHGLPNSIVT  1183



>gb|ABA91843.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1411

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL + + AW  ++MDFIEGLPKS  KD ILVVVDR TKYAHF++L+HP++ E+V  
Sbjct  1083  GLLNPLEVLDMAWTHITMDFIEGLPKSKWKDAILVVVDRLTKYAHFLALSHPYSVEQVVE  1142

Query  54    LYMENVYKLHGLPQGIV  4
             ++M N+++LHG+P  I+
Sbjct  1143  IFMNNIHRLHGMPMAII  1159



>gb|AAX96796.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=429

 Score =   104 bits (260),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P + W  +SMDF EGLP+ NGK VIL VVDR +KYAHF+ L HP+TA  VA+
Sbjct  123  GLLQPLPVPTRVWEDISMDFEEGLPRVNGKSVILTVVDRQSKYAHFLPLGHPYTATSVAH  182

Query  54   LYMENVYKLHGLPQGIVS  1
            ++   V +LHG+P  IVS
Sbjct  183  VFFNEVVRLHGIPLSIVS  200



>ref|XP_010694863.1| PREDICTED: uncharacterized protein LOC104907605 [Beta vulgaris 
subsp. vulgaris]
Length=891

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP++ WV +SMDF+EGLPKS G D ILVVVDR +KY+HF+ L HPFTA  VA 
Sbjct  290  GLLQPLPIPDKVWVDLSMDFVEGLPKSLGWDTILVVVDRLSKYSHFIGLRHPFTALLVAA  349

Query  54   LYMENVYKLHGLPQGIV  4
            ++++ V +LHG PQ IV
Sbjct  350  IFIKEVVRLHGFPQTIV  366



>ref|XP_006651601.1| PREDICTED: uncharacterized protein LOC102715003 [Oryza brachyantha]
Length=1415

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PE AW  +SMDFIEGLP+S+  + I+V+VD+F+KY HF+ LAHPF A  VA 
Sbjct  1005  GLLQPLPVPEGAWQVISMDFIEGLPRSHRFNCIMVIVDKFSKYGHFIPLAHPFNALDVAK  1064

Query  54    LYMENVYKLHGLPQGIVS  1
             ++M +VYKLHGLP  I+S
Sbjct  1065  VFMSHVYKLHGLPTTIIS  1082



>gb|KFK23032.1| hypothetical protein AALP_AAs71112U000100, partial [Arabis alpina]
Length=1074

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P+Q W  +SMDF+EGLPKS+G DV++VVVDR TKYAHF+ L+HP+ +  VA 
Sbjct  980   GLLQPLPVPKQVWEDISMDFVEGLPKSDGYDVVMVVVDRLTKYAHFVKLSHPYESPDVAL  1039

Query  54    LYMENVYKLHGLPQGIVS  1
             L++  V +LHG P+ IVS
Sbjct  1040  LFVNEVVRLHGYPRTIVS  1057



>gb|KFK34141.1| hypothetical protein AALP_AA5G106200 [Arabis alpina]
Length=1584

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PEQ W  +S+DFIEGLPKS G DVI+VVVDR TK AHF  L HPF A +VA 
Sbjct  1176  GLLQPLPVPEQIWEDISLDFIEGLPKSEGYDVIMVVVDRLTKSAHFNRLKHPFVASEVAL  1235

Query  54    LYMENVYKLHGLPQGIVS  1
             L+++ V +LHG P+ +VS
Sbjct  1236  LFIQEVVRLHGFPKTLVS  1253



>ref|XP_011027642.1| PREDICTED: transposon Ty3-G Gag-Pol polyprotein [Populus euphratica]
Length=1364

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPLSIP + W +VSMDF+EGLP S G  VI+VVVDR +KYAHF++L HPFTA  VA 
Sbjct  1087  GLLQPLSIPTKIWTEVSMDFVEGLPPSLGNTVIMVVVDRLSKYAHFVALKHPFTAIIVAK  1146

Query  54    LYMENVYKLHGLPQGIVS  1
              ++ NV KLHG+P  IVS
Sbjct  1147  SFIANVVKLHGIPVSIVS  1164



>gb|KFK40399.1| hypothetical protein AALP_AA3G368400 [Arabis alpina]
Length=669

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PEQ W  +SMDFIEGLPKS G DVI+VVVD  TK AHF  L HPF A +VA 
Sbjct  362  GLLQPLPVPEQIWEDISMDFIEGLPKSEGYDVIMVVVDMLTKSAHFSRLKHPFVASEVAL  421

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ V +LHG P+ +VS
Sbjct  422  LFIQEVVRLHGFPKTLVS  439



>emb|CAJ65872.1| putative integrase [Cucumis melo]
Length=134

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
             LQP  IP + W  +SMDF+EGLP+S G D ILV+VDR +KYAHF++L HPF+A+ VA +
Sbjct  29   CLQPSPIPNRIWEDISMDFVEGLPRSKGFDTILVIVDRLSKYAHFITLGHPFSAKVVALV  88

Query  51   YMENVYKLHGLPQGIVS  1
            +++ V +LHG P+ IVS
Sbjct  89   FIKEVVRLHGYPRSIVS  105



>gb|KFK43793.1| hypothetical protein AALP_AA1G173500 [Arabis alpina]
Length=1336

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P+Q W  +SMDF+EGLPKS+G DV++VVVDR TKYAHF+ L+HP+ +  VA 
Sbjct  927   GLLQPLPVPKQVWEDISMDFVEGLPKSDGYDVVMVVVDRLTKYAHFIKLSHPYESPDVAL  986

Query  54    LYMENVYKLHGLPQGIVS  1
             L+++ + +LHG P  IVS
Sbjct  987   LFVKEIVRLHGYPMTIVS  1004



>ref|XP_010451711.1| PREDICTED: uncharacterized protein LOC104733878 [Camelina sativa]
Length=1459

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +PE  W  +SMDFI+GLP S+G  VI VVVDR +K AHF++LAHP+TA  VA 
Sbjct  1089  GLLQPLPVPEALWTDLSMDFIDGLPPSSGFTVIFVVVDRLSKAAHFIALAHPYTAMTVAQ  1148

Query  54    LYMENVYKLHGLPQGIVS  1
              +M NV+KLHG P+ IVS
Sbjct  1149  AFMNNVFKLHGCPRSIVS  1166



>gb|KFK22699.1| hypothetical protein AALP_AAs67984U000100 [Arabis alpina]
Length=1470

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  +S+DF+EGLPKS G D ILVVVDR TKYAHF+ L HPF A+++A 
Sbjct  515  GLLQPLPIPTQVWEDISLDFVEGLPKSEGFDAILVVVDRLTKYAHFIKLQHPFGAKEIAA  574

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ + +LHG P+ +VS
Sbjct  575  VFIQEIVRLHGYPRTMVS  592



>ref|XP_004170075.1| PREDICTED: uncharacterized protein LOC101232562, partial [Cucumis 
sativus]
Length=497

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL +P + W  +SMDF+EGLPK+ G +V+ VVVDRF+KY HF+ + HP+TA+ VA 
Sbjct  359  GLLTPLEVPNRVWEDISMDFVEGLPKAAGDEVLFVVVDRFSKYGHFIPMKHPYTAKTVAE  418

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ V +LHG P+ IVS
Sbjct  419  IFVKEVVRLHGYPKSIVS  436



>gb|ACP30609.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=2726

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP + W  VSMDF+EGLP S G +VI+VVVDR +KYAHF+ L HPFTA +VA+
Sbjct  2331  GLLQPLPIPNRIWEDVSMDFVEGLPGSQGVNVIMVVVDRLSKYAHFVGLKHPFTAVEVAS  2390

Query  54    LYMENVYKLHGLPQGIVS  1
              ++  V K HG P+ IVS
Sbjct  2391  KFVSEVVKHHGFPRSIVS  2408



>gb|ABA97104.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1412

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P+ AW  ++MDFIEGLPKS   + ILVVVD+F+KY+HF  L+HPF+A  VA 
Sbjct  1073  GLLQPLPVPDGAWQIITMDFIEGLPKSGQFNCILVVVDKFSKYSHFFPLSHPFSAIDVAQ  1132

Query  54    LYMENVYKLHGLPQGIVS  1
              +M NVYKLHGLP+ I+S
Sbjct  1133  SFMVNVYKLHGLPKFIIS  1150



>ref|XP_010646171.1| PREDICTED: uncharacterized protein LOC104878095 [Vitis vinifera]
Length=799

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  +++DFIE LP S+GKD ILVVVDR  K+AHF+ L HPFTA+ VA 
Sbjct  415  GLLQPLPIPTQVWEDITLDFIERLPTSHGKDTILVVVDRLRKFAHFIPLTHPFTAKVVAE  474

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E V KLHG+P+ I+S
Sbjct  475  NFIEGVVKLHGMPRSIIS  492



>gb|KFK38387.1| hypothetical protein AALP_AA3G106900 [Arabis alpina]
Length=1719

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  +SMDF EGLPK  G DVI+VVVDR TKY+HF+SLAHPF A +VA 
Sbjct  1106  GLLQPLPIPTQVWADISMDFFEGLPKFEGFDVIMVVVDRLTKYSHFISLAHPFGAPQVAM  1165

Query  54    LYMENVYKLHGLPQGIVS  1
             +++  + +LHG P+ +VS
Sbjct  1166  VFILEIVRLHGFPETLVS  1183



>gb|ADB85304.1| putative retrotransposon protein [Phyllostachys edulis]
Length=335

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  AWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHG  22
            AW  +SMDFIEGLPKS GK+VILVVVDR TKYAHF+SLAHP++ + V  ++M+N+ KLHG
Sbjct  2    AWTHISMDFIEGLPKSRGKEVILVVVDRLTKYAHFLSLAHPYSVQHVVQVFMDNILKLHG  61

Query  21   LPQGIVS  1
            +P  IV+
Sbjct  62   MPITIVT  68



>ref|XP_008354290.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103417910 
[Malus domestica]
Length=2186

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  +SMDFI GLP   GK VILV+VDR +KYAHF+ LAHP+TA  VA 
Sbjct  1155  GLLQPLPIPTHVWKDISMDFITGLPLCKGKSVILVIVDRLSKYAHFIPLAHPYTASMVAQ  1214

Query  54    LYMENVYKLHGLPQGIV  4
              Y++NV+KLHG+P  I+
Sbjct  1215  EYVDNVFKLHGMPSTIL  1231



>gb|AAX96513.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=605

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P + W  +SMDF EGLP+ NGK VIL VVDR +KYAHF+ L HP+TA  VA+
Sbjct  299  GLLQPLPVPTRVWEDISMDFEEGLPRVNGKSVILTVVDRQSKYAHFLPLGHPYTATSVAH  358

Query  54   LYMENVYKLHGLPQGIVS  1
            ++   V +LHG+P  IVS
Sbjct  359  VFFNEVVRLHGIPLSIVS  376



>gb|ACY01928.1| hypothetical protein [Beta vulgaris]
Length=1583

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  +SMDF+EGLPKS G D ILVVVDR +KYAHF++L HPFTA  VA 
Sbjct  1163  GLLQPLPIPLAIWEDISMDFVEGLPKSQGWDTILVVVDRLSKYAHFITLKHPFTAPTVAA  1222

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ + KLHG P  IVS
Sbjct  1223  VFIKEIVKLHGFPSTIVS  1240



>emb|CAN64046.1| hypothetical protein VITISV_040537 [Vitis vinifera]
Length=1259

 Score =   106 bits (264),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  ++M+FI+GLP+S+GK  I+VVVDR +K AHF++ AHP+TA+ +AN
Sbjct  941   GLLQPLPIPCQVWDDITMBFIDGLPRSDGKTSIMVVVDRLSKSAHFIAXAHPYTAKTLAN  1000

Query  54    LYMENVYKLHGLPQGIVS  1
              ++E V KLHG+P  I+S
Sbjct  1001  KFVEGVVKLHGMPXSIIS  1018



>gb|ABA92870.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=621

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P + W  +SMDF EGLP+ NGK VIL VVDR +KYAHF+ L HP+TA  VA+
Sbjct  315  GLLQPLPVPTRVWEDISMDFEEGLPRVNGKSVILTVVDRQSKYAHFLPLGHPYTATSVAH  374

Query  54   LYMENVYKLHGLPQGIVS  1
            ++   V +LHG+P  IVS
Sbjct  375  VFFNEVVRLHGIPLSIVS  392



>ref|XP_007216306.1| hypothetical protein PRUPE_ppa019597mg, partial [Prunus persica]
 gb|EMJ17505.1| hypothetical protein PRUPE_ppa019597mg, partial [Prunus persica]
Length=1392

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP+  W  ++MDF+EGLP  NGK+ ILVVVDR +KY HF+ + HP+TA +VA+
Sbjct  1052  GLLQPLPIPDSIWQDIAMDFVEGLPSVNGKNAILVVVDRLSKYGHFIPIKHPYTASQVAD  1111

Query  54    LYMENVYKLHGLPQGIVS  1
              ++  V+KLHG+P+ IVS
Sbjct  1112  FFICEVFKLHGMPRTIVS  1129



>ref|XP_002437407.1| hypothetical protein SORBIDRAFT_10g026363 [Sorghum bicolor]
 gb|EER88774.1| hypothetical protein SORBIDRAFT_10g026363 [Sorghum bicolor]
Length=1609

 Score =   106 bits (264),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P + W  ++MDF+E LPK +GK VIL VVDRF+KYAHF+ L HP+TA  VA 
Sbjct  1241  GLLQPLPVPSKVWADIAMDFVEALPKVHGKSVILTVVDRFSKYAHFIPLGHPYTASSVAR  1300

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG P  IVS
Sbjct  1301  AFFRDIVRLHGFPDSIVS  1318



>emb|CAN70471.1| hypothetical protein VITISV_013478 [Vitis vinifera]
Length=1122

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   W  ++MDFIEGLP SNGK+ ILVVVD  +K AHF +LAHPFTA+ VA 
Sbjct  674  GLLQPLPIPCLVWDDITMDFIEGLPTSNGKNTILVVVDHLSKSAHFFALAHPFTAKMVAE  733

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E V KLHG+P+ I+S
Sbjct  734  KFVEGVVKLHGMPKSIIS  751



>ref|XP_010484774.1| PREDICTED: uncharacterized protein LOC104763056 [Camelina sativa]
Length=553

 Score =   104 bits (259),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P+Q W  VSMDFI+GLP+S+G   I+VV+DR TK AH + L++P+TA+ VA 
Sbjct  337  GLLQPLHVPDQVWEDVSMDFIDGLPRSDGYTTIMVVIDRLTKSAHLVPLSYPYTAKTVAA  396

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E+V KLHG+P+ IVS
Sbjct  397  KFVEDVVKLHGMPRSIVS  414



>emb|CAD40278.2| OSJNBb0062H02.17 [Oryza sativa Japonica Group]
 emb|CAE05600.2| OSJNBa0054D14.1 [Oryza sativa Japonica Group]
Length=1629

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G+LQPL +P+ AW  VS+DF+EGLPKS   + ILVVVD+F+KY+HF+ L HPF+A  VA 
Sbjct  1221  GMLQPLPVPDHAWQIVSLDFVEGLPKSASFNCILVVVDKFSKYSHFVPLTHPFSALDVAE  1280

Query  54    LYMENVYKLHGLPQGIVS  1
              YM+++++LHGLPQ ++S
Sbjct  1281  AYMQHIHRLHGLPQSLIS  1298



>gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris subsp. vulgaris]
Length=1631

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  +SMDFIEGLP S G D ILV+VDR +KYAHF++L HPFTA  VA+
Sbjct  1230  GLLQPLPIPSLVWEDISMDFIEGLPVSKGVDTILVIVDRLSKYAHFLTLRHPFTALMVAD  1289

Query  54    LYMENVYKLHGLPQGIVS  1
             L+++ V +LHG P  IVS
Sbjct  1290  LFVKEVVRLHGFPSSIVS  1307



>ref|XP_006365576.1| PREDICTED: uncharacterized protein LOC102595311 [Solanum tuberosum]
Length=1907

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  ++MDFI GLPK+ G D ILVVVD FTKY HF+ L HP+TA+ VA 
Sbjct  1152  GLLQPLPIPTQVWNDIAMDFISGLPKAMGHDTILVVVDHFTKYCHFLLLCHPYTAKSVAE  1211

Query  54    LYMENVYKLHGLPQGIVS  1
             L++  + +LHG P+ IVS
Sbjct  1212  LFVREIVRLHGFPKTIVS  1229



>gb|AAP55181.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1459

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL+PL +PE AW  +S+DF EGLP+S   D ILVVVD+F+KY+HF+ LAHPF A  VA 
Sbjct  1128  GLLKPLPVPEGAWQTISLDFNEGLPRSEHSDCILVVVDKFSKYSHFLPLAHPFLALSVAK  1187

Query  54    LYMENVYKLHGLPQGIV  4
             L+M+N++KLHGLP  I+
Sbjct  1188  LFMKNIFKLHGLPLVII  1204



>ref|XP_010109691.1| Sterol 3-beta-glucosyltransferase [Morus notabilis]
 gb|EXC24161.1| Sterol 3-beta-glucosyltransferase [Morus notabilis]
Length=1117

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQPL +P+Q W  +SMDFIEGLP S G D ILVVVDR +KYAHF++L HP++AEKVA+ 
Sbjct  914  LLQPLPVPKQVWEDMSMDFIEGLPPSEGFDTILVVVDRLSKYAHFVALKHPYSAEKVAHR  973

Query  51   YMENVYKLHGLPQGIVS  1
            +++ V  LHG+P+ IVS
Sbjct  974  FIQEVVCLHGVPRTIVS  990



>emb|CAN60449.1| hypothetical protein VITISV_036155 [Vitis vinifera]
Length=647

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  ++MDFIEGLP S GK+ ILVVVDR +K AHF++L HPF+A+ VA 
Sbjct  258  GLLQPLPIPCQVWDDITMDFIEGLPPSQGKNTILVVVDRLSKSAHFLALTHPFSAKMVAE  317

Query  54   LYMENVYKLHGLPQGIVS  1
             +++ V KLHG+P  I+S
Sbjct  318  KFVDGVIKLHGMPSSIIS  335



>ref|XP_008655231.1| PREDICTED: uncharacterized protein LOC100382585 isoform X1 [Zea 
mays]
Length=1543

 Score =   105 bits (263),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G LQPL +P  AW  +SMDF+EGLP+S   D ILVVVD+F+K+ HF+ L+HP+TA  VA 
Sbjct  1245  GKLQPLPVPPSAWHTISMDFVEGLPRSGSWDCILVVVDKFSKFGHFVPLSHPYTAHSVAQ  1304

Query  54    LYMENVYKLHGLPQGIVS  1
             L++ ++Y+LHG P  IVS
Sbjct  1305  LFLSHIYRLHGFPAAIVS  1322



>emb|CAN66553.1| hypothetical protein VITISV_018166 [Vitis vinifera]
Length=1448

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP++ W  V+MDFIEGLPKS G + ILVVVDR +KYAHF  L HPF A+ VA 
Sbjct  639  GLLQPLPIPDKIWDDVTMDFIEGLPKSEGYNFILVVVDRLSKYAHFSLLKHPFXAQTVAA  698

Query  54   LYMENVYKLHGLPQGIVS  1
            +++ +V KLHG P+ I+S
Sbjct  699  IFVRDVVKLHGFPRSIIS  716



>gb|KFK28310.1| hypothetical protein AALP_AA8G499800 [Arabis alpina]
Length=1557

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  +S+DF+EGLPKS G D ILVVVDR TKYAHF+ L HPF A+++A 
Sbjct  1155  GLLQPLPIPTQVWEDISLDFVEGLPKSEGFDAILVVVDRLTKYAHFIKLQHPFGAKEIAA  1214

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ + +LHG P  +VS
Sbjct  1215  VFIQEIVRLHGYPSTMVS  1232



>ref|XP_010548864.1| PREDICTED: uncharacterized protein LOC104820194 [Tarenaya hassleriana]
Length=1552

 Score =   105 bits (263),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IPEQ W  +SMD IEGLP+S G +V+LVVVDR +KYAHF++L H F+A  V  
Sbjct  1184  GLLQPLPIPEQIWEDISMDLIEGLPRSAGYNVVLVVVDRLSKYAHFIALKHLFSAMVVVK  1243

Query  54    LYMENVYKLHGLPQGIVS  1
              +++ V KLHG P+ IVS
Sbjct  1244  AFVQEVVKLHGFPKSIVS  1261



>emb|CAN64437.1| hypothetical protein VITISV_011228 [Vitis vinifera]
Length=623

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  ++MDFIEGLP S GK+ ILVVVDR +K AHF++L HPF+A+ VA 
Sbjct  250  GLLQPLPIPCQVWDDITMDFIEGLPPSQGKNTILVVVDRLSKSAHFLALTHPFSAKMVAE  309

Query  54   LYMENVYKLHGLPQGIVS  1
             +++ V KLHG+P  I+S
Sbjct  310  KFVDGVVKLHGMPSSIIS  327



>emb|CAE05274.1| OSJNBb0014D23.8 [Oryza sativa Japonica Group]
Length=1545

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE AW  ++MDFIEGLPKS   + I VVVD+F+KY+HF+ L+HPF+A  VA 
Sbjct  624  GLLQPLPVPEGAWQVLTMDFIEGLPKSGKFNSIFVVVDKFSKYSHFIPLSHPFSAIDVAQ  683

Query  54   LYMENVYKLHGLPQGIVS  1
             +M N+YKLHGLP+ I+S
Sbjct  684  AFMCNIYKLHGLPRFIIS  701



>emb|CAH66146.1| OSIGBa0114M03.4 [Oryza sativa Indica Group]
Length=1448

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P   W  + +DF+E LP+ +GK VIL VVDRF+KY HF+ LAHP+TAE VA 
Sbjct  1048  GLLQPLPVPSIVWADIGIDFVEALPRVHGKTVILSVVDRFSKYCHFIPLAHPYTAESVAQ  1107

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG+PQ IVS
Sbjct  1108  AFFADIVRLHGVPQSIVS  1125



>ref|XP_002438456.1| hypothetical protein SORBIDRAFT_10g020014 [Sorghum bicolor]
 gb|EER89823.1| hypothetical protein SORBIDRAFT_10g020014 [Sorghum bicolor]
Length=1414

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+  W+ +++DF+E LP+  GK VIL VVDRF+KY HF+ LAHP++AE VA 
Sbjct  963   GLLLPLPVPQGVWIDIALDFVEALPRVRGKSVILTVVDRFSKYCHFIPLAHPYSAESVAQ  1022

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG+PQ IVS
Sbjct  1023  AFFADIVRLHGVPQSIVS  1040



>gb|KFK23310.1| hypothetical protein AALP_AAs43195U000200 [Arabis alpina]
Length=1496

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP++ W  +S+DF+EGLPKS G DV++VVVDR +KYAHF+ L HP+ A  VA 
Sbjct  1094  GLLQPLPIPDKVWEDISLDFVEGLPKSEGFDVVMVVVDRLSKYAHFLKLKHPYEASAVAL  1153

Query  54    LYMENVYKLHGLPQGIVS  1
             L+++ + +LHG P+ IVS
Sbjct  1154  LFVQEIVRLHGFPRTIVS  1171



>emb|CAN81876.1| hypothetical protein VITISV_034528 [Vitis vinifera]
Length=1241

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   W  ++MDFIEGLP SNGK+ ILVVVDR +K AHF++LAHPF A+ V  
Sbjct  896  GLLQPLPIPCLVWDDITMDFIEGLPTSNGKNTILVVVDRLSKSAHFLALAHPFXAKMVXE  955

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E V KLHG+P+ I+S
Sbjct  956  KFVEGVVKLHGMPKSIIS  973



>ref|XP_010680400.1| PREDICTED: transposon Tf2-1 polyprotein isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=1574

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL  P Q W  ++MDF+EGLP S G D ILVVVDRFTK+AHF+ L HPFTA  VA 
Sbjct  1179  GLLQPLPPPNQVWEDITMDFVEGLPPSRGVDTILVVVDRFTKFAHFLGLKHPFTAATVAG  1238

Query  54    LYMENVYKLHGLPQGIVS  1
              +++ + +LHG P  I+S
Sbjct  1239  TFIKEIVRLHGFPASIIS  1256



>emb|CAH66431.1| OSIGBa0096P03.5 [Oryza sativa Indica Group]
Length=413

 Score =   102 bits (254),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQ L +P   W  ++MDF+EGLP+ +GK VIL VVDRF+K+AHF+ LAHP+TA  VA 
Sbjct  188  GLLQSLPVPSAVWADIAMDFVEGLPRVHGKTVILTVVDRFSKFAHFIPLAHPYTATSVAA  247

Query  54   LYMENVYKLHGLPQGIVS  1
             +   + +LHG+P  IVS
Sbjct  248  AFFAEIVRLHGVPASIVS  265



>gb|KFK36441.1| hypothetical protein AALP_AA4G124900 [Arabis alpina]
Length=776

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  +SMDF+EGLPKS G +V++VVVDR +KYAHF+ L HP+ A  VA+
Sbjct  368  GLLQPLPIPVQVWEDISMDFVEGLPKSEGFEVVMVVVDRLSKYAHFVKLKHPYDASSVAS  427

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ + +LHG P+ ++S
Sbjct  428  LFVQEIVRLHGFPKTLIS  445



>gb|ABA93987.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1485

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P+ AW  +SMDFIEGLP S+  +VILV+VD+F+K+AHF++L HP+TA  VA 
Sbjct  1070  GLLQPLEVPDHAWQVISMDFIEGLPLSDHCNVILVIVDKFSKFAHFLALRHPYTALSVAQ  1129

Query  54    LYMENVYKLHGLPQGIVS  1
             L+M++++ +HGLP  I+S
Sbjct  1130  LFMDHIHCIHGLPCAIIS  1147



>ref|XP_002438460.1| hypothetical protein SORBIDRAFT_10g020018 [Sorghum bicolor]
 gb|EER89827.1| hypothetical protein SORBIDRAFT_10g020018 [Sorghum bicolor]
Length=1437

 Score =   104 bits (260),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+  W  ++MDF+E LP+  GK VIL VVDRF+KY HF+ LAHP++AE VA 
Sbjct  1047  GLLLPLPVPQGVWSDIAMDFVEALPRVKGKSVILTVVDRFSKYCHFIPLAHPYSAEGVAQ  1106

Query  54    LYMENVYKLHGLPQGIVS  1
              +  +V +LHG+PQ IVS
Sbjct  1107  AFFADVVRLHGIPQSIVS  1124



>emb|CAN73897.1| hypothetical protein VITISV_025576 [Vitis vinifera]
Length=269

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQP  IP Q W  +++DF+EGLP S+ KD ILVVVDR  KYAHF++L+HPF+ + VA 
Sbjct  162  GLLQPFPIPFQVWDDITLDFVEGLPSSHDKDSILVVVDRLNKYAHFVALSHPFSTKIVAE  221

Query  54   LYMENVYKLHGLPQGIVS  1
             +++++ KLHG+P+ I+S
Sbjct  222  HFVKHIIKLHGMPKSIIS  239



>ref|XP_002443111.1| hypothetical protein SORBIDRAFT_08g008675 [Sorghum bicolor]
 gb|EES16949.1| hypothetical protein SORBIDRAFT_08g008675 [Sorghum bicolor]
Length=1456

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PLS+P+  W  +++DF+E LP+  GK VIL VVDRF+KY HF+ LAHP+TAE VA 
Sbjct  1047  GLLLPLSVPQGIWTDIALDFVEALPRVRGKTVILTVVDRFSKYCHFVPLAHPYTAESVAE  1106

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG+PQ +VS
Sbjct  1107  AFFADIVRLHGVPQSMVS  1124



>emb|CAJ00277.1| hypothetical protein [Lotus japonicus]
Length=1508

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  ++MDFI+ LPKS+GKD I VV+DR +KYAHF+ L HP+TA  +A 
Sbjct  1137  GLLQPLPIPAGVWQSIAMDFIDKLPKSHGKDAIWVVIDRLSKYAHFIPLTHPYTASTLAE  1196

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ VY+LHG P  IVS
Sbjct  1197  IFIKEVYRLHGAPSNIVS  1214



>emb|CAJ00274.1| hypothetical protein [Lotus japonicus]
Length=1508

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  ++MDFI+ LPKS+GKD I VV+DR +KYAHF+ L HP+TA  +A 
Sbjct  1137  GLLQPLPIPAGVWQSIAMDFIDKLPKSHGKDAIWVVIDRLSKYAHFIPLTHPYTASTLAE  1196

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ VY+LHG P  IVS
Sbjct  1197  IFIKEVYRLHGAPSNIVS  1214



>ref|XP_004150327.1| PREDICTED: uncharacterized protein LOC101216833 [Cucumis sativus]
Length=2712

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P   W  +SMDFIEGLPKS G + I VVVDRF+KY HF++L HPFTA+ VA 
Sbjct  2078  GLLLPLEVPTNIWSDISMDFIEGLPKSCGFETIFVVVDRFSKYGHFLALKHPFTAKTVAE  2137

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ + +LHG P+ IVS
Sbjct  2138  IFVKEIVRLHGFPKSIVS  2155



>emb|CAJ00278.1| hypothetical protein [Lotus japonicus]
Length=1508

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  ++MDFI+ LPKS+GKD I VV+DR +KYAHF+ L HP+TA  +A 
Sbjct  1137  GLLQPLPIPAGVWQSIAMDFIDKLPKSHGKDAIWVVIDRLSKYAHFIPLTHPYTASTLAE  1196

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ VY+LHG P  IVS
Sbjct  1197  IFIKEVYRLHGAPSNIVS  1214



>gb|KFK36440.1| hypothetical protein AALP_AA4G124900 [Arabis alpina]
Length=1034

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  +SMDF+EGLPKS G +V++VVVDR +KYAHF+ L HP+ A  VA+
Sbjct  626  GLLQPLPIPVQVWEDISMDFVEGLPKSEGFEVVMVVVDRLSKYAHFVKLKHPYDASSVAS  685

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ + +LHG P+ ++S
Sbjct  686  LFVQEIVRLHGFPKTLIS  703



>ref|XP_009801581.1| PREDICTED: uncharacterized protein LOC104247310 [Nicotiana sylvestris]
Length=534

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPE     ++MDFIE L  S+ K+ ILV++DRFTKY HF++L HP+TA+ VAN
Sbjct  414  GLLQPLPIPEFPRQDIAMDFIERLFSSSQKNAILVIIDRFTKYGHFLALKHPYTAKDVAN  473

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ +YKLHGLP+ I+S
Sbjct  474  LFLKEIYKLHGLPKTILS  491



>gb|KFK36442.1| hypothetical protein AALP_AA4G124900 [Arabis alpina]
Length=1409

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP Q W  +SMDF+EGLPKS G +V++VVVDR +KYAHF+ L HP+ A  VA+
Sbjct  1001  GLLQPLPIPVQVWEDISMDFVEGLPKSEGFEVVMVVVDRLSKYAHFVKLKHPYDASSVAS  1060

Query  54    LYMENVYKLHGLPQGIVS  1
             L+++ + +LHG P+ ++S
Sbjct  1061  LFVQEIVRLHGFPKTLIS  1078



>gb|AAP52367.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=415

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQ L +P QAW  VS+DFIEGLPKS   D IL VVD+FTK+A F++L+HPFTA  VA 
Sbjct  208  GLLQTLPVPLQAWSTVSLDFIEGLPKSGKFDTILAVVDKFTKFAKFIALSHPFTALTVAQ  267

Query  54   LYMENVYKLHGLPQGIVS  1
             +++NVY++ G+P+ I+S
Sbjct  268  AFIQNVYEMFGMPRVIIS  285



>gb|KDP33197.1| hypothetical protein JCGZ_12719 [Jatropha curcas]
Length=280

 Score =   100 bits (248),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQPL IP + W ++SMDFI+ LP S GK  I VVVDR +KYAHF+ + HP+TA  +A +
Sbjct  203  LLQPLPIPNRIWEEISMDFIDDLPNSKGKTTISVVVDRLSKYAHFIPMTHPYTAVIIAQI  262

Query  51   YMENVYKLHGLPQGIV  4
            + +N++KLHG+P  +V
Sbjct  263  FFDNIFKLHGMPLTLV  278



>ref|XP_008378706.1| PREDICTED: uncharacterized protein LOC103441785 [Malus domestica]
Length=607

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  +SMDFI  LP   GK VI VVVDR +KYAHF +L+HP+T   VA 
Sbjct  442  GLLQPLPIPGKVWSDISMDFITNLPPCKGKXVIWVVVDRLSKYAHFTTLSHPYTXSTVAX  501

Query  54   LYMENVYKLHGLPQGIVS  1
              ++N++KLHG+PQ IVS
Sbjct  502  HXVDNIFKLHGMPQSIVS  519



>gb|KFK43656.1| hypothetical protein AALP_AA1G155400 [Arabis alpina]
Length=690

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPE  W  +SMDFIEGLPKS G ++I+VVVDR TKY HF+ L HP  A  VA+
Sbjct  260  GLLQPLPIPEAVWEDISMDFIEGLPKSAGMELIMVVVDRLTKYGHFVGLKHPLDATTVAS  319

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ + +LHG P+ +VS
Sbjct  320  VFIQEIVRLHGFPKTLVS  337



>ref|NP_001052635.1| Os04g0389000 [Oryza sativa Japonica Group]
 dbj|BAF14549.1| Os04g0389000, partial [Oryza sativa Japonica Group]
Length=538

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQ L +P   W  ++MDF+EGLP+ +GK VIL VVDRF+K+AHF+ +AHP+TA  VA 
Sbjct  144  GLLQSLPVPSAVWADIAMDFVEGLPRVHGKTVILTVVDRFSKFAHFIPMAHPYTATSVAA  203

Query  54   LYMENVYKLHGLPQGIVS  1
             +   + +LHG+P  IVS
Sbjct  204  AFFSEIVRLHGVPASIVS  221



>gb|ABA93917.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1091

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             +LQPL +P+ AW  VS+DFIEGL KS   + ILVVVD+F+KY+HF+ LAHPFTA  VA 
Sbjct  675  SMLQPLPVPDHAWQIVSLDFIEGLSKSASFNCILVVVDKFSKYSHFVPLAHPFTALDVAE  734

Query  54   LYMENVYKLHGLPQGIVS  1
             +M+++++LHGLPQ I+S
Sbjct  735  AFMQHIHRLHGLPQSIIS  752



>gb|AEV42261.1| hypothetical protein [Beta vulgaris]
Length=1396

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  VSMDF+EGLPKS G D ILVVVDR +KY HF+ L HPF+A  VA 
Sbjct  999   GLLQPLPIPTLIWEDVSMDFVEGLPKSGGWDSILVVVDRLSKYGHFIGLRHPFSAATVAQ  1058

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V KLHG P  IVS
Sbjct  1059  VFIKEVVKLHGFPTTIVS  1076



>ref|XP_004293097.1| PREDICTED: uncharacterized protein LOC101292971 [Fragaria vesca 
subsp. vesca]
Length=1570

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQP+SIP QAW  +SMDFIE LPKS GK VI V++D+ TKYAHF+ L+HP++A  +  
Sbjct  1434  GLLQPVSIPPQAWHTISMDFIEALPKSEGKTVIWVIIDKLTKYAHFIPLSHPYSAATLVK  1493

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ V KLHG+P  I+S
Sbjct  1494  VFVQEVAKLHGMPVNIIS  1511



>gb|AAS07071.1| putative integrase, 3'-partial [Oryza sativa Japonica Group]
Length=303

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  AWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHG  22
            AW  +SMDFIEGLPKS+GKDVILVVVDR TKY HF++++HP++ E+V  ++M N++KL+G
Sbjct  2    AWTHISMDFIEGLPKSHGKDVILVVVDRLTKYVHFVAMSHPYSVEQVVEVFMNNIHKLYG  61

Query  21   LPQGIVS  1
            +P  IV+
Sbjct  62   MPMAIVT  68



>ref|XP_008364806.1| PREDICTED: protein ROOT HAIR DEFECTIVE 3 homolog 2-like [Malus 
domestica]
Length=544

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
             LQPLS+P Q W  ++MDF+EGLP ++GK+ ILVVVDR +KY HF+ + HP+ A ++A +
Sbjct  356  FLQPLSVPTQVWTDIAMDFVEGLPSNHGKNAILVVVDRLSKYGHFIPIQHPYYAPQIAEV  415

Query  51   YMENVYKLHGLPQGIVS  1
            +++ V++LH +P  IVS
Sbjct  416  FIQEVFRLHRMPASIVS  432



>ref|XP_008653833.1| PREDICTED: uncharacterized protein LOC103633960 [Zea mays]
Length=1380

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P   W  ++MDF+EG PK  GK VIL VVDRF+KYAHF+ L+HP++A  VA 
Sbjct  1058  GLLQPLPVPSSVWSDIAMDFVEGFPKVGGKSVILTVVDRFSKYAHFIPLSHPYSATVVAK  1117

Query  54    LYMENVYKLHGLPQGIVS  1
              + + + +LHG P  IVS
Sbjct  1118  AFFDEIVRLHGFPCSIVS  1135



>emb|CAE05536.2| OSJNBa0053B21.10 [Oryza sativa Japonica Group]
Length=582

 Score =   102 bits (254),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQ L +P   W  ++MDF+EGLP+ +GK VIL VVDRF+K+AHF+ +AHP+TA  VA 
Sbjct  188  GLLQSLPVPSAVWADIAMDFVEGLPRVHGKTVILTVVDRFSKFAHFIPMAHPYTATSVAA  247

Query  54   LYMENVYKLHGLPQGIVS  1
             +   + +LHG+P  IVS
Sbjct  248  AFFSEIVRLHGVPASIVS  265



>ref|XP_008676069.1| PREDICTED: uncharacterized protein LOC103652215 [Zea mays]
Length=1375

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P   W  ++MDF+EG PK  GK VIL VVDRF+KYAHF+ L+HP++A  VA 
Sbjct  1058  GLLQPLPVPSSVWSDIAMDFVEGFPKVGGKSVILTVVDRFSKYAHFIPLSHPYSATVVAK  1117

Query  54    LYMENVYKLHGLPQGIVS  1
              + + + +LHG P  IVS
Sbjct  1118  AFFDEIVRLHGFPCSIVS  1135



>emb|CAN81740.1| hypothetical protein VITISV_009674 [Vitis vinifera]
Length=771

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 4/81 (5%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQPLSI  Q W  +++DFIEGLP S G+D I+VVVDRF+K+AHF++L+H FTA+ VA  
Sbjct  548  LLQPLSILCQVWDDITLDFIEGLPVSQGRDTIMVVVDRFSKFAHFLTLSHTFTAKNVAEK  607

Query  51   YMENVYKLHGLPQ----GIVS  1
            ++E + KLHG+PQ    GIV+
Sbjct  608  FVEGIIKLHGMPQVLELGIVA  628



>ref|XP_004166527.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226839 
[Cucumis sativus]
Length=739

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IP + W  +SM FI+GLPK+ G DV+LVVVDRF+KY HF+SL HP+ A+ VA 
Sbjct  157  GLLTPLEIPNRVWYDISMVFIDGLPKAAGFDVVLVVVDRFSKYGHFLSLKHPYAAKSVAE  216

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ V +LHGLP+ + S
Sbjct  217  LFVKEVVQLHGLPKSMAS  234



>gb|AAK98731.1|AC090485_10 Putative retroelement [Oryza sativa Japonica Group]
 gb|ABF93967.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1461

 Score =   103 bits (256),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+  W  V++DF+E LP+  GK VIL VVDRF+KY HF+ LAHP++AE VA 
Sbjct  1054  GLLLPLPVPQGVWTDVALDFVEALPRVRGKSVILTVVDRFSKYCHFIPLAHPYSAESVAQ  1113

Query  54    LYMENVYKLHGLPQGIVS  1
             ++   + +LHG+PQ +VS
Sbjct  1114  VFFAEIVRLHGVPQSMVS  1131



>emb|CAE02543.1| OSJNBb0069N01.1 [Oryza sativa Japonica Group]
 emb|CAE05183.2| OSJNBa0013A04.20 [Oryza sativa Japonica Group]
Length=1395

 Score =   103 bits (256),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL+PL I    W  V+MDF+EGLP+  GK VIL VVDRF+KYAHF++LAHP+TAE VA 
Sbjct  1034  GLLRPLPILMAVWSDVAMDFVEGLPRVAGKTVILTVVDRFSKYAHFIALAHPYTAETVAR  1093

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG+P  IVS
Sbjct  1094  AFFADIVRLHGVPVSIVS  1111



>gb|AAP68389.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1246

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL IPE AW  +SMDFIEGLPKS+GKDVILVVVDR TKYAHF++++HPF  + V  
Sbjct  952   GLLDPLQIPEMAWTHISMDFIEGLPKSHGKDVILVVVDRLTKYAHFVAMSHPFDTQDVIQ  1011

Query  54    LYMEN  40
             ++MEN
Sbjct  1012  VFMEN  1016



>gb|ABF98227.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1160

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL IPE AW  +SMDFIEGLPKS+GKDVILVVVDR TKYAHF++++HPF  + V  
Sbjct  866  GLLDPLQIPEMAWTHISMDFIEGLPKSHGKDVILVVVDRLTKYAHFVAMSHPFDTQDVIQ  925

Query  54   LYMEN  40
            ++MEN
Sbjct  926  VFMEN  930



>gb|KFK43655.1| hypothetical protein AALP_AA1G155400 [Arabis alpina]
Length=1548

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IPE  W  +SMDFIEGLPKS G ++I+VVVDR TKY HF+ L HP  A  VA+
Sbjct  1118  GLLQPLPIPEAVWEDISMDFIEGLPKSAGMELIMVVVDRLTKYGHFVGLKHPLDATTVAS  1177

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ + +LHG P+ +VS
Sbjct  1178  VFIQEIVRLHGFPKTLVS  1195



>ref|XP_010248413.1| PREDICTED: uncharacterized protein LOC104591303 [Nelumbo nucifera]
Length=815

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQ L IP++ W  +SMDFIEGLP S GKDVI VVVDR +K AHFM+L HP+T  +VA 
Sbjct  493  GLLQSLPIPDKVWSAISMDFIEGLPTSFGKDVIFVVVDRLSKVAHFMALRHPYTTLQVAQ  552

Query  54   LYMENVYKLHGL  19
            LY+  V+KLHGL
Sbjct  553  LYLNEVFKLHGL  564



>ref|XP_010501553.1| PREDICTED: uncharacterized protein LOC104778823 [Camelina sativa]
Length=820

 Score =   102 bits (253),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIE-GLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVA  58
            GLLQ L I E+ W  +SMDF+E GLPKS G + +LVVVDR +KYAHF+ + HPFTA  VA
Sbjct  230  GLLQLLPILEKVWEDISMDFVEEGLPKSGGHNAVLVVVDRLSKYAHFLLIKHPFTATDVA  289

Query  57   NLYMENVYKLHGLPQGIVS  1
            NL+++ V +LHG P+ I+S
Sbjct  290  NLFIQEVVRLHGFPRSIIS  308



>ref|XP_009762104.1| PREDICTED: uncharacterized protein LOC104214174 [Nicotiana sylvestris]
Length=611

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            G LQPL IPE  W Q++MDFI+ LPKS G +VILVVV R +KYAHFM L HP+TA+ +A 
Sbjct  499  GFLQPLPIPEMVWSQINMDFIDDLPKSKGHEVILVVVYRLSKYAHFMPLKHPYTAQSIAK  558

Query  54   LYMENVYKLHGLPQGIVS  1
             + + V +LHGLP+ I S
Sbjct  559  AFFDVVVRLHGLPEIITS  576



>ref|XP_010418661.1| PREDICTED: uncharacterized protein LOC104704240 [Camelina sativa]
Length=743

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +PE+ W  +SMDF+EGLPKS G + +LVVVDR +K+AHF+ + HPFTA  VAN
Sbjct  420  GLLQPLPVPEKIWKDISMDFVEGLPKSGGNNAVLVVVDRLSKFAHFLIIKHPFTATDVAN  479

Query  54   LYMENVYKLHG  22
            L+++ + +LHG
Sbjct  480  LFIQEIVRLHG  490



>gb|AAL82656.1|AC092387_4 retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|AAM18147.1|AC092172_7 Putative gag-pol polyprotein [Oryza sativa Japonica Group]
Length=1338

 Score =   102 bits (255),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P   W  V+MDF+EGLP+  GK VIL VVDRF+KYAH ++LAH +TAE VA 
Sbjct  943   GLLLPLPVPSAIWSDVAMDFVEGLPRVGGKSVILTVVDRFSKYAHLIALAHSYTAETVAR  1002

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG+P+ IVS
Sbjct  1003  AFFVDIVRLHGVPESIVS  1020



>gb|ABB47037.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1347

 Score =   102 bits (255),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P   W  V+MDF+EGLP+  GK VIL VVDRF+KYAH ++LAH +TAE VA 
Sbjct  952   GLLLPLPVPSAIWSDVAMDFVEGLPRVGGKSVILTVVDRFSKYAHLIALAHSYTAETVAR  1011

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG+P+ IVS
Sbjct  1012  AFFVDIVRLHGVPESIVS  1029



>gb|KFK35335.1| hypothetical protein AALP_AA5G271700 [Arabis alpina]
Length=1702

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IPE+ W  V+MDFIEGLP SNG +VI+VVVDR +KY HF+ L HPF A  VA 
Sbjct  1326  GLLQPLPIPEKIWEDVAMDFIEGLPTSNGVNVIMVVVDRLSKYGHFIGLKHPFNATDVAL  1385

Query  54    LYMENVYKLHGLPQGIVS  1
              + + + +LHG P  IVS
Sbjct  1386  KFAQEIIRLHGYPASIVS  1403



>ref|XP_010513516.1| PREDICTED: uncharacterized protein LOC104789530 [Camelina sativa]
Length=671

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P Q W  +SMDF+EGLP S GK+VILV+VDRF+KY  F++L HP T  +VAN
Sbjct  380  GLLQPLPLPNQIWEDISMDFVEGLPTSQGKNVILVIVDRFSKYGLFLALKHPLTTPEVAN  439

Query  54   LYMENVYKLHGLPQGIVS  1
             ++  + +LHG P  IVS
Sbjct  440  KFIYEIVRLHGYPASIVS  457



>ref|XP_010233012.1| PREDICTED: uncharacterized protein LOC104583042 [Brachypodium 
distachyon]
Length=917

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P++ W  +SMDFI GLPKS G +VILVVVD +TK+ HF++L HPFTA  VA 
Sbjct  242  GLLQPLPVPKRPWQDLSMDFITGLPKSEGYEVILVVVDCYTKFTHFIALKHPFTASVVAK  301

Query  54   LYMENVYKLHGLPQGIVS  1
             ++ NV +LHG+P  I S
Sbjct  302  AFLHNVVRLHGMPLTITS  319



>ref|XP_010104920.1| Transposon Ty3-I Gag-Pol polyprotein [Morus notabilis]
 gb|EXC02267.1| Transposon Ty3-I Gag-Pol polyprotein [Morus notabilis]
Length=398

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  +SMDFIEGLP+S   + ILVVVD  +KY HF+ L HPF+A  VA 
Sbjct  260  GLLQPLPIPNRVWDDISMDFIEGLPRSASYNSILVVVDHLSKYGHFIGLKHPFSANTVAV  319

Query  54   LYMENVYKLHGLPQGIVS  1
            +++ ++ +LHG PQ I+S
Sbjct  320  VFVRDIVRLHGFPQSIIS  337



>gb|AAF13073.1|AC011621_1 putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1661

 Score =   102 bits (254),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL IP+Q W  VS+DF+EGLP SN  + ILVVVDR +KY+HF+ L HPFTA+ V  
Sbjct  1256  GLLSPLPIPQQIWSDVSLDFVEGLPSSNRFNCILVVVDRLSKYSHFIPLKHPFTAKTVVE  1315

Query  54    LYMENVYKLHGLPQGIVS  1
              ++ +V KLHG P  +VS
Sbjct  1316  AFIRDVVKLHGFPNTLVS  1333



>ref|XP_007216187.1| hypothetical protein PRUPE_ppa015897mg [Prunus persica]
 gb|EMJ17386.1| hypothetical protein PRUPE_ppa015897mg [Prunus persica]
Length=842

 Score =   101 bits (252),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   W  +++ FI+GLPKS GKD+ILVVVDR  KY HF++LAHP+ A  VA+
Sbjct  521  GLLQPLPIPTTIWQDIALGFIKGLPKSGGKDIILVVVDRLAKYGHFIALAHPYFAATVAD  580

Query  54   LYMENVYKLHGLPQGIV  4
            L+++ VY+LHG+ + IV
Sbjct  581  LFIKEVYRLHGMSKTIV  597



>gb|ACL52843.1| unknown [Zea mays]
Length=269

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P  AW  ++MDF+EGLP    K+ ++VVVD+F+K++HF++L HPF+A  VA 
Sbjct  71   GLLQPLPVPNGAWQTITMDFVEGLPTYGNKNCVMVVVDKFSKFSHFIALKHPFSALVVAQ  130

Query  54   LYMENVYKLHGLPQGIVS  1
             +M+++ KLHG+P  IVS
Sbjct  131  HFMQHICKLHGMPVAIVS  148



>ref|XP_008356102.1| PREDICTED: uncharacterized protein LOC103419752 [Malus domestica]
Length=882

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL+IP+Q W  ++MDF+EG+P  +G++ ILVVVDR +KY HF+ + HP++A K+  
Sbjct  568  GLLQPLAIPKQIWTDIAMDFVEGIPSVHGRNAILVVVDRLSKYGHFIPIKHPYSAPKITE  627

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ +++LHG+P  IV+
Sbjct  628  VFIKEIFRLHGMPASIVN  645



>ref|XP_008343455.1| PREDICTED: uncharacterized protein LOC103406229 [Malus domestica]
Length=910

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL+IP+Q W  ++MDF+EG+P  +G++ ILVVVDR +KY HF+ + HP++A K+  
Sbjct  596  GLLQPLAIPKQIWTDIAMDFVEGIPSVHGRNAILVVVDRLSKYGHFIPIKHPYSAPKITE  655

Query  54   LYMENVYKLHGLPQGIVS  1
            ++++ +++LHG+P  IV+
Sbjct  656  VFIKEIFRLHGMPASIVN  673



>ref|XP_007220353.1| hypothetical protein PRUPE_ppa015255mg, partial [Prunus persica]
 gb|EMJ21552.1| hypothetical protein PRUPE_ppa015255mg, partial [Prunus persica]
Length=500

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  AWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHG  22
            +W  +SMDFIEGLP S GK VI+VVVDR TKYAHF + AHPF+AEK+A ++++ V+KLHG
Sbjct  189  SWQFISMDFIEGLPHSIGKSVIMVVVDRLTKYAHFTASAHPFSAEKIAAVFIQEVFKLHG  248

Query  21   LPQGIVS  1
            LPQ I+S
Sbjct  249  LPQSIIS  255



>ref|NP_001052201.1| Os04g0191000 [Oryza sativa Japonica Group]
 emb|CAE01900.2| OSJNBa0059D20.8 [Oryza sativa Japonica Group]
 dbj|BAF14115.1| Os04g0191000 [Oryza sativa Japonica Group]
Length=1463

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+  W  +++DFIE LP+  GK VIL VVDRF+KY HF+ LAHP++AE VA 
Sbjct  1047  GLLLPLPVPQGVWTDIALDFIEALPRVRGKSVILTVVDRFSKYCHFIPLAHPYSAESVAQ  1106

Query  54    LYMENVYKLHGLPQGIVS  1
              +   +  LHG+PQ +VS
Sbjct  1107  AFFAEIVHLHGVPQSMVS  1124



>gb|AAM01152.2|AC113336_4 Putative retroelement [Oryza sativa Japonica Group]
Length=575

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQ L +P QAW  VS+DFIEGLPKS   D IL VVD+FTK+A F++L+HPFTA  VA 
Sbjct  308  GLLQTLPVPLQAWSTVSLDFIEGLPKSGKFDTILAVVDKFTKFAKFIALSHPFTALTVAQ  367

Query  54   LYMENVYKLHGLPQGIVS  1
             +++NVY++ G+P+ I+S
Sbjct  368  AFIQNVYEMFGMPRVIIS  385



>gb|AAP44617.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF96628.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=627

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  AWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHG  22
            AW  +SMDFIEGLPKS+GKDVILVVVDR TKY HF++++HP++ E+V  ++M N++KL+G
Sbjct  2    AWTHISMDFIEGLPKSHGKDVILVVVDRLTKYVHFVAMSHPYSVEQVVEVFMNNIHKLYG  61

Query  21   LPQGIVS  1
            +P  IV+
Sbjct  62   MPMAIVT  68



>ref|XP_006575970.1| PREDICTED: uncharacterized protein LOC100803389 [Glycine max]
Length=1457

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL+PL IPEQ W  V+MDFI GLP SNG  VI+VV+DR +KYAH  SL   F +++VA 
Sbjct  992   GLLEPLPIPEQIWEDVAMDFITGLPSSNGHTVIMVVIDRLSKYAHLASLKSDFNSKQVAE  1051

Query  54    LYMENVYKLHGLPQGIVS  1
             L+M+ + KLHG P+ IVS
Sbjct  1052  LFMKTIVKLHGFPRTIVS  1069


 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL+PL IPEQ W  V+MDFI GLP SNG  VI+VV+DR +KYAH  SL   F +++VA 
Sbjct  1245  GLLEPLPIPEQIWEDVAMDFITGLPSSNGHTVIMVVIDRLSKYAHLASLKSDFNSKQVAE  1304

Query  54    LYMENV  37
             L+M+ +
Sbjct  1305  LFMKTI  1310



>ref|XP_010445386.1| PREDICTED: uncharacterized protein LOC104728041 [Camelina sativa]
Length=693

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQ L IPE  W  V MDFI+GLP S GK VI+VVVDR +K AHF++L+HP++A  VA 
Sbjct  355  GLLQQLPIPETVWSDVFMDFIDGLPDSAGKTVIMVVVDRLSKAAHFIALSHPYSALSVAQ  414

Query  54   LYMENVYKLHGLPQGI  7
             Y++NV+KLHG P  I
Sbjct  415  AYLDNVFKLHGCPTSI  430



>gb|EMT23862.1| Alpha-L-fucosidase 2 [Aegilops tauschii]
Length=1100

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQPL +P Q W  +SMDFIEGLPK  GK VIL VVDRF+KYAHF++L H + A  VA  
Sbjct  595  LLQPLEVPSQVWADISMDFIEGLPKVGGKSVILTVVDRFSKYAHFIALGHRYPAASVARA  654

Query  51   YMENVYKLHGLPQGIVS  1
            + + + +LHG+   IVS
Sbjct  655  FFDGIVRLHGVLASIVS  671


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPK  157
            LLQPL +P Q W  +SMDFIEGLPK
Sbjct  515  LLQPLEVPSQVWADISMDFIEGLPK  539



>emb|CAN72998.1| hypothetical protein VITISV_043958 [Vitis vinifera]
Length=1078

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  V+MDFI GLP SNGK  I VVVDR +K  HF++ +HP+ A+ VA 
Sbjct  837  GLLQPLPIPCQVWDBVTMDFIXGLPPSNGKSTIFVVVDRLSKSTHFLAFSHPYXAKMVAE  896

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E + KLHGLP+ I+S
Sbjct  897  KFVEGIVKLHGLPKAIIS  914



>emb|CCI55401.1| PH01B015M02.2 [Phyllostachys edulis]
Length=1655

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  EQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKL  28
            +QAW  ++MDFIEGLP+S G + I+V+VD+F+KYAHF+++AHPFTA +VA  +M+ V++L
Sbjct  613  DQAWQVIAMDFIEGLPRSAGFNCIMVIVDKFSKYAHFIAMAHPFTAFQVAQTFMQQVFRL  672

Query  27   HGLPQGIVS  1
            HGLPQ IVS
Sbjct  673  HGLPQSIVS  681



>ref|XP_008777107.1| PREDICTED: uncharacterized protein LOC103697100 [Phoenix dactylifera]
Length=1488

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W  +SMDF+EGLP S G +VI VVVDR +KYAHF+ + HP+TA+ VA 
Sbjct  1297  GLLQPLPIPNMIWEDISMDFVEGLPTSKGVEVIFVVVDRLSKYAHFIPIKHPYTAKSVAL  1356

Query  54    LYMENVYKLHGLPQGIVS  1
              ++E+V KLHG+P+ I +
Sbjct  1357  TFVESVVKLHGIPKSIFT  1374


 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPLSIP   W  +S+DF+EGL  S G +VI VVVDR ++YAHF+ + HP+TA+ VA 
Sbjct  2    GLLQPLSIPNMIWEDISIDFVEGLLTSKGVEVIFVVVDRLSEYAHFIPIKHPYTAKSVAL  61

Query  54   LYMENVYKLHGLPQGIVS  1
             ++E+V KLHG+ + IVS
Sbjct  62   AFVESVVKLHGITKSIVS  79



>gb|ABA94261.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1369

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             G+LQ L +P  AW  VS+DFIEGLP+S   + ILVVVD+F+KY HF+ L+HPFTA  VA 
Sbjct  1057  GMLQLLPVPAHAWQIVSLDFIEGLPRSATFNCILVVVDKFSKYNHFVPLSHPFTALDVAE  1116

Query  54    LYMENVYKLHGLPQGIVS  1
              YM+++++LHGLPQ ++S
Sbjct  1117  AYMQHIHRLHGLPQSLIS  1134



>ref|XP_008779305.1| PREDICTED: transposon Ty3-G Gag-Pol polyprotein [Phoenix dactylifera]
Length=1179

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP + W  VSMDFIEGLP +NG  VI+VVVDR +KYAHF+ L H F A  V  
Sbjct  818  GLLQPLPIPTRIWTDVSMDFIEGLPTANGHSVIMVVVDRLSKYAHFVPLKHLFIAAMVTK  877

Query  54   LYMENVYKLHGLPQGIVS  1
             ++ NV +LHG+P  IVS
Sbjct  878  AFVANVVRLHGIPTSIVS  895



>ref|XP_010497069.1| PREDICTED: uncharacterized protein LOC104774101 [Camelina sativa]
Length=1049

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P   W  VS+DFIEGLP S G +VILVVVDR +K AHF+ L HPF+A  VAN
Sbjct  925   GLLQPLPVPTAIWEDVSLDFIEGLPMSGGVNVILVVVDRLSKAAHFLGLKHPFSALDVAN  984

Query  54    LYMENVYKLHGLPQGIVS  1
              ++E V +LH  P+ IVS
Sbjct  985   KFVEGVVRLHSFPKSIVS  1002



>ref|XP_004142023.1| PREDICTED: uncharacterized protein LOC101222087 [Cucumis sativus]
Length=3608

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -3

Query  231   LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
             LL P  IP   W  +SMDF+EGL KS G +VI VVVDRF+KY HF+ L HP+TA+ VA+L
Sbjct  1034  LLLPSEIPNSMWRDISMDFVEGLSKSKGYEVIFVVVDRFSKYGHFLPLKHPYTAKTVADL  1093

Query  51    YMENVYKLHGLPQGIVS  1
             ++  + +LHG P+ IVS
Sbjct  1094  FVNEIVRLHGYPKSIVS  1110



>ref|XP_004499590.1| PREDICTED: uncharacterized protein LOC101506525 [Cicer arietinum]
Length=293

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPEQ W  VS+DFI GLPKS G DVI VVVDR +KY+HF+ L   F A  +A 
Sbjct  27   GLLQPLPIPEQIWEDVSIDFITGLPKSKGFDVIFVVVDRLSKYSHFIPLKRHFNARVLAE  86

Query  54   LYMENVYKLHGLPQGIVS  1
            ++ + + +LHG+P  I S
Sbjct  87   VFTKEIVRLHGIPSSIGS  104



>ref|XP_002463949.1| hypothetical protein SORBIDRAFT_01g009436 [Sorghum bicolor]
 gb|EER90947.1| hypothetical protein SORBIDRAFT_01g009436 [Sorghum bicolor]
Length=1450

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P+  W  +++DF+E LP   GK VIL VVDRF+KY +F+ LAHP+TAE VA 
Sbjct  1082  GLLLPLPVPQGIWTDIALDFVEALPSVRGKTVILTVVDRFSKYCYFIPLAHPYTAESVAE  1141

Query  54    LYMENVYKLHGLPQGIVS  1
              +  ++ +LHG+PQ +VS
Sbjct  1142  AFFTDIVRLHGVPQSMVS  1159



>ref|XP_004489081.1| PREDICTED: uncharacterized protein LOC101488814 [Cicer arietinum]
Length=1248

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL IP+Q W  ++MDFI GLP  NG  VI+VVVDR TKYAHF++L   + ++ VA 
Sbjct  1143  GLLHPLPIPQQVWEDIAMDFITGLPIVNGLSVIMVVVDRLTKYAHFLTLKADYNSKTVAE  1202

Query  54    LYMENVYKLHGLPQGIVS  1
              +M N+ KLHG+PQ IVS
Sbjct  1203  AFMSNIVKLHGIPQSIVS  1220



>emb|CAE04958.2| OSJNBa0070D17.9 [Oryza sativa Japonica Group]
Length=394

 Score = 96.7 bits (239),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             LL PL IP+ AW  +SMDFIEGLPKS+GKDVILVVVDR TKYAHF++++HP++ E+V  
Sbjct  205  SLLNPLEIPDMAWTHISMDFIEGLPKSHGKDVILVVVDRLTKYAHFVAMSHPYSVEQVVE  264

Query  54   L--YMENVYKLHG  22
            L  Y +  + + G
Sbjct  265  LQPYRQTAFGIRG  277



>gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; 
Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl 
transferase, Ribonuclease H fold [Medicago truncatula]
Length=1297

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P++ W  +SMDFI GLPKS G + +LVVVDR +KY+HF+ L HP+TA+ +A+
Sbjct  922  GLLQPLPVPDRIWEDLSMDFIMGLPKSKGYEAVLVVVDRLSKYSHFILLKHPYTAKVIAD  981

Query  54   LYMENVYKLHGLPQGIVS  1
            +++  V +LHG+P  IVS
Sbjct  982  VFIREVVRLHGIPLSIVS  999



>gb|KFK39596.1| hypothetical protein AALP_AA3G264600 [Arabis alpina]
Length=1419

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP   W   SMDFI+GLPKS G  VI+VVV+R TKY+HF+SL HP+ A  V  
Sbjct  1044  GLLQPLPIPADVWEDTSMDFIKGLPKSEGFSVIMVVVERITKYSHFISLKHPYEASMVVQ  1103

Query  54    LYMENVYKLHGLPQGIVS  1
             ++++ + +LHG P+ IVS
Sbjct  1104  IFIQEIVRLHGFPKTIVS  1121



>ref|XP_010468466.1| PREDICTED: uncharacterized protein LOC104748542 [Camelina sativa]
Length=1813

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP+  W  V+MDF+EGLP S G + ILVVVDR +KY HF++L HPF+A  VA 
Sbjct  1497  GLLQPLPIPQAVWSDVNMDFVEGLPASQGFNAILVVVDRLSKYGHFIALKHPFSASDVAQ  1556

Query  54    LYMENVYKLHGLPQGIVS  1
              ++  + +LHG P  IVS
Sbjct  1557  KFVAEIVRLHGFPASIVS  1574



>gb|AAK70635.1|AC091238_13 Putative polyprotein [Oryza sativa Japonica Group]
 gb|AAM47286.1|AC122146_5 Putative polyprotein [Oryza sativa Japonica Group]
 gb|AAP52460.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=869

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANL  52
            LLQPL +P  AW  +SMDF+EGLPKS+G D +L VVD+FTK+A F+ L HPFTA  VA  
Sbjct  596  LLQPLPVPLHAWHTISMDFVEGLPKSDGYDTVLAVVDKFTKFAKFIPLTHPFTALLVAKA  655

Query  51   YMENVYKLHGLPQGIVS  1
            ++ N+Y + G+PQ I+S
Sbjct  656  FIHNIYDVFGMPQVIIS  672



>gb|ABA97714.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1287

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P   W  + +DF+E LP+ + K +IL VVDRF+KY HF+ LAHP+TAE VA 
Sbjct  881  GLLQPLPVPSIVWANIGLDFVEALPRVHAKTIILSVVDRFSKYCHFIPLAHPYTAESVAQ  940

Query  54   LYMENVYKLHGLPQGIVS  1
             +  ++ +LHG+ Q IVS
Sbjct  941  AFFIDIVRLHGIHQSIVS  958



>ref|XP_009107707.1| PREDICTED: uncharacterized protein LOC103833373 [Brassica rapa]
Length=495

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL +P   W  +S+ F+EGLP S GK  ILVV+DR +K AHF++L+HP+TA  VA 
Sbjct  361  GLLQPLPVPAGVWESISLVFVEGLPPSAGKHCILVVIDRLSKNAHFLALSHPYTALDVAK  420

Query  54   LYMENVYKLHGLPQGIVS  1
            +Y+  V++LHG+P+ I S
Sbjct  421  VYLNQVFRLHGMPKDITS  438



>gb|AAO17006.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=439

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL +P   W  VSMDFIEG P+  GK VIL VV+RF+KYAHF++L+HP++AE VA+
Sbjct  223  GLLLPLPVPSVVWSDVSMDFIEGFPRVEGKSVILTVVNRFSKYAHFITLSHPYSAESVAH  282

Query  54   LYMENVYKLHGLPQGIVS  1
             +  ++ +LHG+   I+S
Sbjct  283  AFYTDIVRLHGILTLIMS  300



>ref|XP_002443132.1| hypothetical protein SORBIDRAFT_08g010830 [Sorghum bicolor]
 gb|EES16970.1| hypothetical protein SORBIDRAFT_08g010830 [Sorghum bicolor]
Length=1462

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLL PL +P   W  + +DFIE LP+  GK VIL  VDRF+KY HF+ LAHP+ AE VA 
Sbjct  1032  GLLLPLPVPTGVWTDIGLDFIETLPRVKGKSVILTAVDRFSKYCHFIPLAHPYFAESVAQ  1091

Query  54    LYMENVYKLHGLPQGIVS  1
              +   + +LHGLPQ +VS
Sbjct  1092  AFYSGIVRLHGLPQSMVS  1109



>emb|CAE05104.1| OSJNBa0009K15.24 [Oryza sativa Japonica Group]
Length=940

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  PLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYME  43
            PL IP++AWV +S DFIEGL KS+G  VILVVVDRFTK+AH + L HPFTA +VA+   +
Sbjct  846  PLPIPKEAWVDISKDFIEGLLKSDGYTVILVVVDRFTKFAHLIPLRHPFTASQVASAVDK  905

Query  42   NVYKLHGLPQGIVS  1
             V+K HG+P  IVS
Sbjct  906  AVFKTHGIPHSIVS  919



>dbj|BAB02140.1| unnamed protein product [Arabidopsis thaliana]
Length=904

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP+  W  VSMDFI+GLP SNGK VI VVVD F+K  HFM+L+HP++   +A+
Sbjct  765  GLLQPLLIPDSIWSDVSMDFIDGLPMSNGKTVIRVVVDHFSKAVHFMALSHPYSPLTLAH  824

Query  54   LYMENVYKLHGLP  16
             Y++NV+KLH  P
Sbjct  825  AYLDNVFKLHECP  837



>gb|AAF71149.1| pol protein integrase region, partial [Abies alba]
Length=131

 Score = 91.7 bits (226),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  QVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHGLPQ  13
            +VSMDFI GLPKS GK VI+ VVDR TKYAHF +L+HPF A  VA  +ME V KLHG P+
Sbjct  2    KVSMDFITGLPKSEGKSVIMAVVDRLTKYAHFCALSHPFKASTVATTFMETVQKLHGNPK  61

Query  12   GIVS  1
             IVS
Sbjct  62   IIVS  65



>ref|XP_008680288.1| PREDICTED: uncharacterized protein LOC103655285 [Zea mays]
Length=593

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  PLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYME  43
            PL IPE  W  + +DFIE LP+  GK VIL VVDRF+KY HF+ LAHP+T E VA  +  
Sbjct  271  PLPIPEGVWSDIGIDFIEALPRVQGKKVILTVVDRFSKYCHFILLAHPYTTESVAQAFCT  330

Query  42   NVYKLHGLPQGIVS  1
             V +LHG+PQ IVS
Sbjct  331  EVVRLHGVPQSIVS  344



>ref|XP_006593038.1| PREDICTED: uncharacterized protein LOC100791656 [Glycine max]
Length=1776

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPLS PE  W  +SMDFI  LP SNG  VILVVVDRF+K  H  +LA  FTA KVAN
Sbjct  1087  GLLQPLSTPEGVWEDLSMDFITHLPTSNGFSVILVVVDRFSKGVHLGALASGFTAFKVAN  1146

Query  54    LYMENVYKLHGLPQGIVS  1
             L+++ V KLHG P+ IVS
Sbjct  1147  LFLDIVCKLHGFPKSIVS  1164



>gb|AAF71197.1| pol protein integrase region [Pinus brutia]
Length=131

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  QVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHGLPQ  13
            +VSMDFI GLPKS GK VI+VVVDR TKYAHF +L+HPF A  V+  +ME + KLHG P+
Sbjct  2    KVSMDFITGLPKSEGKSVIMVVVDRLTKYAHFCALSHPFRASTVSTAFMETIQKLHGNPK  61

Query  12   GIVS  1
             IVS
Sbjct  62   IIVS  65



>ref|XP_008382786.1| PREDICTED: uncharacterized protein LOC103445548 [Malus domestica]
Length=1140

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP   W  +SMDFI GLP   GK VILV VDR +KYAHF+ LAHP+TA   A 
Sbjct  367  GLLQPLXIPTHVWKDISMDFIIGLPLCKGKSVILVTVDRLSKYAHFIPLAHPYTASMXAQ  426

Query  54   LYMENVYKLHGLPQGI  7
             +++NV+KL G+P  I
Sbjct  427  EFVDNVFKLXGMPSTI  442



>gb|AAF71195.1| pol protein integrase region [Pinus brutia]
Length=131

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  QVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHGLPQ  13
            +VSMDFI GLPKS GK VI+VVVDR TKYAHF +L+HPF A  V+  +ME + KLHG P+
Sbjct  2    KVSMDFITGLPKSEGKSVIMVVVDRLTKYAHFCALSHPFKASTVSTAFMETIQKLHGNPK  61

Query  12   GIVS  1
             IVS
Sbjct  62   IIVS  65



>ref|XP_008650732.1| PREDICTED: uncharacterized protein LOC103631648 [Zea mays]
Length=932

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL PL +P+  W  + +DF+E L ++ GK VIL VVDRF+KY H + LAHP++AE VA 
Sbjct  845  GLLLPLPVPQAFWTDIGLDFVEALSRAGGKSVILTVVDRFSKYCHSIPLAHPYSAESVAQ  904

Query  54   LYMENVYKLHGLPQGIVS  1
             +  ++ +LHG+PQ +VS
Sbjct  905  AFFADIVRLHGVPQSMVS  922



>gb|KFK22215.1| hypothetical protein AALP_AAs67613U000200, partial [Arabis alpina]
Length=953

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IP Q W  +SM+FIEGLPKS+G +V  VVVDR +KYAHF+ L HP+ A  VA 
Sbjct  594  GLLQPLPIPTQVWEDISMNFIEGLPKSDGFEV--VVVDRLSKYAHFLKLKHPYEARIVAL  651

Query  54   LYMENVYKLHGLPQGIVS  1
            L+++ V +LHG P+ I+S
Sbjct  652  LFVQEVVRLHGFPKTIIS  669



>ref|XP_010930470.1| PREDICTED: uncharacterized protein LOC105051646 [Elaeis guineensis]
Length=544

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLLQPL IPE+ W  VSMDFI GLP S GK++I+VVVDR +KY +F++ A  ++   VA 
Sbjct  291  GLLQPLPIPEEIWTDVSMDFINGLPLSFGKEMIMVVVDRLSKYGYFIAFAPSYSVAIVAK  350

Query  54   LYMENVYKLHGLPQGIVS  1
             Y+EN+YKLH + + IVS
Sbjct  351  AYIENIYKLHRMSKSIVS  368



>emb|CAN71306.1| hypothetical protein VITISV_018194 [Vitis vinifera]
Length=279

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  IPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVY  34
            IP + W  +SMDFI+GLP   GK ++LVVVDRF+KYAHF+ ++H + A KVA  + ENV+
Sbjct  104  IPIEVWADISMDFIDGLPPYKGKTILLVVVDRFSKYAHFIPMSHLYIAPKVAQTFFENVF  163

Query  33   KLHGLPQGIVS  1
            KLHG+P  IV 
Sbjct  164  KLHGMPSSIVC  174



>pir||T18348 probable pol polyprotein, truncated - rice blast fungus magnaporthe 
gypsy retrotransposon
 gb|AAA33420.1| reverse transcriptase [Magnaporthe grisea]
Length=1199

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL+PL  PE++W  +SMDFI  LP+SNG D ILVVVDR TK  HF+       AE  AN
Sbjct  825  GLLRPLPTPERSWQHLSMDFITHLPQSNGHDAILVVVDRLTKMRHFVPCKGTCNAEDTAN  884

Query  54   LYMENVYKLHGLPQGIVS  1
            LY+ +V+KLHGLP  IVS
Sbjct  885  LYLHHVWKLHGLPLTIVS  902



>emb|CDR00358.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=356

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            G L+PL IP + W  +++DFI GLP S GK VIL VVDRF+K AHF+ LA   +A++ A 
Sbjct  149  GRLRPLPIPSRPWSHIALDFITGLPSSAGKTVILTVVDRFSKAAHFIPLAKLPSAKETAQ  208

Query  54   LYMENVYKLHGLPQGIVS  1
            + +ENV+++HGLP  +VS
Sbjct  209  IIIENVFRIHGLPSDVVS  226



>ref|XP_008456800.1| PREDICTED: uncharacterized protein LOC103496640 [Cucumis melo]
Length=897

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -3

Query  234  GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
            GLL P  I  Q W  +SMDFI GLPK+ G DVILVVVDRF++Y+H ++L HP+T + VA+
Sbjct  649  GLLVPQEILHQVWSDISMDFINGLPKAKGCDVILVVVDRFSEYSHSLALKHPYTTKSVAD  708

Query  54   LYMENVYKLHGLPQGIV  4
            ++++ + KLHG P  IV
Sbjct  709  IFVKEIVKLHGSPSSIV  725



>gb|AAF71147.1| pol protein integrase region, partial [Abies alba]
Length=131

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  QVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMENVYKLHGLPQ  13
            +VSMDFI GLPK  GK VI+VVVDR TKYAHF +L+HPF A  VA  +ME V KLHG P+
Sbjct  2    KVSMDFITGLPKPEGKSVIMVVVDRLTKYAHFCALSHPFKASTVATHFMETVQKLHGNPK  61

Query  12   GIVS  1
             IVS
Sbjct  62   IIVS  65



>gb|KFK40544.1| hypothetical protein AALP_AA2G009700 [Arabis alpina]
Length=1226

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL +P+Q W  +SMDF+EGLPKS G DV++VVVDR TKYAHF+SL HP TA +VA 
Sbjct  1142  GLLQPLPVPDQVWEDISMDFVEGLPKSEGFDVVMVVVDRLTKYAHFISLQHPVTAAEVAL  1201

Query  54    LYMENV  37
             ++++ V
Sbjct  1202  VFIKEV  1207



>ref|XP_011083470.1| PREDICTED: uncharacterized protein LOC105165998 [Sesamum indicum]
Length=540

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  LSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVANLYMEN  40
            + +P+QAW   SM+FIEGLP   G D ILVVV+R TKY+HF++L HP+TA  +A ++ +N
Sbjct  247  IHVPDQAWSCDSMEFIEGLPSFEGNDSILVVVERLTKYSHFIALKHPYTATSIAKMFFDN  306

Query  39   VYKLHGLPQGIVS  1
            VYKLHGL   I+S
Sbjct  307  VYKLHGLLVSIIS  319



>gb|AAO23078.1| polyprotein [Glycine max]
Length=1552

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  234   GLLQPLSIPEQAWVQVSMDFIEGLPKSNGKDVILVVVDRFTKYAHFMSLAHPFTAEKVAN  55
             GLLQPL IP+Q W  V+MDFI GLP S G  VI+VV+DR TKYAHF+ L   + ++ VA 
Sbjct  1131  GLLQPLPIPQQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAE  1190

Query  54    LYMENVYKLHGLPQGIVS  1
              +M ++ KLHG+P+ IVS
Sbjct  1191  AFMSHIVKLHGIPRSIVS  1208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519253874986