BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c116290_g1_i1 len=169 path=[1:0-168]

Length=169
                                                                      Score     E

gb|EYU22842.1|  hypothetical protein MIMGU_mgv1a005115mg                110   6e-27   
ref|XP_004250396.1|  PREDICTED: calcium-dependent protein kinase ...    108   3e-26   
emb|CBI18175.3|  unnamed protein product                                107   3e-26   
gb|KDP43357.1|  hypothetical protein JCGZ_25462                         108   3e-26   
ref|XP_004160243.1|  PREDICTED: calcium-dependent protein kinase ...    103   3e-26   
dbj|BAD94110.1|  calcium-dependent protein kinase                       103   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ADN34193.1|  calcium-dependent protein kinase                        103   4e-26   
emb|CAB59359.1|  ATCDPK2-like protein                                   103   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096992.1|  PREDICTED: calcium-dependent protein kinase 11     107   5e-26   
ref|XP_010665103.1|  PREDICTED: calcium-dependent protein kinase 4      107   7e-26   
ref|XP_006351913.1|  PREDICTED: calcium-dependent protein kinase ...    107   8e-26   
ref|XP_010062000.1|  PREDICTED: calcium-dependent protein kinase 11     107   9e-26   
ref|XP_009345937.1|  PREDICTED: calcium-dependent protein kinase ...    107   9e-26   
ref|XP_008380994.1|  PREDICTED: calcium-dependent protein kinase ...    107   9e-26   
ref|XP_009375285.1|  PREDICTED: calcium-dependent protein kinase 11     107   9e-26   
ref|XP_008382024.1|  PREDICTED: calcium-dependent protein kinase 11     107   9e-26   
ref|XP_011005156.1|  PREDICTED: calcium-dependent protein kinase ...    106   1e-25   
ref|XP_009782854.1|  PREDICTED: calcium-dependent protein kinase ...    107   1e-25   
gb|KHG19874.1|  Calcium-dependent protein kinase 11                     105   1e-25   
ref|XP_007199799.1|  hypothetical protein PRUPE_ppa004665mg             106   1e-25   
ref|XP_007019990.1|  Calcium-dependent protein kinase 2 isoform 3       106   1e-25   
ref|XP_007019988.1|  Calcium-dependent protein kinase 2 isoform 1       107   1e-25   
ref|XP_010543384.1|  PREDICTED: calcium-dependent protein kinase 11     106   2e-25   
ref|XP_006376288.1|  hypothetical protein POPTR_0013s11690g             105   3e-25   
ref|XP_010678309.1|  PREDICTED: calcium-dependent protein kinase 11     105   3e-25   
ref|XP_011005155.1|  PREDICTED: calcium-dependent protein kinase ...    105   4e-25   
ref|XP_002526815.1|  calcium-dependent protein kinase, putative         105   4e-25   Ricinus communis
ref|XP_002325988.2|  hypothetical protein POPTR_0019s11290g             105   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011001786.1|  PREDICTED: calcium-dependent protein kinase ...    105   4e-25   
gb|KHG12764.1|  Calcium-dependent protein kinase 11                     105   7e-25   
ref|XP_010521536.1|  PREDICTED: calcium-dependent protein kinase 12     104   7e-25   
ref|XP_006353626.1|  PREDICTED: calcium-dependent protein kinase ...    104   7e-25   
ref|XP_004290421.1|  PREDICTED: calcium-dependent protein kinase ...    104   7e-25   
ref|XP_004241825.1|  PREDICTED: calcium-dependent protein kinase 11     104   8e-25   
emb|CDP17874.1|  unnamed protein product                                104   8e-25   
ref|XP_008237265.1|  PREDICTED: calcium-dependent protein kinase ...    104   9e-25   
ref|XP_009145120.1|  PREDICTED: calcium-dependent protein kinase 11     104   1e-24   
gb|AGG35964.1|  calcium-dependent protein kinase 11                     104   1e-24   
ref|XP_006376289.1|  Calcium-dependent protein kinase 2                 104   1e-24   
gb|KGN44377.1|  hypothetical protein Csa_7G274170                       103   2e-24   
ref|XP_008461962.1|  PREDICTED: calcium-dependent protein kinase 11     103   2e-24   
ref|XP_004149412.1|  PREDICTED: calcium-dependent protein kinase ...    103   2e-24   
ref|XP_004955505.1|  PREDICTED: calcium-dependent protein kinase ...    104   2e-24   
ref|XP_004496370.1|  PREDICTED: calcium-dependent protein kinase ...    103   2e-24   
ref|XP_006307331.1|  hypothetical protein CARUB_v10008949mg             103   2e-24   
ref|XP_002891197.1|  predicted protein                                  103   2e-24   
ref|NP_174807.1|  calcium-dependent protein kinase 2                    103   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79386.1|AC007887_45  F15O4.8                                      103   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26973.1|  hypothetical protein AALP_AA8G317600                    103   2e-24   
ref|XP_006397467.1|  hypothetical protein EUTSA_v10001816mg             103   2e-24   
gb|KEH43562.1|  calmodulin-domain kinase CDPK protein                   103   2e-24   
gb|KHN17080.1|  Calcium-dependent protein kinase 4                      103   3e-24   
ref|NP_001235629.1|  calmodulin-like domain protein kinase isoenz...    103   3e-24   
ref|XP_009620445.1|  PREDICTED: calcium-dependent protein kinase 11     103   3e-24   
ref|XP_009786091.1|  PREDICTED: calcium-dependent protein kinase ...    103   3e-24   
ref|XP_009594347.1|  PREDICTED: calcium-dependent protein kinase ...    103   3e-24   
gb|AAP03013.1|  seed calcium dependent protein kinase b                 103   3e-24   Glycine max [soybeans]
gb|KHN00795.1|  Calcium-dependent protein kinase 4                      103   3e-24   
emb|CDY05064.1|  BnaC03g28620D                                          103   3e-24   
ref|XP_010538925.1|  PREDICTED: calcium-dependent protein kinase ...    102   3e-24   
ref|XP_009134149.1|  PREDICTED: calcium-dependent protein kinase 4      102   4e-24   
ref|XP_006606214.1|  PREDICTED: calcium-dependent protein kinase ...    100   4e-24   
ref|XP_006397184.1|  hypothetical protein EUTSA_v10028598mg             102   5e-24   
ref|XP_002872452.1|  calcium-dependent protein kinase 4                 102   5e-24   
gb|KHN00796.1|  Calcium-dependent protein kinase SK5                    102   5e-24   
gb|EPS60285.1|  hypothetical protein M569_14517                         102   5e-24   
gb|EMT21316.1|  Calcium-dependent protein kinase SK5                    103   5e-24   
gb|ABY59011.1|  calcium-dependent protein kinase                        103   5e-24   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK04659.1|  predicted protein                                      102   6e-24   
ref|XP_007143645.1|  hypothetical protein PHAVU_007G089200g             102   6e-24   
gb|EMT23123.1|  Calcium-dependent protein kinase 2                      102   7e-24   
gb|EAZ28845.1|  hypothetical protein OsJ_12879                          102   7e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG92869.1|  unnamed protein product                                102   7e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650702.1|  PREDICTED: calcium-dependent protein kinase ...    102   7e-24   
gb|ABC59622.1|  calcium-dependent protein kinase                        102   8e-24   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001051503.1|  Os03g0788500                                       102   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010500048.1|  PREDICTED: calcium-dependent protein kinase ...    102   8e-24   
ref|XP_008665565.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    103   9e-24   
ref|XP_002518007.1|  calcium-dependent protein kinase, putative       98.2    9e-24   Ricinus communis
ref|XP_006434607.1|  hypothetical protein CICLE_v10000931mg             102   9e-24   
gb|AHG06447.1|  calcium-dependent protein kinase 4.1                    101   1e-23   
ref|XP_004955504.1|  PREDICTED: calcium-dependent protein kinase ...    102   1e-23   
ref|XP_010256400.1|  PREDICTED: calcium-dependent protein kinase SK5    101   1e-23   
gb|KDO58737.1|  hypothetical protein CISIN_1g014949mg                   100   1e-23   
gb|AEY99977.1|  calcium-dependent protein kinase                        101   1e-23   
gb|EMS47453.1|  Calcium-dependent protein kinase SK5                    101   1e-23   
ref|XP_010478955.1|  PREDICTED: calcium-dependent protein kinase ...    101   1e-23   
ref|XP_004955503.1|  PREDICTED: calcium-dependent protein kinase ...    102   1e-23   
ref|NP_001105109.1|  LOC541988                                          102   1e-23   Zea mays [maize]
dbj|BAK02486.1|  predicted protein                                      101   1e-23   
gb|EEE66603.1|  hypothetical protein OsJ_23173                          102   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KHN17081.1|  Calcium-dependent protein kinase SK5                    100   1e-23   
gb|ABW97697.2|  calcium-dependent protein kinase                        101   1e-23   Hordeum vulgare [barley]
gb|KFK35647.1|  hypothetical protein AALP_AA4G017800                    101   1e-23   
ref|XP_010421853.1|  PREDICTED: calcium-dependent protein kinase ...    101   1e-23   
ref|NP_192695.1|  calcium-dependent protein kinase 4                    101   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDO58736.1|  hypothetical protein CISIN_1g014949mg                   100   2e-23   
dbj|BAI94529.1|  calcium dependent protein kinase                       100   2e-23   
tpg|DAA51810.1|  TPA: putative calcium-dependent protein kinase f...    101   2e-23   
ref|XP_010455345.1|  PREDICTED: calcium-dependent protein kinase 4      100   2e-23   
ref|XP_006287576.1|  hypothetical protein CARUB_v10000785mg             100   2e-23   
ref|XP_002466330.1|  hypothetical protein SORBIDRAFT_01g005780          101   2e-23   Sorghum bicolor [broomcorn]
ref|XP_010438320.1|  PREDICTED: calcium-dependent protein kinase ...    100   2e-23   
ref|XP_006426412.1|  hypothetical protein CICLE_v10025418mg             100   2e-23   
ref|XP_006426413.1|  hypothetical protein CICLE_v10025418mg             100   2e-23   
ref|XP_006846993.1|  hypothetical protein AMTR_s00017p00128950          100   2e-23   
ref|XP_007143646.1|  hypothetical protein PHAVU_007G089300g             101   2e-23   
tpg|DAA42603.1|  TPA: putative calcium-dependent protein kinase f...    101   2e-23   
ref|XP_004503020.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-23   
gb|KHG16833.1|  Calcium-dependent protein kinase SK5                    100   3e-23   
ref|XP_010094966.1|  Calcium-dependent protein kinase 11                100   3e-23   
ref|XP_006589459.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-23   
gb|EMS58448.1|  Calcium-dependent protein kinase 2                      100   3e-23   
ref|XP_006340028.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-23   
ref|XP_004249931.1|  PREDICTED: calcium-dependent protein kinase 1      100   3e-23   
ref|XP_008670974.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-23   
ref|XP_011074932.1|  PREDICTED: calcium-dependent protein kinase 11     100   4e-23   
ref|XP_004237548.1|  PREDICTED: calcium-dependent protein kinase SK5    100   4e-23   
ref|XP_009379843.1|  PREDICTED: calcium-dependent protein kinase ...    100   4e-23   
ref|XP_006350933.1|  PREDICTED: calcium-dependent protein kinase ...    100   4e-23   
gb|AIK28476.1|  chloroplast calcium-dependent protein kinase 7          100   4e-23   
pdb|1S6I|A  Chain A, Ca2+-Regulatory Region (Cld) From Soybean Ca...  96.7    4e-23   
ref|XP_003523190.1|  PREDICTED: calcium-dependent protein kinase ...    100   4e-23   
gb|ABC59621.1|  calcium-dependent protein kinase                        100   4e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006426411.1|  hypothetical protein CICLE_v10025418mg             100   4e-23   
gb|ACN27823.1|  unknown                                                 100   4e-23   Zea mays [maize]
emb|CDP19676.1|  unnamed protein product                              98.2    5e-23   
ref|XP_007048647.1|  Calcium-dependent protein kinase 2 isoform 1     99.8    6e-23   
gb|AHG06448.1|  calcium-dependent protein kinase 4.2                  99.8    6e-23   
ref|NP_001066266.1|  Os12g0169800                                     99.8    6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058943.1|  Os07g0161600                                       100   7e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406103.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    7e-23   
ref|XP_009406102.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    7e-23   
gb|AES72952.2|  CDPK-related kinase                                   99.4    7e-23   
ref|XP_004981497.1|  PREDICTED: calcium-dependent protein kinase ...    100   7e-23   
ref|XP_009357911.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    7e-23   
ref|XP_004147335.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    8e-23   
gb|KGN52164.1|  hypothetical protein Csa_5G612930                     95.5    8e-23   
emb|CBI27695.3|  unnamed protein product                              97.8    8e-23   
ref|XP_010096406.1|  Calcium-dependent protein kinase SK5             99.4    8e-23   
ref|XP_007215266.1|  hypothetical protein PRUPE_ppa004580mg           99.4    9e-23   
ref|XP_009625599.1|  PREDICTED: calcium-dependent protein kinase ...  99.8    9e-23   
gb|AAK38161.1|  calcium-dependent protein kinase                      97.8    9e-23   Psophocarpus tetragonolobus [asparagus bean]
ref|XP_003602701.1|  Calcium-dependent protein kinase                 99.4    9e-23   
ref|XP_010908659.1|  PREDICTED: calcium-dependent protein kinase ...  99.8    1e-22   
gb|EEE52836.1|  hypothetical protein OsJ_35367                        99.0    1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002450385.1|  hypothetical protein SORBIDRAFT_05g004610        99.0    1e-22   Sorghum bicolor [broomcorn]
ref|XP_004978823.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    1e-22   
ref|XP_011083330.1|  PREDICTED: calcium-dependent protein kinase SK5  98.2    1e-22   
ref|XP_004503860.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-22   
ref|XP_009416913.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-22   
ref|XP_009764211.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    1e-22   
ref|XP_009615662.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    1e-22   
ref|XP_008228139.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-22   
ref|XP_010658918.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    1e-22   
ref|XP_003526904.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-22   
ref|XP_008798696.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    1e-22   
ref|XP_009798725.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    2e-22   
ref|XP_009603424.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    2e-22   
ref|XP_010228367.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    2e-22   
ref|XP_002310978.1|  calcium-dependent protein kinase 2               99.0    2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006658294.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    2e-22   
ref|XP_008460850.1|  PREDICTED: calcium-dependent protein kinase SK5  98.6    2e-22   
tpg|DAA39028.1|  TPA: putative calcium-dependent protein kinase f...  98.2    2e-22   
ref|XP_008665566.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    2e-22   
emb|CBI40890.3|  unnamed protein product                              96.7    2e-22   
gb|KFK27666.1|  calcium-dependent protein kinase                      98.2    2e-22   
ref|XP_008781518.1|  PREDICTED: calcium-dependent protein kinase ...  98.2    2e-22   
ref|XP_008775130.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    2e-22   
ref|XP_009336723.1|  PREDICTED: calcium-dependent protein kinase ...  98.2    2e-22   
ref|XP_006588885.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    2e-22   
ref|XP_009397608.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    2e-22   
ref|NP_001234784.1|  calcium dependent protein kinase                 98.6    2e-22   
ref|XP_007145769.1|  hypothetical protein PHAVU_007G266100g           98.6    2e-22   
gb|AGG35965.1|  calcium-dependent protein kinase 12                   97.8    2e-22   
ref|XP_010938933.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    2e-22   
ref|NP_001105752.1|  calcium-dependent protein kinase ZmCPK11         98.2    2e-22   Zea mays [maize]
ref|XP_009141613.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    2e-22   
ref|XP_002461493.1|  hypothetical protein SORBIDRAFT_02g003500        98.6    2e-22   Sorghum bicolor [broomcorn]
tpg|DAA39024.1|  TPA: putative calcium-dependent protein kinase f...  98.2    2e-22   
gb|KDP24209.1|  hypothetical protein JCGZ_25866                       98.2    3e-22   
ref|NP_001065864.1|  Os11g0171500                                     98.2    3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670973.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    3e-22   
ref|NP_001275230.1|  calcium-dependent protein kinase 1-like          98.6    3e-22   
gb|AAN41657.1|  OsCDPK protein                                        97.8    3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577783.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    3e-22   
emb|CDX87164.1|  BnaC09g04790D                                        97.4    3e-22   
ref|XP_010653043.1|  PREDICTED: calcium-dependent protein kinase SK5  97.8    3e-22   
gb|ABK79680.2|  calcium-dependent protein kinase 2                    97.8    3e-22   Rubia cordifolia
ref|XP_010930818.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    3e-22   
gb|EPS73126.1|  calcium-dependent protein kinase 2                    98.2    3e-22   
gb|AFN06795.1|  calcium-dependent protein kinase                      97.8    3e-22   
ref|XP_004497629.1|  PREDICTED: calcium-dependent protein kinase ...  98.2    3e-22   
ref|XP_007159928.1|  hypothetical protein PHAVU_002G279300g           97.4    4e-22   
ref|XP_006664374.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    4e-22   
ref|XP_004981494.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    4e-22   
ref|XP_008644440.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    4e-22   
ref|XP_004239626.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    4e-22   
ref|NP_001241962.1|  calcium-dependent protein kinase SK5-like        97.4    4e-22   
gb|KHN17436.1|  Calcium-dependent protein kinase SK5                  97.4    4e-22   
ref|XP_006345749.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    4e-22   
ref|XP_008679628.1|  PREDICTED: calcium-dependent protein kinase 11   97.4    4e-22   
ref|XP_009757603.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    4e-22   
gb|AGS14999.1|  calcium-dependent protein kinase 2                    97.8    4e-22   
ref|XP_006663248.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    5e-22   
ref|XP_009418968.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    5e-22   
dbj|BAB63463.1|  calcium dependent protein kinase                     97.8    5e-22   Solanum tuberosum [potatoes]
gb|AFW67407.1|  putative calcium-dependent protein kinase family ...  96.3    5e-22   
ref|XP_010446329.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    5e-22   
ref|XP_002524091.1|  calcium-dependent protein kinase, putative       97.8    5e-22   Ricinus communis
ref|XP_002265450.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    5e-22   Vitis vinifera
ref|XP_010431750.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    5e-22   
ref|XP_002463766.1|  hypothetical protein SORBIDRAFT_01g005750        97.4    5e-22   Sorghum bicolor [broomcorn]
gb|EPS71343.1|  calcium dependent protein kinase 12                   97.1    6e-22   
ref|XP_009389511.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    6e-22   
gb|AFH35029.1|  calcium dependent protein kinase                      97.4    6e-22   
gb|KHN16906.1|  Calcium-dependent protein kinase SK5                  97.1    6e-22   
ref|NP_001238517.2|  calcium-dependent protein kinase SK5             97.1    6e-22   
ref|XP_004303728.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    6e-22   
ref|XP_008446726.1|  PREDICTED: calcium-dependent protein kinase 1    97.4    6e-22   
ref|NP_195536.2|  calcium-dependent protein kinase 26                 95.1    7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578789.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    7e-22   
ref|XP_004162718.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    7e-22   
ref|XP_004135049.1|  PREDICTED: calcium-dependent protein kinase ...  97.4    7e-22   
ref|XP_002514436.1|  calcium-dependent protein kinase, putative       97.4    7e-22   Ricinus communis
gb|AAV28169.1|  calcium-dependent protein kinase 1                    96.7    7e-22   Vicia faba [broad bean]
ref|XP_009398351.1|  PREDICTED: calcium-dependent protein kinase ...  97.1    8e-22   
ref|XP_008803232.1|  PREDICTED: calcium-dependent protein kinase 1    97.1    8e-22   
gb|AFK13839.1|  calmcium/calmodulin-dependent protein kinase CDPK2    96.7    8e-22   
ref|XP_008375558.1|  PREDICTED: calcium-dependent protein kinase 1    97.1    9e-22   
ref|XP_004303727.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    9e-22   
ref|XP_006584637.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    9e-22   
ref|XP_007010504.1|  Calcium dependent protein kinase 1               97.1    1e-21   
ref|XP_004977255.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    1e-21   
ref|XP_003602699.1|  Calcium-dependent protein kinase                 96.3    1e-21   
ref|XP_009389198.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    1e-21   
ref|NP_001167855.1|  uncharacterized LOC100381559                     96.7    1e-21   Zea mays [maize]
gb|KHN08596.1|  Calcium-dependent protein kinase 1                    97.1    1e-21   
ref|XP_010238945.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  97.1    1e-21   
gb|KCW45721.1|  hypothetical protein EUGRSUZ_L00499                   92.8    1e-21   
gb|AAB49984.1|  calcium-dependent calmodulin-independent protein ...  96.7    1e-21   Cucurbita pepo
ref|XP_010909026.1|  PREDICTED: calcium-dependent protein kinase 26   96.7    1e-21   
dbj|BAA04830.1|  calcium-dependent protein kinase                     96.3    1e-21   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA54876.1|  TPA: putative calcium-dependent protein kinase f...  97.1    1e-21   
ref|XP_006485498.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    1e-21   
ref|XP_010421165.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    1e-21   
ref|XP_003535945.1|  PREDICTED: calcium-dependent protein kinase 1    96.7    1e-21   
gb|EMS53751.1|  Calcium-dependent protein kinase 1                    96.3    1e-21   
ref|XP_002442894.1|  hypothetical protein SORBIDRAFT_08g004510        96.3    1e-21   Sorghum bicolor [broomcorn]
gb|KDO48687.1|  hypothetical protein CISIN_1g007353mg                 96.7    1e-21   
ref|XP_010911424.1|  PREDICTED: calcium-dependent protein kinase 4    93.6    1e-21   
ref|XP_006651892.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    1e-21   
gb|KDO70719.1|  hypothetical protein CISIN_1g0400032mg                92.0    1e-21   
ref|XP_010694387.1|  PREDICTED: calcium-dependent protein kinase 1    96.7    1e-21   
gb|KHN05362.1|  Calcium-dependent protein kinase 1                    96.7    1e-21   
ref|XP_001761532.1|  cpk12 calcium-dependent protein kinase           95.9    1e-21   
ref|XP_003555695.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    1e-21   
ref|XP_006445805.1|  hypothetical protein CICLE_v10014759mg           96.3    1e-21   
ref|XP_008674183.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    1e-21   
emb|CAC83000.1|  calcium-dependent protein kinase 2                   96.3    1e-21   Nicotiana benthamiana
ref|XP_007145376.1|  hypothetical protein PHAVU_007G233900g           96.3    2e-21   
ref|XP_006826421.1|  hypothetical protein AMTR_s00004p00161280        96.3    2e-21   
ref|XP_004307068.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    2e-21   
ref|XP_008231941.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  96.3    2e-21   
ref|XP_010999676.1|  PREDICTED: calcium-dependent protein kinase SK5  95.9    2e-21   
gb|EYU31203.1|  hypothetical protein MIMGU_mgv1a004202mg              95.9    2e-21   
gb|EMS61598.1|  Calcium-dependent protein kinase SK5                  95.1    2e-21   
ref|XP_002325726.1|  calcium-dependent protein kinase 1               95.9    2e-21   Populus trichocarpa [western balsam poplar]
emb|CDX80376.1|  BnaC07g30680D                                        95.5    2e-21   
ref|XP_010039815.1|  PREDICTED: calcium-dependent protein kinase ...  93.6    2e-21   
ref|NP_001051507.1|  Os03g0789000                                     96.3    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008347036.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    2e-21   
ref|XP_007137839.1|  hypothetical protein PHAVU_009G160100g           95.5    2e-21   
ref|XP_008241096.1|  PREDICTED: calcium-dependent protein kinase 26   96.3    2e-21   
ref|XP_010090475.1|  Calcium-dependent protein kinase 1               95.9    2e-21   
ref|XP_009150889.1|  PREDICTED: calcium-dependent protein kinase 12   95.5    2e-21   
gb|EYU19860.1|  hypothetical protein MIMGU_mgv1a003630mg              95.9    2e-21   
gb|KHG00929.1|  Calcium-dependent protein kinase 1                    95.9    2e-21   
gb|KDP29499.1|  hypothetical protein JCGZ_19338                       95.9    2e-21   
ref|XP_010421166.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    2e-21   
ref|XP_008786722.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    2e-21   
ref|XP_002874139.1|  calcium-dependent protein kinase 9               95.1    2e-21   
ref|XP_010493481.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    2e-21   
ref|XP_006855638.1|  hypothetical protein AMTR_s00044p00104590        95.9    2e-21   
ref|XP_004303388.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    2e-21   
ref|XP_007213945.1|  hypothetical protein PRUPE_ppa003542mg           95.9    2e-21   
gb|KDP36080.1|  hypothetical protein JCGZ_08724                       91.3    2e-21   
gb|ABY59007.1|  calcium-dependent protein kinase                      95.5    3e-21   
ref|XP_002442139.1|  hypothetical protein SORBIDRAFT_08g014910        95.9    3e-21   
ref|XP_006282810.1|  hypothetical protein CARUB_v10006526mg           94.7    3e-21   
ref|XP_011032926.1|  PREDICTED: calcium-dependent protein kinase 1    95.5    3e-21   
pdb|2AAO|A  Chain A, Regulatory Apparatus Of Calcium Dependent Pr...  91.3    3e-21   
emb|CDO99952.1|  unnamed protein product                              95.5    3e-21   
ref|XP_010454647.1|  PREDICTED: calcium-dependent protein kinase 12   95.1    3e-21   
ref|XP_008387135.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    3e-21   
ref|XP_002868839.1|  predicted protein                                94.7    3e-21   
ref|NP_001190950.1|  calcium-dependent protein kinase 26              94.7    3e-21   
gb|ACR37715.1|  unknown                                               92.4    3e-21   
gb|AGJ83809.1|  calcium-dependent protein kinase 3b                   95.5    3e-21   
ref|NP_001190949.1|  calcium-dependent protein kinase 26              95.1    3e-21   
ref|XP_009407728.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    4e-21   
ref|XP_006664026.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    4e-21   
ref|XP_010266265.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    4e-21   
ref|XP_006430001.1|  hypothetical protein CICLE_v10011369mg           95.1    4e-21   
ref|XP_011024127.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    4e-21   
ref|XP_009341566.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    4e-21   
ref|XP_003518161.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    4e-21   
emb|CBI39146.3|  unnamed protein product                              95.1    4e-21   
ref|XP_003589907.1|  Calcium dependent protein kinase                 95.1    5e-21   
dbj|BAJ86330.1|  predicted protein                                    92.0    5e-21   
ref|XP_010674273.1|  PREDICTED: calcium-dependent protein kinase SK5  94.4    5e-21   
dbj|BAJ88346.1|  predicted protein                                    92.0    5e-21   
ref|XP_010058855.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    5e-21   
ref|XP_009356139.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    5e-21   
gb|ABS88997.1|  calcium-dependent calmodulin-independent protein ...  94.7    5e-21   
ref|XP_009362664.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    5e-21   
dbj|BAJ97730.1|  predicted protein                                    93.6    5e-21   
ref|XP_002264440.1|  PREDICTED: calcium-dependent protein kinase 1    94.7    5e-21   
ref|XP_002322763.2|  calcium-dependent protein kinase                 94.7    5e-21   
gb|ACH88439.1|  calcium-dependent protein kinase                      94.7    5e-21   
ref|XP_006394622.1|  hypothetical protein EUTSA_v10004083mg           94.4    5e-21   
gb|EPS61686.1|  calcium dependent protein kinase 5                    94.0    5e-21   
ref|XP_010906856.1|  PREDICTED: calcium-dependent protein kinase 6    94.4    5e-21   
ref|XP_010248104.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    6e-21   
emb|CDY00963.1|  BnaC05g42370D                                        94.7    6e-21   
gb|AGG35969.1|  calcium-dependent protein kinase 2                    94.7    6e-21   
ref|XP_009392207.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    6e-21   
ref|XP_007204872.1|  hypothetical protein PRUPE_ppa002734mg           94.7    6e-21   
ref|XP_004962973.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    6e-21   
emb|CDX88038.1|  BnaA06g26290D                                        95.5    6e-21   
ref|XP_009146816.1|  PREDICTED: calcium-dependent protein kinase 2    94.7    6e-21   
gb|ACX37459.1|  calcium dependent protein kinase 1                    94.7    6e-21   
ref|XP_006481857.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    6e-21   
ref|XP_011077773.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    7e-21   
ref|XP_011076878.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    7e-21   
ref|XP_002309269.1|  calcium-dependent protein kinase                 94.7    7e-21   
ref|XP_008662525.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    7e-21   
emb|CDY08584.1|  BnaA05g28200D                                        94.4    7e-21   
ref|NP_197748.1|  calcium-dependent protein kinase 12                 94.0    7e-21   
ref|XP_010555172.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    7e-21   
ref|XP_006287609.1|  hypothetical protein CARUB_v10000821mg           94.0    8e-21   
ref|XP_008812553.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    8e-21   
ref|XP_011047130.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    8e-21   
ref|XP_010555169.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    8e-21   
gb|KHG01398.1|  Calcium-dependent protein kinase 1                    94.4    8e-21   
ref|XP_009390783.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    8e-21   
gb|KFK24927.1|  hypothetical protein AALP_AA8G042900                  94.4    8e-21   
ref|XP_010555167.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    8e-21   
ref|XP_010935343.1|  PREDICTED: calcium-dependent protein kinase 26   94.4    8e-21   
gb|EMT26589.1|  Calcium-dependent protein kinase 5                    94.4    8e-21   
ref|XP_010940240.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    8e-21   
gb|EMT18988.1|  Calcium-dependent protein kinase 1                    93.6    9e-21   
emb|CAN64630.1|  hypothetical protein VITISV_039195                   94.4    9e-21   
ref|XP_006481632.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    9e-21   
ref|XP_006430028.1|  hypothetical protein CICLE_v10011252mg           94.4    9e-21   
gb|KDO70669.1|  hypothetical protein CISIN_1g006259mg                 94.4    9e-21   
ref|XP_010558242.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    1e-20   
ref|XP_008804660.1|  PREDICTED: calcium-dependent protein kinase 26   94.0    1e-20   
ref|XP_004498060.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    1e-20   
ref|XP_003630428.1|  Calcium-dependent protein kinase                 93.6    1e-20   
ref|XP_006407522.1|  hypothetical protein EUTSA_v10020268mg           94.0    1e-20   
ref|XP_010558239.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    1e-20   
ref|XP_002524101.1|  calcium-dependent protein kinase, putative       93.6    1e-20   
emb|CDP10568.1|  unnamed protein product                              94.0    1e-20   
ref|XP_011047145.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    1e-20   
gb|EYU40484.1|  hypothetical protein MIMGU_mgv1a004107mg              93.2    2e-20   
ref|XP_010555170.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-20   
ref|XP_008778195.1|  PREDICTED: calcium-dependent protein kinase 26   93.2    2e-20   
gb|KEH41846.1|  calcium-dependent kinase                              93.2    2e-20   
gb|AAB70706.1|  calmodulin-like domain protein kinase                 93.2    2e-20   
ref|XP_002315411.1|  calcium-dependent protein kinase 2               93.2    2e-20   
ref|XP_011088723.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-20   
ref|XP_009401246.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    2e-20   
gb|AHZ58490.1|  calmodulin-like domain protein kinase                 93.2    2e-20   
ref|XP_002323364.2|  calcium-dependent protein kinase 1               93.2    2e-20   
ref|XP_010067103.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  93.2    2e-20   
ref|XP_011088720.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-20   
dbj|BAJ96062.1|  predicted protein                                    92.8    2e-20   
ref|XP_004976604.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    2e-20   
ref|XP_009101956.1|  PREDICTED: calcium-dependent protein kinase 26   92.4    2e-20   
emb|CDY59100.1|  BnaCnng34240D                                        92.4    2e-20   
gb|KCW65171.1|  hypothetical protein EUGRSUZ_G02664                   93.2    2e-20   
ref|NP_001170478.1|  LOC100384476                                     92.8    2e-20   
ref|XP_009349885.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-20   
gb|EMS67325.1|  Calcium-dependent protein kinase 1                    93.2    2e-20   
ref|XP_004489857.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-20   
gb|AAW31900.1|  calcium-dependent/calmodulin-independent protein ...  90.5    2e-20   
dbj|BAJ88027.1|  predicted protein                                    93.2    3e-20   
gb|EAZ20507.1|  hypothetical protein OsJ_36113                        93.2    3e-20   
ref|XP_006647698.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    3e-20   
ref|NP_001066786.1|  Os12g0486600                                     92.8    3e-20   
gb|EMS53623.1|  Calcium-dependent protein kinase 5                    92.0    3e-20   
gb|AFR54115.1|  calcium-dependent protein kinase 3-like protein       90.1    3e-20   
gb|AAL68972.1|  calmodulin-like-domain protein kinase CPK2            92.8    3e-20   
emb|CDX98791.1|  BnaC09g50440D                                        92.8    3e-20   
ref|XP_010491015.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    3e-20   
gb|AAL68971.1|  phloem calmodulin-like-domain protein kinase PCPK1    92.4    3e-20   
ref|NP_001053670.1|  Os04g0584600                                     92.4    3e-20   
ref|XP_008668637.1|  PREDICTED: calcium dependent protein kinase ...  92.4    3e-20   
ref|XP_006411116.1|  hypothetical protein EUTSA_v10017647mg           92.8    3e-20   
ref|XP_010645765.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    3e-20   
ref|XP_010558243.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    3e-20   
ref|XP_010228730.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    3e-20   
ref|XP_006411612.1|  hypothetical protein EUTSA_v10025058mg           92.0    3e-20   
ref|XP_011092924.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    4e-20   
dbj|BAB16888.1|  OsCDPK7                                              92.4    4e-20   
gb|EEE61563.1|  hypothetical protein OsJ_15923                        92.4    4e-20   
gb|EAZ24214.1|  hypothetical protein OsJ_07963                        92.0    4e-20   
ref|XP_006652699.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-20   
gb|AAC49405.1|  calcium dependent protein kinase                      92.0    4e-20   
ref|XP_007204221.1|  hypothetical protein PRUPE_ppa003092mg           92.4    4e-20   
ref|XP_010452389.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    4e-20   
gb|KDP36070.1|  hypothetical protein JCGZ_08714                       92.4    4e-20   
ref|XP_006588896.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    4e-20   
ref|XP_008241110.1|  PREDICTED: calcium-dependent protein kinase 20   92.4    4e-20   
ref|XP_002446994.1|  hypothetical protein SORBIDRAFT_06g026530        92.0    4e-20   
gb|ABU45516.1|  calcium-dependent protein kinase 1                    92.4    4e-20   
ref|XP_008391998.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-20   
ref|XP_011042556.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    4e-20   
gb|EAY87105.1|  hypothetical protein OsI_08506                        92.0    4e-20   
gb|EYU38701.1|  hypothetical protein MIMGU_mgv1a003550mg              92.0    4e-20   
ref|XP_007142577.1|  hypothetical protein PHAVU_008G292500g           92.0    4e-20   
ref|NP_001105307.1|  Calcium-dependent protein kinase                 92.0    5e-20   
gb|EMT27097.1|  Calcium-dependent protein kinase 2                    92.4    5e-20   
ref|NP_001047767.1|  Os02g0685900                                     92.0    5e-20   
ref|XP_003570118.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    5e-20   
gb|EMT18908.1|  Calcium-dependent protein kinase 5                    92.4    5e-20   
gb|EYU24096.1|  hypothetical protein MIMGU_mgv1a005313mg              91.7    5e-20   
gb|KEH24278.1|  calmodulin-domain kinase CDPK protein                 92.0    5e-20   
ref|XP_011042536.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    5e-20   
ref|XP_006398939.1|  hypothetical protein EUTSA_v10012990mg           92.0    5e-20   
gb|ABV22574.1|  calcium-dependent protein kinase                      92.0    5e-20   
ref|XP_009122558.1|  PREDICTED: calcium-dependent protein kinase 1    92.0    5e-20   
gb|ABE73345.1|  putative calcium-dependent protein kinase 2           92.0    5e-20   
ref|XP_010247940.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    5e-20   
gb|KEH24277.1|  calmodulin-domain kinase CDPK protein                 92.0    6e-20   
ref|XP_009387790.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    6e-20   
ref|XP_010423525.1|  PREDICTED: calcium-dependent protein kinase 1    92.0    6e-20   
gb|AFW63434.1|  putative calcium-dependent protein kinase family ...  88.2    6e-20   
ref|XP_006398940.1|  hypothetical protein EUTSA_v10012990mg           92.0    6e-20   
emb|CDY40638.1|  BnaA03g53250D                                        87.0    7e-20   
ref|XP_010266261.1|  PREDICTED: calcium-dependent protein kinase ...  91.7    7e-20   
ref|NP_001105304.1|  calcium dependent protein kinase                 91.3    7e-20   
gb|EMS52553.1|  Calcium-dependent protein kinase 5                    90.9    7e-20   
gb|ABY59016.1|  calcium-dependent protein kinase                      90.9    7e-20   
ref|XP_006287286.1|  hypothetical protein CARUB_v10000481mg           91.7    8e-20   
gb|KDO68395.1|  hypothetical protein CISIN_1g007895mg                 91.7    8e-20   
ref|XP_008451214.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    8e-20   
ref|XP_001775155.1|  predicted protein                                90.9    8e-20   
emb|CDX70192.1|  BnaA10g25410D                                        91.3    8e-20   
ref|XP_001775176.1|  cpk11 calcium-dependent protein kinase           90.9    8e-20   
ref|XP_003519696.2|  PREDICTED: calcium-dependent protein kinase ...  91.3    8e-20   
ref|XP_008451211.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    9e-20   
ref|XP_004144896.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    9e-20   
gb|KHN46862.1|  Calcium-dependent protein kinase 4                    91.3    9e-20   
ref|XP_003537146.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    9e-20   
gb|EYU38709.1|  hypothetical protein MIMGU_mgv1a002855mg              91.7    9e-20   
ref|XP_003544188.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    9e-20   
ref|XP_007199654.1|  hypothetical protein PRUPE_ppa003459mg           91.3    9e-20   
ref|XP_008235819.1|  PREDICTED: calcium-dependent protein kinase 26   91.3    9e-20   
ref|XP_004305563.1|  PREDICTED: calcium-dependent protein kinase ...  91.7    9e-20   
ref|XP_002454465.1|  hypothetical protein SORBIDRAFT_04g031570        90.9    9e-20   
ref|XP_002873173.1|  calcium-dependent protein kinase isoform ak1     91.3    9e-20   
ref|XP_002308334.2|  calcium-dependent protein kinase 1               91.3    9e-20   
ref|XP_006422397.1|  hypothetical protein CICLE_v10028110mg           91.3    1e-19   
ref|XP_009362641.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  91.3    1e-19   
ref|XP_001776407.1|  cpk9 calcium-dependent protein kinase            91.3    1e-19   
ref|XP_010543629.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    1e-19   
ref|XP_007043083.1|  Calmodulin-domain protein kinase 5 isoform 1     90.9    1e-19   
ref|XP_011040815.1|  PREDICTED: calcium-dependent protein kinase ...  90.9    1e-19   
gb|ADZ99350.1|  calcium-dependent protein kinase 5                    90.9    1e-19   
emb|CDY46963.1|  BnaA02g32830D                                        90.1    1e-19   
gb|AAV28170.1|  calcium-dependent protein kinase 2                    89.4    1e-19   
ref|XP_010090706.1|  Calcium-dependent protein kinase 4               90.9    1e-19   
ref|XP_006384859.1|  calcium-dependent/calmodulin-independent pro...  90.9    1e-19   
ref|XP_006422398.1|  hypothetical protein CICLE_v10028110mg           90.9    1e-19   
emb|CDP14487.1|  unnamed protein product                              90.9    1e-19   
ref|XP_002520611.1|  calcium-dependent protein kinase, putative       90.9    1e-19   
ref|NP_196107.1|  calcium dependent protein kinase 1                  91.3    1e-19   
gb|KHG11035.1|  Calcium-dependent protein kinase 4                    90.9    1e-19   
emb|CBI37730.3|  unnamed protein product                              90.1    1e-19   
gb|ABK25876.1|  unknown                                               86.7    1e-19   
ref|XP_009608537.1|  PREDICTED: calcium-dependent protein kinase ...  90.9    1e-19   
gb|AET01085.2|  calmodulin-domain kinase CDPK protein                 90.5    1e-19   
ref|XP_009130843.1|  PREDICTED: calcium-dependent protein kinase ...  90.9    1e-19   
gb|AGG35968.1|  calcium-dependent protein kinase 1                    90.9    1e-19   
ref|XP_006649209.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    1e-19   
gb|EAZ25201.1|  hypothetical protein OsJ_09001                        90.5    1e-19   
gb|EAY88137.1|  hypothetical protein OsI_09572                        90.5    1e-19   
ref|XP_006296161.1|  hypothetical protein CARUB_v10025314mg           90.9    1e-19   
gb|KHG07421.1|  Calcium-dependent protein kinase 2                    90.9    1e-19   
gb|ABY59005.1|  calcium-dependent protein kinase                      90.5    1e-19   
ref|XP_010493983.1|  PREDICTED: calcium-dependent protein kinase 2    90.9    1e-19   
ref|XP_010437488.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    1e-19   
ref|XP_011000864.1|  PREDICTED: calcium-dependent protein kinase 26   90.5    1e-19   
gb|AAV41876.1|  calcium-dependent protein kinase 2                    90.5    2e-19   
gb|AFV30233.1|  calcium-dependent protein kinase                      90.5    2e-19   
ref|XP_010464745.1|  PREDICTED: calcium-dependent protein kinase ...  90.9    2e-19   
gb|KHG05702.1|  Calcium-dependent protein kinase 2                    90.9    2e-19   
ref|XP_010446939.1|  PREDICTED: calcium-dependent protein kinase ...  90.5    2e-19   



>gb|EYU22842.1| hypothetical protein MIMGU_mgv1a005115mg [Erythranthe guttata]
Length=496

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENLLAAFS+FDKDGSGYITVDELQ ACK+FGLGD QL+
Sbjct  386  DYGEFLAATLHMNKMEREENLLAAFSFFDKDGSGYITVDELQQACKDFGLGDVQLD  441



>ref|XP_004250396.1| PREDICTED: calcium-dependent protein kinase 11-like [Solanum 
lycopersicum]
Length=505

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT+DELQ AC+EFGLGD +LE
Sbjct  394  DYGEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITIDELQQACQEFGLGDVKLE  449



>emb|CBI18175.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYIT+DELQ AC+EFGLGDA L+
Sbjct  238  DYGEFLAATLHLNKMEREENLIAAFSFFDKDGSGYITIDELQQACREFGLGDAHLD  293



>gb|KDP43357.1| hypothetical protein JCGZ_25462 [Jatropha curcas]
Length=502

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFSYFDKDGSGYITVDELQ ACKEFGL D QL+
Sbjct  386  DYGEFLAATLHLNKMEREENLIAAFSYFDKDGSGYITVDELQQACKEFGLDDVQLD  441



>ref|XP_004160243.1| PREDICTED: calcium-dependent protein kinase 4-like [Cucumis sativus]
Length=159

 Score =   103 bits (258),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  47   DYGEFLAATLHLNKIEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  102



>dbj|BAD94110.1| calcium-dependent protein kinase [Arabidopsis thaliana]
Length=158

 Score =   103 bits (257),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  47   DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  102



>gb|ADN34193.1| calcium-dependent protein kinase [Cucumis melo subsp. melo]
Length=159

 Score =   103 bits (257),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  47   DYGEFLAATLHLNKIEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  102



>emb|CAB59359.1| ATCDPK2-like protein [Arabidopsis thaliana]
Length=145

 Score =   103 bits (256),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  34   DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  89



>ref|XP_011096992.1| PREDICTED: calcium-dependent protein kinase 11 [Sesamum indicum]
Length=496

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL AAFS+FDKDGSGYIT+DELQ ACKEFGLGD QLE
Sbjct  386  DYGEFLAATLHLNKMEREENLHAAFSFFDKDGSGYITIDELQQACKEFGLGDVQLE  441



>ref|XP_010665103.1| PREDICTED: calcium-dependent protein kinase 4 [Vitis vinifera]
Length=489

 Score =   107 bits (267),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYIT+DELQ AC+EFGLGDA L+
Sbjct  381  DYGEFLAATLHLNKMEREENLIAAFSFFDKDGSGYITIDELQQACREFGLGDAHLD  436



>ref|XP_006351913.1| PREDICTED: calcium-dependent protein kinase 4-like [Solanum tuberosum]
Length=505

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT+DELQ AC+EFGLGD +LE
Sbjct  394  DYGEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITIDELQLACQEFGLGDVKLE  449



>ref|XP_010062000.1| PREDICTED: calcium-dependent protein kinase 11 [Eucalyptus grandis]
 gb|KCW69057.1| hypothetical protein EUGRSUZ_F02611 [Eucalyptus grandis]
Length=508

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFSYFDKDGSGYIT DELQ ACKEFGLGD  L+
Sbjct  399  DYGEFLAATLHLNKMEREENLVAAFSYFDKDGSGYITTDELQQACKEFGLGDVHLD  454



>ref|XP_009345937.1| PREDICTED: calcium-dependent protein kinase 11-like [Pyrus x 
bretschneideri]
Length=500

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYITVDELQ ACKEFGLGD  L+
Sbjct  385  DYGEFLAATLHLNKMEREENLIAAFSFFDKDGSGYITVDELQQACKEFGLGDVHLD  440



>ref|XP_008380994.1| PREDICTED: calcium-dependent protein kinase 4-like [Malus domestica]
Length=495

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYITVDELQ ACKEFGLGD  L+
Sbjct  378  DYGEFLAATLHLNKMEREENLIAAFSFFDKDGSGYITVDELQQACKEFGLGDVHLD  433



>ref|XP_009375285.1| PREDICTED: calcium-dependent protein kinase 11 [Pyrus x bretschneideri]
Length=500

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYITVDELQ ACKEFGLGD  L+
Sbjct  385  DYGEFLAATLHLNKMEREENLIAAFSFFDKDGSGYITVDELQQACKEFGLGDVHLD  440



>ref|XP_008382024.1| PREDICTED: calcium-dependent protein kinase 11 [Malus domestica]
Length=500

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYITVDELQ ACKEFGLGD  L+
Sbjct  385  DYGEFLAATLHLNKMEREENLIAAFSFFDKDGSGYITVDELQQACKEFGLGDVHLD  440



>ref|XP_011005156.1| PREDICTED: calcium-dependent protein kinase 4-like isoform X2 
[Populus euphratica]
Length=470

 Score =   106 bits (265),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  403  DYGEFLAATLHLNKMEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  458



>ref|XP_009782854.1| PREDICTED: calcium-dependent protein kinase 11-like [Nicotiana 
sylvestris]
Length=500

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT+DELQ AC++FG GDA+LE
Sbjct  389  DYGEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITIDELQQACQDFGFGDAKLE  444



>gb|KHG19874.1| Calcium-dependent protein kinase 11 [Gossypium arboreum]
Length=332

 Score =   105 bits (262),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREEN++AAF++FDKDGSGYITVDELQ ACKEFGLGD  LE
Sbjct  209  DYGEFIAATLHMNKLEREENIVAAFTFFDKDGSGYITVDELQQACKEFGLGDVHLE  264



>ref|XP_007199799.1| hypothetical protein PRUPE_ppa004665mg [Prunus persica]
 gb|EMJ00998.1| hypothetical protein PRUPE_ppa004665mg [Prunus persica]
Length=497

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYIT+DELQ ACKEFGLGD  L+
Sbjct  388  DYGEFLAATLHLNKMEREENLVAAFSFFDKDGSGYITIDELQQACKEFGLGDVHLD  443



>ref|XP_007019990.1| Calcium-dependent protein kinase 2 isoform 3, partial [Theobroma 
cacao]
 gb|EOY17215.1| Calcium-dependent protein kinase 2 isoform 3, partial [Theobroma 
cacao]
Length=466

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYIT+DELQ+ACKEFGLGD  L+
Sbjct  391  DYGEFLAATLHINKMEREENLVAAFSFFDKDGSGYITIDELQNACKEFGLGDVHLD  446



>ref|XP_007019988.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao]
 gb|EOY17213.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao]
Length=566

 Score =   107 bits (267),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKDGSGYIT+DELQ+ACKEFGLGD  L+
Sbjct  454  DYGEFLAATLHINKMEREENLVAAFSFFDKDGSGYITIDELQNACKEFGLGDVHLD  509



>ref|XP_010543384.1| PREDICTED: calcium-dependent protein kinase 11 [Tarenaya hassleriana]
Length=495

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFSYFDKDGSGYITVDELQ ACKEFGL D+ +E
Sbjct  383  DYGEFLAATLHLNKMEREENLVAAFSYFDKDGSGYITVDELQQACKEFGLCDSPIE  438



>ref|XP_006376288.1| hypothetical protein POPTR_0013s11690g [Populus trichocarpa]
 gb|ERP54085.1| hypothetical protein POPTR_0013s11690g [Populus trichocarpa]
Length=470

 Score =   105 bits (262),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKM+RE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  403  DYGEFLAATLHLNKMDREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  458



>ref|XP_010678309.1| PREDICTED: calcium-dependent protein kinase 11 [Beta vulgaris 
subsp. vulgaris]
Length=512

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAF YFDKDGSGYIT+DELQ ACKEFGLG+  L+
Sbjct  398  DYGEFLAATLHMNKMEREENLIAAFKYFDKDGSGYITIDELQEACKEFGLGEGHLD  453



>ref|XP_011005155.1| PREDICTED: calcium-dependent protein kinase 11-like isoform X1 
[Populus euphratica]
Length=521

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  403  DYGEFLAATLHLNKMEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  458



>ref|XP_002526815.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF35550.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=497

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENLLAAFSYFDKDGSGYITVDELQ ACK+FGL D  L+
Sbjct  388  DYGEFLAATLHLNKMEREENLLAAFSYFDKDGSGYITVDELQQACKDFGLDDVHLD  443



>ref|XP_002325988.2| hypothetical protein POPTR_0019s11290g [Populus trichocarpa]
 gb|EEF00370.2| hypothetical protein POPTR_0019s11290g [Populus trichocarpa]
Length=519

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  406  DYGEFLAATLHLNKMEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  461



>ref|XP_011001786.1| PREDICTED: calcium-dependent protein kinase 11-like [Populus 
euphratica]
 ref|XP_011016201.1| PREDICTED: calcium-dependent protein kinase 11-like [Populus 
euphratica]
Length=516

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  403  DYGEFLAATLHLNKMEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  458



>gb|KHG12764.1| Calcium-dependent protein kinase 11 [Gossypium arboreum]
Length=502

 Score =   105 bits (261),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+EREENL+AAFS+FDKDGSGYIT+DELQ ACKEFGLGD  L+
Sbjct  389  DYGEFLAATLHINKIEREENLVAAFSFFDKDGSGYITIDELQQACKEFGLGDVHLD  444



>ref|XP_010521536.1| PREDICTED: calcium-dependent protein kinase 12 [Tarenaya hassleriana]
Length=491

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL+ AFS+FDKDGSGYIT+DELQHACKEFGL D  LE
Sbjct  380  DYGEFLAATIHLNKLEREENLVTAFSFFDKDGSGYITIDELQHACKEFGLNDTHLE  435



>ref|XP_006353626.1| PREDICTED: calcium-dependent protein kinase 4-like [Solanum tuberosum]
Length=501

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT DELQ AC EFGLGD +L
Sbjct  390  DYGEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITTDELQQACVEFGLGDVKL  444



>ref|XP_004290421.1| PREDICTED: calcium-dependent protein kinase 11-like [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFS+FDKD SGYIT+DELQ ACK+FGLGD  L+
Sbjct  379  DYGEFLAATLHMNKMEREENLIAAFSFFDKDASGYITIDELQQACKDFGLGDVHLD  434



>ref|XP_004241825.1| PREDICTED: calcium-dependent protein kinase 11 [Solanum lycopersicum]
 ref|XP_010322758.1| PREDICTED: calcium-dependent protein kinase 11 [Solanum lycopersicum]
Length=501

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT DELQ AC EFGLGD +L
Sbjct  390  DYGEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITTDELQQACVEFGLGDVKL  444



>emb|CDP17874.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            +YGEFLAATLHMNKMEREENLLAAF++FDKDGSGYIT+DELQ ACK+FGL D QL+
Sbjct  384  EYGEFLAATLHMNKMEREENLLAAFTFFDKDGSGYITIDELQQACKDFGLADGQLD  439



>ref|XP_008237265.1| PREDICTED: calcium-dependent protein kinase 11-like [Prunus mume]
Length=497

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFS+FDKD SGYIT+DELQ ACKEFGLGD  L+
Sbjct  388  DYGEFLAATLHLNKMEREENLVAAFSFFDKDASGYITIDELQQACKEFGLGDVHLD  443



>ref|XP_009145120.1| PREDICTED: calcium-dependent protein kinase 11 [Brassica rapa]
 emb|CDY37101.1| BnaAnng04600D [Brassica napus]
Length=497

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  438



>gb|AGG35964.1| calcium-dependent protein kinase 11 [Brassica napus]
 emb|CDX73342.1| BnaC05g27640D [Brassica napus]
Length=497

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  438



>ref|XP_006376289.1| Calcium-dependent protein kinase 2 [Populus trichocarpa]
 gb|ERP54086.1| Calcium-dependent protein kinase 2 [Populus trichocarpa]
Length=521

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKM+RE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  403  DYGEFLAATLHLNKMDREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  458



>gb|KGN44377.1| hypothetical protein Csa_7G274170 [Cucumis sativus]
Length=501

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  389  DYGEFLAATLHLNKIEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  444



>ref|XP_008461962.1| PREDICTED: calcium-dependent protein kinase 11 [Cucumis melo]
Length=501

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  389  DYGEFLAATLHLNKIEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  444



>ref|XP_004149412.1| PREDICTED: calcium-dependent protein kinase 11-like [Cucumis 
sativus]
Length=501

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL+AAFSYFDKDGSGYIT+DELQ ACK+FGLGD  L+
Sbjct  389  DYGEFLAATLHLNKIEREDNLVAAFSYFDKDGSGYITIDELQQACKDFGLGDVHLD  444



>ref|XP_004955505.1| PREDICTED: calcium-dependent protein kinase 1-like isoform X3 
[Setaria italica]
Length=555

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+GDA LE
Sbjct  451  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITYDELQTACEEFGIGDAHLE  506



>ref|XP_004496370.1| PREDICTED: calcium-dependent protein kinase 4-like [Cicer arietinum]
Length=497

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT+DELQ ACK+FGLG+  L+
Sbjct  387  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFGLGEVHLD  442



>ref|XP_006307331.1| hypothetical protein CARUB_v10008949mg [Capsella rubella]
 gb|EOA40229.1| hypothetical protein CARUB_v10008949mg [Capsella rubella]
Length=495

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  384  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  439



>ref|XP_002891197.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010461330.1| PREDICTED: calcium-dependent protein kinase 11 [Camelina sativa]
 gb|EFH67456.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=495

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  384  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  439



>ref|NP_174807.1| calcium-dependent protein kinase 2 [Arabidopsis thaliana]
 sp|Q39016.2|CDPKB_ARATH RecName: Full=Calcium-dependent protein kinase 11; AltName: Full=Calcium-dependent 
protein kinase isoform CDPK2; Short=AtCDPK2 
[Arabidopsis thaliana]
 gb|AAK93658.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAM45034.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE31822.1| calcium-dependent protein kinase 2 [Arabidopsis thaliana]
Length=495

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  384  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  439



>gb|AAF79386.1|AC007887_45 F15O4.8 [Arabidopsis thaliana]
Length=557

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  446  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  501



>gb|KFK26973.1| hypothetical protein AALP_AA8G317600 [Arabis alpina]
Length=494

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  438



>ref|XP_006397467.1| hypothetical protein EUTSA_v10001816mg [Eutrema salsugineum]
 gb|ESQ38920.1| hypothetical protein EUTSA_v10001816mg [Eutrema salsugineum]
Length=497

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  438



>gb|KEH43562.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=499

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT+DELQ ACK+FGLG+  L+
Sbjct  388  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFGLGEVHLD  443



>gb|KHN17080.1| Calcium-dependent protein kinase 4 [Glycine soja]
Length=492

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT+DELQ ACK+F LGD  L+
Sbjct  381  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFSLGDVHLD  436



>ref|NP_001235629.1| calmodulin-like domain protein kinase isoenzyme beta [Glycine 
max]
 gb|AAB80692.1| calmodulin-like domain protein kinase isoenzyme beta [Glycine 
max]
Length=490

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT+DELQ ACK+F LGD  L+
Sbjct  381  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFSLGDVHLD  436



>ref|XP_009620445.1| PREDICTED: calcium-dependent protein kinase 11 [Nicotiana tomentosiformis]
Length=503

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT DELQ AC +FGLGD +L
Sbjct  392  DYGEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITTDELQQACIDFGLGDVKL  446



>ref|XP_009786091.1| PREDICTED: calcium-dependent protein kinase 11-like [Nicotiana 
sylvestris]
Length=503

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT DELQ AC +FGLGD +L
Sbjct  392  DYGEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITTDELQQACIDFGLGDVKL  446



>ref|XP_009594347.1| PREDICTED: calcium-dependent protein kinase 11-like [Nicotiana 
tomentosiformis]
Length=500

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DY EF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT+DELQ AC +FG GDA+LE
Sbjct  389  DYSEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITIDELQQACLDFGFGDAKLE  444



>gb|AAP03013.1| seed calcium dependent protein kinase b [Glycine max]
 gb|ACU24528.1| unknown [Glycine max]
Length=490

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT+DELQ ACK+F LGD  L+
Sbjct  381  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFSLGDVHLD  436



>gb|KHN00795.1| Calcium-dependent protein kinase 4 [Glycine soja]
Length=490

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT+DELQ ACK+F LGD  L+
Sbjct  381  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFSLGDVHLD  436



>emb|CDY05064.1| BnaC03g28620D [Brassica napus]
 emb|CDX90725.1| BnaA03g24050D [Brassica napus]
Length=500

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>ref|XP_010538925.1| PREDICTED: calcium-dependent protein kinase 11-like [Tarenaya 
hassleriana]
Length=499

 Score =   102 bits (255),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFSYFDKDGSGYITVDELQ A KEFGL D+ +E
Sbjct  383  DYGEFLAATLHLNKMEREENLVAAFSYFDKDGSGYITVDELQQASKEFGLCDSPIE  438



>ref|XP_009134149.1| PREDICTED: calcium-dependent protein kinase 4 [Brassica rapa]
Length=500

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>ref|XP_006606214.1| PREDICTED: calcium-dependent protein kinase SK5-like [Glycine 
max]
Length=294

 Score =   100 bits (250),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT++E+Q ACK+FGLG+  L+
Sbjct  191  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIEEIQQACKDFGLGNLHLD  246



>ref|XP_006397184.1| hypothetical protein EUTSA_v10028598mg [Eutrema salsugineum]
 gb|ESQ38637.1| hypothetical protein EUTSA_v10028598mg [Eutrema salsugineum]
Length=501

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>ref|XP_002872452.1| calcium-dependent protein kinase 4 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48711.1| calcium-dependent protein kinase 4 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>gb|KHN00796.1| Calcium-dependent protein kinase SK5 [Glycine soja]
Length=491

 Score =   102 bits (254),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT++E+Q ACK+FGLG+  L+
Sbjct  335  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIEEIQQACKDFGLGNLHLD  390



>gb|EPS60285.1| hypothetical protein M569_14517 [Genlisea aurea]
Length=494

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKME+EENL+AAF++FDKDGSGYIT+DELQ ACK+FGL DA L+
Sbjct  383  DYGEFLAATLHMNKMEKEENLVAAFTFFDKDGSGYITIDELQQACKDFGLTDAHLD  438



>gb|EMT21316.1| Calcium-dependent protein kinase SK5 [Aegilops tauschii]
Length=572

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL HAC++FGL D  LE
Sbjct  464  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSHACRKFGLDDVHLE  519



>gb|ABY59011.1| calcium-dependent protein kinase [Triticum aestivum]
Length=562

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+GDA L
Sbjct  458  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITQDELQKACEEFGIGDAHL  512



>dbj|BAK04659.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score =   102 bits (254),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL HAC+EFGL D  LE
Sbjct  408  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSHACREFGLDDVHLE  463



>ref|XP_007143645.1| hypothetical protein PHAVU_007G089200g [Phaseolus vulgaris]
 gb|ESW15639.1| hypothetical protein PHAVU_007G089200g [Phaseolus vulgaris]
Length=491

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENLLAAFSYFDKDGSGYIT DELQ A K+FGLGD  L+
Sbjct  381  DYGEFLAATLHLNKMEREENLLAAFSYFDKDGSGYITFDELQQASKDFGLGDVPLD  436



>gb|EMT23123.1| Calcium-dependent protein kinase 2 [Aegilops tauschii]
Length=562

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+GDA L
Sbjct  458  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITQDELQKACEEFGIGDAHL  512



>gb|EAZ28845.1| hypothetical protein OsJ_12879 [Oryza sativa Japonica Group]
Length=599

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  491  DYGEFIAATLHMNKIEREDHLFAAFQYFDKDGSGYITADELQLACEEFGLGDVQLE  546



>dbj|BAG92869.1| unnamed protein product [Oryza sativa Japonica Group]
Length=600

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  491  DYGEFIAATLHMNKIEREDHLFAAFQYFDKDGSGYITADELQLACEEFGLGDVQLE  546



>ref|XP_006650702.1| PREDICTED: calcium-dependent protein kinase 1-like [Oryza brachyantha]
Length=606

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  498  DYGEFIAATLHMNKIEREDHLFAAFQYFDKDGSGYITADELQLACEEFGLGDVQLE  553



>gb|ABC59622.1| calcium-dependent protein kinase [Triticum aestivum]
Length=514

 Score =   102 bits (253),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL HAC++FGL D  LE
Sbjct  406  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSHACRQFGLDDVHLE  461



>ref|NP_001051503.1| Os03g0788500 [Oryza sativa Japonica Group]
 gb|AAT75244.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99256.1| Calcium-dependent protein kinase, isoform AK1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13417.1| Os03g0788500 [Oryza sativa Japonica Group]
 gb|EAY92115.1| hypothetical protein OsI_13822 [Oryza sativa Indica Group]
Length=599

 Score =   102 bits (255),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  491  DYGEFIAATLHMNKIEREDHLFAAFQYFDKDGSGYITADELQLACEEFGLGDVQLE  546



>ref|XP_010500048.1| PREDICTED: calcium-dependent protein kinase 11-like [Camelina 
sativa]
Length=495

 Score =   102 bits (253),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+AAFSYFDKDGSGYIT+DELQ AC EFGL +  L+
Sbjct  384  DYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCNTPLD  439



>ref|XP_008665565.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized threonine-rich 
GPI-anchored glycoprotein PJ4664.02-like [Zea mays]
Length=1841

 Score =   103 bits (258),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2     DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
             DYGEF+AATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  1734  DYGEFIAATLHLNKVEREDHLFAAFQYFDKDGSGYITADELQVACEEFGLGDVQLE  1789



>ref|XP_002518007.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF44525.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=187

 Score = 98.2 bits (243),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKDGSGYIT+DELQ ACKEFGL +  L+
Sbjct  76   DYGEFLAATVHLNKLEREENLVSAFSFFDKDGSGYITIDELQQACKEFGLSELHLD  131



>ref|XP_006434607.1| hypothetical protein CICLE_v10000931mg [Citrus clementina]
 ref|XP_006473190.1| PREDICTED: calcium-dependent protein kinase 11-like isoform X1 
[Citrus sinensis]
 gb|ESR47847.1| hypothetical protein CICLE_v10000931mg [Citrus clementina]
 gb|KDO83906.1| hypothetical protein CISIN_1g010806mg [Citrus sinensis]
Length=500

 Score =   102 bits (253),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            +YGEF+AATLH+NKMEREENL+AAFS+FD+DGSGYIT+DELQ ACKEFGLG+  L+
Sbjct  387  EYGEFIAATLHLNKMEREENLIAAFSFFDRDGSGYITIDELQQACKEFGLGEVPLD  442



>gb|AHG06447.1| calcium-dependent protein kinase 4.1 [Brassica napus]
Length=500

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVVAFSYFDKDGSGYITIDELQLACTEFGLCDTPLD  438



>ref|XP_004955504.1| PREDICTED: calcium-dependent protein kinase 1-like isoform X2 
[Setaria italica]
Length=573

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+GDA LE
Sbjct  469  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITYDELQTACEEFGIGDAHLE  524



>ref|XP_010256400.1| PREDICTED: calcium-dependent protein kinase SK5 [Nelumbo nucifera]
Length=492

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NKMEREENL+ AFS+FDKDGSGYIT+DELQ ACKEFGL D  L+
Sbjct  385  DYGEFLAATIHLNKMEREENLIKAFSFFDKDGSGYITIDELQQACKEFGLSDLHLD  440



>gb|KDO58737.1| hypothetical protein CISIN_1g014949mg [Citrus sinensis]
Length=379

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+EREENLL+AFS+FDKD SGYIT+DELQHACKEFG+ +  L+
Sbjct  307  DYGEFLAATLHLNKLEREENLLSAFSFFDKDASGYITIDELQHACKEFGISELHLD  362



>gb|AEY99977.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=500

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DY EF+AATLH+NKMEREENLLAAFSYFDKDGSGYIT+DELQ AC +FG GD +LE
Sbjct  389  DYSEFIAATLHLNKMEREENLLAAFSYFDKDGSGYITIDELQQACLDFGFGDTKLE  444



>gb|EMS47453.1| Calcium-dependent protein kinase SK5 [Triticum urartu]
Length=496

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL HAC++FGL D  LE
Sbjct  388  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSHACRKFGLDDVHLE  443



>ref|XP_010478955.1| PREDICTED: calcium-dependent protein kinase 11-like [Camelina 
sativa]
Length=495

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREE+L+AAFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  384  DYGEFLAATLHMNKMEREEHLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLD  439



>ref|XP_004955503.1| PREDICTED: calcium-dependent protein kinase 1-like isoform X1 
[Setaria italica]
Length=606

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+GDA LE
Sbjct  502  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITYDELQTACEEFGIGDAHLE  557



>ref|NP_001105109.1| LOC541988 [Zea mays]
 emb|CAA07481.1| calcium-dependent protein kinase [Zea mays]
Length=639

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  511  DYGEFIAATLHLNKVEREDHLFAAFQYFDKDGSGYITADELQVACEEFGLGDVQLE  566



>dbj|BAK02486.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFS28892.1| calcium dependent protein kinase 12 [Hordeum vulgare]
Length=516

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL HAC+EFGL D  LE
Sbjct  408  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSHACREFGLDDVHLE  463



>gb|EEE66603.1| hypothetical protein OsJ_23173 [Oryza sativa Japonica Group]
Length=676

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+ERE+NL AAFSYFDKD SGYIT DELQ AC+EFG+GDA LE
Sbjct  572  DYGEFIAATMHLNKVEREDNLFAAFSYFDKDSSGYITQDELQKACEEFGIGDAHLE  627



>gb|KHN17081.1| Calcium-dependent protein kinase SK5 [Glycine soja]
Length=438

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT++E+Q ACK+FGLG+  L+
Sbjct  335  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIEEIQQACKDFGLGNMHLD  390



>gb|ABW97697.2| calcium-dependent protein kinase [Hordeum vulgare]
Length=516

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL HAC+EFGL D  LE
Sbjct  408  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSHACREFGLDDVHLE  463



>gb|KFK35647.1| hypothetical protein AALP_AA4G017800 [Arabis alpina]
Length=501

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREENL+ AFSYFDKDGSGYIT+D+LQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREENLVVAFSYFDKDGSGYITIDDLQQACTEFGLCDTPLD  438



>ref|XP_010421853.1| PREDICTED: calcium-dependent protein kinase 4-like [Camelina 
sativa]
Length=501

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D+ L+
Sbjct  383  DYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDSPLD  438



>ref|NP_192695.1| calcium-dependent protein kinase 4 [Arabidopsis thaliana]
 sp|Q38869.1|CDPK4_ARATH RecName: Full=Calcium-dependent protein kinase 4; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 4 [Arabidopsis 
thaliana]
 gb|AAB03243.1| calmodulin-domain protein kinase CDPK isoform 4, partial [Arabidopsis 
thaliana]
 emb|CAB78080.1| calmodulin-domain protein kinase CDPK isoform 4 (CPK4) [Arabidopsis 
thaliana]
 emb|CAB82124.1| calmodulin-domain protein kinase CDPK isoform 4 (CPK4) [Arabidopsis 
thaliana]
 gb|AEE82766.1| calcium-dependent protein kinase 4 [Arabidopsis thaliana]
Length=501

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>gb|KDO58736.1| hypothetical protein CISIN_1g014949mg [Citrus sinensis]
Length=415

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+EREENLL+AFS+FDKD SGYIT+DELQHACKEFG+ +  L+
Sbjct  307  DYGEFLAATLHLNKLEREENLLSAFSFFDKDASGYITIDELQHACKEFGISELHLD  362



>dbj|BAI94529.1| calcium dependent protein kinase [Ananas comosus]
Length=420

 Score =   100 bits (248),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+HMNK+EREENL +AFSYFDKDGSGYIT+DEL  AC+EFGL D  LE
Sbjct  238  DYGEFLAATVHMNKLEREENLHSAFSYFDKDGSGYITIDELSQACREFGLTDVHLE  293



>tpg|DAA51810.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=608

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  501  DYGEFIAATLHLNKVEREDHLFAAFQYFDKDGSGYITADELQVACEEFGLGDVQLE  556



>ref|XP_010455345.1| PREDICTED: calcium-dependent protein kinase 4 [Camelina sativa]
Length=501

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>ref|XP_006287576.1| hypothetical protein CARUB_v10000785mg [Capsella rubella]
 gb|EOA20474.1| hypothetical protein CARUB_v10000785mg [Capsella rubella]
Length=501

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>ref|XP_002466330.1| hypothetical protein SORBIDRAFT_01g005780 [Sorghum bicolor]
 gb|EER93328.1| hypothetical protein SORBIDRAFT_01g005780 [Sorghum bicolor]
Length=617

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD +LE
Sbjct  511  DYGEFLAATLHLNKVEREDHLFAAFQYFDKDGSGYITADELQVACEEFGLGDVKLE  566



>ref|XP_010438320.1| PREDICTED: calcium-dependent protein kinase 4-like [Camelina 
sativa]
Length=501

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>ref|XP_006426412.1| hypothetical protein CICLE_v10025418mg [Citrus clementina]
 gb|ESR39652.1| hypothetical protein CICLE_v10025418mg [Citrus clementina]
Length=469

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+EREENLL+AFS+FDKD SGYIT+DELQHACKEFG+ +  L+
Sbjct  397  DYGEFLAATLHLNKLEREENLLSAFSFFDKDASGYITIDELQHACKEFGISELHLD  452



>ref|XP_006426413.1| hypothetical protein CICLE_v10025418mg [Citrus clementina]
 gb|ESR39653.1| hypothetical protein CICLE_v10025418mg [Citrus clementina]
Length=476

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+EREENLL+AFS+FDKD SGYIT+DELQHACKEFG+ +  L+
Sbjct  397  DYGEFLAATLHLNKLEREENLLSAFSFFDKDASGYITIDELQHACKEFGISELHLD  452



>ref|XP_006846993.1| hypothetical protein AMTR_s00017p00128950 [Amborella trichopoda]
 gb|ERN08574.1| hypothetical protein AMTR_s00017p00128950 [Amborella trichopoda]
Length=491

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NKMEREENL +AFSYFDKDGSGYIT+DELQ AC+EFGL D  L+
Sbjct  384  DYGEFLAATMHLNKMEREENLASAFSYFDKDGSGYITIDELQQACREFGLSDFHLD  439



>ref|XP_007143646.1| hypothetical protein PHAVU_007G089300g [Phaseolus vulgaris]
 gb|ESW15640.1| hypothetical protein PHAVU_007G089300g [Phaseolus vulgaris]
Length=558

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAFSYFD+DGSGYIT+DELQ AC +FGLG   L+
Sbjct  451  DYGEFLAATLHLNKMEREENLVAAFSYFDRDGSGYITIDELQQACNDFGLGVLHLD  506



>tpg|DAA42603.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=685

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+ DA LE
Sbjct  581  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITHDELQKACEEFGIEDAHLE  636



>ref|XP_004503020.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cicer arietinum]
Length=499

 Score =   100 bits (249),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKDGSGYIT+DE+Q ACKEFGL D  ++
Sbjct  391  DYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITIDEIQEACKEFGLDDVHID  446



>gb|KHG16833.1| Calcium-dependent protein kinase SK5 [Gossypium arboreum]
Length=497

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL+ AFS+FDKDGSGYIT+DELQ ACKEFGL D  L+
Sbjct  383  DYGEFLAATVHLNKLEREENLVGAFSFFDKDGSGYITIDELQQACKEFGLSDVHLD  438



>ref|XP_010094966.1| Calcium-dependent protein kinase 11 [Morus notabilis]
 gb|EXB57725.1| Calcium-dependent protein kinase 11 [Morus notabilis]
Length=501

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ REENL+AAFS+FDKDGSGYIT+DE Q ACKEFGLGD  L+
Sbjct  392  DYGEFLAATLHLNKLVREENLIAAFSFFDKDGSGYITIDEFQDACKEFGLGDVHLD  447



>ref|XP_006589459.1| PREDICTED: calcium-dependent protein kinase 4-like [Glycine max]
Length=492

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NKMEREENL+AAF+YFDKDGSGYIT+DELQ ACK+F LG   L+
Sbjct  381  DYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFSLGHVHLD  436



>gb|EMS58448.1| Calcium-dependent protein kinase 2 [Triticum urartu]
Length=516

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+GDA L
Sbjct  412  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITQDELQKACEEFGIGDAHL  466



>ref|XP_006340028.1| PREDICTED: calcium-dependent protein kinase SK5-like [Solanum 
tuberosum]
Length=510

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK EREENL++AFS+FDKDGSGYIT+DELQHACKEFGL +  L+
Sbjct  400  DYGEFLAATVHLNKFEREENLVSAFSFFDKDGSGYITIDELQHACKEFGLSELNLD  455



>ref|XP_004249931.1| PREDICTED: calcium-dependent protein kinase 1 [Solanum lycopersicum]
Length=578

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ER+++L AAFSYFDKDGSGYIT DELQHAC+EFG+GD ++E
Sbjct  472  DYGEFIAATLHLNKIERDDHLFAAFSYFDKDGSGYITADELQHACEEFGIGDVRME  527



>ref|XP_008670974.1| PREDICTED: calcium-dependent protein kinase 26-like isoform X2 
[Zea mays]
Length=581

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+ DA LE
Sbjct  477  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITHDELQKACEEFGIEDAHLE  532



>ref|XP_011074932.1| PREDICTED: calcium-dependent protein kinase 11 [Sesamum indicum]
Length=495

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREENL AAFS+FDKDGSGYIT+DELQ ACK+FG+ +A L+
Sbjct  385  DYGEFLAATLHMNKIEREENLAAAFSFFDKDGSGYITIDELQQACKDFGIAEAHLD  440



>ref|XP_004237548.1| PREDICTED: calcium-dependent protein kinase SK5 [Solanum lycopersicum]
Length=508

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK EREENL++AFS+FDKDGSGYIT+DELQHACKEFGL +  L+
Sbjct  397  DYGEFLAATVHLNKFEREENLVSAFSFFDKDGSGYITIDELQHACKEFGLSELNLD  452



>ref|XP_009379843.1| PREDICTED: calcium-dependent protein kinase SK5-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREENL++AFS+FDKDGSGYITVDEL  AC+EFGL D  L+
Sbjct  388  DYGEFLAATLHMNKLEREENLVSAFSFFDKDGSGYITVDELSQACREFGLDDVHLD  443



>ref|XP_006350933.1| PREDICTED: calcium-dependent protein kinase 1-like [Solanum tuberosum]
Length=578

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ER+++L AAFSYFDKDGSGYIT DELQHAC+EFG+GD ++E
Sbjct  472  DYGEFIAATLHLNKIERDDHLFAAFSYFDKDGSGYITADELQHACEEFGIGDVRME  527



>gb|AIK28476.1| chloroplast calcium-dependent protein kinase 7 [Solanum tuberosum]
Length=578

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ER+++L AAFSYFDKDGSGYIT DELQHAC+EFG+GD ++E
Sbjct  472  DYGEFIAATLHLNKIERDDHLFAAFSYFDKDGSGYITADELQHACEEFGIGDVRME  527



>pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent 
Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ 
And The Junction Domain (Jd)
Length=188

 Score = 96.7 bits (239),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  64   DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDIHID  119



>ref|XP_003523190.1| PREDICTED: calcium-dependent protein kinase SK5-like [Glycine 
max]
 gb|KHN31226.1| Calcium-dependent protein kinase SK5 [Glycine soja]
Length=496

 Score =   100 bits (248),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACKEFGL D  ++
Sbjct  388  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITIDEIQQACKEFGLDDVHID  443



>gb|ABC59621.1| calcium-dependent protein kinase [Triticum aestivum]
Length=513

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL HAC++FGL D  LE
Sbjct  405  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSHACRKFGLDDVHLE  460



>ref|XP_006426411.1| hypothetical protein CICLE_v10025418mg [Citrus clementina]
 ref|XP_006466209.1| PREDICTED: calcium-dependent protein kinase SK5-like [Citrus 
sinensis]
 gb|ESR39651.1| hypothetical protein CICLE_v10025418mg [Citrus clementina]
Length=505

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+EREENLL+AFS+FDKD SGYIT+DELQHACKEFG+ +  L+
Sbjct  397  DYGEFLAATLHLNKLEREENLLSAFSFFDKDASGYITIDELQHACKEFGISELHLD  452



>gb|ACN27823.1| unknown [Zea mays]
 gb|AFW67417.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=620

 Score =   100 bits (250),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD QLE
Sbjct  513  DYGEFIAATLHLNKVEREDHLFAAFQYFDKDGSGYITADELQVACEEFGLGDVQLE  568



>emb|CDP19676.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKDGSGYIT+DELQ ACKEFGL +  L+
Sbjct  238  DYGEFLAATVHLNKLEREENLVSAFSFFDKDGSGYITIDELQQACKEFGLSELHLD  293



>ref|XP_007048647.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao]
 ref|XP_007048648.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao]
 gb|EOX92804.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao]
 gb|EOX92805.1| Calcium-dependent protein kinase 2 isoform 1 [Theobroma cacao]
Length=494

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AF++FDKDGSGYIT+DELQ ACKEFGL D  L+
Sbjct  383  DYGEFLAATVHLNKLEREENLVSAFAFFDKDGSGYITIDELQQACKEFGLSDVHLD  438



>gb|AHG06448.1| calcium-dependent protein kinase 4.2 [Brassica napus]
Length=500

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREE L+ AFSYFDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  383  DYGEFLAATLHMNKMEREEILVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLD  438



>ref|NP_001066266.1| Os12g0169800 [Oryza sativa Japonica Group]
 gb|ABA95933.1| Calcium-dependent protein kinase, isoform AK1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29285.1| Os12g0169800 [Oryza sativa Japonica Group]
Length=526

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREENL++AF++FDKDGSG+IT+DEL  AC++FGL D  LE
Sbjct  407  DYGEFLAATLHMNKLEREENLVSAFTFFDKDGSGFITIDELSQACEQFGLSDVHLE  462



>ref|NP_001058943.1| Os07g0161600 [Oryza sativa Japonica Group]
 dbj|BAC79646.1| putative calcium-dependent protein kinase 2 [Oryza sativa Japonica 
Group]
 dbj|BAF20857.1| Os07g0161600 [Oryza sativa Japonica Group]
 gb|EAZ02855.1| hypothetical protein OsI_24986 [Oryza sativa Indica Group]
Length=568

 Score =   100 bits (248),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+ERE+NL AAFSYFDKD SGYIT DELQ AC+EFG+GDA LE
Sbjct  464  DYGEFIAATMHLNKVEREDNLFAAFSYFDKDSSGYITQDELQKACEEFGIGDAHLE  519



>ref|XP_009406103.1| PREDICTED: calcium-dependent protein kinase SK5-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=492

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+HMNK+EREENL +AFSYFDKDGSGYIT+DEL  AC+EFGL D +L+
Sbjct  385  DYGEFLAATVHMNKLEREENLASAFSYFDKDGSGYITIDELSQACREFGLDDVRLD  440



>ref|XP_009406102.1| PREDICTED: calcium-dependent protein kinase SK5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=496

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+HMNK+EREENL +AFSYFDKDGSGYIT+DEL  AC+EFGL D +L+
Sbjct  389  DYGEFLAATVHMNKLEREENLASAFSYFDKDGSGYITIDELSQACREFGLDDVRLD  444



>gb|AES72952.2| CDPK-related kinase [Medicago truncatula]
Length=498

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKDGSGYIT+DE+Q ACKEFGL D  ++
Sbjct  390  DYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITIDEIQAACKEFGLDDVHID  445



>ref|XP_004981497.1| PREDICTED: calcium-dependent protein kinase 1-like [Setaria italica]
Length=614

 Score =   100 bits (248),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC+EFGLGD +LE
Sbjct  507  DYGEFIAATLHLNKVEREDHLFAAFQYFDKDGSGYITADELQLACEEFGLGDVKLE  562



>ref|XP_009357911.1| PREDICTED: calcium-dependent protein kinase SK5-like [Pyrus x 
bretschneideri]
 ref|XP_009357919.1| PREDICTED: calcium-dependent protein kinase SK5-like [Pyrus x 
bretschneideri]
Length=502

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENLL+AFS+FDKDGSG+IT+DEL  ACKEFGLG+  LE
Sbjct  389  DYGEFLAATVHLNKLEREENLLSAFSFFDKDGSGFITIDELSQACKEFGLGELHLE  444



>ref|XP_004147335.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cucumis 
sativus]
 ref|XP_004163390.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cucumis 
sativus]
 gb|KGN62225.1| hypothetical protein Csa_2G336720 [Cucumis sativus]
Length=503

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENLL+AFSYFDKDGSG+IT+DELQ ACKEFGL +  L+
Sbjct  388  DYGEFLAATIHLNKLEREENLLSAFSYFDKDGSGFITIDELQLACKEFGLSELHLD  443



>gb|KGN52164.1| hypothetical protein Csa_5G612930 [Cucumis sativus]
Length=181

 Score = 95.5 bits (236),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E++LLAAFSYFDKDGSG+IT DELQ ACKEFG+ D QLE
Sbjct  76   DYGEFVAATLHLNKIEKEDHLLAAFSYFDKDGSGFITHDELQQACKEFGIEDLQLE  131



>emb|CBI27695.3| unnamed protein product [Vitis vinifera]
Length=347

 Score = 97.8 bits (242),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKD SGYIT+DELQ ACKEFGL +A L+
Sbjct  238  DYGEFLAATVHLNKLEREENLVSAFSFFDKDKSGYITIDELQQACKEFGLSEAHLD  293



>ref|XP_010096406.1| Calcium-dependent protein kinase SK5 [Morus notabilis]
 gb|EXB64077.1| Calcium-dependent protein kinase SK5 [Morus notabilis]
Length=508

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENLL+AFS+FDKDGSG+IT+DELQ AC+EFGL D  L+
Sbjct  396  DYGEFLAATVHLNKLEREENLLSAFSFFDKDGSGFITIDELQQACREFGLNDVHLD  451



>ref|XP_007215266.1| hypothetical protein PRUPE_ppa004580mg [Prunus persica]
 gb|EMJ16465.1| hypothetical protein PRUPE_ppa004580mg [Prunus persica]
Length=502

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENLL+AFS+FDKDGSG+IT+DEL+ AC+EFGLG+  LE
Sbjct  388  DYGEFLAATVHLNKLEREENLLSAFSFFDKDGSGFITIDELRQACREFGLGELHLE  443



>ref|XP_009625599.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009625600.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009625601.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
tomentosiformis]
Length=577

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ER+++L AAFSYFDKDGSGYIT DELQ AC+EFG+GD ++E
Sbjct  471  DYGEFIAATLHMNKIERQDHLFAAFSYFDKDGSGYITADELQQACEEFGIGDVRME  526



>gb|AAK38161.1| calcium-dependent protein kinase [Psophocarpus tetragonolobus]
Length=347

 Score = 97.8 bits (242),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  276  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDVHID  331



>ref|XP_003602701.1| Calcium-dependent protein kinase [Medicago truncatula]
Length=547

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKDGSGYIT+DE+Q ACKEFGL D  ++
Sbjct  439  DYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITIDEIQAACKEFGLDDVHID  494



>ref|XP_010908659.1| PREDICTED: calcium-dependent protein kinase 1-like isoform X1 
[Elaeis guineensis]
Length=586

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+ L AAFSYFDKDGSGYIT DELQ AC+EFG+GD  LE
Sbjct  481  DYGEFLAATLHLNKIEREDKLFAAFSYFDKDGSGYITQDELQKACEEFGIGDVHLE  536



>gb|EEE52836.1| hypothetical protein OsJ_35367 [Oryza sativa Japonica Group]
Length=502

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREENL++AF++FDKDGSG+IT+DEL  AC++FGL D  LE
Sbjct  383  DYGEFLAATLHMNKLEREENLVSAFTFFDKDGSGFITIDELSQACEQFGLSDVHLE  438



>ref|XP_002450385.1| hypothetical protein SORBIDRAFT_05g004610 [Sorghum bicolor]
 gb|EES09373.1| hypothetical protein SORBIDRAFT_05g004610 [Sorghum bicolor]
Length=515

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC+EFGL D  LE
Sbjct  407  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDVHLE  462



>ref|XP_004978823.1| PREDICTED: calcium-dependent protein kinase SK5-like [Setaria 
italica]
Length=211

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+ DKDGSG+IT+DEL  AC+EFGL D  LE
Sbjct  68   DYGEFIAATLHMNKLEREENLVSAFSFSDKDGSGFITIDELSQACREFGLDDVHLE  123



>ref|XP_011083330.1| PREDICTED: calcium-dependent protein kinase SK5, partial [Sesamum 
indicum]
Length=442

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKDGSGYIT+DELQ ACKEFGL +  L+
Sbjct  331  DYGEFLAATVHLNKLEREENLVSAFSFFDKDGSGYITIDELQQACKEFGLSELHLD  386



>ref|XP_004503860.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cicer arietinum]
Length=497

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  388  DYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITIDEIQQACKDFGLDDIHID  443



>ref|XP_009416913.1| PREDICTED: calcium-dependent protein kinase SK5-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFSYFDKDGSGYIT+DEL  AC+EFGL D  L+
Sbjct  388  DYGEFLAATVHINKLEREENLISAFSYFDKDGSGYITIDELSQACREFGLDDVHLD  443



>ref|XP_009764211.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
sylvestris]
 emb|CAC82998.1| calcium-dependent protein kinase 2 [Nicotiana tabacum]
Length=581

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+GD  LE
Sbjct  475  DYGEFIAATLHFNKIEREDHLFAAFSYFDKDGSGYITADELQQACEEFGIGDVHLE  530



>ref|XP_009615662.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
tomentosiformis]
Length=581

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+GD  LE
Sbjct  475  DYGEFIAATLHFNKIEREDHLFAAFSYFDKDGSGYITADELQQACEEFGIGDVHLE  530



>ref|XP_008228139.1| PREDICTED: calcium-dependent protein kinase SK5-like [Prunus 
mume]
Length=502

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENLL+AFS+FDKDGSG+IT+DEL+ AC+EFGLG+  LE
Sbjct  388  DYGEFLAATVHLNKLEREENLLSAFSFFDKDGSGFITIDELRQACREFGLGELHLE  443



>ref|XP_010658918.1| PREDICTED: calcium-dependent protein kinase 1 isoform X2 [Vitis 
vinifera]
Length=341

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFGL D +LE
Sbjct  237  DYGEFIAATLHLNKVEREDHLFAAFSYFDKDGSGYITPDELQQACEEFGLEDVRLE  292



>ref|XP_003526904.1| PREDICTED: calcium-dependent protein kinase SK5-like [Glycine 
max]
 gb|KHN09683.1| Calcium-dependent protein kinase SK5 [Glycine soja]
Length=497

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  389  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITIDEIQQACKDFGLDDVHID  444



>ref|XP_008798696.1| PREDICTED: calcium-dependent protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008798697.1| PREDICTED: calcium-dependent protein kinase 1-like [Phoenix dactylifera]
Length=585

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+ D +LE
Sbjct  480  DYGEFIAATLHMNKIEREDHLFAAFSYFDKDGSGYITQDELQQACEEFGIEDVRLE  535



>ref|XP_009798725.1| PREDICTED: calcium-dependent protein kinase SK5-like [Nicotiana 
sylvestris]
Length=496

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKDGSGYIT++ELQ ACKEFGL +  L+
Sbjct  386  DYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITIEELQQACKEFGLSELNLD  441



>ref|XP_009603424.1| PREDICTED: calcium-dependent protein kinase SK5-like [Nicotiana 
tomentosiformis]
 dbj|BAB63464.1| calcium dependent protein kinase [Solanum tuberosum]
Length=496

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKDGSGYIT++ELQ ACKEFGL +  L+
Sbjct  386  DYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITIEELQQACKEFGLSELNLD  441



>ref|XP_010228367.1| PREDICTED: calcium-dependent protein kinase 26-like [Brachypodium 
distachyon]
 ref|XP_010228368.1| PREDICTED: calcium-dependent protein kinase 26-like [Brachypodium 
distachyon]
Length=567

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DEL+ AC+EFG+GDA L
Sbjct  463  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITQDELEKACEEFGIGDAHL  517



>ref|XP_002310978.1| calcium-dependent protein kinase 2 [Populus trichocarpa]
 gb|EEE88345.1| calcium-dependent protein kinase 2 [Populus trichocarpa]
Length=579

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ER+++L AAFSYFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  474  DYGEFIAATLHLNKIERQDHLFAAFSYFDKDGSGYITPDELQQACEEFGIGDVRLE  529



>ref|XP_006658294.1| PREDICTED: calcium-dependent protein kinase 1-like, partial [Oryza 
brachyantha]
Length=518

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+ERE+NL AAFSYFDKD SGYIT DELQ AC+EFG+GDA LE
Sbjct  414  DYGEFIAATMHLNKVEREDNLFAAFSYFDKDSSGYITQDELQKACEEFGIGDAHLE  469



>ref|XP_008460850.1| PREDICTED: calcium-dependent protein kinase SK5 [Cucumis melo]
 ref|XP_008460851.1| PREDICTED: calcium-dependent protein kinase SK5 [Cucumis melo]
Length=503

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENLL+AFSYFDKDGSG+IT+DELQ ACKEFGL +  L+
Sbjct  388  DYGEFLAATIHLNKLEREENLLSAFSYFDKDGSGFITIDELQLACKEFGLSELHLD  443



>tpg|DAA39028.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=473

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC+EFGL D  LE
Sbjct  402  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLE  457



>ref|XP_008665566.1| PREDICTED: calcium-dependent protein kinase 26-like [Zea mays]
 tpg|DAA51814.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=580

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E+ L AAFSYFDKDGSGYIT DELQ AC+EFGLGD +LE
Sbjct  475  DYGEFIAATLHINKVEKEDKLFAAFSYFDKDGSGYITQDELQKACEEFGLGDTRLE  530



>emb|CBI40890.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFGL D +LE
Sbjct  238  DYGEFIAATLHLNKVEREDHLFAAFSYFDKDGSGYITPDELQQACEEFGLEDVRLE  293



>gb|KFK27666.1| calcium-dependent protein kinase [Arabis alpina]
Length=486

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL+AAFS+FDKD SGYIT+DELQHA KEFG+ D+ L+
Sbjct  380  DYGEFLAATIHLNKLEREENLVAAFSFFDKDSSGYITIDELQHAWKEFGINDSHLD  435



>ref|XP_008781518.1| PREDICTED: calcium-dependent protein kinase SK5-like [Phoenix 
dactylifera]
Length=496

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+HMNK+EREENL++AFS+FDKDGSGYIT+DEL  AC+EFGL D  L+
Sbjct  389  DYGEFLAATVHMNKLEREENLISAFSFFDKDGSGYITIDELSQACQEFGLDDVHLD  444



>ref|XP_008775130.1| PREDICTED: calcium-dependent protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008775131.1| PREDICTED: calcium-dependent protein kinase 1-like [Phoenix dactylifera]
Length=585

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE+ L AAFSYFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  480  DYGEFIAATLHLNKIEREDKLFAAFSYFDKDGSGYITQDELQKACEEFGIGDVRLE  535



>ref|XP_009336723.1| PREDICTED: calcium-dependent protein kinase SK5-like [Pyrus x 
bretschneideri]
Length=498

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENLL+AFS+FDKDGSG+IT+DEL  AC+EFGLG+  LE
Sbjct  389  DYGEFLAATVHLNKLEREENLLSAFSFFDKDGSGFITIDELSQACREFGLGELHLE  444



>ref|XP_006588885.1| PREDICTED: calcium-dependent protein kinase 1-like [Glycine max]
 gb|KHN37758.1| Calcium-dependent protein kinase 2 [Glycine soja]
Length=592

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L+AAF+YFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  485  DYGEFIAATLHLNKVEREDHLVAAFAYFDKDGSGYITQDELQQACEEFGIGDVRLE  540



>ref|XP_009397608.1| PREDICTED: calcium-dependent protein kinase 26-like [Musa acuminata 
subsp. malaccensis]
Length=542

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREE+L+AAFSYFDKDGSGYITVDELQ ACKE  + DA LE
Sbjct  437  DYGEFIAATVHLNKLEREEHLVAAFSYFDKDGSGYITVDELQQACKEHNMTDASLE  492



>ref|NP_001234784.1| calcium dependent protein kinase [Solanum lycopersicum]
 dbj|BAJ12071.1| calcium dependent protein kinase [Solanum lycopersicum]
Length=581

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+GD  LE
Sbjct  475  DYGEFIAATLHFNKIEREDHLFAAFSYFDKDGSGYITADELQQACEEFGIGDVHLE  530



>ref|XP_007145769.1| hypothetical protein PHAVU_007G266100g [Phaseolus vulgaris]
 gb|ESW17763.1| hypothetical protein PHAVU_007G266100g [Phaseolus vulgaris]
Length=582

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L+AAF+YFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  475  DYGEFIAATLHLNKIEREDHLVAAFAYFDKDGSGYITQDELQKACEEFGIGDVRLE  530



>gb|AGG35965.1| calcium-dependent protein kinase 12 [Brassica napus]
 emb|CDY16860.1| BnaA09g05220D [Brassica napus]
Length=486

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL+AAFS+FDKDGSGYITVDELQ A KEFG+ D+ L+
Sbjct  380  DYGEFLAATIHLNKLEREENLVAAFSFFDKDGSGYITVDELQQALKEFGINDSHLD  435



>ref|XP_010938933.1| PREDICTED: calcium-dependent protein kinase 1-like [Elaeis guineensis]
Length=582

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+ D QLE
Sbjct  477  DYGEFVAATLHLNKIEREDHLFAAFSYFDKDGSGYITQDELQQACEEFGIQDVQLE  532



>ref|NP_001105752.1| calcium-dependent protein kinase ZmCPK11 [Zea mays]
 ref|XP_008668654.1| PREDICTED: calcium-dependent protein kinase ZmCPK11 isoform X1 
[Zea mays]
 ref|XP_008668655.1| PREDICTED: calcium-dependent protein kinase ZmCPK11 isoform X1 
[Zea mays]
 gb|AAP57564.2| calcium-dependent protein kinase ZmCPK11 [Zea mays]
 gb|ACF85157.1| unknown [Zea mays]
 gb|ACF87735.1| unknown [Zea mays]
 gb|ACL52808.1| unknown [Zea mays]
 tpg|DAA39025.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA39026.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
 tpg|DAA39027.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 3 [Zea mays]
Length=510

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC+EFGL D  LE
Sbjct  402  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLE  457



>ref|XP_009141613.1| PREDICTED: calcium-dependent protein kinase 12-like [Brassica 
rapa]
Length=486

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL+AAFS+FDKDGSGYITVDELQ A KEFG+ D+ L+
Sbjct  380  DYGEFLAATIHLNKLEREENLVAAFSFFDKDGSGYITVDELQQALKEFGINDSHLD  435



>ref|XP_002461493.1| hypothetical protein SORBIDRAFT_02g003500 [Sorghum bicolor]
 gb|EER98014.1| hypothetical protein SORBIDRAFT_02g003500 [Sorghum bicolor]
Length=581

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKD SGYIT DELQ AC+EFG+ DA LE
Sbjct  477  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDSSGYITHDELQKACEEFGIEDAHLE  532



>tpg|DAA39024.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=533

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC+EFGL D  LE
Sbjct  425  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLE  480



>gb|KDP24209.1| hypothetical protein JCGZ_25866 [Jatropha curcas]
Length=518

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKDGSGYIT+DELQ ACKEFGL +  L+
Sbjct  407  DYGEFLAATVHLNKLEREENLVSAFSFFDKDGSGYITIDELQQACKEFGLSELHLD  462



>ref|NP_001065864.1| Os11g0171500 [Oryza sativa Japonica Group]
 gb|AAX95085.1| Protein kinase domain, putative [Oryza sativa Japonica Group]
 gb|ABA91635.1| Calcium-dependent protein kinase, isoform AK1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27709.1| Os11g0171500 [Oryza sativa Japonica Group]
 gb|EAY80107.1| hypothetical protein OsI_35279 [Oryza sativa Indica Group]
 gb|EAZ17585.1| hypothetical protein OsJ_33123 [Oryza sativa Japonica Group]
Length=513

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC+EFGL D  LE
Sbjct  405  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLE  460



>ref|XP_008670973.1| PREDICTED: calcium-dependent protein kinase 26-like isoform X1 
[Zea mays]
Length=597

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+ERE+NL AAFSYFDKDGSGYIT DELQ AC+EFG+ DA LE
Sbjct  493  DYGEFLAATLHLNKVEREDNLFAAFSYFDKDGSGYITHDELQKACEEFGIEDAHLE  548



>ref|NP_001275230.1| calcium-dependent protein kinase 1-like [Solanum tuberosum]
 dbj|BAN57323.1| calcium-dependent protein kinase [Solanum tuberosum]
Length=581

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+GD  LE
Sbjct  475  DYGEFIAATLHFNKIEREDHLFAAFSYFDKDGSGYITADELQQACEEFGIGDVHLE  530



>gb|AAN41657.1| OsCDPK protein [Oryza sativa Japonica Group]
Length=513

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC+EFGL D  LE
Sbjct  405  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLE  460



>ref|XP_003577783.1| PREDICTED: calcium-dependent protein kinase SK5-like [Brachypodium 
distachyon]
Length=518

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC EFGL D  LE
Sbjct  410  DYGEFLAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACHEFGLDDVHLE  465



>emb|CDX87164.1| BnaC09g04790D [Brassica napus]
Length=485

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQL  166
            DYGEFLAAT+H+NK+EREENL+AAFS+FDKDGSGYITVDELQ A KEFG+ D+ L
Sbjct  380  DYGEFLAATIHLNKLEREENLVAAFSFFDKDGSGYITVDELQQALKEFGINDSHL  434



>ref|XP_010653043.1| PREDICTED: calcium-dependent protein kinase SK5 [Vitis vinifera]
 gb|AAR28766.1| calcium-dependent protein kinase [Vitis labrusca x Vitis vinifera]
 emb|CAN70726.1| hypothetical protein VITISV_011381 [Vitis vinifera]
Length=497

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKD SGYIT+DELQ ACKEFGL +A L+
Sbjct  388  DYGEFLAATVHLNKLEREENLVSAFSFFDKDKSGYITIDELQQACKEFGLSEAHLD  443



>gb|ABK79680.2| calcium-dependent protein kinase 2 [Rubia cordifolia]
Length=515

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKDGSGYIT+DELQ ACK+FGL +  L+
Sbjct  401  DYGEFLAATVHLNKLEREENLVSAFSFFDKDGSGYITIDELQQACKDFGLSELHLD  456



>ref|XP_010930818.1| PREDICTED: calcium-dependent protein kinase SK5-like isoform 
X1 [Elaeis guineensis]
Length=496

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+HMNK+EREENL++AFS+FDKDGSGYIT+DEL  AC++FGL D  L+
Sbjct  389  DYGEFLAATVHMNKLEREENLISAFSFFDKDGSGYITIDELSQACRQFGLDDVHLD  444



>gb|EPS73126.1| calcium-dependent protein kinase 2 [Genlisea aurea]
Length=559

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E++L AAFSYFDKDGSGYIT DELQ AC+EFGL D++LE
Sbjct  461  DYGEFIAATLHLNKVEKEDHLFAAFSYFDKDGSGYITPDELQQACQEFGLDDSRLE  516



>gb|AFN06795.1| calcium-dependent protein kinase, partial [Vitis amurensis]
Length=497

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKD SGYIT+DELQ ACKEFGL +A L+
Sbjct  388  DYGEFLAATVHLNKLEREENLVSAFSFFDKDKSGYITIDELQQACKEFGLSEAHLD  443



>ref|XP_004497629.1| PREDICTED: calcium-dependent protein kinase 1-like [Cicer arietinum]
Length=581

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK++RE++L+AAF+YFDKDGSGYIT DELQ AC+EFGLGD  LE
Sbjct  474  DYGEFIAATLHLNKVDREDHLVAAFAYFDKDGSGYITQDELQKACEEFGLGDVPLE  529



>ref|XP_007159928.1| hypothetical protein PHAVU_002G279300g [Phaseolus vulgaris]
 gb|ESW31922.1| hypothetical protein PHAVU_002G279300g [Phaseolus vulgaris]
Length=505

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  389  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDVHID  444



>ref|XP_006664374.1| PREDICTED: calcium-dependent protein kinase SK5-like [Oryza brachyantha]
Length=483

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC++FG+ D  LE
Sbjct  375  DYGEFLAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACEQFGISDVHLE  430



>ref|XP_004981494.1| PREDICTED: calcium-dependent protein kinase 1-like [Setaria italica]
Length=582

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E+ L AAFSYFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  477  DYGEFIAATLHINKVEKEDKLFAAFSYFDKDGSGYITQDELQKACEEFGIGDTRLE  532



>ref|XP_008644440.1| PREDICTED: calcium-dependent protein kinase 26-like [Zea mays]
 gb|AFW67406.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=584

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E+ L AAFSYFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  479  DYGEFIAATLHINKVEKEDKLFAAFSYFDKDGSGYITQDELQKACEEFGIGDTRLE  534



>ref|XP_004239626.1| PREDICTED: calcium-dependent protein kinase SK5-like [Solanum 
lycopersicum]
Length=503

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFS+FDKDGSGYIT++ELQ ACKEFGL +  L+
Sbjct  393  DYGEFIAATVHLNKLEREENLLSAFSFFDKDGSGYITIEELQQACKEFGLSELNLD  448



>ref|NP_001241962.1| calcium-dependent protein kinase SK5-like [Glycine max]
 gb|AAP03012.1| seed calcium dependent protein kinase a [Glycine max]
Length=507

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  391  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDVHID  446



>gb|KHN17436.1| Calcium-dependent protein kinase SK5 [Glycine soja]
Length=507

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  391  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDVHID  446



>ref|XP_006345749.1| PREDICTED: calcium-dependent protein kinase SK5-like [Solanum 
tuberosum]
Length=503

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFS+FDKDGSGYIT++ELQ ACKEFGL +  L+
Sbjct  393  DYGEFIAATVHLNKLEREENLLSAFSFFDKDGSGYITIEELQQACKEFGLSELNLD  448



>ref|XP_008679628.1| PREDICTED: calcium-dependent protein kinase 11 [Zea mays]
 gb|AFW65384.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=508

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC EFGL D  LE
Sbjct  400  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACHEFGLDDVHLE  455



>ref|XP_009757603.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
sylvestris]
 ref|XP_009757604.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
sylvestris]
 ref|XP_009757605.1| PREDICTED: calcium-dependent protein kinase 1-like [Nicotiana 
sylvestris]
 emb|CAC82999.1| calcium-dependent protein kinase 3 [Nicotiana tabacum]
Length=578

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ER+++L AAF YFDKDGSGYIT DELQ AC+EFG+GD ++E
Sbjct  472  DYGEFIAATLHMNKIERQDHLFAAFCYFDKDGSGYITADELQQACEEFGIGDVRME  527



>gb|AGS14999.1| calcium-dependent protein kinase 2 [Vitis amurensis]
Length=569

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFGL D +LE
Sbjct  465  DYGEFIAATLHLNKVEREDHLFAAFSYFDKDGSGYITPDELQQACEEFGLEDVRLE  520



>ref|XP_006663248.1| PREDICTED: calcium-dependent protein kinase SK5-like, partial 
[Oryza brachyantha]
Length=480

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+EREENL++AFS+FDKDGSG+IT+DEL  AC EFGL D  LE
Sbjct  372  DYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACHEFGLDDVHLE  427



>ref|XP_009418968.1| PREDICTED: calcium-dependent protein kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=566

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE+NL +AFSYFDKDGSGYIT DELQ AC EFG+ D ++E
Sbjct  461  DYGEFIAATLHLNKIEREDNLFSAFSYFDKDGSGYITQDELQKACDEFGIEDVRIE  516



>dbj|BAB63463.1| calcium dependent protein kinase [Solanum tuberosum]
Length=578

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLHMNK+ER+++L AAF YFDKDGSGYIT DELQ AC+EFG+GD ++E
Sbjct  472  DYGEFIAATLHMNKIERQDHLFAAFCYFDKDGSGYITADELQQACEEFGIGDVRME  527



>gb|AFW67407.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=412

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E+ L AAFSYFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  307  DYGEFIAATLHINKVEKEDKLFAAFSYFDKDGSGYITQDELQKACEEFGIGDTRLE  362



>ref|XP_010446329.1| PREDICTED: calcium-dependent protein kinase 26-like [Camelina 
sativa]
 ref|XP_010446330.1| PREDICTED: calcium-dependent protein kinase 26-like [Camelina 
sativa]
 ref|XP_010446331.1| PREDICTED: calcium-dependent protein kinase 26-like [Camelina 
sativa]
 ref|XP_010446332.1| PREDICTED: calcium-dependent protein kinase 26-like [Camelina 
sativa]
Length=484

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+HMNK+EREE+LL+AF+YFDKDGSGYIT+DELQHAC E G+ D  LE
Sbjct  382  DYGEFIAATIHMNKLEREEHLLSAFTYFDKDGSGYITIDELQHACAEQGMSDVFLE  437



>ref|XP_002524091.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF38301.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=641

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT+DELQ AC EFG+ D  LE
Sbjct  535  DYGEFIAATLHLNKVEREDHLFAAFSYFDKDGSGYITLDELQQACIEFGMEDVHLE  590



>ref|XP_002265450.1| PREDICTED: calcium-dependent protein kinase 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010658917.1| PREDICTED: calcium-dependent protein kinase 1 isoform X1 [Vitis 
vinifera]
Length=569

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFGL D +LE
Sbjct  465  DYGEFIAATLHLNKVEREDHLFAAFSYFDKDGSGYITPDELQQACEEFGLEDVRLE  520



>ref|XP_010431750.1| PREDICTED: calcium-dependent protein kinase 26 isoform X1 [Camelina 
sativa]
 ref|XP_010431751.1| PREDICTED: calcium-dependent protein kinase 26 isoform X2 [Camelina 
sativa]
 ref|XP_010431752.1| PREDICTED: calcium-dependent protein kinase 26 isoform X1 [Camelina 
sativa]
 ref|XP_010431754.1| PREDICTED: calcium-dependent protein kinase 26 isoform X3 [Camelina 
sativa]
 ref|XP_010431755.1| PREDICTED: calcium-dependent protein kinase 26 isoform X1 [Camelina 
sativa]
 ref|XP_010436921.1| PREDICTED: calcium-dependent protein kinase 26 [Camelina sativa]
Length=484

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+HMNK+EREE+LL+AF+YFDKDGSGYIT+DELQHAC E G+ D  LE
Sbjct  382  DYGEFIAATIHMNKLEREEHLLSAFTYFDKDGSGYITIDELQHACAEQGMSDVFLE  437



>ref|XP_002463766.1| hypothetical protein SORBIDRAFT_01g005750 [Sorghum bicolor]
 gb|EER90764.1| hypothetical protein SORBIDRAFT_01g005750 [Sorghum bicolor]
Length=585

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E+ L AAFSYFDKDGSGYIT DELQ AC+EFG+GD +LE
Sbjct  480  DYGEFIAATLHINKVEKEDKLFAAFSYFDKDGSGYITQDELQKACEEFGIGDTRLE  535



>gb|EPS71343.1| calcium dependent protein kinase 12 [Genlisea aurea]
Length=516

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL +AF++FDKDGSGYIT+DELQ ACK+FGL +  L+
Sbjct  412  DYGEFLAATVHLNKLEREENLASAFAFFDKDGSGYITIDELQQACKQFGLSEMNLD  467



>ref|XP_009389511.1| PREDICTED: calcium-dependent protein kinase SK5-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+HMNK+EREENL++AFS+FDKDGSGYIT+DEL  AC+EFGL +  L+
Sbjct  389  DYGEFLAATVHMNKLEREENLMSAFSFFDKDGSGYITIDELSQACREFGLDEVHLD  444



>gb|AFH35029.1| calcium dependent protein kinase, partial [Hevea brasiliensis]
Length=582

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFGL D +LE
Sbjct  452  DYGEFIAATLHLNKIEREDHLFAAFSYFDKDGSGYITPDELQQACEEFGLEDVRLE  507



>gb|KHN16906.1| Calcium-dependent protein kinase SK5 [Glycine soja]
Length=508

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  392  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDIHID  447



>ref|NP_001238517.2| calcium-dependent protein kinase SK5 [Glycine max]
 sp|P28583.1|CDPK_SOYBN RecName: Full=Calcium-dependent protein kinase SK5; Short=CDPK 
[Glycine max]
 gb|AAB00806.1| calmcium/calmodulin-dependent protein kinase [Glycine max]
Length=508

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  392  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDIHID  447



>ref|XP_004303728.1| PREDICTED: calcium-dependent protein kinase SK5-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=466

 Score = 96.7 bits (239),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKDGSG+IT+DEL  AC EFGLG+  LE
Sbjct  353  DYGEFLAATVHLNKLEREENLMSAFSFFDKDGSGFITIDELTQACVEFGLGEVHLE  408



>ref|XP_008446726.1| PREDICTED: calcium-dependent protein kinase 1 [Cucumis melo]
Length=575

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E++LLAAFSYFDKDGSG+IT DELQ ACKEFG+ D QLE
Sbjct  470  DYGEFVAATLHLNKIEKEDHLLAAFSYFDKDGSGFITHDELQQACKEFGIEDLQLE  525



>ref|NP_195536.2| calcium-dependent protein kinase 26 [Arabidopsis thaliana]
 gb|ABJ98560.1| At4g38230 [Arabidopsis thaliana]
 gb|AEE86899.1| calcium-dependent protein kinase 26 [Arabidopsis thaliana]
Length=340

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREE+LL+AF YFDKDGSGYIT+DELQHAC E G+ D  LE
Sbjct  238  DYGEFIAATIHLNKLEREEHLLSAFRYFDKDGSGYITIDELQHACAEQGMSDVFLE  293



>ref|XP_003578789.1| PREDICTED: calcium-dependent protein kinase SK5-like [Brachypodium 
distachyon]
Length=523

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH+NK+EREENL++AFS+FDKDGSG+IT+DEL  AC++FGL D  LE
Sbjct  406  DYGEFLAATLHVNKLEREENLVSAFSFFDKDGSGFITIDELSQACEKFGLSDVHLE  461



>ref|XP_004162718.1| PREDICTED: calcium-dependent protein kinase 1-like [Cucumis sativus]
Length=575

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E++LLAAFSYFDKDGSG+IT DELQ ACKEFG+ D QLE
Sbjct  470  DYGEFVAATLHLNKIEKEDHLLAAFSYFDKDGSGFITHDELQQACKEFGIEDLQLE  525



>ref|XP_004135049.1| PREDICTED: calcium-dependent protein kinase 1-like [Cucumis sativus]
Length=575

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E++LLAAFSYFDKDGSG+IT DELQ ACKEFG+ D QLE
Sbjct  470  DYGEFVAATLHLNKIEKEDHLLAAFSYFDKDGSGFITHDELQQACKEFGIEDLQLE  525



>ref|XP_002514436.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF47932.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=578

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFGL D +LE
Sbjct  472  DYGEFIAATLHLNKIEREDHLFAAFSYFDKDGSGYITPDELQQACEEFGLEDFRLE  527



>gb|AAV28169.1| calcium-dependent protein kinase 1 [Vicia faba]
Length=493

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKDGSGYIT+DE+  ACKEFGL D  ++
Sbjct  385  DYGEFIAATVHLNKLEREENLLSAFSYFDKDGSGYITIDEIHVACKEFGLDDIHID  440



>ref|XP_009398351.1| PREDICTED: calcium-dependent protein kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=584

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+ D +LE
Sbjct  479  DYGEFIAATLHLNKIEREDHLFAAFSYFDKDGSGYITQDELQQACQEFGIEDVRLE  534



>ref|XP_008803232.1| PREDICTED: calcium-dependent protein kinase 1 [Phoenix dactylifera]
Length=589

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+ D +LE
Sbjct  484  DYGEFVAATLHLNKIEREDHLFAAFSYFDKDGSGYITQDELQQACEEFGIEDVRLE  539



>gb|AFK13839.1| calmcium/calmodulin-dependent protein kinase CDPK2 [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+EREENL +AF+YFDKDGSGYIT++ELQ ACKE GL D  LE
Sbjct  387  DYGEFVAATLHLNKLEREENLASAFAYFDKDGSGYITIEELQQACKELGLSDHHLE  442



>ref|XP_008375558.1| PREDICTED: calcium-dependent protein kinase 1 [Malus domestica]
Length=577

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC++FG+ D +LE
Sbjct  477  DYGEFVAATLHLNKIEREDHLFAAFSYFDKDGSGYITPDELQQACEDFGIEDVRLE  532



>ref|XP_004303727.1| PREDICTED: calcium-dependent protein kinase SK5-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=498

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL++AFS+FDKDGSG+IT+DEL  AC EFGLG+  LE
Sbjct  385  DYGEFLAATVHLNKLEREENLMSAFSFFDKDGSGFITIDELTQACVEFGLGEVHLE  440



>ref|XP_006584637.1| PREDICTED: calcium-dependent protein kinase SK5 isoform X1 [Glycine 
max]
Length=537

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENL++AFSYFDKDGSGYIT+DE+Q ACK+FGL D  ++
Sbjct  421  DYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDIHID  476



>ref|XP_007010504.1| Calcium dependent protein kinase 1 [Theobroma cacao]
 gb|EOY19314.1| Calcium dependent protein kinase 1 [Theobroma cacao]
Length=583

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+ D +LE
Sbjct  474  DYGEFVAATLHLNKIEREDHLFAAFSYFDKDGSGYITPDELQQACEEFGIEDVRLE  529



>ref|XP_004977255.1| PREDICTED: calcium-dependent protein kinase SK5-like [Setaria 
italica]
Length=515

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREE+L++AF++FDKDGSG+IT+DEL  AC++FGL D  LE
Sbjct  407  DYGEFLAATLHMNKLEREESLVSAFAFFDKDGSGFITIDELSQACQQFGLSDVHLE  462



>ref|XP_003602699.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES72950.1| CDPK-related kinase [Medicago truncatula]
Length=495

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREENLL+AFSYFDKD SGYIT+DE+Q ACKEFGL D  ++
Sbjct  387  DYGEFIAATVHLNKLEREENLLSAFSYFDKDCSGYITIDEIQAACKEFGLDDVHID  442



>ref|XP_009389198.1| PREDICTED: calcium-dependent protein kinase 26-like [Musa acuminata 
subsp. malaccensis]
Length=545

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREE+L+AAFSYFDKDGSGYITVDELQ ACKE  + D  LE
Sbjct  442  DYGEFIAATIHLNKLEREEHLVAAFSYFDKDGSGYITVDELQQACKEHNMTDVILE  497



>ref|NP_001167855.1| uncharacterized LOC100381559 [Zea mays]
 gb|ACN26314.1| unknown [Zea mays]
 tpg|DAA55560.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA55561.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
Length=515

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREE+L++AF++FDKDGSG+IT+DEL  AC++FGL D  LE
Sbjct  407  DYGEFLAATLHMNKLEREESLVSAFAFFDKDGSGFITIDELSQACEQFGLSDVHLE  462



>gb|KHN08596.1| Calcium-dependent protein kinase 1 [Glycine soja]
Length=581

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH NK+ERE+NL AAFSYFDKDGSGYIT +ELQ AC EFG+ D +LE
Sbjct  476  DYGEFLAATLHRNKIEREDNLFAAFSYFDKDGSGYITQEELQQACDEFGIKDVRLE  531



>ref|XP_010238945.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
26-like [Brachypodium distachyon]
Length=625

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC EFG+ D +LE
Sbjct  516  DYGEFIAATLHLNKVEREDHLYAAFQYFDKDGSGYITADELQQACDEFGIEDVRLE  571



>gb|KCW45721.1| hypothetical protein EUGRSUZ_L00499 [Eucalyptus grandis]
Length=193

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E++L AAFSYFD+DGSGYIT DELQ AC+EFG+ D +LE
Sbjct  121  DYGEFVAATLHLNKVEKEDHLFAAFSYFDRDGSGYITQDELQQACEEFGIEDVRLE  176



>gb|AAB49984.1| calcium-dependent calmodulin-independent protein kinase CDPK 
[Cucurbita pepo]
Length=573

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+E+E++LLAAFSYFDKDGSG+IT DELQ ACKEFG+ D Q+E
Sbjct  468  DYGEFVAATLHLNKIEKEDHLLAAFSYFDKDGSGFITHDELQQACKEFGIEDLQME  523



>ref|XP_010909026.1| PREDICTED: calcium-dependent protein kinase 26 [Elaeis guineensis]
Length=548

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+EREE+L+AAFSYFDKDGSGYITVDELQ ACKE+ + D  LE
Sbjct  443  DYGEFIAATVHLNKLEREEHLVAAFSYFDKDGSGYITVDELQQACKEYNMTDCFLE  498



>dbj|BAA04830.1| calcium-dependent protein kinase [Arabidopsis thaliana]
Length=495

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNKMEREE L+AAFS FDKDGSGYIT+DELQ AC EFGL D  L+
Sbjct  384  DYGEFLAATLHMNKMEREEILVAAFSDFDKDGSGYITIDELQSACTEFGLCDTPLD  439



>tpg|DAA54876.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=646

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AATLH+NK+ERE++L AAF YFDKDGSGYIT DELQ AC EFG+ D +LE
Sbjct  540  DYGEFIAATLHLNKIEREDHLFAAFQYFDKDGSGYITADELQQACDEFGIEDIRLE  595



>ref|XP_006485498.1| PREDICTED: calcium-dependent protein kinase 1-like [Citrus sinensis]
Length=588

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+ D +LE
Sbjct  482  DYGEFIAATMHLNKIEREDHLFAAFSYFDKDGSGYITQDELQQACEEFGIEDVRLE  537



>ref|XP_010421165.1| PREDICTED: calcium-dependent protein kinase 12-like isoform X1 
[Camelina sativa]
Length=490

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAAT+H+NK+EREENL+AAFS+FDKD SGYIT+DELQ A KEFGL D+ L+
Sbjct  380  DYGEFLAATIHLNKLEREENLVAAFSFFDKDASGYITIDELQQAWKEFGLKDSNLD  435



>ref|XP_003535945.1| PREDICTED: calcium-dependent protein kinase 1 [Glycine max]
Length=581

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLH NK+ERE+NL AAFSYFDKDGSGYIT +ELQ AC EFG+ D +LE
Sbjct  476  DYGEFLAATLHRNKIEREDNLFAAFSYFDKDGSGYITQEELQQACDEFGIKDVRLE  531



>gb|EMS53751.1| Calcium-dependent protein kinase 1 [Triticum urartu]
Length=542

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+HMNK+E+E+ L AAF YFDKDGSGYIT DELQ AC+EFG+GD ++E
Sbjct  399  DYGEFIAATMHMNKVEKEDKLFAAFQYFDKDGSGYITQDELQKACEEFGIGDTRIE  454



>ref|XP_002442894.1| hypothetical protein SORBIDRAFT_08g004510 [Sorghum bicolor]
 gb|EES16732.1| hypothetical protein SORBIDRAFT_08g004510 [Sorghum bicolor]
Length=515

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEFLAATLHMNK+EREE+L++AF++FDKDGSG+IT+DEL  AC++FGL D  LE
Sbjct  407  DYGEFLAATLHMNKLEREESLVSAFAFFDKDGSGFITIDELSQACEQFGLSDVHLE  462



>gb|KDO48687.1| hypothetical protein CISIN_1g007353mg [Citrus sinensis]
Length=607

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    DYGEFLAATLHMNKMEREENLLAAFSYFDKDGSGYITVDELQHACKEFGLGDAQLE  169
            DYGEF+AAT+H+NK+ERE++L AAFSYFDKDGSGYIT DELQ AC+EFG+ D +LE
Sbjct  501  DYGEFIAATMHLNKIEREDHLFAAFSYFDKDGSGYITQDELQQACEEFGIEDVRLE  556



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514682829918