BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c116395_g1_i1 len=452 path=[1:0-451]

Length=452
                                                                      Score     E

ref|XP_009787744.1|  PREDICTED: synaptotagmin-5-like isoform X1         144   1e-39   
ref|XP_009787745.1|  PREDICTED: synaptotagmin-5-like isoform X2         142   5e-39   
ref|XP_008378453.1|  PREDICTED: synaptotagmin-5                         144   2e-37   
ref|XP_009379292.1|  PREDICTED: synaptotagmin-5                         144   3e-37   
ref|XP_007218082.1|  hypothetical protein PRUPE_ppa006397mg             142   4e-37   
ref|XP_009608315.1|  PREDICTED: synaptotagmin-4-like isoform X1         141   2e-36   
ref|XP_009619318.1|  PREDICTED: synaptotagmin-4-like                    141   2e-36   
gb|KHG00739.1|  Extended synaptotagmin-2-A                              140   2e-36   
gb|AII99831.1|  CLB1                                                    140   3e-36   
ref|XP_009776436.1|  PREDICTED: synaptotagmin-4 isoform X2              140   3e-36   
ref|XP_009776432.1|  PREDICTED: synaptotagmin-4 isoform X1              140   5e-36   
ref|XP_004306886.1|  PREDICTED: synaptotagmin-5-like                    140   5e-36   
gb|KHG05048.1|  Extended synaptotagmin-1                                132   6e-36   
ref|XP_007052003.1|  Calcium-dependent lipid-binding (CaLB domain...    139   9e-36   
ref|XP_010092727.1|  Extended synaptotagmin-1                           138   9e-36   
gb|KDP28724.1|  hypothetical protein JCGZ_14495                         139   9e-36   
ref|XP_007052004.1|  Calcium-dependent lipid-binding (CaLB domain...    139   1e-35   
ref|XP_002320076.2|  calcium-dependent lipid-binding family protein     139   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_008232820.1|  PREDICTED: synaptotagmin-5                         139   1e-35   
ref|XP_009762430.1|  PREDICTED: synaptotagmin-4-like                    138   1e-35   
ref|XP_002301308.1|  calcium-dependent lipid-binding family protein     138   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011002093.1|  PREDICTED: synaptotagmin-5-like                    138   2e-35   
gb|KDO85906.1|  hypothetical protein CISIN_1g010372mg                   137   3e-35   
ref|XP_004248576.1|  PREDICTED: synaptotagmin-5-like                    137   3e-35   
gb|KDO85908.1|  hypothetical protein CISIN_1g010372mg                   136   3e-35   
ref|XP_006445211.1|  hypothetical protein CICLE_v10019763mg             136   3e-35   
gb|KDO85905.1|  hypothetical protein CISIN_1g010372mg                   137   4e-35   
ref|XP_011034774.1|  PREDICTED: synaptotagmin-5-like                    137   6e-35   
ref|XP_006445212.1|  hypothetical protein CICLE_v10019763mg             137   6e-35   
ref|XP_009630577.1|  PREDICTED: synaptotagmin-4-like                    136   8e-35   
ref|XP_002511750.1|  calcium lipid binding protein, putative            136   9e-35   Ricinus communis
ref|XP_002276807.1|  PREDICTED: synaptotagmin-5                         136   1e-34   Vitis vinifera
ref|XP_006341725.1|  PREDICTED: synaptotagmin-4-like                    135   1e-34   
ref|XP_010272629.1|  PREDICTED: synaptotagmin-4-like                    135   1e-34   
ref|NP_001231830.1|  CLB1                                               134   3e-34   
ref|XP_010053878.1|  PREDICTED: synaptotagmin-4                         133   1e-33   
ref|XP_004144995.1|  PREDICTED: synaptotagmin-5-like                    133   1e-33   
ref|XP_004160660.1|  PREDICTED: LOW QUALITY PROTEIN: synaptotagmi...    133   1e-33   
gb|AFK45771.1|  unknown                                                 126   1e-33   
ref|XP_008460136.1|  PREDICTED: synaptotagmin-5                         133   1e-33   
ref|XP_007139969.1|  hypothetical protein PHAVU_008G074100g             133   2e-33   
ref|XP_004510925.1|  PREDICTED: synaptotagmin-5-like                    132   3e-33   
gb|KHN29424.1|  Extended synaptotagmin-3                                130   3e-33   
ref|XP_010934089.1|  PREDICTED: synaptotagmin-5-like isoform X3         131   3e-33   
ref|XP_010934087.1|  PREDICTED: synaptotagmin-5-like isoform X2         131   3e-33   
ref|XP_010934086.1|  PREDICTED: synaptotagmin-4-like isoform X1         131   4e-33   
ref|XP_006576394.1|  PREDICTED: synaptotagmin-5-like isoform X2         131   4e-33   
gb|KHN04090.1|  Extended synaptotagmin-2                                131   5e-33   
ref|XP_003521498.1|  PREDICTED: synaptotagmin-5-like isoform X1         131   5e-33   
ref|XP_006602763.1|  PREDICTED: synaptotagmin-5-like                    131   7e-33   
gb|KHN03163.1|  Extended synaptotagmin-2                                131   8e-33   
ref|XP_006339511.1|  PREDICTED: synaptotagmin-4-like isoform X1         130   1e-32   
ref|XP_003534599.1|  PREDICTED: synaptotagmin-5-like                    130   1e-32   
ref|XP_003627654.1|  Extended synaptotagmin-3                           129   2e-32   
ref|XP_003528900.1|  PREDICTED: synaptotagmin-5-like                    129   3e-32   
ref|XP_008783766.1|  PREDICTED: synaptotagmin-5-like                    129   3e-32   
ref|XP_010918986.1|  PREDICTED: synaptotagmin-5-like                    128   5e-32   
ref|XP_010247855.1|  PREDICTED: synaptotagmin-4-like isoform X1         128   8e-32   
ref|XP_007134911.1|  hypothetical protein PHAVU_010G086200g             128   9e-32   
gb|KHN04579.1|  Extended synaptotagmin-2                                127   1e-31   
ref|XP_006829125.1|  hypothetical protein AMTR_s00001p00267880          127   2e-31   
ref|XP_011091137.1|  PREDICTED: synaptotagmin-5                         125   6e-31   
ref|XP_011093190.1|  PREDICTED: synaptotagmin-5-like                    125   8e-31   
ref|NP_191664.1|  calcium-dependent lipid-binding transcriptional...    125   9e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876590.1|  integral membrane single C2 domain protein         125   1e-30   
gb|AES80016.2|  C2 calcium/lipid-binding and GRAM domain protein        124   1e-30   
ref|XP_010469129.1|  PREDICTED: synaptotagmin-5-like                    124   1e-30   
ref|XP_010413499.1|  PREDICTED: synaptotagmin-5-like                    124   1e-30   
ref|XP_010512433.1|  PREDICTED: synaptotagmin-5-like isoform X1         124   1e-30   
ref|XP_008791240.1|  PREDICTED: synaptotagmin-5-like                    123   2e-30   
ref|XP_006360640.1|  PREDICTED: synaptotagmin-4-like                    124   2e-30   
ref|XP_003623798.1|  Extended synaptotagmin-2-A                         124   2e-30   
gb|EPS66529.1|  hypothetical protein M569_08245                         123   3e-30   
ref|XP_004492657.1|  PREDICTED: synaptotagmin-4-like isoform X1         123   4e-30   
gb|EPS62289.1|  hypothetical protein M569_12500                         122   5e-30   
ref|XP_010523704.1|  PREDICTED: synaptotagmin-4-like                    123   5e-30   
ref|XP_006402526.1|  hypothetical protein EUTSA_v10005905mg             122   7e-30   
gb|EYU25714.1|  hypothetical protein MIMGU_mgv1a0050051mg               114   1e-29   
ref|XP_004492658.1|  PREDICTED: synaptotagmin-4-like isoform X2         122   1e-29   
ref|XP_006292241.1|  hypothetical protein CARUB_v10018448mg             122   1e-29   
ref|XP_009389076.1|  PREDICTED: synaptotagmin-5-like                    122   1e-29   
gb|KHF98588.1|  Extended synaptotagmin-2-A                              121   2e-29   
ref|NP_001170442.1|  hypothetical protein                               121   2e-29   Zea mays [maize]
emb|CDX89094.1|  BnaA04g00920D                                          121   2e-29   
ref|XP_009138799.1|  PREDICTED: synaptotagmin-4                         121   2e-29   
emb|CDY42483.1|  BnaC04g21980D                                          120   3e-29   
ref|XP_010559119.1|  PREDICTED: synaptotagmin-4-like                    120   5e-29   
emb|CDX67848.1|  BnaA07g18880D                                          119   9e-29   
ref|XP_009104284.1|  PREDICTED: synaptotagmin-5-like                    118   2e-28   
emb|CDY45675.1|  BnaCnng13400D                                          118   3e-28   
gb|EYU32022.1|  hypothetical protein MIMGU_mgv1a004726mg                118   3e-28   
ref|XP_004240281.2|  PREDICTED: synaptotagmin-5-like                    117   4e-28   
ref|XP_009399496.1|  PREDICTED: synaptotagmin-5-like                    115   3e-27   
ref|XP_004956021.1|  PREDICTED: synaptotagmin-5-like                    115   4e-27   
ref|XP_010056266.1|  PREDICTED: synaptotagmin-5-like                    114   1e-26   
ref|XP_002466063.1|  integral membrane single C2 domain protein         113   2e-26   Sorghum bicolor [broomcorn]
emb|CBI38811.3|  unnamed protein product                                112   3e-26   
ref|XP_010692291.1|  PREDICTED: synaptotagmin-5                         111   8e-26   
emb|CDP17806.1|  unnamed protein product                                110   2e-25   
ref|XP_006664839.1|  PREDICTED: synaptotagmin-5-like                    110   3e-25   
ref|NP_001059439.1|  Os07g0409100                                       108   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459742.1|  integral membrane single C2 domain protein         107   3e-24   Sorghum bicolor [broomcorn]
dbj|BAK06145.1|  predicted protein                                      104   2e-23   
ref|XP_003557309.1|  PREDICTED: synaptotagmin-5                         103   7e-23   
emb|CAA65416.1|  CaLB protein                                           102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004987077.1|  PREDICTED: synaptotagmin-5-like                    101   4e-22   
ref|XP_006651221.1|  PREDICTED: synaptotagmin-5-like                  99.0    2e-21   
dbj|BAJ93871.1|  predicted protein                                    99.8    2e-21   
ref|XP_003558336.1|  PREDICTED: synaptotagmin-5-like                  94.7    1e-19   
gb|EMS53254.1|  Extended synaptotagmin-2-A                            90.1    4e-18   
gb|EMS48933.1|  Synaptotagmin-7                                       90.1    5e-18   
ref|XP_002974430.1|  hypothetical protein SELMODRAFT_101052           89.4    6e-18   
ref|XP_002985728.1|  hypothetical protein SELMODRAFT_122842           89.4    7e-18   
ref|XP_009608318.1|  PREDICTED: synaptotagmin-4-like isoform X2       87.8    2e-17   
ref|XP_002465551.1|  integral membrane single C2 domain protein       86.7    9e-17   Sorghum bicolor [broomcorn]
ref|XP_008653557.1|  PREDICTED: synaptotagmin-5-like                  79.3    3e-14   
tpg|DAA44413.1|  TPA: hypothetical protein ZEAMMB73_731754            78.6    4e-14   
gb|ABF94993.1|  calcium-dependent lipid-binding protein, putative     75.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EMT12410.1|  hypothetical protein F775_10896                       72.0    1e-11   
gb|EEC74875.1|  hypothetical protein OsI_10777                        71.2    2e-11   Oryza sativa Indica Group [Indian rice]
gb|EEE55638.1|  hypothetical protein OsJ_04001                        70.5    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001755175.1|  integral membrane single C2 domain protein       65.5    1e-09   
ref|XP_001763607.1|  integral membrane single C2 domain protein       57.0    1e-06   
emb|CAN70311.1|  hypothetical protein VITISV_022886                   55.5    4e-06   Vitis vinifera
ref|XP_009592572.1|  PREDICTED: synaptotagmin-4-like                  46.6    4e-04   
emb|CAB94131.1|  putative protein                                     48.1    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567107.5|  Calcium-dependent lipid-binding (CaLB domain) f...  48.1    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567106.5|  C2 calcium/lipid-binding endonuclease/exonuclea...  48.1    8e-04   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009787744.1| PREDICTED: synaptotagmin-5-like isoform X1 [Nicotiana sylvestris]
Length=217

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  KMGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFP  46
            KMGLISG L+G++FG+GLMA W+H+MRYRSTKRI+KAV+VKLMGSLNRDDLKK+CGDNFP
Sbjct  16   KMGLISGILMGMIFGVGLMAAWKHMMRYRSTKRISKAVEVKLMGSLNRDDLKKMCGDNFP  75

Query  45   EWVSFPVYEQVKWLN  1
            EW+SFPVYEQVKWLN
Sbjct  76   EWISFPVYEQVKWLN  90



>ref|XP_009787745.1| PREDICTED: synaptotagmin-5-like isoform X2 [Nicotiana sylvestris]
Length=201

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FG+GLMA W+H+MRYRSTKRI+KAV+VKLMGSLNRDDLKK+CGDNFPE
Sbjct  1    MGLISGILMGMIFGVGLMAAWKHMMRYRSTKRISKAVEVKLMGSLNRDDLKKMCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_008378453.1| PREDICTED: synaptotagmin-5 [Malus domestica]
Length=536

 Score =   144 bits (363),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FGI LMA WRH+MRYRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLISGILMGMLFGIALMAGWRHMMRYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_009379292.1| PREDICTED: synaptotagmin-5 [Pyrus x bretschneideri]
Length=547

 Score =   144 bits (362),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FGI LMA WRH+MRYRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLISGILMGMVFGIALMAGWRHMMRYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_007218082.1| hypothetical protein PRUPE_ppa006397mg [Prunus persica]
 gb|EMJ19281.1| hypothetical protein PRUPE_ppa006397mg [Prunus persica]
Length=413

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FGI LMA WRH+MRYRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLISGILMGMVFGIALMAGWRHMMRYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_009608315.1| PREDICTED: synaptotagmin-4-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608316.1| PREDICTED: synaptotagmin-4-like isoform X1 [Nicotiana tomentosiformis]
Length=502

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FG+GLMA W+H+MRYRS KR++KAV+VKLMGSLNRDDLKK+CGDNFPE
Sbjct  1    MGLISGILMGMIFGVGLMAAWKHMMRYRSAKRVSKAVEVKLMGSLNRDDLKKMCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_009619318.1| PREDICTED: synaptotagmin-4-like [Nicotiana tomentosiformis]
 ref|XP_009619319.1| PREDICTED: synaptotagmin-4-like [Nicotiana tomentosiformis]
 ref|XP_009619320.1| PREDICTED: synaptotagmin-4-like [Nicotiana tomentosiformis]
Length=518

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++ GIGLMA W+H+MRYRS KRIAKAVDVKLMG LNRDDLKK+CGDNFPE
Sbjct  1    MGLISGILMGMILGIGLMAAWKHMMRYRSNKRIAKAVDVKLMGCLNRDDLKKVCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|KHG00739.1| Extended synaptotagmin-2-A [Gossypium arboreum]
Length=511

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  LGI+FGI LMA WRH+MRYRSTKRIAKA D+K++G+LNRDDLKKICGDNFPE
Sbjct  1    MGLISGIFLGIIFGISLMAGWRHMMRYRSTKRIAKAADIKVLGALNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|AII99831.1| CLB1 [Nicotiana tabacum]
Length=518

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++ GIGLMA W+H+MRYRS KR+AKAVDVKLMG LNRDDLKK+CGDNFPE
Sbjct  1    MGLISGILMGMILGIGLMAAWKHMMRYRSNKRVAKAVDVKLMGCLNRDDLKKVCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_009776436.1| PREDICTED: synaptotagmin-4 isoform X2 [Nicotiana sylvestris]
Length=518

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++ GIGLMA W+H+MRYRS KR+AKAVDVKLMG LNRDDLKK+CGDNFPE
Sbjct  1    MGLISGILMGMILGIGLMAAWKHMMRYRSNKRVAKAVDVKLMGCLNRDDLKKVCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_009776432.1| PREDICTED: synaptotagmin-4 isoform X1 [Nicotiana sylvestris]
 ref|XP_009776433.1| PREDICTED: synaptotagmin-4 isoform X1 [Nicotiana sylvestris]
 ref|XP_009776434.1| PREDICTED: synaptotagmin-4 isoform X1 [Nicotiana sylvestris]
 ref|XP_009776435.1| PREDICTED: synaptotagmin-4 isoform X1 [Nicotiana sylvestris]
Length=548

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++ GIGLMA W+H+MRYRS KR+AKAVDVKLMG LNRDDLKK+CGDNFPE
Sbjct  1    MGLISGILMGMILGIGLMAAWKHMMRYRSNKRVAKAVDVKLMGCLNRDDLKKVCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_004306886.1| PREDICTED: synaptotagmin-5-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FGI LMA WRH+M YRSTKRIAKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLISGILMGMVFGIALMAGWRHMMAYRSTKRIAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>gb|KHG05048.1| Extended synaptotagmin-1 [Gossypium arboreum]
Length=129

 Score =   132 bits (331),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL+SG  +G++FGI LMA WRH+M+YRSTKRIAKA D+K++G+L+RDDLKKICGDN+PE
Sbjct  1    MGLVSGMFMGMVFGISLMAGWRHMMKYRSTKRIAKAADIKVLGALSRDDLKKICGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_007052003.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
isoform 1 [Theobroma cacao]
 gb|EOX96160.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
isoform 1 [Theobroma cacao]
Length=512

 Score =   139 bits (350),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FGI LMA WRH+MRYRSTKRIAKA D+K++GSL+RDDLKKICG+NFPE
Sbjct  1    MGLISGILMGMIFGISLMAGWRHMMRYRSTKRIAKAADIKVLGSLSRDDLKKICGENFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_010092727.1| Extended synaptotagmin-1 [Morus notabilis]
 gb|EXB52072.1| Extended synaptotagmin-1 [Morus notabilis]
Length=390

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++ GI LMA WRH+MR RSTKRIAKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLISGILMGMIMGIALMAGWRHMMRRRSTKRIAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|KDP28724.1| hypothetical protein JCGZ_14495 [Jatropha curcas]
Length=511

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  LGI+FGIG+MA W+H+M YRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLISGIFLGIIFGIGVMAGWKHMMSYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_007052004.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
isoform 2 [Theobroma cacao]
 gb|EOX96161.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
isoform 2 [Theobroma cacao]
Length=507

 Score =   139 bits (349),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FGI LMA WRH+MRYRSTKRIAKA D+K++GSL+RDDLKKICG+NFPE
Sbjct  1    MGLISGILMGMIFGISLMAGWRHMMRYRSTKRIAKAADIKVLGSLSRDDLKKICGENFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_002320076.2| calcium-dependent lipid-binding family protein [Populus trichocarpa]
 gb|EEE98391.2| calcium-dependent lipid-binding family protein [Populus trichocarpa]
Length=500

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  LGI+FGIGLMA W+H+M+YRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFP+
Sbjct  1    MGLISGIFLGIIFGIGLMAGWKHMMQYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPD  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_008232820.1| PREDICTED: synaptotagmin-5 [Prunus mume]
Length=536

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FGI LMA W H+MRYRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLISGILMGMVFGIALMAGWLHMMRYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_009762430.1| PREDICTED: synaptotagmin-4-like [Nicotiana sylvestris]
Length=490

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++FGIGLMA W+++MRYRSTKRIAKAVDVKLMGSLNRDDLKKICGD FPE
Sbjct  1    MGLISGIMMGMIFGIGLMAGWQYMMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDKFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_002301308.1| calcium-dependent lipid-binding family protein [Populus trichocarpa]
 gb|EEE80581.1| calcium-dependent lipid-binding family protein [Populus trichocarpa]
Length=500

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  LGI+FGIGLMA W+H+M+YRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFP+
Sbjct  1    MGLISGLFLGIVFGIGLMAGWKHMMQYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPD  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_011002093.1| PREDICTED: synaptotagmin-5-like [Populus euphratica]
 ref|XP_011002094.1| PREDICTED: synaptotagmin-5-like [Populus euphratica]
Length=500

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  LGI+FGIGLMA W+H+M+YRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFP+
Sbjct  1    MGLISGLFLGIVFGIGLMAGWKHMMQYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPD  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>gb|KDO85906.1| hypothetical protein CISIN_1g010372mg [Citrus sinensis]
 gb|KDO85907.1| hypothetical protein CISIN_1g010372mg [Citrus sinensis]
Length=398

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA WRH+MRYRSTKRIAKA D+K++GSLNRDDLKKICGDNFP 
Sbjct  1    MGLISGVFMGMIFGIALMAGWRHMMRYRSTKRIAKAADIKILGSLNRDDLKKICGDNFPV  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_004248576.1| PREDICTED: synaptotagmin-5-like [Solanum lycopersicum]
Length=492

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG +LG+MFGIG+MA W+H+MRYRS KR+AKAVDVKLM SLNRDDLKKICGD FPE
Sbjct  1    MGLISGIMLGMMFGIGIMAGWQHMMRYRSRKRVAKAVDVKLMASLNRDDLKKICGDKFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>gb|KDO85908.1| hypothetical protein CISIN_1g010372mg [Citrus sinensis]
 gb|KDO85909.1| hypothetical protein CISIN_1g010372mg [Citrus sinensis]
Length=379

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA WRH+MRYRSTKRIAKA D+K++GSLNRDDLKKICGDNFP 
Sbjct  1    MGLISGVFMGMIFGIALMAGWRHMMRYRSTKRIAKAADIKILGSLNRDDLKKICGDNFPV  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_006445211.1| hypothetical protein CICLE_v10019763mg [Citrus clementina]
 gb|ESR58451.1| hypothetical protein CICLE_v10019763mg [Citrus clementina]
Length=398

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA WRH+MRYRSTKRIAKA D+K++GSLNRDDLKKICGDNFP 
Sbjct  1    MGLISGVFMGMIFGIALMAGWRHMMRYRSTKRIAKAADIKILGSLNRDDLKKICGDNFPI  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|KDO85905.1| hypothetical protein CISIN_1g010372mg [Citrus sinensis]
Length=512

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA WRH+MRYRSTKRIAKA D+K++GSLNRDDLKKICGDNFP 
Sbjct  1    MGLISGVFMGMIFGIALMAGWRHMMRYRSTKRIAKAADIKILGSLNRDDLKKICGDNFPV  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_011034774.1| PREDICTED: synaptotagmin-5-like [Populus euphratica]
 ref|XP_011034781.1| PREDICTED: synaptotagmin-5-like [Populus euphratica]
Length=511

 Score =   137 bits (344),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG   GI+ GIGLMA W+H+M+YRSTKR+AKAVD+KL+GSLNRDDLKKICGDNFP+
Sbjct  1    MGLISGIFFGIILGIGLMAGWKHMMQYRSTKRVAKAVDIKLLGSLNRDDLKKICGDNFPD  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_006445212.1| hypothetical protein CICLE_v10019763mg [Citrus clementina]
 ref|XP_006490958.1| PREDICTED: synaptotagmin-5-like [Citrus sinensis]
 gb|ESR58452.1| hypothetical protein CICLE_v10019763mg [Citrus clementina]
Length=512

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA WRH+MRYRSTKRIAKA D+K++GSLNRDDLKKICGDNFP 
Sbjct  1    MGLISGVFMGMIFGIALMAGWRHMMRYRSTKRIAKAADIKILGSLNRDDLKKICGDNFPI  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_009630577.1| PREDICTED: synaptotagmin-4-like [Nicotiana tomentosiformis]
Length=492

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++FGIGLMA W+++M YRSTKRIAKAVDVKLMGSLNRDDLKKICGD FPE
Sbjct  1    MGLISGIMMGMIFGIGLMAGWQYMMSYRSTKRIAKAVDVKLMGSLNRDDLKKICGDKFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_002511750.1| calcium lipid binding protein, putative [Ricinus communis]
 gb|EEF50419.1| calcium lipid binding protein, putative [Ricinus communis]
Length=515

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI +MA W+H+MRYRSTKRIAKAVD+KL+GSLNRDDLKKICGDNFP+
Sbjct  1    MGLISGIFMGMIFGIAVMAGWKHMMRYRSTKRIAKAVDIKLLGSLNRDDLKKICGDNFPD  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_002276807.1| PREDICTED: synaptotagmin-5 [Vitis vinifera]
 ref|XP_010661593.1| PREDICTED: synaptotagmin-5 [Vitis vinifera]
 ref|XP_010661595.1| PREDICTED: synaptotagmin-5 [Vitis vinifera]
Length=513

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G +FGI LMA W H+MRYRS KR+AKAVD+KL+GSLNR+DLKKICGDNFPE
Sbjct  1    MGLISGILMGTIFGIALMAGWVHMMRYRSIKRVAKAVDIKLLGSLNREDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_006341725.1| PREDICTED: synaptotagmin-4-like [Solanum tuberosum]
Length=490

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++FGIG+MA W+H+MRYRS KRIAKAVDVKLM SLNRDDLKKICGD FPE
Sbjct  1    MGLISGIMMGMIFGIGIMAGWQHMMRYRSRKRIAKAVDVKLMASLNRDDLKKICGDKFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_010272629.1| PREDICTED: synaptotagmin-4-like [Nelumbo nucifera]
Length=524

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G + GI +MA WRH+MRYRSTKRIAKAVD+KL+GSL RDDLKKICGDN+PE
Sbjct  1    MGLISGILMGTIVGIAMMAGWRHMMRYRSTKRIAKAVDIKLLGSLGRDDLKKICGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|NP_001231830.1| CLB1 [Solanum lycopersicum]
 ref|XP_010323781.1| PREDICTED: CLB1 isoform X1 [Solanum lycopersicum]
 ref|XP_010323784.1| PREDICTED: CLB1 isoform X1 [Solanum lycopersicum]
 dbj|BAA24382.1| CLB1 [Solanum lycopersicum]
Length=505

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++ GIGLMA+W+H+ RYRS KRIAKAVDVK+MG L RDDLKK+CGDNFPE
Sbjct  1    MGLISGILMGMICGIGLMAVWKHMTRYRSNKRIAKAVDVKVMGCLCRDDLKKVCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_010053878.1| PREDICTED: synaptotagmin-4 [Eucalyptus grandis]
 gb|KCW78244.1| hypothetical protein EUGRSUZ_D02433 [Eucalyptus grandis]
Length=524

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G +FG+ +MA WRH+MRYRS+KR AKAVD+K++GSLNRDDLKKICG+NFP+
Sbjct  1    MGLISGILMGTIFGVAIMAGWRHMMRYRSSKRTAKAVDIKVLGSLNRDDLKKICGENFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_004144995.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus]
 ref|XP_004154298.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus]
 gb|KGN46228.1| hypothetical protein Csa_6G076760 [Cucumis sativus]
Length=507

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA W+H+MR+RSTKR+AKA D+K++GSL+RDDLKK+CGDNFPE
Sbjct  1    MGLISGIFMGVIFGIALMAGWQHMMRHRSTKRVAKAADMKILGSLSRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_004160660.1| PREDICTED: LOW QUALITY PROTEIN: synaptotagmin-5-like [Cucumis 
sativus]
Length=507

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA W+H+MR+RSTKR+AKA D+K++GSL+RDDLKK+CGDNFPE
Sbjct  1    MGLISGIFMGVIFGIALMAGWQHMMRHRSTKRVAKAADMKILGSLSRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|AFK45771.1| unknown [Medicago truncatula]
Length=148

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA W  +MRYRS KRIAKAVD+K++GSLNR+DLKKICG+N PE
Sbjct  1    MGLISGIFMGMLFGIALMAGWARMMRYRSAKRIAKAVDIKILGSLNREDLKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_008460136.1| PREDICTED: synaptotagmin-5 [Cucumis melo]
 ref|XP_008460137.1| PREDICTED: synaptotagmin-5 [Cucumis melo]
Length=507

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA W+H+MR+RSTKR+AKA D+K++GSL+RDDLKK+CGDNFPE
Sbjct  1    MGLISGIFMGVIFGIALMAGWQHMMRHRSTKRVAKAADMKILGSLSRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_007139969.1| hypothetical protein PHAVU_008G074100g [Phaseolus vulgaris]
 ref|XP_007139970.1| hypothetical protein PHAVU_008G074100g [Phaseolus vulgaris]
 gb|ESW11963.1| hypothetical protein PHAVU_008G074100g [Phaseolus vulgaris]
 gb|ESW11964.1| hypothetical protein PHAVU_008G074100g [Phaseolus vulgaris]
Length=579

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  LG++FGI LMA W  +M+YRS KRIAKAVD+KL+GSLNRDDLKKICGDNFP+
Sbjct  1    MGLFSGIFLGMLFGIALMAAWERMMKYRSAKRIAKAVDIKLLGSLNRDDLKKICGDNFPD  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_004510925.1| PREDICTED: synaptotagmin-5-like [Cicer arietinum]
Length=502

 Score =   132 bits (331),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA W  ++RYRS+KRIAKAVDVKL+GSLNRDDLKKICG+N PE
Sbjct  1    MGLISGIFMGMVFGIALMAGWARMIRYRSSKRIAKAVDVKLLGSLNRDDLKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|KHN29424.1| Extended synaptotagmin-3 [Glycine soja]
Length=334

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  LG++ GI LMA W+ +M YRS KRIAKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLFSGIFLGMVLGIALMAAWQRMMTYRSAKRIAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP+YEQVKWLN
Sbjct  61   WISFPIYEQVKWLN  74



>ref|XP_010934089.1| PREDICTED: synaptotagmin-5-like isoform X3 [Elaeis guineensis]
Length=403

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G M GI LMA W  +MRYRSTKRIAKAVD+KL+GSLNRDDLKK+CGDN+PE
Sbjct  1    MGLISGMVMGTMVGIALMAGWSRMMRYRSTKRIAKAVDIKLLGSLNRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_010934087.1| PREDICTED: synaptotagmin-5-like isoform X2 [Elaeis guineensis]
Length=454

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G M GI LMA W  +MRYRSTKRIAKAVD+KL+GSLNRDDLKK+CGDN+PE
Sbjct  1    MGLISGMVMGTMVGIALMAGWSRMMRYRSTKRIAKAVDIKLLGSLNRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_010934086.1| PREDICTED: synaptotagmin-4-like isoform X1 [Elaeis guineensis]
Length=510

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G M GI LMA W  +MRYRSTKRIAKAVD+KL+GSLNRDDLKK+CGDN+PE
Sbjct  1    MGLISGMVMGTMVGIALMAGWSRMMRYRSTKRIAKAVDIKLLGSLNRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_006576394.1| PREDICTED: synaptotagmin-5-like isoform X2 [Glycine max]
Length=524

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  +G++FGI LMA W  +MRYRS KRIAKA D+KL+GSLNRDDLKKICGDN PE
Sbjct  1    MGLFSGIFMGVLFGIALMAGWARMMRYRSAKRIAKAADIKLLGSLNRDDLKKICGDNLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|KHN04090.1| Extended synaptotagmin-2 [Glycine soja]
Length=535

 Score =   131 bits (330),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  +G++FGI LMA W  +MRYRS KRIAKA D+KL+GSLNRDDLKKICGDN PE
Sbjct  1    MGLFSGIFMGVLFGIALMAGWARMMRYRSAKRIAKAADIKLLGSLNRDDLKKICGDNLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_003521498.1| PREDICTED: synaptotagmin-5-like isoform X1 [Glycine max]
Length=535

 Score =   131 bits (330),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  +G++FGI LMA W  +MRYRS KRIAKA D+KL+GSLNRDDLKKICGDN PE
Sbjct  1    MGLFSGIFMGVLFGIALMAGWARMMRYRSAKRIAKAADIKLLGSLNRDDLKKICGDNLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_006602763.1| PREDICTED: synaptotagmin-5-like [Glycine max]
Length=522

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  LG++ GI LMA W+ +M YRS KRIAKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLFSGIFLGMVLGIALMAAWQRMMTYRSAKRIAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|KHN03163.1| Extended synaptotagmin-2 [Glycine soja]
Length=534

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  LG++ GI LMA W+ +M YRS KRIAKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLFSGIFLGMVLGIALMAAWQRMMTYRSAKRIAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_006339511.1| PREDICTED: synaptotagmin-4-like isoform X1 [Solanum tuberosum]
 ref|XP_006339512.1| PREDICTED: synaptotagmin-4-like isoform X2 [Solanum tuberosum]
 ref|XP_006339513.1| PREDICTED: synaptotagmin-4-like isoform X3 [Solanum tuberosum]
Length=507

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLI+G L G++ GIGLMA+W+H+ RYRS KRIAKAVDV +MG L RDDLKK+CGDNFPE
Sbjct  1    MGLITGILTGMICGIGLMAVWKHMTRYRSNKRIAKAVDVTVMGCLCRDDLKKVCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_003534599.1| PREDICTED: synaptotagmin-5-like [Glycine max]
Length=535

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  LG++ GI LMA W+ +M YRS KRIAKAVD+KL+GSLNRDDLKKICGDNFPE
Sbjct  1    MGLFSGIFLGMVLGIALMAAWQRMMTYRSAKRIAKAVDIKLLGSLNRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP+YEQVKWLN
Sbjct  61   WISFPIYEQVKWLN  74



>ref|XP_003627654.1| Extended synaptotagmin-3 [Medicago truncatula]
 gb|AET02130.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=513

 Score =   129 bits (325),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  +G++FGI LMA W  +MRYRS KRIAKAVD+K++GSLNR+DLKKICG+N PE
Sbjct  1    MGLISGIFMGMLFGIALMAGWARMMRYRSAKRIAKAVDIKILGSLNREDLKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_003528900.1| PREDICTED: synaptotagmin-5-like [Glycine max]
Length=524

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  +G++FGI LMA W  +M+YRS KRIAKA D+KL+GSLNRDDLKKICGDN PE
Sbjct  1    MGLFSGIFMGVLFGIALMAGWARMMKYRSAKRIAKAADIKLLGSLNRDDLKKICGDNLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_008783766.1| PREDICTED: synaptotagmin-5-like [Phoenix dactylifera]
Length=593

 Score =   129 bits (325),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G M GI L+A W  +MRYRSTKR+AKAVD+KL+GSLNRDDLKK+CGDN+PE
Sbjct  1    MGLISGMVVGTMVGIALVAGWSRMMRYRSTKRVAKAVDIKLLGSLNRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_010918986.1| PREDICTED: synaptotagmin-5-like [Elaeis guineensis]
Length=511

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ GI L+A W  +MRYRSTKR+AKAVD+KL+GSLNRDDLKK+CGDN+PE
Sbjct  1    MGLISGMVMGMVLGIALVAGWSRMMRYRSTKRVAKAVDIKLLGSLNRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPAYEQVKWLN  74



>ref|XP_010247855.1| PREDICTED: synaptotagmin-4-like isoform X1 [Nelumbo nucifera]
Length=554

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++ GI LMA W H+MRYRST R+ KA+D+KL+G L+RDDLKKICGDN+PE
Sbjct  1    MGLISGILMGMIVGIALMAGWYHMMRYRSTNRVTKAIDIKLLGCLSRDDLKKICGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_007134911.1| hypothetical protein PHAVU_010G086200g [Phaseolus vulgaris]
 gb|ESW06905.1| hypothetical protein PHAVU_010G086200g [Phaseolus vulgaris]
Length=512

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  +G++FGI LMA W  +MRYRS KR+AKA DVKL+ SLNRDDLKKICGDN PE
Sbjct  1    MGLFSGIFMGVVFGIALMAGWARMMRYRSAKRVAKAADVKLLASLNRDDLKKICGDNLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|KHN04579.1| Extended synaptotagmin-2 [Glycine soja]
Length=524

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  +G++FGI LMA W  +M+YRS KR AKA D+KL+GSLNRDDLKKICGDN PE
Sbjct  1    MGLFSGIFMGVLFGIALMAGWARMMKYRSAKRFAKAADIKLLGSLNRDDLKKICGDNLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_006829125.1| hypothetical protein AMTR_s00001p00267880 [Amborella trichopoda]
 gb|ERM96541.1| hypothetical protein AMTR_s00001p00267880 [Amborella trichopoda]
Length=508

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG  LG++ GI LMA W+ +MRYR TKR+AKAVD+K++GSLNRDDLKK+CGDN+PE
Sbjct  1    MGLISGLFLGMVAGIALMAGWQRMMRYRGTKRVAKAVDLKILGSLNRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPAYEQVKWLN  74



>ref|XP_011091137.1| PREDICTED: synaptotagmin-5 [Sesamum indicum]
Length=512

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++FGI LMA W+++M+YR+TKR+AKAVD+KL+ SLNR+D+KKICG+N PE
Sbjct  1    MGLISGMVMGMLFGIALMAGWKYMMQYRATKRVAKAVDIKLLSSLNREDMKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_011093190.1| PREDICTED: synaptotagmin-5-like [Sesamum indicum]
Length=495

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G+MFGIGLMA W+H+M YR+ KR+AKA+DV+ + SLNRDDLKKICG+ FP 
Sbjct  1    MGLISGIVMGMMFGIGLMAGWKHMMEYRNKKRLAKAIDVRSLSSLNRDDLKKICGETFPC  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|NP_191664.1| calcium-dependent lipid-binding transcriptional regulator [Arabidopsis 
thaliana]
 ref|NP_001030908.1| calcium-dependent lipid-binding transcriptional regulator [Arabidopsis 
thaliana]
 emb|CAB94141.1| CaLB protein [Arabidopsis thaliana]
 gb|AAO42810.1| At3g61050 [Arabidopsis thaliana]
 dbj|BAE99336.1| CaLB protein [Arabidopsis thaliana]
 gb|AEE80144.1| calcium-dependent lipid-binding transcriptional regulator [Arabidopsis 
thaliana]
 gb|AEE80145.1| calcium-dependent lipid-binding transcriptional regulator [Arabidopsis 
thaliana]
Length=510

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ LMA W  +M +RS+KR+AKAVD+KL+GSL+RDDLKKICGDNFP+
Sbjct  1    MGLISGILFGIIFGVALMAGWSRMMTHRSSKRVAKAVDMKLLGSLSRDDLKKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_002876590.1| integral membrane single C2 domain protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52849.1| integral membrane single C2 domain protein [Arabidopsis lyrata 
subsp. lyrata]
Length=510

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ LMA W  +M +RS+KR+AKAVD+KL+GSL+RDDLKKICGDNFP+
Sbjct  1    MGLISGILFGIIFGVALMAGWSRMMTHRSSKRVAKAVDMKLLGSLSRDDLKKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>gb|AES80016.2| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=514

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL  G  LG++FG+ LMA W  +M YRS KRIAKAVD+KL+GSLNRDDLKKICG+N PE
Sbjct  1    MGLFFGIFLGVLFGVALMAGWERMMTYRSRKRIAKAVDIKLLGSLNRDDLKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_010469129.1| PREDICTED: synaptotagmin-5-like [Camelina sativa]
Length=510

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ +MA W  +M +RS+KRIAKAVD+KL+GSL+RDDLKKICGDNFP+
Sbjct  1    MGLISGILFGIIFGVAIMAGWSRMMTHRSSKRIAKAVDMKLLGSLSRDDLKKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_010413499.1| PREDICTED: synaptotagmin-5-like [Camelina sativa]
Length=510

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ +MA W  +M +RS+KRIAKAVD+KL+GSL+RDDLKKICGDNFP+
Sbjct  1    MGLISGILFGIIFGVAIMAGWSRMMTHRSSKRIAKAVDMKLLGSLSRDDLKKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_010512433.1| PREDICTED: synaptotagmin-5-like isoform X1 [Camelina sativa]
Length=510

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ +MA W  +M +RS+KRIAKAVD+KL+GSL+RDDLKKICGDNFP+
Sbjct  1    MGLISGILFGIIFGVAIMAGWSRMMTHRSSKRIAKAVDMKLLGSLSRDDLKKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_008791240.1| PREDICTED: synaptotagmin-5-like [Phoenix dactylifera]
Length=390

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G+  GI L+A W  +MRYRST+R+AKAVD+KL+GSL RDDLKK+CGDN+PE
Sbjct  1    MGLISGMVVGMAVGIALVAGWSRMMRYRSTQRVAKAVDIKLLGSLTRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPAYEQVKWLN  74



>ref|XP_006360640.1| PREDICTED: synaptotagmin-4-like [Solanum tuberosum]
Length=513

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLI+G L+G++FG+GLMA W+++  YRSTKR +KAV+V LM SL+RDDLKK+CGD FPE
Sbjct  1    MGLITGILMGMIFGVGLMAAWKYMTSYRSTKRSSKAVEVNLMSSLSRDDLKKMCGDKFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_003623798.1| Extended synaptotagmin-2-A [Medicago truncatula]
Length=566

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL  G  LG++FG+ LMA W  +M YRS KRIAKAVD+KL+GSLNRDDLKKICG+N PE
Sbjct  1    MGLFFGIFLGVLFGVALMAGWERMMTYRSRKRIAKAVDIKLLGSLNRDDLKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|EPS66529.1| hypothetical protein M569_08245, partial [Genlisea aurea]
Length=456

 Score =   123 bits (308),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G+  GI LMA W+H+M YR+ +RI KAVD+KL+ +LNRDD+KKICGD FPE
Sbjct  1    MGLISGIVMGLPIGIALMAGWKHMMNYRANQRITKAVDIKLLSTLNRDDIKKICGDTFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_004492657.1| PREDICTED: synaptotagmin-4-like isoform X1 [Cicer arietinum]
Length=542

 Score =   123 bits (309),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL  G  +GI+FGI LMA W  +M YRS +RIAKA+D+KL+GSLNR+DLKKICG+N PE
Sbjct  1    MGLFFGIFIGIVFGIALMAGWEKMMAYRSARRIAKAIDIKLLGSLNREDLKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>gb|EPS62289.1| hypothetical protein M569_12500, partial [Genlisea aurea]
Length=442

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG +LGI FGI LMA W ++MRYRST R+AKAVD+KL+ SL R+D+K+ICG++ PE
Sbjct  1    MGLISGMVLGIAFGISLMAGWNYMMRYRSTSRVAKAVDIKLLSSLTREDMKRICGESIPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_010523704.1| PREDICTED: synaptotagmin-4-like [Tarenaya hassleriana]
Length=506

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG   G++FG+ LMA W  +MR+R++KR++KAVD+KL+GSL+RDDLKKICGDNFPE
Sbjct  1    MGLISGIFFGVIFGVVLMAGWSRMMRHRTSKRVSKAVDMKLLGSLSRDDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_006402526.1| hypothetical protein EUTSA_v10005905mg [Eutrema salsugineum]
 gb|ESQ43979.1| hypothetical protein EUTSA_v10005905mg [Eutrema salsugineum]
Length=508

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ LMA W  +M +R++KR+AKAVD+KL+GSL+R+DLKKICGDNFP+
Sbjct  1    MGLISGILFGIIFGVALMAGWSRMMTHRTSKRVAKAVDMKLLGSLSREDLKKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>gb|EYU25714.1| hypothetical protein MIMGU_mgv1a0050051mg, partial [Erythranthe 
guttata]
Length=86

 Score =   114 bits (285),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ GI LMA W+++M +RS KRI+KA D+KL+ SL RDDL+KICG++FPE
Sbjct  1    MGLISGMVMGMLLGIALMAGWKYMMTHRSIKRISKAADIKLLSSLKRDDLRKICGESFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_004492658.1| PREDICTED: synaptotagmin-4-like isoform X2 [Cicer arietinum]
Length=520

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL  G  +GI+FGI LMA W  +M YRS +RIAKA+D+KL+GSLNR+DLKKICG+N PE
Sbjct  1    MGLFFGIFIGIVFGIALMAGWEKMMAYRSARRIAKAIDIKLLGSLNREDLKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_006292241.1| hypothetical protein CARUB_v10018448mg [Capsella rubella]
 gb|EOA25139.1| hypothetical protein CARUB_v10018448mg [Capsella rubella]
Length=510

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ LMA W  +M +RS+KR+AKAVD+KL+GSL+R+DLKKICGDNFP+
Sbjct  1    MGLISGILFGIVFGVALMAGWSRMMTHRSSKRVAKAVDMKLLGSLSREDLKKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP ++QVKWLN
Sbjct  61   WISFPAFDQVKWLN  74



>ref|XP_009389076.1| PREDICTED: synaptotagmin-5-like [Musa acuminata subsp. malaccensis]
Length=520

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G + GI LMA W  +MR RSTKRI KA D+KL+GSL+RDDLKK+CGDN+PE
Sbjct  1    MGLISGLVMGALVGIALMAGWSRMMRRRSTKRILKAADIKLLGSLSRDDLKKLCGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            WVSFP+YEQVKWLN
Sbjct  61   WVSFPLYEQVKWLN  74



>gb|KHF98588.1| Extended synaptotagmin-2-A [Gossypium arboreum]
Length=469

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L+G++FG+ LMA W  +M+YRS KRI KAVD+K + +LNRDDL+KICGDN+PE
Sbjct  1    MGLISGILMGMIFGVSLMAGWLQMMKYRSGKRIGKAVDIKTLSTLNRDDLRKICGDNYPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQ KWLN
Sbjct  61   WISFPVFEQAKWLN  74



>ref|NP_001170442.1| hypothetical protein [Zea mays]
 ref|XP_008651775.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN37014.1| unknown [Zea mays]
 tpg|DAA60346.1| TPA: hypothetical protein ZEAMMB73_800441 [Zea mays]
 tpg|DAA60347.1| TPA: hypothetical protein ZEAMMB73_800441 [Zea mays]
Length=501

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ G+ +MA W  VMR RSTKRIAKA D+K++GSL+RDDL+K+CGDNFPE
Sbjct  1    MGLISGMMMGVIVGVAIMAGWSRVMRRRSTKRIAKAADIKVLGSLSRDDLRKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPQFEQVKWLN  74



>emb|CDX89094.1| BnaA04g00920D [Brassica napus]
Length=474

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ LMA W  +M +RS+KR+AKAVD+KL+GSL+R+DL KICGDNFP+
Sbjct  1    MGLISGILFGIIFGVALMAGWSRMMSHRSSKRVAKAVDMKLLGSLSREDLMKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_009138799.1| PREDICTED: synaptotagmin-4 [Brassica rapa]
 ref|XP_009138800.1| PREDICTED: synaptotagmin-4 [Brassica rapa]
Length=505

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ LMA W  +M +RS+KR+AKAVD+KL+GSL+R+DL KICGDNFP+
Sbjct  1    MGLISGILFGIIFGVALMAGWSRMMSHRSSKRVAKAVDMKLLGSLSREDLMKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>emb|CDY42483.1| BnaC04g21980D [Brassica napus]
Length=474

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ LMA W  +M +RS+KR+AKAVD+KL+GSL+R+DL KICGDNFP+
Sbjct  1    MGLISGILFGIIFGLALMAGWSRMMSHRSSKRVAKAVDMKLLGSLSREDLMKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_010559119.1| PREDICTED: synaptotagmin-4-like [Tarenaya hassleriana]
Length=513

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG   G++FGI LMA W  +MR+R++KR++KAVD+KL+GSL+R+DLKKICGDNFP 
Sbjct  1    MGLISGIFFGVIFGIALMAGWSRMMRHRTSKRVSKAVDMKLLGSLSREDLKKICGDNFPG  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>emb|CDX67848.1| BnaA07g18880D [Brassica napus]
Length=474

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ +MA W  +M +RS+KR+AKAVD+KL+GSL+R+DL KICGDNFP+
Sbjct  1    MGLISGILFGIIFGVAIMAGWARMMTHRSSKRVAKAVDMKLLGSLSREDLIKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>ref|XP_009104284.1| PREDICTED: synaptotagmin-5-like [Brassica rapa]
 ref|XP_009104285.1| PREDICTED: synaptotagmin-5-like [Brassica rapa]
Length=505

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ +MA W  +M +R++KR+AKAVD+KL+GSL+R+DL KICGDNFP+
Sbjct  1    MGLISGILFGIIFGVAIMAGWARMMTHRTSKRVAKAVDMKLLGSLSREDLIKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>emb|CDY45675.1| BnaCnng13400D [Brassica napus]
Length=505

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG L GI+FG+ +MA W  +M +R++KR+AKAVD+KL+GSL+R+DL KICGDNFP+
Sbjct  1    MGLISGILFGIVFGVAIMAGWARMMTHRTSKRVAKAVDMKLLGSLSREDLIKICGDNFPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPAFEQVKWLN  74



>gb|EYU32022.1| hypothetical protein MIMGU_mgv1a004726mg [Erythranthe guttata]
Length=512

 Score =   118 bits (295),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++FGI LMA W+++M +RS KR+AKAVD+KL+ SL+++D+KKICG+N PE
Sbjct  1    MGLISGMVMGMVFGIALMAGWKYMMGHRSRKRVAKAVDIKLLSSLSKEDMKKICGENCPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>ref|XP_004240281.2| PREDICTED: synaptotagmin-5-like [Solanum lycopersicum]
Length=503

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            M LI+G L+G++FG+GLMA W+++  YRSTKR +KAV+V LM SL+RDDLKK+C D FPE
Sbjct  1    MVLIAGILMGMIFGVGLMAAWKYMTSYRSTKRSSKAVEVNLMSSLSRDDLKKMCDDKFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPVYEQVKWLN
Sbjct  61   WISFPVYEQVKWLN  74



>ref|XP_009399496.1| PREDICTED: synaptotagmin-5-like [Musa acuminata subsp. malaccensis]
 ref|XP_009399497.1| PREDICTED: synaptotagmin-5-like [Musa acuminata subsp. malaccensis]
Length=521

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G + GI LMA W  VM+ RS KR+AKAVD+KL+G L RDDLKK+CGD++PE
Sbjct  1    MGLISGLVMGSLVGIALMAGWSRVMKSRSIKRVAKAVDIKLLGFLGRDDLKKLCGDSYPE  60

Query  42   WVSFPVYEQVKWLN  1
            WVSFP++EQVKWLN
Sbjct  61   WVSFPLFEQVKWLN  74



>ref|XP_004956021.1| PREDICTED: synaptotagmin-5-like [Setaria italica]
Length=508

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ G+ +MA W  VM  RS KRIAKA D+K++GSL RDDLKK+CGDNFPE
Sbjct  1    MGLISGMVMGMIVGVAIMAGWSRVMLRRSRKRIAKAADIKVLGSLGRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQVKWLN
Sbjct  61   WISFPQFEQVKWLN  74



>ref|XP_010056266.1| PREDICTED: synaptotagmin-5-like [Eucalyptus grandis]
 gb|KCW72906.1| hypothetical protein EUGRSUZ_E01350 [Eucalyptus grandis]
Length=518

 Score =   114 bits (284),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL SG  +G + G+ LM  W ++MR RS KRIAKA+D+KL+G L+R+DLKKICGDNFPE
Sbjct  1    MGLTSGVFMGTVVGVALMFGWSYMMRRRSAKRIAKAMDIKLLGCLDRNDLKKICGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP +EQ KWLN
Sbjct  61   WISFPEFEQAKWLN  74



>ref|XP_002466063.1| integral membrane single C2 domain protein [Sorghum bicolor]
 gb|EER93061.1| integral membrane single C2 domain protein [Sorghum bicolor]
Length=504

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL+SG + G++ G+ LMA W  +MR R+ KR+AKA D+ ++GSL+RDDLKK+CGDNFPE
Sbjct  1    MGLVSGMVAGLLLGVALMAAWSRMMRRRTAKRVAKAADINILGSLSRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            WVSF  +EQVKWLN
Sbjct  61   WVSFQQFEQVKWLN  74



>emb|CBI38811.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  MAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            MA W H+MRYRS KR+AKAVD+KL+GSLNR+DLKKICGDNFPEW+SFPVYEQVKWLN
Sbjct  1    MAGWVHMMRYRSIKRVAKAVDIKLLGSLNREDLKKICGDNFPEWISFPVYEQVKWLN  57



>ref|XP_010692291.1| PREDICTED: synaptotagmin-5 [Beta vulgaris subsp. vulgaris]
 ref|XP_010692292.1| PREDICTED: synaptotagmin-5 [Beta vulgaris subsp. vulgaris]
Length=499

 Score =   111 bits (277),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG +LG++ GI +MA W  +M++RS KR +KA D+K++ SL R++LKKICG++FPE
Sbjct  1    MGLISGMMLGMIVGIAVMAGWHRMMQHRSKKRTSKAADIKVLASLGREELKKICGESFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFPV+EQVKWLN
Sbjct  61   WISFPVFEQVKWLN  74



>emb|CDP17806.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   110 bits (275),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  MAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            MA W+H+MRYRS KRIAKAVD+KL+ SL+RDDLKKICG+N+PEW+SFPV+EQVKWLN
Sbjct  1    MAGWQHMMRYRSKKRIAKAVDIKLLSSLDRDDLKKICGENYPEWISFPVFEQVKWLN  57



>ref|XP_006664839.1| PREDICTED: synaptotagmin-5-like [Oryza brachyantha]
Length=519

 Score =   110 bits (274),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ G+ LMA W H+M+ RS KRIAKA D+K++GSL RDDLKK+CGDNFPE
Sbjct  1    MGLISGMVMGMVVGVALMAGWSHMMQRRSRKRIAKAADIKVLGSLGRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPQYEQVKWLN  74



>ref|NP_001059439.1| Os07g0409100 [Oryza sativa Japonica Group]
 dbj|BAC81175.1| putative CLB1 protein (calcium-dependent lipid binding) protein 
[Oryza sativa Japonica Group]
 dbj|BAF21353.1| Os07g0409100 [Oryza sativa Japonica Group]
 gb|EEC81896.1| hypothetical protein OsI_25718 [Oryza sativa Indica Group]
 gb|EEE67011.1| hypothetical protein OsJ_23930 [Oryza sativa Japonica Group]
Length=515

 Score =   108 bits (269),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ G+ LMA W  VM+ RS KRIAKA D+K++GSL RDDLKK+CGDNFPE
Sbjct  1    MGLISGMVMGMVVGVALMAGWSRVMQRRSRKRIAKAADIKVLGSLGRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPQYEQVKWLN  74



>ref|XP_002459742.1| integral membrane single C2 domain protein [Sorghum bicolor]
 gb|EER96263.1| integral membrane single C2 domain protein [Sorghum bicolor]
Length=508

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ G+ +MA W  VMR RSTKR+AKA D+K++GSL RDDL+K+CGDNFPE
Sbjct  1    MGLISGMVMGMVVGVAIMAGWSRVMRRRSTKRVAKAADIKVLGSLTRDDLRKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            WVSFP +EQVKWLN
Sbjct  61   WVSFPQFEQVKWLN  74



>dbj|BAK06145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   104 bits (260),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG ++G + G+ L+A W H M  R+ KR AKA ++  +GSLNR+DL+KICG+N P+
Sbjct  1    MGFISGIMMGFIVGVALIAGWAHAMSRRAHKRSAKAAEISALGSLNREDLRKICGENLPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP Y+QVKWLN
Sbjct  61   WISFPEYDQVKWLN  74



>ref|XP_003557309.1| PREDICTED: synaptotagmin-5 [Brachypodium distachyon]
Length=509

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGLISG ++G++ G+ +MA W H+M+ RS KRIAKA D+K++G L RD+LKK+CGDNFPE
Sbjct  1    MGLISGMVMGVVVGVAIMAGWSHLMQRRSRKRIAKAADIKVLGCLGRDELKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPQYEQVKWLN  74



>emb|CAA65416.1| CaLB protein [Arabidopsis thaliana]
Length=493

 Score =   102 bits (254),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  MAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            MA W  +M +RS+KR+AKAVD+KL+GSL+RDDLKKICGDNFP+W+SFP +EQVKWLN
Sbjct  1    MAGWSRMMTHRSSKRVAKAVDMKLLGSLSRDDLKKICGDNFPQWISFPAFEQVKWLN  57



>ref|XP_004987077.1| PREDICTED: synaptotagmin-5-like [Setaria italica]
Length=520

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG ++G++ G+ L+A W   M  R+ KR  KA D+  +GSLNR+D+KKICG+N P+
Sbjct  1    MGFISGVIMGMIVGVALIAGWARTMARRAAKRSNKAADINSLGSLNREDVKKICGENLPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPEYEQVKWLN  74



>ref|XP_006651221.1| PREDICTED: synaptotagmin-5-like [Oryza brachyantha]
Length=461

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG L+G++ G+ L+A W   M  R  KR A A DV  + SL+R+D+KKICG+N PE
Sbjct  1    MGFISGVLMGMIVGVALIAGWSRAMARRVAKRSALAADVNALASLDREDVKKICGENLPE  60

Query  42   WVSFPVYEQVKWLN  1
            WVSFP YEQVKWLN
Sbjct  61   WVSFPEYEQVKWLN  74



>dbj|BAJ93871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG +SG ++G++ G+ +MA W  VM+ R+ KR+AKA D+ ++GSL RDDLKK+CGDNFPE
Sbjct  1    MGFLSGVVMGLVVGVVIMAGWSRVMQRRTRKRVAKAADIMVLGSLGRDDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPQYEQVKWLN  74



>ref|XP_003558336.1| PREDICTED: synaptotagmin-5-like [Brachypodium distachyon]
Length=497

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG ++GI+ G+ L+A W H M  R+ KR AKA D+  +GSL+R+D+KKICGDN PE
Sbjct  1    MGFISGIMMGIIVGVALIAGWAHTMARRAAKRSAKAADINSLGSLDREDVKKICGDNIPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP Y+QVKWLN
Sbjct  61   WISFPEYDQVKWLN  74



>gb|EMS53254.1| Extended synaptotagmin-2-A [Triticum urartu]
Length=473

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 11/85 (13%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLM-----------GSLNRDD  76
            MG  SG +LGI+ G+ L+A W   M  R+ KR AKA     M           GSLNR+D
Sbjct  1    MGFFSGIMLGIILGVALIAGWARAMARRAHKRSAKASAPARMLYIDHCIHAMFGSLNRED  60

Query  75   LKKICGDNFPEWVSFPVYEQVKWLN  1
            LKKICG+N P+W+SFP Y+QVKWLN
Sbjct  61   LKKICGENLPQWISFPEYDQVKWLN  85



>gb|EMS48933.1| Synaptotagmin-7 [Triticum urartu]
Length=551

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG ++G++ G+ +MA W  VM+ RS KR+AKA D+K++GSL R+DLKK+CGDNFPE
Sbjct  1    MGFISGVVMGLVVGVVIMAGWSRVMQRRSRKRVAKAADIKVLGSLGREDLKKLCGDNFPE  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQ  ++ 
Sbjct  61   WISFPQYEQRDYIQ  74



>ref|XP_002974430.1| hypothetical protein SELMODRAFT_101052 [Selaginella moellendorffii]
 gb|EFJ24652.1| hypothetical protein SELMODRAFT_101052 [Selaginella moellendorffii]
Length=466

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL++G L G++ GIGL+A W   MR RS +RIAKA ++KL+G +++D++KK+  D FP 
Sbjct  1    MGLLTGLLFGVIVGIGLVAGWCFAMRCRSKQRIAKAANIKLLGKMSQDEVKKLLYDAFPP  60

Query  42   WVSFPVYEQVKWLN  1
            WV FP +E+VKW+N
Sbjct  61   WVIFPEFERVKWMN  74



>ref|XP_002985728.1| hypothetical protein SELMODRAFT_122842 [Selaginella moellendorffii]
 gb|EFJ13306.1| hypothetical protein SELMODRAFT_122842 [Selaginella moellendorffii]
Length=466

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MGL++G L G++ GIGL+A W   MR RS +RIAKA ++KL+G +++D++KK+  D FP 
Sbjct  1    MGLLTGLLFGVIVGIGLVAGWCFAMRCRSKQRIAKAANIKLLGKMSQDEVKKLLYDAFPP  60

Query  42   WVSFPVYEQVKWLN  1
            WV FP +E+VKW+N
Sbjct  61   WVIFPEFERVKWMN  74



>ref|XP_009608318.1| PREDICTED: synaptotagmin-4-like isoform X2 [Nicotiana tomentosiformis]
Length=475

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  TKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            ++  + AV+VKLMGSLNRDDLKK+CGDNFPEW+SFPVYEQVKWLN
Sbjct  3    SRNYSLAVEVKLMGSLNRDDLKKMCGDNFPEWISFPVYEQVKWLN  47



>ref|XP_002465551.1| integral membrane single C2 domain protein [Sorghum bicolor]
 gb|EER92549.1| integral membrane single C2 domain protein [Sorghum bicolor]
Length=511

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG ++G++ G+ L+A W   M  R+ KR  KA DV  +GSLNR+D+KKICG+N P+
Sbjct  1    MGFISGVIMGMIVGVALIAGWARAMARRAAKRSNKAADVSALGSLNREDVKKICGENVPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPEYEQVKWLN  74



>ref|XP_008653557.1| PREDICTED: synaptotagmin-5-like [Zea mays]
Length=513

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG ++G++ G+ L+A W   M  R+ KR  KA  +  +GSLNR+D+KKICG++ P+
Sbjct  1    MGFISGVVMGMIVGVALIAGWARAMARRAAKRSNKAAVISSLGSLNREDVKKICGESLPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPEYEQVKWLN  74



>tpg|DAA44413.1| TPA: hypothetical protein ZEAMMB73_731754 [Zea mays]
Length=435

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPE  43
            MG ISG ++G++ G+ L+A W   M  R+ KR  KA  +  +GSLNR+D+KKICG++ P+
Sbjct  1    MGFISGVVMGMIVGVALIAGWARAMARRAAKRSNKAAVISSLGSLNREDVKKICGESLPQ  60

Query  42   WVSFPVYEQVKWLN  1
            W+SFP YEQVKWLN
Sbjct  61   WISFPEYEQVKWLN  74



>gb|ABF94993.1| calcium-dependent lipid-binding protein, putative [Oryza sativa 
Japonica Group]
Length=604

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  RIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            R A+A DV  + SL+R+D+KKICG+N PEWVSFP YEQVKWLN
Sbjct  94   RFAQAADVNALASLDREDVKKICGENLPEWVSFPEYEQVKWLN  136



>gb|EMT12410.1| hypothetical protein F775_10896 [Aegilops tauschii]
Length=510

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  KAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            +A DV ++GSL+R+DLKKICG+N P+W+SFP Y+QVKWLN
Sbjct  30   EAADVNVLGSLSREDLKKICGENLPQWISFPEYDQVKWLN  69



>gb|EEC74875.1| hypothetical protein OsI_10777 [Oryza sativa Indica Group]
Length=530

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 7/64 (11%)
 Frame = -3

Query  171  MAIWRHVMRYRSTKRIAK-------AVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQV  13
            MA    VMR    +R  +       A DV  + SL+R+D+KKICG+N PEWVSFP YEQV
Sbjct  1    MASTNDVMRQMEEERRGRLRGCRYFAADVNALASLDREDVKKICGENLPEWVSFPEYEQV  60

Query  12   KWLN  1
            KWLN
Sbjct  61   KWLN  64



>gb|EEE55638.1| hypothetical protein OsJ_04001 [Oryza sativa Japonica Group]
Length=512

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  AVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            A DV  + SL+R+D+KKICG+N PEWVSFP YEQVKWLN
Sbjct  26   AADVNALASLDREDVKKICGENLPEWVSFPEYEQVKWLN  64



>ref|XP_001755175.1| integral membrane single C2 domain protein [Physcomitrella patens]
 gb|EDQ80119.1| integral membrane single C2 domain protein [Physcomitrella patens]
Length=510

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  LISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWV  37
            ++SG ++G + G+ ++A WR++M  R+ KRI KA  ++L+  ++  DLKK+C  + P  +
Sbjct  2    VLSGLIIGWLVGVVIIARWRYMMDKRNKKRIQKATGIELLNVIDEMDLKKLCEQSLPNHI  61

Query  36   SFPVYEQVKWLN  1
            SF  +E+V+WLN
Sbjct  62   SFLTFEKVEWLN  73



>ref|XP_001763607.1| integral membrane single C2 domain protein [Physcomitrella patens]
 gb|EDQ71497.1| integral membrane single C2 domain protein [Physcomitrella patens]
Length=511

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  GTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFP  28
            G + G + G+ L+   + +M  RS KR  K   ++L   ++  +LKK+C D++P  VSF 
Sbjct  5    GLIFGWLVGVALICGLKVMMDRRSRKRTKKVAAIELFNLIDEVELKKLCSDSYPNHVSFT  64

Query  27   VYEQVKWLN  1
             YE+V WLN
Sbjct  65   TYEKVNWLN  73



>emb|CAN70311.1| hypothetical protein VITISV_022886 [Vitis vinifera]
Length=1856

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAV  112
            MGLISG L+G +FGI LMA W H+MRYRS KR+AK V
Sbjct  1    MGLISGILMGTIFGIALMAGWVHMMRYRSIKRVAKEV  37



>ref|XP_009592572.1| PREDICTED: synaptotagmin-4-like, partial [Nicotiana tomentosiformis]
Length=127

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = -3

Query  222  MGLISGTLLGIMFGIGLMAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKIC-GDNFP  46
            MGL+ G  LG   G+GL+  +     YRS  RI  A  +     +   D +K+   + +P
Sbjct  1    MGLLVGFFLGAALGVGLIVCFARFQNYRSKARIDLAKVIAAFARMTVQDSRKLLPPEAYP  60

Query  45   EWVSFPVYEQVKWLN  1
             WV F   +++ WLN
Sbjct  61   SWVVFSQKQKLNWLN  75



>emb|CAB94131.1| putative protein [Arabidopsis thaliana]
 emb|CAB94139.1| putative protein [Arabidopsis thaliana]
Length=592

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 14/57 (25%)
 Frame = -3

Query  171  MAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            MA W  +M YRS KR++KAVD+K++GSL+RDD +    +NF           VKWLN
Sbjct  1    MAGWSRMMTYRSIKRVSKAVDMKVLGSLSRDDFE----ENF----------VVKWLN  43



>ref|NP_567107.5| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Arabidopsis thaliana]
 gb|AEE80140.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Arabidopsis thaliana]
Length=509

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 14/57 (25%)
 Frame = -3

Query  171  MAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            MA W  +M YRS KR++KAVD+K++GSL+RDD +    +NF           VKWLN
Sbjct  1    MAGWSRMMTYRSIKRVSKAVDMKVLGSLSRDDFE----ENF----------VVKWLN  43



>ref|NP_567106.5| C2 calcium/lipid-binding endonuclease/exonuclease/phosphatase 
[Arabidopsis thaliana]
 gb|AEE80129.1| C2 calcium/lipid-binding endonuclease/exonuclease/phosphatase 
[Arabidopsis thaliana]
Length=627

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 14/57 (25%)
 Frame = -3

Query  171  MAIWRHVMRYRSTKRIAKAVDVKLMGSLNRDDLKKICGDNFPEWVSFPVYEQVKWLN  1
            MA W  +M YRS KR++KAVD+K++GSL+RDD +    +NF           VKWLN
Sbjct  1    MAGWSRMMTYRSIKRVSKAVDMKVLGSLSRDDFE----ENF----------VVKWLN  43



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509219560224