BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c116347_g1_i1 len=108 path=[1:0-107]

Length=108
                                                                      Score     E

ref|XP_007013028.1|  Kinase family protein with leucine-rich repe...  79.0    1e-15   
ref|XP_008798566.1|  PREDICTED: receptor-like protein kinase HSL1     77.0    2e-15   
ref|XP_007013027.1|  Kinase family protein with leucine-rich repe...  79.0    2e-15   
ref|XP_010911143.1|  PREDICTED: receptor-like protein kinase 5        75.5    2e-15   
gb|KGN66180.1|  hypothetical protein Csa_1G574960                     77.0    7e-15   
ref|XP_002324455.2|  hypothetical protein POPTR_0018s09540g           77.0    7e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004157305.1|  PREDICTED: receptor-like protein kinase 5-like   77.0    9e-15   
ref|XP_008450784.1|  PREDICTED: receptor-like protein kinase 5        76.6    9e-15   
ref|XP_002324453.1|  hypothetical protein POPTR_0018s09510g           76.6    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010095356.1|  Leucine-rich repeat receptor-like protein ki...  73.2    1e-14   
ref|XP_011007104.1|  PREDICTED: receptor-like protein kinase HSL1     76.6    1e-14   
ref|XP_008780630.1|  PREDICTED: leucine-rich repeat receptor-like...  73.2    1e-14   
ref|XP_002280395.1|  PREDICTED: receptor-like protein kinase 5        76.3    1e-14   Vitis vinifera
ref|XP_006366693.1|  PREDICTED: receptor-like protein kinase HSL1...  76.3    2e-14   
ref|XP_004245143.1|  PREDICTED: receptor-like protein kinase HSL1     76.3    2e-14   
emb|CBI27997.3|  unnamed protein product                              75.9    2e-14   
ref|XP_007203859.1|  hypothetical protein PRUPE_ppa022167mg           75.9    2e-14   
ref|XP_007203222.1|  hypothetical protein PRUPE_ppa000737mg           75.9    2e-14   
ref|XP_008242543.1|  PREDICTED: receptor-like protein kinase HSL1     75.5    2e-14   
ref|XP_004135674.1|  PREDICTED: receptor-like protein kinase 5-like   72.8    2e-14   
ref|XP_011008121.1|  PREDICTED: receptor-like protein kinase 5        75.5    3e-14   
ref|XP_010110882.1|  Receptor-like protein kinase HSL1                75.5    3e-14   
ref|XP_011014419.1|  PREDICTED: receptor-like protein kinase 5        75.5    3e-14   
emb|CBI39978.3|  unnamed protein product                              75.1    3e-14   
emb|CAN76607.1|  hypothetical protein VITISV_030396                   75.1    3e-14   Vitis vinifera
ref|XP_002324456.2|  hypothetical protein POPTR_0018s09550g           75.1    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010493845.1|  PREDICTED: receptor-like protein kinase 5 is...  75.1    3e-14   
ref|XP_010454934.1|  PREDICTED: receptor-like protein kinase 5        75.1    3e-14   
ref|XP_010421450.1|  PREDICTED: receptor-like protein kinase 5        75.1    3e-14   
ref|XP_010106712.1|  Receptor-like protein kinase HSL1                75.1    4e-14   
ref|XP_010924676.1|  PREDICTED: receptor-like protein kinase 5        74.7    4e-14   
ref|XP_010661160.1|  PREDICTED: receptor-like protein kinase HSL1     74.7    5e-14   
ref|XP_009795019.1|  PREDICTED: receptor-like protein kinase HSL1     74.3    6e-14   
ref|XP_004288943.1|  PREDICTED: receptor-like protein kinase HSL1...  74.3    7e-14   
ref|XP_010536218.1|  PREDICTED: receptor-like protein kinase HSL1     74.3    7e-14   
ref|XP_004961447.1|  PREDICTED: receptor-like protein kinase HSL1...  74.3    7e-14   
ref|XP_011093340.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  73.9    8e-14   
ref|XP_010910702.1|  PREDICTED: receptor-like protein kinase HSL1...  73.6    1e-13   
ref|XP_010910701.1|  PREDICTED: receptor-like protein kinase HSL1...  73.6    1e-13   
ref|XP_004288893.1|  PREDICTED: receptor-like protein kinase HSL1...  73.6    1e-13   
ref|XP_010910700.1|  PREDICTED: receptor-like protein kinase HSL1...  73.6    1e-13   
ref|XP_004287478.1|  PREDICTED: receptor-like protein kinase HSL1...  73.6    1e-13   
ref|XP_007225351.1|  hypothetical protein PRUPE_ppa000941mg           73.6    1e-13   
ref|XP_009350259.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-13   
ref|XP_008377967.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-13   
ref|XP_009367420.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-13   
ref|XP_008220120.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-13   
ref|XP_002516533.1|  serine-threonine protein kinase, plant-type,...  73.6    1e-13   Ricinus communis
ref|XP_009415190.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-13   
ref|XP_009587881.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-13   
ref|NP_001168877.1|  uncharacterized protein LOC100382682             70.5    1e-13   Zea mays [maize]
ref|XP_006353495.1|  PREDICTED: receptor-like protein kinase 5-like   73.6    1e-13   
ref|XP_007137253.1|  hypothetical protein PHAVU_009G112200g           73.6    1e-13   
ref|XP_008242547.1|  PREDICTED: LRR receptor-like serine/threonin...  73.6    1e-13   
ref|XP_009415677.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-13   
gb|KHN18142.1|  Receptor-like protein kinase HSL1                     73.2    1e-13   
ref|XP_004251639.1|  PREDICTED: receptor-like protein kinase 5        73.6    1e-13   
ref|XP_007203495.1|  hypothetical protein PRUPE_ppa022516mg           73.2    1e-13   
ref|NP_197965.1|  protein kinase family protein with leucine-rich...  73.2    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872190.1|  leucine-rich repeat family protein               73.2    1e-13   
ref|XP_006286985.1|  hypothetical protein CARUB_v10000132mg           73.2    1e-13   
ref|XP_009601880.1|  PREDICTED: receptor-like protein kinase 5        73.2    2e-13   
ref|XP_010917293.1|  PREDICTED: receptor-like protein kinase 5        73.2    2e-13   
ref|XP_009779466.1|  PREDICTED: receptor-like protein kinase HSL1     73.2    2e-13   
ref|XP_008344114.1|  PREDICTED: receptor-like protein kinase HSL1     73.2    2e-13   
ref|XP_004969910.1|  PREDICTED: leucine-rich repeat receptor-like...  73.2    2e-13   
ref|XP_003527853.1|  PREDICTED: receptor-like protein kinase HSL1...  73.2    2e-13   
ref|XP_010047668.1|  PREDICTED: receptor-like protein kinase 5        73.2    2e-13   
ref|XP_004972171.1|  PREDICTED: receptor-like protein kinase HSL1...  73.2    2e-13   
ref|XP_010047253.1|  PREDICTED: LRR receptor-like serine/threonin...  73.2    2e-13   
gb|EMS60554.1|  Leucine-rich repeat receptor-like protein kinase ...  73.2    2e-13   
dbj|BAJ98312.1|  predicted protein                                    73.2    2e-13   
ref|XP_010924675.1|  PREDICTED: receptor-like protein kinase HSL1     72.8    2e-13   
ref|XP_010232300.1|  PREDICTED: receptor-like protein kinase 5        73.2    2e-13   
emb|CDP08193.1|  unnamed protein product                              72.8    2e-13   
gb|KEH27208.1|  LRR receptor-like kinase family protein               72.8    2e-13   
emb|CDX80547.1|  BnaC07g28970D                                        72.8    2e-13   
ref|XP_010924441.1|  PREDICTED: receptor-like protein kinase 5        72.8    2e-13   
ref|XP_004513049.1|  PREDICTED: receptor-like protein kinase HSL1...  72.8    2e-13   
ref|XP_010267130.1|  PREDICTED: receptor-like protein kinase HSL1     72.8    2e-13   
ref|XP_002442938.1|  hypothetical protein SORBIDRAFT_08g005090        72.8    3e-13   Sorghum bicolor [broomcorn]
gb|EMT04436.1|  Receptor-like protein kinase 5                        69.3    3e-13   
gb|EYU30701.1|  hypothetical protein MIMGU_mgv1a000689mg              72.4    3e-13   
ref|XP_006596182.1|  PREDICTED: receptor-like protein kinase HSL1...  72.4    3e-13   
ref|XP_009627680.1|  PREDICTED: receptor-like protein kinase 5        72.4    3e-13   
ref|XP_009759980.1|  PREDICTED: receptor-like protein kinase 5        72.4    3e-13   
ref|XP_009619690.1|  PREDICTED: receptor-like protein kinase 5 is...  72.4    3e-13   
ref|XP_006596181.1|  PREDICTED: receptor-like protein kinase HSL1...  72.4    3e-13   
gb|EYU29298.1|  hypothetical protein MIMGU_mgv1a000685mg              72.4    3e-13   
gb|KCW79612.1|  hypothetical protein EUGRSUZ_C00966                   71.6    4e-13   
ref|XP_010042345.1|  PREDICTED: receptor-like protein kinase 5        72.0    4e-13   
gb|KHN40380.1|  Receptor-like protein kinase HSL1                     72.0    4e-13   
ref|XP_009600836.1|  PREDICTED: receptor-like protein kinase 5        70.9    4e-13   
ref|XP_010925541.1|  PREDICTED: receptor-like protein kinase HSL1     72.0    4e-13   
ref|XP_004969911.1|  PREDICTED: receptor-like protein kinase HSL1...  72.0    4e-13   
ref|XP_002456336.1|  hypothetical protein SORBIDRAFT_03g034210        71.6    4e-13   Sorghum bicolor [broomcorn]
ref|XP_009381187.1|  PREDICTED: receptor-like protein kinase HSL1     72.0    5e-13   
ref|XP_010050474.1|  PREDICTED: receptor-like protein kinase 5        71.6    5e-13   
ref|XP_010519877.1|  PREDICTED: receptor-like protein kinase 5        71.6    5e-13   
gb|KCW79622.1|  hypothetical protein EUGRSUZ_C00979                   71.6    5e-13   
ref|XP_008794105.1|  PREDICTED: receptor-like protein kinase 5        71.6    5e-13   
ref|XP_003516786.2|  PREDICTED: receptor-like protein kinase 5-like   71.6    6e-13   
ref|XP_010519875.1|  PREDICTED: receptor-like protein kinase 5        71.6    6e-13   
ref|XP_006364729.1|  PREDICTED: receptor-like protein kinase 5-like   71.2    6e-13   
gb|KCW79613.1|  hypothetical protein EUGRSUZ_C00967                   71.6    6e-13   
tpg|DAA57705.1|  TPA: putative leucine-rich repeat receptor-like ...  71.6    6e-13   
ref|XP_006364718.1|  PREDICTED: receptor-like protein kinase HSL1...  69.3    6e-13   
gb|EMS35768.1|  Leucine-rich repeat receptor-like serine/threonin...  68.2    6e-13   
gb|KCW79627.1|  hypothetical protein EUGRSUZ_C00986                   71.2    7e-13   
emb|CDP03253.1|  unnamed protein product                              71.2    7e-13   
emb|CDP03251.1|  unnamed protein product                              71.2    7e-13   
ref|XP_006451306.1|  hypothetical protein CICLE_v10007383mg           71.2    8e-13   
gb|KHN16977.1|  Receptor-like protein kinase HSL1                     71.2    9e-13   
ref|XP_003548595.1|  PREDICTED: receptor-like protein kinase 5-like   71.2    9e-13   
ref|XP_004513052.1|  PREDICTED: receptor-like protein kinase HSL1...  70.9    9e-13   
gb|KCW79626.1|  hypothetical protein EUGRSUZ_C00986                   70.9    9e-13   
ref|XP_009151112.1|  PREDICTED: receptor-like protein kinase 5        70.9    9e-13   
ref|XP_002456337.1|  hypothetical protein SORBIDRAFT_03g034220        71.2    9e-13   Sorghum bicolor [broomcorn]
ref|XP_004513051.1|  PREDICTED: receptor-like protein kinase HSL1...  70.9    9e-13   
ref|XP_009151111.1|  PREDICTED: receptor-like protein kinase 5        70.9    1e-12   
emb|CDX88206.1|  BnaA06g27970D                                        70.9    1e-12   
gb|KFK26382.1|  hypothetical protein AALP_AA8G241000                  70.9    1e-12   
gb|KDO66581.1|  hypothetical protein CISIN_1g001778mg                 70.9    1e-12   
ref|XP_010924677.1|  PREDICTED: receptor-like protein kinase HSL1     70.9    1e-12   
ref|XP_006475586.1|  PREDICTED: receptor-like protein kinase 5-like   70.9    1e-12   
gb|KEH27215.1|  leucine-rich receptor-like kinase family protein      70.9    1e-12   
emb|CDX80548.1|  BnaC07g28960D                                        70.9    1e-12   
ref|XP_008242546.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  70.9    1e-12   
ref|XP_007152971.1|  hypothetical protein PHAVU_004G175700g           70.9    1e-12   
ref|XP_009416472.1|  PREDICTED: receptor-like protein kinase HSL1     70.9    1e-12   
gb|KDO79911.1|  hypothetical protein CISIN_1g001706mg                 70.9    1e-12   
ref|XP_006450731.1|  hypothetical protein CICLE_v10010761mg           70.9    1e-12   
gb|KHN10176.1|  Leucine-rich repeat receptor-like protein kinase ...  67.8    1e-12   
ref|XP_010668734.1|  PREDICTED: receptor-like protein kinase HSL1     70.9    1e-12   
gb|KDO79910.1|  hypothetical protein CISIN_1g001706mg                 70.9    1e-12   
ref|XP_006475995.1|  PREDICTED: receptor-like protein kinase HSL1...  70.9    1e-12   
ref|XP_009409608.1|  PREDICTED: receptor-like protein kinase HSL1     70.5    1e-12   
ref|XP_007204807.1|  hypothetical protein PRUPE_ppa019571mg           70.5    1e-12   
ref|XP_006655502.1|  PREDICTED: receptor-like protein kinase 5-like   70.5    1e-12   
ref|XP_002442937.1|  hypothetical protein SORBIDRAFT_08g005070        70.5    1e-12   Sorghum bicolor [broomcorn]
ref|XP_008362962.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  70.5    2e-12   
gb|KHN40381.1|  LRR receptor-like serine/threonine-protein kinase...  70.1    2e-12   
ref|XP_009415678.1|  PREDICTED: receptor-like protein kinase 5        70.5    2e-12   
ref|XP_010047669.1|  PREDICTED: receptor-like protein kinase 5        70.5    2e-12   
gb|KHG25031.1|  Receptor-like protein kinase HSL1                     70.1    2e-12   
ref|XP_011078243.1|  PREDICTED: receptor-like protein kinase HSL1     70.1    2e-12   
ref|XP_008242544.1|  PREDICTED: receptor-like protein kinase HSL1     70.5    2e-12   
gb|KHN16978.1|  Receptor-like protein kinase HSL1                     70.1    2e-12   
gb|KHM99760.1|  LRR receptor-like serine/threonine-protein kinase...  70.1    2e-12   
ref|XP_008390812.1|  PREDICTED: receptor-like protein kinase HSL1     70.1    2e-12   
ref|XP_010050388.1|  PREDICTED: receptor-like protein kinase 5        69.7    2e-12   
ref|XP_003548596.1|  PREDICTED: receptor-like protein kinase HSL1...  70.1    2e-12   
ref|XP_002442939.1|  hypothetical protein SORBIDRAFT_08g005100        69.7    2e-12   Sorghum bicolor [broomcorn]
emb|CDP08192.1|  unnamed protein product                              69.3    2e-12   
ref|XP_003517639.1|  PREDICTED: receptor-like protein kinase HSL1...  69.7    3e-12   
emb|CDM84035.1|  unnamed protein product                              69.3    3e-12   
ref|XP_006364719.1|  PREDICTED: receptor-like protein kinase HSL1...  69.3    3e-12   
ref|XP_008337667.1|  PREDICTED: receptor-like protein kinase HSL1     69.7    3e-12   
ref|XP_009628518.1|  PREDICTED: receptor protein kinase CLAVATA1-...  69.3    3e-12   
ref|XP_011007101.1|  PREDICTED: receptor-like protein kinase 5        69.7    3e-12   
ref|XP_003533283.1|  PREDICTED: receptor-like protein kinase HSL1...  69.7    3e-12   
ref|XP_010278042.1|  PREDICTED: receptor-like protein kinase 5        69.7    3e-12   
gb|KCW79121.1|  hypothetical protein EUGRSUZ_C00562                   69.7    3e-12   
ref|XP_003549165.1|  PREDICTED: receptor-like protein kinase HSL1...  69.3    3e-12   
ref|XP_003619786.1|  Receptor-like protein kinase                     69.3    3e-12   
ref|XP_011081744.1|  PREDICTED: receptor-like protein kinase 5        69.3    3e-12   
ref|XP_009628514.1|  PREDICTED: receptor-like protein kinase 2 is...  69.3    3e-12   
dbj|BAH19649.1|  AT5G25930                                            69.3    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364730.1|  PREDICTED: probable LRR receptor-like serine...  68.9    4e-12   
ref|XP_004512685.1|  PREDICTED: receptor-like protein kinase HSL1...  69.3    4e-12   
gb|KDP33799.1|  hypothetical protein JCGZ_07370                       69.3    4e-12   
ref|XP_009628516.1|  PREDICTED: receptor-like protein kinase 2 is...  68.9    4e-12   
ref|XP_007152973.1|  hypothetical protein PHAVU_004G175900g           69.3    4e-12   
gb|KEH27211.1|  LRR receptor-like kinase family protein               68.9    4e-12   
emb|CBI20579.3|  unnamed protein product                              68.9    4e-12   
ref|XP_004512684.1|  PREDICTED: receptor-like protein kinase HSL1...  69.3    4e-12   
ref|XP_009628517.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    4e-12   
ref|XP_010095459.1|  Receptor-like protein kinase HSL1                68.9    4e-12   
emb|CDY05509.1|  BnaA02g31820D                                        68.9    5e-12   
emb|CDY05337.1|  BnaC02g40450D                                        68.9    5e-12   
ref|XP_007013026.1|  Kinase family protein with leucine-rich repe...  68.9    5e-12   
ref|XP_006394841.1|  hypothetical protein EUTSA_v10003585mg           68.9    5e-12   
gb|KHG24857.1|  Receptor-like protein kinase HSL1                     68.9    5e-12   
ref|XP_010917300.1|  PREDICTED: receptor-like protein kinase 5        68.2    5e-12   
ref|XP_008671313.1|  PREDICTED: receptor-like protein kinase HSL1     67.8    5e-12   
ref|XP_011010886.1|  PREDICTED: receptor-like protein kinase HSL1...  68.9    6e-12   
ref|XP_011010885.1|  PREDICTED: receptor-like protein kinase HSL1...  68.9    6e-12   
ref|XP_004164767.1|  PREDICTED: receptor-like protein kinase HSL1...  68.6    6e-12   
ref|XP_004513050.1|  PREDICTED: receptor-like protein kinase HSL1...  68.6    6e-12   
ref|XP_004148398.1|  PREDICTED: receptor-like protein kinase HSL1...  68.6    6e-12   
ref|XP_004288894.1|  PREDICTED: receptor-like protein kinase HSL1...  68.6    6e-12   
gb|EMT29167.1|  Serine/threonine-protein kinase PBS1                  67.8    6e-12   
ref|XP_003523755.1|  PREDICTED: receptor-like protein kinase HSL1...  68.6    6e-12   
ref|XP_009803852.1|  PREDICTED: receptor-like protein kinase HSL1     68.6    6e-12   
gb|EEE64410.1|  hypothetical protein OsJ_19254                        68.6    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAV44033.1|  putative protein kinase                               68.6    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98740.1|  hypothetical protein OsI_20670                        68.6    7e-12   Oryza sativa Indica Group [Indian rice]
gb|KDP33797.1|  hypothetical protein JCGZ_07368                       68.6    7e-12   
ref|XP_010095358.1|  LRR receptor-like serine/threonine-protein k...  67.8    7e-12   
ref|XP_004245388.2|  PREDICTED: receptor-like protein kinase 2        68.6    7e-12   
ref|XP_008444991.1|  PREDICTED: receptor-like protein kinase HSL1     68.6    7e-12   
gb|AGC54428.1|  receptor-like kinase                                  65.1    7e-12   
ref|XP_010325071.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    7e-12   
ref|XP_008649140.1|  PREDICTED: receptor-like protein kinase 5        68.6    7e-12   
ref|XP_002437153.1|  hypothetical protein SORBIDRAFT_10g022060        68.6    7e-12   Sorghum bicolor [broomcorn]
ref|XP_008778616.1|  PREDICTED: receptor-like protein kinase 5        68.2    8e-12   
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                      68.2    8e-12   
ref|NP_001058840.2|  Os07g0134200                                     68.2    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...  68.2    8e-12   
dbj|BAJ84911.1|  predicted protein                                    68.2    8e-12   
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)        68.2    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02682.1|  hypothetical protein OsI_24796                        68.2    8e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010050391.1|  PREDICTED: receptor-like protein kinase 5        68.2    8e-12   
gb|KCW79120.1|  hypothetical protein EUGRSUZ_C00561                   68.2    8e-12   
ref|XP_002324752.1|  leucine-rich repeat family protein               68.2    9e-12   Populus trichocarpa [western balsam poplar]
dbj|BAD87899.1|  putative LRK1 protein                                68.2    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659674.1|  PREDICTED: receptor-like protein kinase 5        68.2    9e-12   
gb|KDP34178.1|  hypothetical protein JCGZ_07749                       68.2    9e-12   
ref|XP_008680083.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    1e-11   
gb|EAZ13493.1|  hypothetical protein OsJ_03409                        68.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75774.1|  hypothetical protein OsI_03690                        68.2    1e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001044213.1|  Os01g0742400                                     68.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007152512.1|  hypothetical protein PHAVU_004G136500g           68.2    1e-11   
ref|XP_007012181.1|  Kinase family protein with leucine-rich repe...  68.2    1e-11   
ref|XP_008789188.1|  PREDICTED: receptor-like protein kinase HSL1     68.2    1e-11   
ref|XP_011077132.1|  PREDICTED: leucine-rich repeat receptor-like...  68.2    1e-11   
gb|AFW56261.1|  putative leucine-rich repeat receptor-like protei...  67.8    1e-11   
gb|ACL54651.1|  unknown                                               67.0    1e-11   Zea mays [maize]
gb|KCW79123.1|  hypothetical protein EUGRSUZ_C00564                   67.8    1e-11   
ref|XP_006853705.1|  hypothetical protein AMTR_s00056p00147890        67.8    1e-11   
ref|XP_009352556.1|  PREDICTED: receptor-like protein kinase HSL1     67.8    1e-11   
ref|XP_010050392.1|  PREDICTED: receptor-like protein kinase 5        67.8    1e-11   
ref|XP_004501091.1|  PREDICTED: receptor-like protein kinase HSL1...  67.8    1e-11   
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...  67.8    1e-11   
gb|KCW79630.1|  hypothetical protein EUGRSUZ_C00989                   67.8    1e-11   
ref|XP_004501092.1|  PREDICTED: receptor-like protein kinase HSL1...  67.8    1e-11   
ref|XP_002441406.1|  hypothetical protein SORBIDRAFT_09g026090        67.8    1e-11   Sorghum bicolor [broomcorn]
ref|XP_008649910.1|  PREDICTED: receptor-like protein kinase HSL1     67.8    1e-11   
gb|KEH27213.1|  leucine-rich receptor-like kinase family protein      67.8    1e-11   
ref|XP_008390801.1|  PREDICTED: receptor-like protein kinase 5        67.4    1e-11   
ref|XP_004506369.1|  PREDICTED: receptor-like protein kinase HAIK...  67.8    1e-11   
gb|KHN01094.1|  Receptor-like protein kinase HSL1                     67.4    1e-11   
ref|XP_010050387.1|  PREDICTED: receptor-like protein kinase 5        67.8    1e-11   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...  67.8    1e-11   
ref|XP_010050472.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  67.8    1e-11   
dbj|BAK01376.1|  predicted protein                                    66.6    2e-11   
ref|XP_010047672.1|  PREDICTED: receptor-like protein kinase 5        67.4    2e-11   
gb|EMT15500.1|  hypothetical protein F775_52402                       67.4    2e-11   
gb|AFW85121.1|  hypothetical protein ZEAMMB73_943636                  67.4    2e-11   
gb|EMT19930.1|  Serine/threonine-protein kinase PBS1                  66.6    2e-11   
ref|NP_001046099.1|  Os02g0182600                                     63.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010050469.1|  PREDICTED: receptor-like protein kinase 5        67.4    2e-11   
ref|NP_001145765.1|  uncharacterized protein LOC100279272             67.0    2e-11   Zea mays [maize]
gb|KHG19858.1|  Receptor-like protein kinase HSL1                     67.4    2e-11   
ref|XP_004245385.2|  PREDICTED: LRR receptor-like serine/threonin...  67.0    2e-11   
ref|XP_007152972.1|  hypothetical protein PHAVU_004G175800g           67.4    2e-11   
dbj|BAJ99137.1|  predicted protein                                    67.4    2e-11   
ref|XP_008657242.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  67.4    2e-11   
gb|KEH27214.1|  leucine-rich receptor-like kinase family protein      67.0    2e-11   
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...  67.0    2e-11   
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...  67.0    2e-11   
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...  67.0    2e-11   
ref|XP_004291157.1|  PREDICTED: receptor-like protein kinase HSL1...  67.0    2e-11   
gb|EPS67710.1|  hypothetical protein M569_07063                       63.9    2e-11   
ref|XP_003570779.2|  PREDICTED: probable receptor-like protein ki...  66.2    2e-11   
ref|XP_009398654.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-11   
gb|AFW87262.1|  putative protein kinase superfamily protein           64.7    2e-11   
ref|XP_003603644.1|  Receptor-like protein kinase                     67.0    2e-11   
ref|XP_009408035.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-11   
ref|XP_006343139.1|  PREDICTED: putative leucine-rich repeat rece...  67.0    2e-11   
ref|XP_010555501.1|  PREDICTED: probable LRR receptor-like serine...  66.6    3e-11   
ref|XP_003526261.1|  PREDICTED: receptor-like protein kinase HSL1...  66.6    3e-11   
gb|EEC78975.1|  hypothetical protein OsI_19455                        65.9    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_007132769.1|  hypothetical protein PHAVU_011G123500g           66.6    3e-11   
ref|NP_001055185.1|  Os05g0319700                                     65.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002526416.1|  serine-threonine protein kinase, plant-type,...  63.5    3e-11   Ricinus communis
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...  66.6    3e-11   
gb|KCW79629.1|  hypothetical protein EUGRSUZ_C00988                   66.2    3e-11   
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like           66.2    4e-11   
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...  66.2    4e-11   
gb|EEE63242.1|  hypothetical protein OsJ_18052                        65.9    4e-11   
gb|AAO72616.1|  protein kinase-like protein                           63.5    4e-11   
ref|XP_010668729.1|  PREDICTED: receptor-like protein kinase HSL1     66.2    4e-11   
gb|AGC54429.1|  receptor-like kinase                                  63.2    4e-11   
gb|AAF73373.1|AF193835_1  LRK1 protein                                66.2    4e-11   
ref|XP_006390688.1|  hypothetical protein EUTSA_v10018075mg           66.2    4e-11   
gb|EMT17967.1|  LRR receptor-like serine/threonine-protein kinase...  65.9    5e-11   
ref|XP_008228443.1|  PREDICTED: senescence-induced receptor-like ...  66.2    5e-11   
gb|AGC54431.1|  receptor-like kinase                                  62.8    5e-11   
ref|XP_010249486.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    5e-11   
ref|XP_009783572.1|  PREDICTED: leucine-rich repeat receptor-like...  65.9    5e-11   
ref|XP_006592621.1|  PREDICTED: receptor-like protein kinase 5-like   62.4    5e-11   
ref|XP_009623756.1|  PREDICTED: leucine-rich repeat receptor-like...  65.9    5e-11   
gb|KDP42003.1|  hypothetical protein JCGZ_27021                       65.1    5e-11   
ref|XP_010540887.1|  PREDICTED: receptor-like protein kinase 5        65.9    5e-11   
ref|XP_010684496.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    5e-11   
gb|EAY85056.1|  hypothetical protein OsI_06414                        65.9    6e-11   
ref|XP_010915380.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    6e-11   
ref|XP_010047673.1|  PREDICTED: receptor-like protein kinase 5        65.9    6e-11   
gb|KHN23688.1|  Receptor-like protein kinase 5                        62.0    6e-11   
emb|CDY53217.1|  BnaA02g19510D                                        65.1    6e-11   
ref|NP_194578.1|  receptor-like protein kinase 5                      65.9    6e-11   
ref|XP_006853707.1|  hypothetical protein AMTR_s00056p00148740        65.9    6e-11   
ref|XP_009128401.1|  PREDICTED: probable receptor-like protein ki...  65.1    6e-11   
dbj|BAJ93662.1|  predicted protein                                    65.9    6e-11   
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...  65.9    6e-11   
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...  65.9    6e-11   
ref|XP_003572165.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    6e-11   
emb|CBI20588.3|  unnamed protein product                              65.9    6e-11   
ref|XP_010239937.1|  PREDICTED: probable receptor-like protein ki...  65.1    6e-11   
dbj|BAD17641.1|  putative CLAVATA1 receptor kinase                    65.9    7e-11   
gb|KHN32898.1|  Putative LRR receptor-like serine/threonine-prote...  65.5    7e-11   
ref|XP_006572924.1|  PREDICTED: probable LRR receptor-like serine...  65.5    7e-11   
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                        65.5    7e-11   
ref|XP_006654258.1|  PREDICTED: probable receptor-like protein ki...  64.7    7e-11   
ref|XP_007131311.1|  hypothetical protein PHAVU_011G003200g           65.5    7e-11   
ref|XP_010648290.1|  PREDICTED: receptor-like protein kinase 5 is...  65.5    7e-11   
ref|XP_004980288.1|  PREDICTED: receptor-like protein kinase HSL1...  65.5    7e-11   
emb|CDY23037.1|  BnaC07g31500D                                        65.5    8e-11   
dbj|BAD17639.1|  putative CLAVATA1 receptor kinase                    65.5    8e-11   
gb|EAZ22277.1|  hypothetical protein OsJ_05933                        65.5    8e-11   
emb|CAN79180.1|  hypothetical protein VITISV_019748                   64.7    8e-11   
ref|XP_002278306.2|  PREDICTED: receptor-like protein kinase 5 is...  65.5    8e-11   
ref|XP_002514220.1|  serine-threonine protein kinase, plant-type,...  65.5    8e-11   
gb|EAY84745.1|  hypothetical protein OsI_06115                        64.7    8e-11   
emb|CDY66126.1|  BnaC02g46490D                                        64.7    9e-11   
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    9e-11   
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...  65.5    9e-11   
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase       65.5    9e-11   
ref|NP_001049453.1|  Os03g0228800                                     65.5    9e-11   
gb|EPS70436.1|  hypothetical protein M569_04317                       65.5    9e-11   
gb|EEC74807.1|  hypothetical protein OsI_10619                        65.5    9e-11   
gb|ACN34797.1|  unknown                                               64.7    9e-11   
ref|XP_002278223.1|  PREDICTED: receptor-like protein kinase HSL1     65.5    9e-11   
ref|NP_001148336.1|  phytosulfokine receptor precursor                64.7    9e-11   
ref|XP_006348830.1|  PREDICTED: receptor-like protein kinase HSL1...  65.5    9e-11   
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    9e-11   
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    9e-11   
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    9e-11   
ref|NP_001137070.1|  uncharacterized LOC100217243                     63.9    9e-11   
ref|XP_010050394.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    1e-10   
gb|KCW79616.1|  hypothetical protein EUGRSUZ_C009702                  64.3    1e-10   
gb|EAZ21983.1|  hypothetical protein OsJ_05638                        64.7    1e-10   
ref|XP_010059290.1|  PREDICTED: putative leucine-rich repeat rece...  64.7    1e-10   
ref|XP_008386502.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-10   
dbj|BAJ86178.1|  predicted protein                                    64.3    1e-10   
ref|XP_008386501.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-10   
ref|XP_004243383.1|  PREDICTED: receptor-like protein kinase HSL1     65.1    1e-10   
gb|EMS60242.1|  Receptor-like protein kinase 2                        65.1    1e-10   
emb|CBI20587.3|  unnamed protein product                              65.1    1e-10   
gb|EPS61889.1|  hypothetical protein M569_12898                       65.1    1e-10   
ref|XP_004165430.1|  PREDICTED: putative leucine-rich repeat rece...  65.1    1e-10   
ref|XP_004149534.1|  PREDICTED: putative leucine-rich repeat rece...  65.1    1e-10   
ref|XP_006394500.1|  hypothetical protein EUTSA_v10003570mg           65.1    1e-10   
ref|XP_008645155.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    1e-10   
gb|EAY85054.1|  hypothetical protein OsI_06413                        65.1    1e-10   
ref|XP_002453157.1|  hypothetical protein SORBIDRAFT_04g000920        65.1    1e-10   
ref|XP_010063545.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-10   
ref|XP_004951670.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-10   
emb|CDY35193.1|  BnaA01g08380D                                        63.5    1e-10   
ref|XP_011015399.1|  PREDICTED: probable receptor-like protein ki...  63.9    1e-10   
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    1e-10   
emb|CDY02141.1|  BnaA03g40260D                                        65.1    1e-10   
ref|XP_010063546.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-10   
ref|XP_010050476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  64.7    1e-10   
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    1e-10   
ref|XP_002301848.1|  leucine-rich repeat transmembrane protein ki...  65.1    1e-10   
gb|EPS67200.1|  leaf senescence-associated receptor-like protein ...  62.0    1e-10   
emb|CAD42335.1|  hypernodulation aberrant root formation protein      64.7    1e-10   
ref|XP_009136481.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    1e-10   
emb|CDY23065.1|  BnaC07g31220D                                        65.1    1e-10   
ref|XP_008658206.1|  PREDICTED: uncharacterized LOC100217243 isof...  64.3    1e-10   
ref|XP_004965735.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-10   
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    1e-10   
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    1e-10   
ref|XP_006364731.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    1e-10   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                   64.7    1e-10   
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1      64.7    1e-10   
ref|XP_002299270.2|  hypothetical protein POPTR_0001s14680g           63.9    1e-10   
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg           64.7    1e-10   
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1      64.7    1e-10   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1      64.7    1e-10   
ref|NP_200956.1|  leucine-rich repeat receptor-like protein kinas...  64.7    1e-10   
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    1e-10   
gb|AFW70452.1|  putative protein kinase superfamily protein           64.3    1e-10   
ref|XP_009129583.1|  PREDICTED: receptor-like protein kinase 5        64.7    1e-10   
ref|XP_002453413.1|  hypothetical protein SORBIDRAFT_04g005600        64.3    1e-10   
ref|NP_001148817.1|  LOC100282434 precursor                           63.9    1e-10   
ref|XP_006300302.1|  hypothetical protein CARUB_v10019725mg           64.7    1e-10   
emb|CDY39959.1|  BnaC06g40370D                                        63.9    2e-10   
ref|XP_011015392.1|  PREDICTED: probable receptor-like protein ki...  63.9    2e-10   
ref|XP_006644690.1|  PREDICTED: receptor-like protein kinase 5-like   64.7    2e-10   
gb|KHG11715.1|  hypothetical protein F383_04417                       63.9    2e-10   
gb|KCW53455.1|  hypothetical protein EUGRSUZ_J02701                   63.2    2e-10   
ref|XP_006412947.1|  hypothetical protein EUTSA_v10024311mg           64.7    2e-10   
dbj|BAD25150.1|  putative protein kinase 2                            63.9    2e-10   
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                 64.7    2e-10   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...  64.7    2e-10   
ref|XP_003566022.1|  PREDICTED: receptor-like protein kinase HSL1     64.7    2e-10   
ref|XP_011020643.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
gb|KCW81624.1|  hypothetical protein EUGRSUZ_C02985                   64.3    2e-10   
ref|XP_006388761.1|  hypothetical protein POPTR_0104s002003g          61.6    2e-10   
ref|XP_002969446.1|  hypothetical protein SELMODRAFT_146189           64.7    2e-10   
ref|XP_006340511.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    2e-10   
ref|XP_006385923.1|  hypothetical protein POPTR_0003s17790g           63.5    2e-10   
ref|XP_002961218.1|  hypothetical protein SELMODRAFT_140032           64.7    2e-10   
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...  64.3    2e-10   
ref|XP_004144606.1|  PREDICTED: receptor-like protein kinase HSL1...  64.3    2e-10   
ref|XP_009630948.1|  PREDICTED: PTI1-like tyrosine-protein kinase...  63.5    2e-10   
ref|XP_011034498.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
ref|XP_010049140.1|  PREDICTED: receptor-like protein kinase HSL1     64.3    2e-10   
ref|XP_006388762.1|  hypothetical protein POPTR_0104s002003g          61.6    2e-10   
gb|AGC54430.1|  receptor-like kinase                                  61.2    2e-10   
gb|AIA83616.1|  Pkinase_Tyr                                           60.5    2e-10   
ref|XP_009385055.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
ref|XP_008354538.1|  PREDICTED: receptor-like protein kinase HSL1     64.3    2e-10   
gb|ABC68437.1|  putative leucine-rich repeat transmembrane protei...  60.5    2e-10   
gb|KGN45563.1|  hypothetical protein Csa_7G452180                     64.3    2e-10   
gb|KCW74513.1|  hypothetical protein EUGRSUZ_E03228                   64.3    2e-10   
ref|XP_010059190.1|  PREDICTED: receptor-like protein kinase At3g...  63.2    2e-10   
ref|XP_008349015.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  63.5    2e-10   
emb|CDY38384.1|  BnaC01g09930D                                        63.2    2e-10   
ref|XP_011034495.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
emb|CBI19895.3|  unnamed protein product                              64.3    2e-10   
ref|XP_007149806.1|  hypothetical protein PHAVU_005G100400g           64.3    2e-10   
ref|XP_002866438.1|  hypothetical protein ARALYDRAFT_496307           64.3    2e-10   
ref|XP_010057361.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  64.3    2e-10   
ref|XP_008788934.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450        64.3    2e-10   
ref|XP_004169267.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  64.3    2e-10   
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...  64.3    2e-10   
ref|XP_004155984.1|  PREDICTED: probable LRR receptor-like serine...  64.3    2e-10   
gb|KFK42447.1|  hypothetical protein AALP_AA2G257900                  63.5    2e-10   
ref|XP_011034496.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
gb|KGN43475.1|  hypothetical protein Csa_7G039230                     64.3    2e-10   
ref|XP_011034494.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
ref|NP_001077858.1|  probable receptor-like protein kinase            63.2    2e-10   
emb|CDP07377.1|  unnamed protein product                              64.3    2e-10   
ref|XP_010245528.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
ref|XP_008788933.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...  64.3    2e-10   
ref|XP_008464660.1|  PREDICTED: putative leucine-rich repeat rece...  64.3    2e-10   
ref|XP_002300697.2|  receptor protein kinase                          64.3    2e-10   
ref|XP_008455491.1|  PREDICTED: receptor-like protein kinase HSL1     64.3    2e-10   
ref|XP_006848777.1|  hypothetical protein AMTR_s00026p00089830        63.5    2e-10   
ref|XP_002869498.1|  hypothetical protein ARALYDRAFT_491919           64.3    2e-10   
ref|XP_002527325.1|  Serine/threonine-protein kinase PBS1, putative   63.2    2e-10   
ref|XP_010915378.1|  PREDICTED: receptor-like protein kinase HSL1     64.3    2e-10   
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...  63.9    2e-10   
ref|XP_009774043.1|  PREDICTED: PTI1-like tyrosine-protein kinase...  63.2    2e-10   
ref|XP_010932226.1|  PREDICTED: probable receptor-like protein ki...  63.5    2e-10   
ref|XP_002307734.1|  receptor protein kinase                          63.9    2e-10   
gb|KFK27903.1|  hypothetical protein AALP_AA8G445100                  63.9    2e-10   
ref|XP_006389818.1|  hypothetical protein EUTSA_v10018582mg           63.2    2e-10   
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...  63.9    2e-10   
ref|XP_004309904.1|  PREDICTED: receptor-like protein kinase HSL1...  63.9    2e-10   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...  63.9    2e-10   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1      63.9    2e-10   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                      63.9    2e-10   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                  63.9    2e-10   
gb|EEE60014.1|  hypothetical protein OsJ_12761                        63.9    2e-10   
gb|AAD23669.1|  hypothetical protein                                  61.6    2e-10   
ref|XP_010265695.1|  PREDICTED: probable receptor-like protein ki...  63.2    2e-10   
ref|XP_010265697.1|  PREDICTED: probable receptor-like protein ki...  63.2    2e-10   
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...  63.9    2e-10   
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  63.9    3e-10   
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...  63.9    3e-10   
ref|XP_004237515.1|  PREDICTED: leucine-rich repeat receptor-like...  63.9    3e-10   
gb|EAY92008.1|  hypothetical protein OsI_13698                        63.9    3e-10   
gb|AAP68887.1|  putative receptor-like protein kinase 1               63.9    3e-10   
gb|KCW79619.1|  hypothetical protein EUGRSUZ_C00974                   63.9    3e-10   
ref|XP_009780494.1|  PREDICTED: receptor-like protein kinase HSL1     63.9    3e-10   
dbj|BAF01968.1|  receptor protein kinase like protein                 61.6    3e-10   
ref|NP_001051418.1|  Os03g0773700                                     63.9    3e-10   
ref|XP_010417683.1|  PREDICTED: probable receptor-like protein ki...  63.2    3e-10   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...  63.9    3e-10   
ref|NP_178179.2|  probable receptor-like protein kinase               63.2    3e-10   
ref|XP_007216152.1|  hypothetical protein PRUPE_ppa015188mg           63.9    3e-10   
gb|EPS73267.1|  hypothetical protein M569_01488                       63.9    3e-10   
ref|XP_010025147.1|  PREDICTED: leucine-rich repeat receptor-like...  60.1    3e-10   
ref|XP_009773864.1|  PREDICTED: probable receptor-like protein ki...  63.2    3e-10   
emb|CAN76226.1|  hypothetical protein VITISV_000266                   62.8    3e-10   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1-...  63.9    3e-10   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...  63.9    3e-10   
ref|NP_001169902.1|  uncharacterized protein LOC100383797             63.2    3e-10   
ref|XP_010417684.1|  PREDICTED: probable receptor-like protein ki...  63.2    3e-10   
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1      63.9    3e-10   
emb|CDP04271.1|  unnamed protein product                              63.9    3e-10   
emb|CBI20586.3|  unnamed protein product                              63.5    3e-10   
gb|ABC41024.1|  CLV1-like LRR receptor kinase                         60.8    3e-10   
dbj|BAJ97909.1|  predicted protein                                    63.9    3e-10   
ref|XP_009607949.1|  PREDICTED: probable receptor-like protein ki...  63.2    3e-10   
ref|XP_008462388.1|  PREDICTED: putative leucine-rich repeat rece...  63.5    3e-10   
gb|KDP33800.1|  hypothetical protein JCGZ_07371                       63.9    3e-10   
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1      63.9    3e-10   
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...  63.9    3e-10   
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...  63.9    3e-10   
gb|AAT28309.1|  leucine-rich repeat receptor-like protein kinase      63.9    3e-10   
ref|XP_008372397.1|  PREDICTED: leucine-rich repeat receptor-like...  63.9    3e-10   
gb|EYU39523.1|  hypothetical protein MIMGU_mgv1a000654mg              63.9    3e-10   



>ref|XP_007013028.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
 gb|EOY30647.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
Length=1019

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHHGC+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  817  QGLCYMHHGCSPPIIHRDVKSSNILLDSEFNAKIAD  852



>ref|XP_008798566.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=343

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHHGC+PPIVHRD+KSSNIL+DS+F AKIAD
Sbjct  268  QGLCYMHHGCSPPIVHRDVKSSNILLDSEFRAKIAD  303



>ref|XP_007013027.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30646.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
Length=1097

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHHGC+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  817  QGLCYMHHGCSPPIIHRDVKSSNILLDSEFNAKIAD  852



>ref|XP_010911143.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=228

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHHGC PPIVHRD+KSSNIL+DS+F AK+AD
Sbjct  54   QGLCYMHHGCFPPIVHRDVKSSNILLDSEFRAKVAD  89



>gb|KGN66180.1| hypothetical protein Csa_1G574960 [Cucumis sativus]
Length=996

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  817  QGLCYMHHDCSPPVIHRDLKSSNILLDSDFNAKIAD  852



>ref|XP_002324455.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
 gb|EEF03020.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
Length=984

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+KSSNIL+DS+FNAKIAD
Sbjct  806  QGLCYMHHDCSPPIVHRDVKSSNILLDSEFNAKIAD  841



>ref|XP_004157305.1| PREDICTED: receptor-like protein kinase 5-like [Cucumis sativus]
Length=1267

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108   QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             QGLCYMHH C+PP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  1088  QGLCYMHHDCSPPVIHRDLKSSNILLDSDFNAKIAD  1123



>ref|XP_008450784.1| PREDICTED: receptor-like protein kinase 5 [Cucumis melo]
Length=995

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  816  QGLCYMHHECSPPVIHRDLKSSNILLDSDFNAKIAD  851



>ref|XP_002324453.1| hypothetical protein POPTR_0018s09510g [Populus trichocarpa]
 gb|EEF03018.1| hypothetical protein POPTR_0018s09510g [Populus trichocarpa]
Length=982

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+KSSNIL+DS+FNAKIAD
Sbjct  804  QGLCYMHHDCSPPIVHRDVKSSNILLDSEFNAKIAD  839



>ref|XP_010095356.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Morus 
notabilis]
 gb|EXB59775.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Morus 
notabilis]
Length=182

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PPI+HRDIKSSNIL+DSDFN KIAD
Sbjct  16   RGLCYMHHDCLPPIMHRDIKSSNILLDSDFNPKIAD  51



>ref|XP_011007104.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=982

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+KSSNIL+DS+FNAKIAD
Sbjct  804  QGLCYMHHDCSPPIVHRDVKSSNILLDSEFNAKIAD  839



>ref|XP_008780630.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Phoenix dactylifera]
Length=196

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+PPIVHRD+KSSNIL+DS+F AKIAD
Sbjct  22   RGLCYMHHGCSPPIVHRDVKSSNILLDSEFRAKIAD  57



>ref|XP_002280395.1| PREDICTED: receptor-like protein kinase 5 [Vitis vinifera]
Length=1021

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+KSSNIL+DS+FNAK+AD
Sbjct  816  QGLCYMHHDCSPPIVHRDVKSSNILLDSEFNAKLAD  851



>ref|XP_006366693.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=1032

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPI+HRD+KSSNIL+DSDF AKIAD
Sbjct  812  QGLCYMHHDCTPPIIHRDVKSSNILLDSDFTAKIAD  847



>ref|XP_004245143.1| PREDICTED: receptor-like protein kinase HSL1 [Solanum lycopersicum]
Length=1043

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPI+HRD+KSSNIL+DSDF AKIAD
Sbjct  823  QGLCYMHHDCTPPIIHRDVKSSNILLDSDFTAKIAD  858



>emb|CBI27997.3| unnamed protein product [Vitis vinifera]
Length=750

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+KSSNIL+DS+FNAK+AD
Sbjct  545  QGLCYMHHDCSPPIVHRDVKSSNILLDSEFNAKLAD  580



>ref|XP_007203859.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
 gb|EMJ05058.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
Length=1016

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  817  QGLCYMHHDCVPPVVHRDVKSSNILLDSDFNAKIAD  852



>ref|XP_007203222.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
 gb|EMJ04421.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
Length=1018

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  816  QGLCYMHHDCVPPVVHRDVKSSNILLDSDFNAKIAD  851



>ref|XP_008242543.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=938

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  745  QGLCYMHHDCVPPVVHRDVKSSNILLDSDFNAKIAD  780



>ref|XP_004135674.1| PREDICTED: receptor-like protein kinase 5-like [Cucumis sativus]
Length=277

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  98   QGLCYMHHDCSPPVIHRDLKSSNILLDSDFNAKIAD  133



>ref|XP_011008121.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCY+HH C+PPIVHRD+KSSNIL+DS+FNAKIAD
Sbjct  808  QGLCYLHHDCSPPIVHRDVKSSNILLDSEFNAKIAD  843



>ref|XP_010110882.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC28701.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1055

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP++HRDIK+SNIL+DSDFNAKIAD
Sbjct  813  QGLCYMHHDCVPPVIHRDIKTSNILLDSDFNAKIAD  848



>ref|XP_011014419.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCY+HH C+PPIVHRD+KSSNIL+DS+FNAKIAD
Sbjct  808  QGLCYLHHDCSPPIVHRDVKSSNILLDSEFNAKIAD  843



>emb|CBI39978.3| unnamed protein product [Vitis vinifera]
Length=912

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  736  RGLCYMHHDCSPPIIHRDVKSSNILLDSEFNAKIAD  771



>emb|CAN76607.1| hypothetical protein VITISV_030396 [Vitis vinifera]
Length=974

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  826  RGLCYMHHDCSPPIIHRDVKSSNILLDSEFNAKIAD  861



>ref|XP_002324456.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
 gb|EEF03021.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
Length=1010

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCY+HH C+PPIVHRD+KSSNIL+DS+FNAKIAD
Sbjct  806  QGLCYLHHDCSPPIVHRDVKSSNILLDSEFNAKIAD  841



>ref|XP_010493845.1| PREDICTED: receptor-like protein kinase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010493847.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Camelina 
sativa]
Length=1007

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DSDFNAKIAD
Sbjct  804  QGLCYMHHDCTPAIIHRDVKSSNILLDSDFNAKIAD  839



>ref|XP_010454934.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DSDFNAKIAD
Sbjct  804  QGLCYMHHDCTPAIIHRDVKSSNILLDSDFNAKIAD  839



>ref|XP_010421450.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DSDFNAKIAD
Sbjct  804  QGLCYMHHDCTPAIIHRDVKSSNILLDSDFNAKIAD  839



>ref|XP_010106712.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC11523.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1194

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108   QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             QGLCYMHH C PP++HRDIK+SNIL+DSDFNAKIAD
Sbjct  989   QGLCYMHHDCVPPVIHRDIKASNILLDSDFNAKIAD  1024



>ref|XP_010924676.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=864

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+PP+VHRD+KSSNIL+DS+F AK+AD
Sbjct  690  RGLCYMHHGCSPPVVHRDVKSSNILLDSEFRAKVAD  725



>ref|XP_010661160.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1007

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  834  RGLCYMHHDCSPPIIHRDVKSSNILLDSEFNAKIAD  869



>ref|XP_009795019.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1018

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  813  RGLCYMHHDCSPPIIHRDVKSSNILLDSEFNAKIAD  848



>ref|XP_004288943.1| PREDICTED: receptor-like protein kinase HSL1-like [Fragaria vesca 
subsp. vesca]
Length=989

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PPI+HRD+KSSNIL+DSDFNAKIAD
Sbjct  812  KGLCYMHHDCVPPILHRDVKSSNILLDSDFNAKIAD  847



>ref|XP_010536218.1| PREDICTED: receptor-like protein kinase HSL1 [Tarenaya hassleriana]
Length=1014

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+P I+HRDIKSSNIL+DSDFNAKIAD
Sbjct  803  RGLCYMHHDCSPAIIHRDIKSSNILLDSDFNAKIAD  838



>ref|XP_004961447.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=1057

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPIVHRD+KSSNIL+DSD NAK+AD
Sbjct  840  RGLCYMHHECSPPIVHRDVKSSNILLDSDLNAKVAD  875



>ref|XP_011093340.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Sesamum indicum]
Length=1025

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPI+HRD+KSSNIL+DSDF  KIAD
Sbjct  812  QGLCYMHHDCTPPIIHRDVKSSNILLDSDFEPKIAD  847



>ref|XP_010910702.1| PREDICTED: receptor-like protein kinase HSL1 isoform X3 [Elaeis 
guineensis]
Length=894

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+PPIVHR++KSSNIL+DS+F AK+AD
Sbjct  758  RGLCYMHHGCSPPIVHREVKSSNILLDSEFRAKVAD  793



>ref|XP_010910701.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Elaeis 
guineensis]
Length=895

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+PPIVHR++KSSNIL+DS+F AK+AD
Sbjct  758  RGLCYMHHGCSPPIVHREVKSSNILLDSEFRAKVAD  793



>ref|XP_004288893.1| PREDICTED: receptor-like protein kinase HSL1-like [Fragaria vesca 
subsp. vesca]
Length=1012

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  812  KGLCYMHHDCVPPVIHRDVKSSNILLDSDFNAKIAD  847



>ref|XP_010910700.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Elaeis 
guineensis]
Length=934

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+PPIVHR++KSSNIL+DS+F AK+AD
Sbjct  758  RGLCYMHHGCSPPIVHREVKSSNILLDSEFRAKVAD  793



>ref|XP_004287478.1| PREDICTED: receptor-like protein kinase HSL1-like [Fragaria vesca 
subsp. vesca]
Length=1013

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  GLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            GLCYMHH C PP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  813  GLCYMHHDCVPPVIHRDVKSSNILLDSDFNAKIAD  847



>ref|XP_007225351.1| hypothetical protein PRUPE_ppa000941mg [Prunus persica]
 gb|EMJ26550.1| hypothetical protein PRUPE_ppa000941mg [Prunus persica]
Length=954

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A+IAD
Sbjct  746  QGLCYMHHDCSPPIIHRDVKSSNILLDSEFKARIAD  781



>ref|XP_009350259.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1017

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A+IAD
Sbjct  809  QGLCYMHHDCSPPIIHRDVKSSNILLDSEFKARIAD  844



>ref|XP_008377967.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1019

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A+IAD
Sbjct  811  QGLCYMHHDCSPPIIHRDVKSSNILLDSEFKARIAD  846



>ref|XP_009367420.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1021

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A+IAD
Sbjct  813  QGLCYMHHDCSPPIIHRDVKSSNILLDSEFKARIAD  848



>ref|XP_008220120.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1022

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A+IAD
Sbjct  815  QGLCYMHHDCSPPIIHRDVKSSNILLDSEFKARIAD  850



>ref|XP_002516533.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45874.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=1026

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A+IAD
Sbjct  816  QGLCYMHHDCSPPIIHRDVKSSNILLDSEFKARIAD  851



>ref|XP_009415190.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1066

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS+FNA++AD
Sbjct  852  RGLCYMHHDCSPPIIHRDVKSSNILLDSEFNARVAD  887



>ref|XP_009587881.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=1026

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPI+HRD+KSSNIL+DS+F AKIAD
Sbjct  808  QGLCYMHHDCTPPILHRDVKSSNILLDSEFKAKIAD  843



>ref|NP_001168877.1| uncharacterized protein LOC100382682 [Zea mays]
 gb|ACN30916.1| unknown [Zea mays]
Length=189

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  48   QGLCYMHHECVPPIVHRDVKTSNILLDSEFRAKVAD  83



>ref|XP_006353495.1| PREDICTED: receptor-like protein kinase 5-like [Solanum tuberosum]
Length=885

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +G+CYMHH C+PPI+HRD+KSSNIL+DS FNAKIAD
Sbjct  680  RGICYMHHDCSPPIIHRDVKSSNILLDSQFNAKIAD  715



>ref|XP_007137253.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
 gb|ESW09247.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
Length=1018

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PP++HRD+KSSNIL+DS+F AKIAD
Sbjct  812  QGLCYMHHECSPPVIHRDVKSSNILLDSEFRAKIAD  847



>ref|XP_008242547.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Prunus mume]
Length=979

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  814  RGLCYMHHYCVPPVVHRDMKSSNILLDSDFNAKIAD  849



>ref|XP_009415677.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1024

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS+FNA++AD
Sbjct  813  RGLCYMHHDCSPPIIHRDVKSSNILLDSEFNARVAD  848



>gb|KHN18142.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=857

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PP++HRD+KSSNIL+DS+F AKIAD
Sbjct  651  QGLCYMHHDCSPPVIHRDVKSSNILLDSEFRAKIAD  686



>ref|XP_004251639.1| PREDICTED: receptor-like protein kinase 5 [Solanum lycopersicum]
Length=1008

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+PPI+HRD+KSSNIL+DS FNAKIAD
Sbjct  803  HGLCYMHHDCSPPIIHRDVKSSNILLDSQFNAKIAD  838



>ref|XP_007203495.1| hypothetical protein PRUPE_ppa022516mg, partial [Prunus persica]
 gb|EMJ04694.1| hypothetical protein PRUPE_ppa022516mg, partial [Prunus persica]
Length=866

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  683  RGLCYMHHDCVPPVVHRDMKSSNILLDSDFNAKIAD  718



>ref|NP_197965.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
 gb|AAD40144.1|AF149413_25 contains similarity to protein kinase domains (Pfam F00069, Score=162.6, 
E=6.8e-45, N=1) and leucien rich repeats (Pfam PF00560, 
Score=210.7, E=2.2e-59, N=10) [Arabidopsis thaliana]
 gb|AAO42089.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59374.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED93502.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
Length=1005

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DS+FNAKIAD
Sbjct  802  QGLCYMHHDCTPAIIHRDVKSSNILLDSEFNAKIAD  837



>ref|XP_002872190.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48449.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1005

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DS+FNAKIAD
Sbjct  802  QGLCYMHHDCTPAIIHRDVKSSNILLDSEFNAKIAD  837



>ref|XP_006286985.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
 gb|EOA19883.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
Length=1006

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DS+FNAKIAD
Sbjct  803  QGLCYMHHDCTPAIIHRDVKSSNILLDSEFNAKIAD  838



>ref|XP_009601880.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=1018

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+D++FNAKIAD
Sbjct  813  RGLCYMHHDCSPPIIHRDVKSSNILLDTEFNAKIAD  848



>ref|XP_010917293.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=742

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+KSSNIL+DSDF  +IAD
Sbjct  531  QGLCYMHHDCSPPIVHRDVKSSNILLDSDFRVRIAD  566



>ref|XP_009779466.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1019

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPI+HRD+KSSNIL+DS+F AKIAD
Sbjct  801  QGLCYMHHDCTPPILHRDVKSSNILLDSEFKAKIAD  836



>ref|XP_008344114.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=888

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  819  QGLSYMHHDCVPPVVHRDVKSSNILLDSDFNAKIAD  854



>ref|XP_004969910.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1052

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPIVHRD+K+SNIL+DS+F AKIAD
Sbjct  839  QGLCYMHHECEPPIVHRDVKTSNILLDSEFRAKIAD  874



>ref|XP_003527853.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1021

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PP++HRD+KSSNIL+DS+F AKIAD
Sbjct  815  QGLCYMHHDCSPPVIHRDVKSSNILLDSEFRAKIAD  850



>ref|XP_010047668.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79625.1| hypothetical protein EUGRSUZ_C00984 [Eucalyptus grandis]
Length=1026

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS FNAKIAD
Sbjct  820  KGLCYMHHDCSPPIIHRDVKSSNILLDSKFNAKIAD  855



>ref|XP_004972171.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=1011

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPIVHRD+K+SNIL+DS+F AKIAD
Sbjct  807  QGLCYMHHECEPPIVHRDVKASNILLDSEFRAKIAD  842



>ref|XP_010047253.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
 gb|KCW79117.1| hypothetical protein EUGRSUZ_C00558 [Eucalyptus grandis]
Length=1026

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS FNAKIAD
Sbjct  820  KGLCYMHHDCSPPIIHRDVKSSNILLDSKFNAKIAD  855



>gb|EMS60554.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Triticum 
urartu]
Length=900

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  685  QGLCYMHHECSPPIVHRDVKTSNILLDSEFRAKVAD  720



>dbj|BAJ98312.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=917

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  841  QGLCYMHHECSPPIVHRDVKTSNILLDSEFRAKVAD  876



>ref|XP_010924675.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=657

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHHGC+PPIVHRD+KSSNIL+DS+F AK+AD
Sbjct  592  QGLFYMHHGCSPPIVHRDVKSSNILLDSEFRAKVAD  627



>ref|XP_010232300.1| PREDICTED: receptor-like protein kinase 5 [Brachypodium distachyon]
Length=1057

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  842  QGLCYMHHECSPPIVHRDVKTSNILLDSEFRAKVAD  877



>emb|CDP08193.1| unnamed protein product [Coffea canephora]
Length=984

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS F+AKIAD
Sbjct  773  QGLCYMHHDCSPPILHRDVKSSNILLDSGFDAKIAD  808



>gb|KEH27208.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=981

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+PPI+HRDIK+SNIL+DS+FNAK+AD
Sbjct  795  HGLCYMHHDCSPPIIHRDIKTSNILLDSEFNAKVAD  830



>emb|CDX80547.1| BnaC07g28970D [Brassica napus]
Length=902

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+D DFNAKIAD
Sbjct  699  QGLCYMHHDCTPAIIHRDVKSSNILLDYDFNAKIAD  734



>ref|XP_010924441.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=1057

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+PPIVHRD+KSSNIL+D +F AK+AD
Sbjct  881  RGLCYMHHGCSPPIVHRDVKSSNILLDFEFRAKVAD  916



>ref|XP_004513049.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1012

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+PPIVHRDIK+SNIL+DS+FNAK+AD
Sbjct  811  HGLCYMHHDCSPPIVHRDIKTSNILLDSEFNAKVAD  846



>ref|XP_010267130.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1045

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMH  C+PPI+HRD+KSSNIL+DS+FNA+IAD
Sbjct  831  QGLCYMHQDCSPPIIHRDVKSSNILLDSEFNARIAD  866



>ref|XP_002442938.1| hypothetical protein SORBIDRAFT_08g005090 [Sorghum bicolor]
 gb|EES16776.1| hypothetical protein SORBIDRAFT_08g005090 [Sorghum bicolor]
Length=1021

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+K+SNIL+DS+F AKIAD
Sbjct  833  QGLCYMHHECSPPIVHRDVKTSNILLDSEFRAKIAD  868



>gb|EMT04436.1| Receptor-like protein kinase 5 [Aegilops tauschii]
Length=202

 Score = 69.3 bits (168),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHR++K+SNIL+DS+F  K+AD
Sbjct  27   QGLCYMHHECSPPIVHRNVKTSNILLDSEFRTKVAD  62



>gb|EYU30701.1| hypothetical protein MIMGU_mgv1a000689mg [Erythranthe guttata]
Length=1017

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+P I+HRD+KSSNIL+DSDFNAKIAD
Sbjct  813  HGLCYMHHHCSPSIIHRDVKSSNILLDSDFNAKIAD  848



>ref|XP_006596182.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Glycine max]
Length=883

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A IAD
Sbjct  817  QGLCYMHHDCSPPIIHRDVKSSNILMDSEFRASIAD  852



>ref|XP_009627680.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=1015

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSN+L+DS FNAKIAD
Sbjct  811  RGLCYMHHDCSPPIIHRDVKSSNVLLDSCFNAKIAD  846



>ref|XP_009759980.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana sylvestris]
Length=1042

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSN+L+DS FNAKIAD
Sbjct  838  RGLCYMHHDCSPPIIHRDVKSSNVLLDSCFNAKIAD  873



>ref|XP_009619690.1| PREDICTED: receptor-like protein kinase 5 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009619691.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=1044

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSN+L+DS FNAKIAD
Sbjct  840  RGLCYMHHDCSPPIIHRDVKSSNVLLDSCFNAKIAD  875



>ref|XP_006596181.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=1032

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+KSSNIL+DS+F A IAD
Sbjct  817  QGLCYMHHDCSPPIIHRDVKSSNILMDSEFRASIAD  852



>gb|EYU29298.1| hypothetical protein MIMGU_mgv1a000685mg [Erythranthe guttata]
Length=1018

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DSDF AKIAD
Sbjct  808  QGLCYMHHDCTPAIIHRDVKSSNILLDSDFRAKIAD  843



>gb|KCW79612.1| hypothetical protein EUGRSUZ_C00966 [Eucalyptus grandis]
Length=598

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  528  KGLCYMHHDCSSPIIHRDVKSSNILLDSEFNAKIAD  563



>ref|XP_010042345.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=662

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  470  KGLCYMHNDCSPPIIHRDVKSSNILLDSEFNAKIAD  505



>gb|KHN40380.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=930

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP+VHRD+K+SNIL+DS FNAK+AD
Sbjct  730  QGLCYMHHDCLPPVVHRDVKTSNILLDSQFNAKVAD  765



>ref|XP_009600836.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=405

 Score = 70.9 bits (172),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C  PI+HRDIKSSNIL+DS+F+AKIAD
Sbjct  235  QGLCYMHHDCTRPIIHRDIKSSNILLDSEFSAKIAD  270



>ref|XP_010925541.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=1033

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPIVHRD+KSSNIL+D++F AKIAD
Sbjct  824  RGLCYMHHDCSPPIVHRDVKSSNILLDAEFGAKIAD  859



>ref|XP_004969911.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=1044

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP+VHRD+K+SNIL+DS+F AK+AD
Sbjct  829  QGLCYMHHECEPPVVHRDVKTSNILLDSEFRAKVAD  864



>ref|XP_002456336.1| hypothetical protein SORBIDRAFT_03g034210 [Sorghum bicolor]
 gb|EES01456.1| hypothetical protein SORBIDRAFT_03g034210 [Sorghum bicolor]
Length=592

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  377  QGLCYMHHECVPPIVHRDVKTSNILLDSEFRAKVAD  412



>ref|XP_009381187.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1025

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PP++HRD+KSSNIL+DSDF AK+AD
Sbjct  820  RGLCYMHHHCTPPVIHRDVKSSNILLDSDFGAKMAD  855



>ref|XP_010050474.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=978

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+ PI+HRD+KSSNIL+DS+F AKIAD
Sbjct  817  EGLCYMHHGCSSPIIHRDVKSSNILLDSEFKAKIAD  852



>ref|XP_010519877.1| PREDICTED: receptor-like protein kinase 5 [Tarenaya hassleriana]
Length=975

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+P I+HRD+KSSNIL+DS+F+AKIAD
Sbjct  802  QGLCYMHHDCSPAIIHRDVKSSNILLDSEFDAKIAD  837



>gb|KCW79622.1| hypothetical protein EUGRSUZ_C00979 [Eucalyptus grandis]
Length=992

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+ PI+HRD+KSSNIL+DS+F AKIAD
Sbjct  817  EGLCYMHHGCSSPIIHRDVKSSNILLDSEFKAKIAD  852



>ref|XP_008794105.1| PREDICTED: receptor-like protein kinase 5 [Phoenix dactylifera]
Length=1033

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPIVHRD+KSSNIL+D++F AKIAD
Sbjct  821  RGLCYMHHDCSPPIVHRDVKSSNILLDAEFGAKIAD  856



>ref|XP_003516786.2| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1013

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP+VHRD+K+SNIL+DS FNAK+AD
Sbjct  813  QGLCYMHHDCLPPVVHRDVKTSNILLDSQFNAKVAD  848



>ref|XP_010519875.1| PREDICTED: receptor-like protein kinase 5 [Tarenaya hassleriana]
Length=1009

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+P I+HRD+KSSNIL+DS+FNAKIAD
Sbjct  803  RGLCYMHHDCSPAIIHRDVKSSNILLDSEFNAKIAD  838



>ref|XP_006364729.1| PREDICTED: receptor-like protein kinase 5-like [Solanum tuberosum]
Length=698

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C  PI+HRDIKSSNIL+DS+FNAKIAD
Sbjct  528  QGLCYMHHHCTRPIIHRDIKSSNILLDSEFNAKIAD  563



>gb|KCW79613.1| hypothetical protein EUGRSUZ_C00967 [Eucalyptus grandis]
Length=986

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  780  KGLCYMHNDCSPPIIHRDVKSSNILLDSEFNAKIAD  815



>tpg|DAA57705.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1054

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  839  QGLCYMHHECVPPIVHRDVKTSNILLDSEFRAKVAD  874



>ref|XP_006364718.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=310

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C  PI+HRDIKSSNIL+DS+FNAKIAD
Sbjct  140  QGLSYMHHDCTRPIIHRDIKSSNILLDSEFNAKIAD  175



>gb|EMS35768.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=174

 Score = 68.2 bits (165),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+P I HRD+KSSNIL+D  F AKIAD
Sbjct  9    RGLCYMHHGCSPAIAHRDVKSSNILLDPQFKAKIAD  44



>gb|KCW79627.1| hypothetical protein EUGRSUZ_C00986 [Eucalyptus grandis]
Length=776

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  687  KGLCYMHHDCSSPIIHRDVKSSNILLDSEFNAKIAD  722



>emb|CDP03253.1| unnamed protein product [Coffea canephora]
Length=934

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+P I+HRD+KSSNIL+DS+FNAKIAD
Sbjct  729  RGLCYMHHDCSPSIIHRDLKSSNILLDSEFNAKIAD  764



>emb|CDP03251.1| unnamed protein product [Coffea canephora]
Length=982

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+P I+HRD+KSSNIL+DS+FNAKIAD
Sbjct  777  RGLCYMHHDCSPSIIHRDLKSSNILLDSEFNAKIAD  812



>ref|XP_006451306.1| hypothetical protein CICLE_v10007383mg [Citrus clementina]
 gb|ESR64546.1| hypothetical protein CICLE_v10007383mg [Citrus clementina]
Length=934

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+P IVHRD+KSSNIL+D +FNAKIAD
Sbjct  729  QGLCYMHHDCSPTIVHRDLKSSNILLDYNFNAKIAD  764



>gb|KHN16977.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1011

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+PPIVHRDIK+SNIL+D+ FNAK+AD
Sbjct  808  HGLCYMHHDCSPPIVHRDIKTSNILLDAQFNAKVAD  843



>ref|XP_003548595.1| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1011

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+PPIVHRDIK+SNIL+D+ FNAK+AD
Sbjct  808  HGLCYMHHDCSPPIVHRDIKTSNILLDAQFNAKVAD  843



>ref|XP_004513052.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Cicer arietinum]
Length=908

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMH+ C+PPIVHRD+K+SNIL+DS FNAK+AD
Sbjct  815  QGLCYMHNDCSPPIVHRDVKTSNILLDSQFNAKVAD  850



>gb|KCW79626.1| hypothetical protein EUGRSUZ_C00986 [Eucalyptus grandis]
Length=893

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  687  KGLCYMHHDCSSPIIHRDVKSSNILLDSEFNAKIAD  722



>ref|XP_009151112.1| PREDICTED: receptor-like protein kinase 5 [Brassica rapa]
Length=904

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+D +FNAKIAD
Sbjct  700  QGLCYMHHDCTPAIIHRDVKSSNILLDYEFNAKIAD  735



>ref|XP_002456337.1| hypothetical protein SORBIDRAFT_03g034220 [Sorghum bicolor]
 gb|EES01457.1| hypothetical protein SORBIDRAFT_03g034220 [Sorghum bicolor]
Length=1044

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCY+HH C+PPI+HRD+K+SNIL+DS+F AK+AD
Sbjct  829  QGLCYLHHECSPPIIHRDVKTSNILLDSEFRAKVAD  864



>ref|XP_004513051.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1012

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMH+ C+PPIVHRD+K+SNIL+DS FNAK+AD
Sbjct  815  QGLCYMHNDCSPPIVHRDVKTSNILLDSQFNAKVAD  850



>ref|XP_009151111.1| PREDICTED: receptor-like protein kinase 5 [Brassica rapa]
Length=1006

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+D +FNAKIAD
Sbjct  803  QGLCYMHHDCTPAIIHRDVKSSNILLDYEFNAKIAD  838



>emb|CDX88206.1| BnaA06g27970D [Brassica napus]
Length=1007

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+D +FNAKIAD
Sbjct  803  QGLCYMHHDCTPAIIHRDVKSSNILLDYEFNAKIAD  838



>gb|KFK26382.1| hypothetical protein AALP_AA8G241000 [Arabis alpina]
Length=1011

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+P I+HRD+KSSNIL+D +FNAKIAD
Sbjct  807  QGLCYMHHDCSPAIIHRDVKSSNILLDFEFNAKIAD  842



>gb|KDO66581.1| hypothetical protein CISIN_1g001778mg [Citrus sinensis]
Length=1014

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+P IVHRD+KSSNIL+D +FNAKIAD
Sbjct  809  QGLCYMHHDCSPTIVHRDLKSSNILLDYNFNAKIAD  844



>ref|XP_010924677.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=836

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHHGC+PPIVHRD+KSSNIL+D +F  K+AD
Sbjct  660  RGLCYMHHGCSPPIVHRDVKSSNILLDFEFRPKVAD  695



>ref|XP_006475586.1| PREDICTED: receptor-like protein kinase 5-like [Citrus sinensis]
Length=1014

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+P IVHRD+KSSNIL+D +FNAKIAD
Sbjct  809  QGLCYMHHDCSPTIVHRDLKSSNILLDYNFNAKIAD  844



>gb|KEH27215.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1012

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMH+ C+PPIVHRD+K+SNIL+DS FNAK+AD
Sbjct  815  QGLCYMHNDCSPPIVHRDVKTSNILLDSKFNAKVAD  850



>emb|CDX80548.1| BnaC07g28960D [Brassica napus]
Length=906

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P  +HRD+KSSNIL+D DFNAKIAD
Sbjct  703  QGLCYMHHDCTPATIHRDVKSSNILLDYDFNAKIAD  738



>ref|XP_008242546.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Prunus mume]
Length=1100

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  898  QGLRYMHHDCVPPVVHRDVKSSNILLDSDFNAKIAD  933



>ref|XP_007152971.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
 gb|ESW24965.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
Length=1011

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PP+VHRD+K+SNIL+DS FNAK+AD
Sbjct  811  QGLCYMHHDCLPPVVHRDVKTSNILLDSKFNAKVAD  846



>ref|XP_009416472.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1014

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KSSNIL+D +FNAKIAD
Sbjct  806  RGLCYLHHDCSPPIIHRDVKSSNILLDMEFNAKIAD  841



>gb|KDO79911.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=969

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DS+F AKIAD
Sbjct  760  QGLCYMHHDCTPQIIHRDVKSSNILLDSEFKAKIAD  795



>ref|XP_006450731.1| hypothetical protein CICLE_v10010761mg [Citrus clementina]
 gb|ESR63971.1| hypothetical protein CICLE_v10010761mg [Citrus clementina]
Length=987

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DS+F AKIAD
Sbjct  778  QGLCYMHHDCTPQIIHRDVKSSNILLDSEFKAKIAD  813



>gb|KHN10176.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Glycine 
soja]
Length=231

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PP++HRD+KSSNIL+DS+F AKIAD
Sbjct  35   QGLYYMHHECSPPVIHRDVKSSNILLDSEFKAKIAD  70



>ref|XP_010668734.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=1023

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPI+HRD+KSSNIL+DS FNAKIAD
Sbjct  814  QGLSYMHHDCSPPIIHRDVKSSNILLDSKFNAKIAD  849



>gb|KDO79910.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=1024

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DS+F AKIAD
Sbjct  815  QGLCYMHHDCTPQIIHRDVKSSNILLDSEFKAKIAD  850



>ref|XP_006475995.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=1024

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+DS+F AKIAD
Sbjct  815  QGLCYMHHDCTPQIIHRDVKSSNILLDSEFKAKIAD  850



>ref|XP_009409608.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1042

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PP++HRD+KSSNIL+DS+F AKIAD
Sbjct  871  KGLCYMHHHCTPPVIHRDVKSSNILLDSNFGAKIAD  906



>ref|XP_007204807.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
 gb|EMJ06006.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
Length=1018

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  816  QGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIAD  851



>ref|XP_006655502.1| PREDICTED: receptor-like protein kinase 5-like [Oryza brachyantha]
Length=973

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPIVHRD+KSSNIL+D+D  AK+AD
Sbjct  758  RGLCYMHHECSPPIVHRDVKSSNILLDADLRAKVAD  793



>ref|XP_002442937.1| hypothetical protein SORBIDRAFT_08g005070 [Sorghum bicolor]
 gb|EES16775.1| hypothetical protein SORBIDRAFT_08g005070 [Sorghum bicolor]
Length=902

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+K+SNIL+DS+F AK+AD
Sbjct  723  QGLCYMHHHCSPPIIHRDVKTSNILLDSEFRAKVAD  758



>ref|XP_008362962.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Malus domestica]
Length=1018

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+KSSNIL+DS FNAKIAD
Sbjct  816  QGLSYMHHDCVPPVVHRDVKSSNILLDSXFNAKIAD  851



>gb|KHN40381.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Glycine 
soja]
Length=804

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPIVHRD+K+SNIL+DS FNAK+AD
Sbjct  605  QGLSYMHHDCSPPIVHRDVKTSNILLDSQFNAKVAD  640



>ref|XP_009415678.1| PREDICTED: receptor-like protein kinase 5 [Musa acuminata subsp. 
malaccensis]
Length=1029

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRD+KSSNIL+DS+ N KIAD
Sbjct  861  RGLCYMHHDCSPPIIHRDVKSSNILLDSELNVKIAD  896



>ref|XP_010047669.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  814  KGLCYMHHDCSSPIIHRDVKSSNILLDSEFNAKIAD  849



>gb|KHG25031.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=959

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C  PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  805  QGLCYMHHECLTPIIHRDVKSSNILLDSEFNAKIAD  840



>ref|XP_011078243.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=1018

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  814  HGLCYMHHHCSSPIIHRDVKSSNILLDSEFNAKIAD  849



>ref|XP_008242544.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1858

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108   QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             +GL YMHH C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  1658  RGLSYMHHDCVPPVVHRDVKSSNILLDSDFNAKIAD  1693



>gb|KHN16978.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1013

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPIVHRD+K+SNIL+DS FNAK+AD
Sbjct  814  QGLSYMHHDCSPPIVHRDVKTSNILLDSQFNAKVAD  849



>gb|KHM99760.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Glycine 
soja]
Length=766

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PP+VHRDIK+SNIL+D+ FNAK+AD
Sbjct  564  QGLSYMHHDCSPPVVHRDIKASNILLDTQFNAKVAD  599



>ref|XP_008390812.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1019

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+KSSNIL+DS FNAKIAD
Sbjct  817  QGLSYMHHDCVPPVVHRDVKSSNILLDSXFNAKIAD  852



>ref|XP_010050388.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=736

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  573  KGLCYMHHDCSLPIIHRDVKSSNILLDSEFNAKIAD  608



>ref|XP_003548596.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1013

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPIVHRD+K+SNIL+DS FNAK+AD
Sbjct  814  QGLSYMHHDCSPPIVHRDVKTSNILLDSQFNAKVAD  849



>ref|XP_002442939.1| hypothetical protein SORBIDRAFT_08g005100 [Sorghum bicolor]
 gb|EES16777.1| hypothetical protein SORBIDRAFT_08g005100 [Sorghum bicolor]
Length=918

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+K+SNIL+D +F AK+AD
Sbjct  611  QGLCYMHHECSPPIIHRDVKTSNILLDLEFRAKVAD  646



>emb|CDP08192.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+ PIVHRDIKSSNIL+DS  NAKIAD
Sbjct  454  QGLCYMHHDCSLPIVHRDIKSSNILLDSGLNAKIAD  489



>ref|XP_003517639.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1010

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPIVHRD+K+SNIL+DS FNAK+AD
Sbjct  811  QGLSYMHHDCSPPIVHRDVKTSNILLDSQFNAKVAD  846



>emb|CDM84035.1| unnamed protein product [Triticum aestivum]
Length=665

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHR++K+SNIL+DS+F  K+AD
Sbjct  472  QGLCYMHHECSPPIVHRNVKTSNILLDSEFRTKVAD  507



>ref|XP_006364719.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=637

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C  PI+HRDIKSSNIL+DS+FNAKIAD
Sbjct  467  QGLSYMHHDCTRPIIHRDIKSSNILLDSEFNAKIAD  502



>ref|XP_008337667.1| PREDICTED: receptor-like protein kinase HSL1, partial [Malus 
domestica]
Length=1013

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+KSSNIL+DSDF AKIAD
Sbjct  811  QGLSYMHHDCVPPVVHRDVKSSNILLDSDFKAKIAD  846



>ref|XP_009628518.1| PREDICTED: receptor protein kinase CLAVATA1-like isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009628519.1| PREDICTED: receptor protein kinase CLAVATA1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=602

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+PPI+HRDIKSSNIL+D+D NAK+AD
Sbjct  432  RGLCYMHNHCSPPIIHRDIKSSNILLDNDLNAKVAD  467



>ref|XP_011007101.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=982

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMH+ C+PPIVHRD+KSSNIL+DS+FNAKIAD
Sbjct  804  QGLRYMHYDCSPPIVHRDVKSSNILLDSEFNAKIAD  839



>ref|XP_003533283.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1008

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PP+VHRDIK+SNIL+D+ FNAK+AD
Sbjct  806  QGLSYMHHDCSPPVVHRDIKASNILLDTQFNAKVAD  841



>ref|XP_010278042.1| PREDICTED: receptor-like protein kinase 5 [Nelumbo nucifera]
Length=1024

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMH  C P I+HRD+KSSNIL+DSDFNA+IAD
Sbjct  815  QGLCYMHQDCCPAIIHRDVKSSNILLDSDFNARIAD  850



>gb|KCW79121.1| hypothetical protein EUGRSUZ_C00562 [Eucalyptus grandis]
Length=1002

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  796  KGLCYMHHDCSLPIIHRDVKSSNILLDSEFNAKIAD  831



>ref|XP_003549165.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
 gb|KHN24478.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1009

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PP+VHRDIK+SNIL+D+ FNAK+AD
Sbjct  807  QGLSYMHHDCSPPVVHRDIKTSNILLDTQFNAKVAD  842



>ref|XP_003619786.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES76004.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1039

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPIVHRD+K+SNIL+D+ FNAK+AD
Sbjct  836  QGLSYMHHDCSPPIVHRDVKTSNILLDAHFNAKVAD  871



>ref|XP_011081744.1| PREDICTED: receptor-like protein kinase 5 [Sesamum indicum]
Length=730

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPI+HRDIKSSNIL+DS+FNAKIAD
Sbjct  545  QGLSYMHHDCSPPIIHRDIKSSNILLDSEFNAKIAD  580



>ref|XP_009628514.1| PREDICTED: receptor-like protein kinase 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628515.1| PREDICTED: receptor-like protein kinase 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=770

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+PPI+HRDIKSSNIL+D+D NAK+AD
Sbjct  600  RGLCYMHNHCSPPIIHRDIKSSNILLDNDLNAKVAD  635



>dbj|BAH19649.1| AT5G25930 [Arabidopsis thaliana]
Length=835

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKI  7
            QGLCYMHH C P I+HRD+KSSNIL+DS+FNAKI
Sbjct  802  QGLCYMHHDCTPAIIHRDVKSSNILLDSEFNAKI  835



>ref|XP_006364730.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Solanum tuberosum]
Length=709

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C   I+HRDIKSSNIL+DS+FNAKIAD
Sbjct  540  QGLCYMHHDCTRSIIHRDIKSSNILLDSEFNAKIAD  575



>ref|XP_004512685.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Cicer arietinum]
Length=836

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPIVHRD+K+SNIL+D+ FNAK+AD
Sbjct  637  QGLSYMHHDCSPPIVHRDVKTSNILLDAQFNAKVAD  672



>gb|KDP33799.1| hypothetical protein JCGZ_07370 [Jatropha curcas]
Length=968

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL Y+HH C PPI+HRD+KSSNIL+DS FNAKIAD
Sbjct  752  QGLSYLHHDCLPPIIHRDVKSSNILLDSSFNAKIAD  787



>ref|XP_009628516.1| PREDICTED: receptor-like protein kinase 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=765

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+PPI+HRDIKSSNIL+D+D NAK+AD
Sbjct  600  RGLCYMHNHCSPPIIHRDIKSSNILLDNDLNAKVAD  635



>ref|XP_007152973.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
 gb|ESW24967.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
Length=1005

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C PPIVHRD+K+SNIL+D+ FNAKIAD
Sbjct  803  HGLCYMHHDCFPPIVHRDVKTSNILLDAQFNAKIAD  838



>gb|KEH27211.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=868

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH C+PPI+HR IK+SNIL+DS+FNAK+AD
Sbjct  715  HGLCYMHHDCSPPIIHRYIKTSNILLDSEFNAKVAD  750



>emb|CBI20579.3| unnamed protein product [Vitis vinifera]
Length=730

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH  +PPI+HRD+KSSNIL+DS+FN KIAD
Sbjct  518  RGLCYMHHDFSPPIIHRDVKSSNILLDSEFNTKIAD  553



>ref|XP_004512684.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1025

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPIVHRD+K+SNIL+D+ FNAK+AD
Sbjct  826  QGLSYMHHDCSPPIVHRDVKTSNILLDAQFNAKVAD  861



>ref|XP_009628517.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 isoform X3 [Nicotiana tomentosiformis]
Length=710

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+PPI+HRDIKSSNIL+D+D NAK+AD
Sbjct  540  RGLCYMHNHCSPPIIHRDIKSSNILLDNDLNAKVAD  575



>ref|XP_010095459.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXB60285.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1032

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+P I+HRD+KSSNIL+D++F A+IAD
Sbjct  817  QGLCYMHHDCSPSIIHRDVKSSNILLDTEFKARIAD  852



>emb|CDY05509.1| BnaA02g31820D [Brassica napus]
Length=966

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+D  FNAKIAD
Sbjct  763  QGLCYMHHDCTPAIIHRDVKSSNILLDYVFNAKIAD  798



>emb|CDY05337.1| BnaC02g40450D [Brassica napus]
Length=972

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+D  FNAKIAD
Sbjct  769  QGLCYMHHDCTPAIIHRDVKSSNILLDYVFNAKIAD  804



>ref|XP_007013026.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY30645.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1006

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+ PI+HRD+KSSNIL+DS+F AKIAD
Sbjct  819  QGLCYMHHYCSAPIIHRDVKSSNILLDSEFKAKIAD  854



>ref|XP_006394841.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
 gb|ESQ32127.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
Length=1005

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C P I+HRD+KSSNIL+D +FN KIAD
Sbjct  802  QGLCYMHHDCTPAIIHRDVKSSNILLDYEFNPKIAD  837



>gb|KHG24857.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=1012

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C  PI+HRD+KSSNIL+DS+F AKIAD
Sbjct  801  QGLCYMHHECPTPIIHRDVKSSNILLDSEFKAKIAD  836



>ref|XP_010917300.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=526

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
             GLCYMHH  +PPIVHRD+KSSNIL+DS+F AKIAD
Sbjct  321  HGLCYMHHDYSPPIVHRDVKSSNILLDSEFRAKIAD  356



>ref|XP_008671313.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
Length=379

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPIVHRD+K+SNIL+DS F AK+AD
Sbjct  331  QGLCYMHHICVPPIVHRDVKTSNILLDSVFRAKVAD  366



>ref|XP_011010886.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Populus 
euphratica]
Length=991

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PIVHRD+KSSNIL+DS+F A+IAD
Sbjct  778  RGLCYMHHDCSTPIVHRDVKSSNILLDSEFKARIAD  813



>ref|XP_011010885.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Populus 
euphratica]
Length=1020

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PIVHRD+KSSNIL+DS+F A+IAD
Sbjct  807  RGLCYMHHDCSTPIVHRDVKSSNILLDSEFKARIAD  842



>ref|XP_004164767.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
Length=1004

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPI+HRD+KSSNIL+D +F AKIAD
Sbjct  815  QGLSYMHHDCSPPIIHRDVKSSNILLDREFQAKIAD  850



>ref|XP_004513050.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1014

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PP+VHRD+K+SNIL+DS FNAK+AD
Sbjct  811  QGLSYMHHECSPPVVHRDVKTSNILLDSQFNAKVAD  846



>ref|XP_004148398.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 gb|KGN62796.1| hypothetical protein Csa_2G373400 [Cucumis sativus]
Length=1090

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPI+HRD+KSSNIL+D +F AKIAD
Sbjct  901  QGLSYMHHDCSPPIIHRDVKSSNILLDREFQAKIAD  936



>ref|XP_004288894.1| PREDICTED: receptor-like protein kinase HSL1-like [Fragaria vesca 
subsp. vesca]
Length=1013

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH  + PI+HRD+KSSNIL+DSDFNAKIAD
Sbjct  812  KGLCYMHHDYDQPIIHRDVKSSNILLDSDFNAKIAD  847



>gb|EMT29167.1| Serine/threonine-protein kinase PBS1 [Aegilops tauschii]
Length=467

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL Y+H  CNPP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  257  RGLEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIAD  292



>ref|XP_003523755.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1011

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PP++HRD+KSSNIL+DS+F AKIAD
Sbjct  815  QGLYYMHHECSPPVIHRDVKSSNILLDSEFKAKIAD  850



>ref|XP_009803852.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=709

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCY+HH C  PI+HRDIKSSNIL+DS+FN KIAD
Sbjct  539  QGLCYIHHDCTRPIIHRDIKSSNILLDSEFNPKIAD  574



>gb|EEE64410.1| hypothetical protein OsJ_19254 [Oryza sativa Japonica Group]
Length=1004

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPIVHRDIKSSNIL+D++  AK+AD
Sbjct  789  RGLCYMHHECSPPIVHRDIKSSNILLDAELMAKVAD  824



>gb|AAV44033.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAV59323.1| putative protein kinase [Oryza sativa Japonica Group]
Length=1014

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPIVHRDIKSSNIL+D++  AK+AD
Sbjct  799  RGLCYMHHECSPPIVHRDIKSSNILLDAELMAKVAD  834



>gb|EAY98740.1| hypothetical protein OsI_20670 [Oryza sativa Indica Group]
Length=1046

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPIVHRDIKSSNIL+D++  AK+AD
Sbjct  831  RGLCYMHHECSPPIVHRDIKSSNILLDAELMAKVAD  866



>gb|KDP33797.1| hypothetical protein JCGZ_07368 [Jatropha curcas]
Length=835

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL Y+HH C PPI+HRD+KSSNIL+DS FNAKIAD
Sbjct  619  QGLSYLHHDCLPPIIHRDVKSSNILLDSSFNAKIAD  654



>ref|XP_010095358.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Morus 
notabilis]
 gb|EXB59777.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Morus 
notabilis]
Length=507

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C PPI+HRDIKSSNIL+DSDFN KIAD
Sbjct  111  RGLCYMHHDCLPPIMHRDIKSSNILLDSDFNPKIAD  146



>ref|XP_004245388.2| PREDICTED: receptor-like protein kinase 2 [Solanum lycopersicum]
Length=807

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+PPI+HRDIK SNIL+D + NAKIAD
Sbjct  638  RGLCYMHHECSPPIIHRDIKCSNILLDHELNAKIAD  673



>ref|XP_008444991.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
 ref|XP_008444992.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=1003

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PPI+HRD+KSSNIL+D +F AKIAD
Sbjct  814  QGLSYMHHDCSPPIIHRDVKSSNILLDCEFQAKIAD  849



>gb|AGC54428.1| receptor-like kinase, partial [Cocos nucifera]
Length=167

 Score = 65.1 bits (157),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C PPI+HRD+KS+NIL+D+DF A +AD
Sbjct  104  KGLCYLHHDCGPPILHRDVKSNNILLDADFEAHVAD  139



>ref|XP_010325071.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Solanum lycopersicum]
Length=697

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C  PI+HRDIKSSNIL+DS+FNAKIAD
Sbjct  527  QGLSYMHHDCTRPIIHRDIKSSNILLDSEFNAKIAD  562



>ref|XP_008649140.1| PREDICTED: receptor-like protein kinase 5 [Zea mays]
 gb|AFW76496.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1043

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL YMHH C PPIVHRD+KSSNIL+D DF AKIAD
Sbjct  823  KGLSYMHHDCAPPIVHRDVKSSNILLDPDFQAKIAD  858



>ref|XP_002437153.1| hypothetical protein SORBIDRAFT_10g022060 [Sorghum bicolor]
 gb|EER88520.1| hypothetical protein SORBIDRAFT_10g022060 [Sorghum bicolor]
Length=1051

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL YMHH C PPIVHRD+KSSNIL+D DF AKIAD
Sbjct  825  KGLSYMHHDCAPPIVHRDVKSSNILLDPDFQAKIAD  860



>ref|XP_008778616.1| PREDICTED: receptor-like protein kinase 5 [Phoenix dactylifera]
Length=731

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPIVHRD+K SNIL+DS+  A+IAD
Sbjct  520  QGLCYMHHDCSPPIVHRDVKCSNILLDSECRARIAD  555



>gb|EMT14290.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=895

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  671  KGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  706



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  804  KGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  839



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  799  KGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  834



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  799  KGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  834



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  804  KGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  839



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  804  KGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  839



>ref|XP_010050391.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=883

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  667  KGLCYMHNDCSSPIIHRDVKSSNILLDSEFNAKIAD  702



>gb|KCW79120.1| hypothetical protein EUGRSUZ_C00561 [Eucalyptus grandis]
Length=851

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  645  KGLCYMHNDCSSPIIHRDVKSSNILLDSEFNAKIAD  680



>ref|XP_002324752.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF03317.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=1019

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH C+ PIVHRD+KSSNIL+DS+F A+IAD
Sbjct  807  RGLCYMHHDCSTPIVHRDVKSSNILLDSEFKARIAD  842



>dbj|BAD87899.1| putative LRK1 protein [Oryza sativa Japonica Group]
Length=936

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  848  QGLYYMHHECTPPIVHRDVKTSNILLDSEFRAKVAD  883



>ref|XP_008659674.1| PREDICTED: receptor-like protein kinase 5 [Zea mays]
 gb|AFW86925.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1047

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL YMHH C PPIVHRD+KSSNIL+D DF AKIAD
Sbjct  824  KGLSYMHHDCAPPIVHRDVKSSNILLDPDFQAKIAD  859



>gb|KDP34178.1| hypothetical protein JCGZ_07749 [Jatropha curcas]
Length=1026

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMHH   PPI+HRDIKSSNIL+DS+F A+IAD
Sbjct  813  RGLCYMHHDSTPPIIHRDIKSSNILLDSEFKARIAD  848



>ref|XP_008680083.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
Length=283

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C PPIVH D+K+SNIL+DS F AK+AD
Sbjct  150  QGLCYMHHECVPPIVHCDVKTSNILLDSVFRAKVAD  185



>gb|EAZ13493.1| hypothetical protein OsJ_03409 [Oryza sativa Japonica Group]
Length=1063

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  845  QGLYYMHHECTPPIVHRDVKTSNILLDSEFRAKVAD  880



>gb|EAY75774.1| hypothetical protein OsI_03690 [Oryza sativa Indica Group]
Length=1065

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  847  QGLYYMHHECTPPIVHRDVKTSNILLDSEFRAKVAD  882



>ref|NP_001044213.1| Os01g0742400 [Oryza sativa Japonica Group]
 dbj|BAD87898.1| putative LRK1 protein [Oryza sativa Japonica Group]
 dbj|BAF06127.1| Os01g0742400 [Oryza sativa Japonica Group]
Length=1066

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PPIVHRD+K+SNIL+DS+F AK+AD
Sbjct  848  QGLYYMHHECTPPIVHRDVKTSNILLDSEFRAKVAD  883



>ref|XP_007152512.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
 gb|ESW24506.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
Length=1003

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+K+SNIL+DS FNAK+AD
Sbjct  805  QGLSYMHHDCLPPVVHRDVKTSNILLDSQFNAKVAD  840



>ref|XP_007012181.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY29800.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1017

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C  PI+HRD+KSSNIL+DS+F A+IAD
Sbjct  806  QGLCYMHHDCPQPIIHRDVKSSNILLDSEFKARIAD  841



>ref|XP_008789188.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=1035

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL YMHH C+PPIVHRD+KSSNIL++S+F+AKIAD
Sbjct  823  RGLSYMHHDCSPPIVHRDVKSSNILLNSEFDAKIAD  858



>ref|XP_011077132.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Sesamum indicum]
Length=987

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL Y+HH C+PP++HRD+KS+NIL+DSDF A+IAD
Sbjct  790  QGLAYLHHDCHPPVIHRDVKSNNILLDSDFEARIAD  825



>gb|AFW56261.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+PPI+HRD+K+SNIL+D++F  K+AD
Sbjct  453  QGLCYMHHHCSPPIIHRDVKTSNILLDAEFRGKVAD  488



>gb|ACL54651.1| unknown [Zea mays]
Length=441

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+D+DF A +AD
Sbjct  228  KGLCYLHHDCSPPILHRDVKSNNILLDADFEAHVAD  263



>gb|KCW79123.1| hypothetical protein EUGRSUZ_C00564, partial [Eucalyptus grandis]
Length=958

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  763  KGLCYMHNDCSSPIIHRDVKSSNILLDSEFNAKIAD  798



>ref|XP_006853705.1| hypothetical protein AMTR_s00056p00147890 [Amborella trichopoda]
 gb|ERN15172.1| hypothetical protein AMTR_s00056p00147890 [Amborella trichopoda]
Length=865

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHHGC+P I+HRD+K SNIL+D +F AKI D
Sbjct  800  QGLCYMHHGCSPAIIHRDVKCSNILMDEEFRAKIGD  835



>ref|XP_009352556.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1023

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C PP+VHRD+KSSNIL+DSDF AKI D
Sbjct  821  QGLSYMHHDCVPPVVHRDVKSSNILLDSDFKAKIGD  856



>ref|XP_010050392.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1011

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  817  KGLCYMHNDCSSPIIHRDVKSSNILLDSEFNAKIAD  852



>ref|XP_004501091.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1030

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+ PI+HRD+KSSNIL+DS+F A IAD
Sbjct  820  QGLCYMHHECSMPIIHRDVKSSNILLDSEFRASIAD  855



>gb|EMS57320.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=788

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  564  KGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  599



>gb|KCW79630.1| hypothetical protein EUGRSUZ_C00989, partial [Eucalyptus grandis]
Length=939

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  783  KGLCYMHNDCSSPIIHRDVKSSNILLDSEFNAKIAD  818



>ref|XP_004501092.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Cicer arietinum]
Length=889

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCYMHH C+ PI+HRD+KSSNIL+DS+F A IAD
Sbjct  820  QGLCYMHHECSMPIIHRDVKSSNILLDSEFRASIAD  855



>ref|XP_002441406.1| hypothetical protein SORBIDRAFT_09g026090 [Sorghum bicolor]
 gb|EES19836.1| hypothetical protein SORBIDRAFT_09g026090 [Sorghum bicolor]
Length=1051

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL YMHH C+PPIVHRD+KSSNIL+DS+ NAK+AD
Sbjct  836  RGLYYMHHECSPPIVHRDVKSSNILLDSELNAKVAD  871



>ref|XP_008649910.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 gb|AFW78821.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1084

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL YMHH C+PPIVHRD+KSSNIL+DS+ NAK+AD
Sbjct  870  RGLYYMHHECSPPIVHRDVKSSNILLDSELNAKVAD  905



>gb|KEH27213.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1015

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGL YMHH C+PP+VHRD+K+SNIL+D+ FNAK+AD
Sbjct  815  QGLSYMHHECSPPVVHRDVKTSNILLDAQFNAKVAD  850



>ref|XP_008390801.1| PREDICTED: receptor-like protein kinase 5 [Malus domestica]
Length=668

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  GLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            GL YMH  C PP+VHRD+KSSNIL+DSDFNAKIAD
Sbjct  467  GLSYMHXDCVPPVVHRDVKSSNILLDSDFNAKIAD  501



>ref|XP_004506369.1| PREDICTED: receptor-like protein kinase HAIKU2-like isoform X1 
[Cicer arietinum]
 ref|XP_004506370.1| PREDICTED: receptor-like protein kinase HAIKU2-like isoform X2 
[Cicer arietinum]
Length=989

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +G+CY+HH C+PP++HRDIKSSNIL+D D+ AKI D
Sbjct  802  KGICYLHHDCSPPVIHRDIKSSNILLDGDYEAKIGD  837



>gb|KHN01094.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=712

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C PPIVHRD+KS+NILVD++F AK+AD
Sbjct  519  EGLCYLHHDCVPPIVHRDVKSNNILVDAEFAAKVAD  554



>ref|XP_010050387.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1000

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  794  KGLCYMHNDCSSPIIHRDVKSSNILLDSEFNAKIAD  829



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+DSDF A +AD
Sbjct  806  RGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVAD  841



>ref|XP_010050472.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Eucalyptus grandis]
Length=1101

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+   PPI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  923  KGLCYMHNDLRPPIIHRDVKSSNILLDSEFNAKIAD  958



>dbj|BAK01376.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL Y+H  CNPP++HRD+KSSNIL+DSDFNAKIAD
Sbjct  271  RGLEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIAD  306



>ref|XP_010047672.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=985

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCYMH+ C+ PI+HRD+KSSNIL+DS+FNAKIAD
Sbjct  814  KGLCYMHNDCSSPIIHRDVKSSNILLDSEFNAKIAD  849



>gb|EMT15500.1| hypothetical protein F775_52402 [Aegilops tauschii]
Length=811

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GLCY+HH C+PPI+HRD+KS+NIL+D+DF A +AD
Sbjct  605  KGLCYLHHDCSPPILHRDVKSNNILLDTDFEAHVAD  640



>gb|AFW85121.1| hypothetical protein ZEAMMB73_943636 [Zea mays]
Length=791

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            QGLCY+HH  +PPI+HRD+K+SNIL+DS+F AK+AD
Sbjct  666  QGLCYLHHESSPPIIHRDVKTSNILLDSEFTAKVAD  701



>gb|EMT19930.1| Serine/threonine-protein kinase PBS1 [Aegilops tauschii]
Length=472

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  QGLCYMHHGCNPPIVHRDIKSSNILVDSDFNAKIAD  1
            +GL Y+H  CNPPI+HRD+KSSNIL+DSDFNAKI+D
Sbjct  282  RGLEYLHEHCNPPIIHRDLKSSNILLDSDFNAKISD  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524198921584