BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11627_g1_i1 len=758 path=[1:0-510 512:511-757]

Length=758
                                                                      Score     E

emb|CDP00165.1|  unnamed protein product                                293   3e-91   
ref|XP_011086565.1|  PREDICTED: polygalacturonase-1 non-catalytic...    289   1e-89   
ref|XP_009794726.1|  PREDICTED: polygalacturonase-1 non-catalytic...    286   1e-88   
gb|AHC69823.1|  polygalacturonase isoenzyme 1 beta subunit              286   1e-88   
ref|XP_009596009.1|  PREDICTED: polygalacturonase-1 non-catalytic...    286   1e-88   
gb|EYU22487.1|  hypothetical protein MIMGU_mgv1a002927mg                270   2e-82   
ref|XP_009794727.1|  PREDICTED: polygalacturonase-1 non-catalytic...    270   3e-82   
ref|XP_008221810.1|  PREDICTED: probable polygalacturonase non-ca...    268   1e-81   
ref|XP_010242994.1|  PREDICTED: probable polygalacturonase non-ca...    268   2e-81   
ref|XP_009596020.1|  PREDICTED: polygalacturonase-1 non-catalytic...    266   1e-80   
gb|EYU31262.1|  hypothetical protein MIMGU_mgv1a002697mg                265   2e-80   
ref|XP_010100469.1|  hypothetical protein L484_027781                   263   1e-79   
gb|EPS67761.1|  polygalacturonase-1 non-catalytic subunit beta          262   2e-79   
gb|KDP26581.1|  hypothetical protein JCGZ_17739                         262   4e-79   
ref|XP_004514684.1|  PREDICTED: polygalacturonase-1 non-catalytic...    262   4e-79   
ref|XP_008444317.1|  PREDICTED: probable polygalacturonase non-ca...    261   9e-79   
ref|XP_008340027.1|  PREDICTED: probable polygalacturonase non-ca...    259   3e-78   
ref|XP_004173618.1|  PREDICTED: probable polygalacturonase non-ca...    258   8e-78   
ref|XP_004142981.1|  PREDICTED: probable polygalacturonase non-ca...    258   9e-78   
ref|XP_011071083.1|  PREDICTED: polygalacturonase-1 non-catalytic...    258   1e-77   
ref|XP_003519820.2|  PREDICTED: probable polygalacturonase non-ca...    255   2e-76   
ref|XP_004298578.1|  PREDICTED: probable polygalacturonase non-ca...    254   2e-76   
ref|XP_006365227.1|  PREDICTED: polygalacturonase-1 non-catalytic...    254   4e-76   
ref|XP_006365226.1|  PREDICTED: polygalacturonase-1 non-catalytic...    253   5e-76   
ref|XP_004238669.1|  PREDICTED: polygalacturonase-1 non-catalytic...    252   2e-75   
ref|XP_011034135.1|  PREDICTED: probable polygalacturonase non-ca...    249   3e-74   
ref|XP_007157462.1|  hypothetical protein PHAVU_002G071500g             248   6e-74   
ref|NP_001234835.1|  polygalacturonase-1 non-catalytic subunit be...    248   6e-74   
ref|XP_007224206.1|  hypothetical protein PRUPE_ppa017408mg             248   7e-74   
ref|XP_006365231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    248   7e-74   
ref|XP_007153633.1|  hypothetical protein PHAVU_003G052000g             247   1e-73   
gb|KHG01313.1|  Polygalacturonase non-catalytic subunit protein         245   4e-73   
ref|XP_008221868.1|  PREDICTED: probable polygalacturonase non-ca...    245   5e-73   
ref|XP_002266341.1|  PREDICTED: probable polygalacturonase non-ca...    244   2e-72   Vitis vinifera
ref|XP_003532010.1|  PREDICTED: probable polygalacturonase non-ca...    243   4e-72   
ref|XP_003517743.1|  PREDICTED: probable polygalacturonase non-ca...    243   6e-72   
ref|XP_009363553.1|  PREDICTED: probable polygalacturonase non-ca...    241   3e-71   
ref|XP_010471031.1|  PREDICTED: probable polygalacturonase non-ca...    241   3e-71   
ref|XP_010471032.1|  PREDICTED: probable polygalacturonase non-ca...    241   3e-71   
ref|XP_009363551.1|  PREDICTED: probable polygalacturonase non-ca...    241   4e-71   
ref|XP_004238668.1|  PREDICTED: polygalacturonase non-catalytic s...    240   5e-71   
ref|XP_006300881.1|  hypothetical protein CARUB_v10019971mg             240   5e-71   
gb|KCW86731.1|  hypothetical protein EUGRSUZ_B03343                     239   1e-70   
ref|XP_010044636.1|  PREDICTED: polygalacturonase-1 non-catalytic...    239   1e-70   
ref|XP_006365228.1|  PREDICTED: polygalacturonase non-catalytic s...    239   1e-70   
ref|XP_011009539.1|  PREDICTED: probable polygalacturonase non-ca...    239   2e-70   
gb|KHG24447.1|  Polygalacturonase non-catalytic subunit protein         239   2e-70   
gb|AAL08244.1|  At1g70370/F17O7_9                                       236   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002314620.2|  hypothetical protein POPTR_0010s05000g             239   2e-70   Populus trichocarpa [western balsam poplar]
emb|CBI28514.3|  unnamed protein product                                229   2e-70   
gb|KDO82432.1|  hypothetical protein CISIN_1g044596mg                   238   4e-70   
ref|XP_006483847.1|  PREDICTED: probable polygalacturonase non-ca...    238   6e-70   
ref|XP_006438392.1|  hypothetical protein CICLE_v10030930mg             238   7e-70   
ref|XP_010415713.1|  PREDICTED: probable polygalacturonase non-ca...    237   1e-69   
ref|XP_008389645.1|  PREDICTED: probable polygalacturonase non-ca...    236   2e-69   
ref|XP_006392169.1|  hypothetical protein EUTSA_v10023352mg             236   2e-69   
ref|NP_177194.1|  polygalacturonase 2                                   236   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238667.1|  PREDICTED: polygalacturonase non-catalytic s...    235   4e-69   
ref|XP_010251282.1|  PREDICTED: probable polygalacturonase non-ca...    235   4e-69   
ref|XP_010427809.1|  PREDICTED: probable polygalacturonase non-ca...    235   5e-69   
ref|XP_002311777.2|  hypothetical protein POPTR_0008s19430g             234   7e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006365229.1|  PREDICTED: polygalacturonase non-catalytic s...    233   2e-68   
ref|XP_004509821.1|  PREDICTED: probable polygalacturonase non-ca...    233   2e-68   
ref|XP_002888771.1|  hypothetical protein ARALYDRAFT_894840             233   2e-68   
ref|XP_007044636.1|  Polygalacturonase 2                                234   2e-68   
gb|AAB39546.1|  polygalacturonase isoenzyme 1 beta subunit homolog      233   3e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KDO82433.1|  hypothetical protein CISIN_1g036311mg                   233   3e-68   
ref|XP_003613234.1|  Polygalacturonase-1 non-catalytic subunit beta     233   3e-68   
ref|XP_006438394.1|  hypothetical protein CICLE_v10030947mg             233   4e-68   
ref|XP_006303930.1|  hypothetical protein CARUB_v10008588mg             232   5e-68   
ref|XP_003552018.1|  PREDICTED: probable polygalacturonase non-ca...    231   8e-68   
ref|XP_006365230.1|  PREDICTED: polygalacturonase-1 non-catalytic...    230   3e-67   
emb|CDY47228.1|  BnaC09g14770D                                          230   4e-67   
ref|XP_002266815.1|  PREDICTED: probable polygalacturonase non-ca...    229   5e-67   Vitis vinifera
emb|CDY53059.1|  BnaA09g14240D                                          229   8e-67   
ref|XP_009113216.1|  PREDICTED: probable polygalacturonase non-ca...    229   8e-67   
ref|XP_006390895.1|  hypothetical protein EUTSA_v10018277mg             229   1e-66   
ref|XP_010498883.1|  PREDICTED: probable polygalacturonase non-ca...    228   3e-66   
ref|XP_006300871.1|  hypothetical protein CARUB_v10019963mg             228   3e-66   
emb|CDX68345.1|  BnaA07g23850D                                          227   4e-66   
emb|CDY23501.1|  BnaC06g24700D                                          227   4e-66   
gb|AAN60310.1|  unknown                                                 216   6e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460151.1|  PREDICTED: probable polygalacturonase non-ca...    224   4e-65   
dbj|BAE99852.1|  putative polygalacuronase isoenzyme 1 beta subunit     223   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173788.1|  putative polygalacturonase non-catalytic subuni...    223   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAB39538.1|  aromatic rich glycoprotein JP630                        223   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477679.1|  PREDICTED: probable polygalacturonase non-ca...    223   2e-64   
ref|XP_010551569.1|  PREDICTED: probable polygalacturonase non-ca...    221   5e-64   
ref|XP_002890594.1|  hypothetical protein ARALYDRAFT_472637             221   7e-64   
ref|XP_002525383.1|  Polygalacturonase-1 non-catalytic subunit be...    219   3e-63   Ricinus communis
gb|KFK44451.1|  hypothetical protein AALP_AA1G258600                    218   1e-62   
ref|XP_010553600.1|  PREDICTED: probable polygalacturonase non-ca...    218   1e-62   
ref|NP_176242.1|  polygalacturonase 1                                   218   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520580.1|  PREDICTED: probable polygalacturonase non-ca...    216   3e-62   
gb|KFK41456.1|  hypothetical protein AALP_AA2G132700                    216   6e-62   
ref|XP_010925453.1|  PREDICTED: BURP domain-containing protein 12...    213   9e-61   
ref|XP_002318036.2|  hypothetical protein POPTR_0012s08060g             210   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006586545.1|  PREDICTED: probable polygalacturonase non-ca...    205   2e-59   
ref|XP_010682558.1|  PREDICTED: probable polygalacturonase non-ca...    210   2e-59   
emb|CDY57845.1|  BnaA07g38770D                                          209   2e-59   
ref|XP_009105700.1|  PREDICTED: probable polygalacturonase non-ca...    209   2e-59   
ref|XP_009393062.1|  PREDICTED: BURP domain-containing protein 12...    209   3e-59   
ref|XP_002886622.1|  hypothetical protein ARALYDRAFT_475291             208   4e-59   
emb|CCD74525.1|  polygalacturonase 1                                    208   4e-59   
ref|XP_010023570.1|  PREDICTED: probable polygalacturonase non-ca...    208   7e-59   
ref|XP_009394250.1|  PREDICTED: BURP domain-containing protein 12...    208   8e-59   
gb|KCW59875.1|  hypothetical protein EUGRSUZ_H02608                     207   8e-59   
gb|KEH20007.1|  polygalacturonase non-catalytic protein                 207   1e-58   
ref|XP_010417970.1|  PREDICTED: probable polygalacturonase non-ca...    207   1e-58   
emb|CDY59986.1|  BnaC06g43610D                                          206   3e-58   
ref|XP_010510953.1|  PREDICTED: probable polygalacturonase non-ca...    206   5e-58   
ref|XP_011044316.1|  PREDICTED: probable polygalacturonase non-ca...    205   8e-58   
ref|XP_010473218.1|  PREDICTED: probable polygalacturonase non-ca...    204   2e-57   
ref|XP_009415276.1|  PREDICTED: BURP domain-containing protein 12...    204   2e-57   
gb|KEH20006.1|  polygalacturonase non-catalytic protein                 204   3e-57   
gb|KDP31113.1|  hypothetical protein JCGZ_11489                         202   1e-56   
ref|XP_011071835.1|  PREDICTED: probable polygalacturonase non-ca...    199   1e-55   
gb|KDO69698.1|  hypothetical protein CISIN_1g0378482mg                  196   2e-55   
ref|XP_010555103.1|  PREDICTED: probable polygalacturonase non-ca...    197   5e-55   
ref|XP_006439797.1|  hypothetical protein CICLE_v10019363mg             197   7e-55   
ref|XP_006476763.1|  PREDICTED: probable polygalacturonase non-ca...    197   8e-55   
ref|XP_004509826.1|  PREDICTED: probable polygalacturonase non-ca...    197   1e-54   
ref|XP_002511417.1|  Polygalacturonase-1 non-catalytic subunit be...    194   8e-54   Ricinus communis
ref|XP_008239752.1|  PREDICTED: probable polygalacturonase non-ca...    192   4e-53   
ref|XP_010101197.1|  hypothetical protein L484_015001                   192   4e-53   
ref|XP_007210277.1|  hypothetical protein PRUPE_ppa003003mg             191   8e-53   
gb|EPS60630.1|  polygalacturonase-1 non-catalytic subunit beta          191   8e-53   
ref|XP_010678748.1|  PREDICTED: probable polygalacturonase non-ca...    189   4e-52   
emb|CBI15046.3|  unnamed protein product                                188   1e-51   
ref|XP_006438393.1|  hypothetical protein CICLE_v10033917mg             188   1e-51   
ref|XP_006484316.1|  PREDICTED: probable polygalacturonase non-ca...    188   2e-51   
ref|XP_002279813.2|  PREDICTED: probable polygalacturonase non-ca...    187   2e-51   Vitis vinifera
ref|XP_007036187.1|  Polygalacturonase 2, putative                      187   2e-51   
ref|XP_008776735.1|  PREDICTED: BURP domain-containing protein 12...    185   2e-50   
ref|XP_008800877.1|  PREDICTED: BURP domain-containing protein 12...    184   5e-50   
gb|KDP26582.1|  hypothetical protein JCGZ_17740                         182   2e-49   
ref|XP_010924225.1|  PREDICTED: BURP domain-containing protein 12...    182   2e-49   
ref|XP_007223063.1|  hypothetical protein PRUPE_ppa003712mg             181   2e-49   
ref|XP_003528153.1|  PREDICTED: polygalacturonase-1 non-catalytic...    182   3e-49   
ref|XP_008346742.1|  PREDICTED: probable polygalacturonase non-ca...    181   6e-49   
gb|KHN30893.1|  Polygalacturonase-1 non-catalytic subunit beta          179   1e-48   
ref|XP_007141610.1|  hypothetical protein PHAVU_008G210500g             179   2e-48   
gb|EPS68955.1|  hypothetical protein M569_05812                         179   3e-48   
gb|KHG12475.1|  Polygalacturonase non-catalytic subunit protein         179   3e-48   
ref|XP_004166494.1|  PREDICTED: probable polygalacturonase non-ca...    178   6e-48   
ref|XP_006578624.1|  PREDICTED: polygalacturonase-1 non-catalytic...    177   1e-47   
ref|XP_004138283.1|  PREDICTED: probable polygalacturonase non-ca...    177   2e-47   
ref|XP_008453099.1|  PREDICTED: probable polygalacturonase non-ca...    177   2e-47   
ref|XP_009593470.1|  PREDICTED: probable polygalacturonase non-ca...    174   1e-46   
ref|XP_004300895.1|  PREDICTED: probable polygalacturonase non-ca...    172   1e-45   
ref|XP_008374449.1|  PREDICTED: probable polygalacturonase non-ca...    171   3e-45   
ref|XP_007138090.1|  hypothetical protein PHAVU_009G179500g             170   5e-45   
dbj|BAK05386.1|  predicted protein                                      170   5e-45   
ref|XP_004501939.1|  PREDICTED: probable polygalacturonase non-ca...    169   7e-45   
dbj|BAJ92348.1|  predicted protein                                      169   1e-44   
ref|XP_009775426.1|  PREDICTED: probable polygalacturonase non-ca...    167   6e-44   
emb|CDP12374.1|  unnamed protein product                                166   8e-44   
ref|XP_010436291.1|  PREDICTED: probable polygalacturonase non-ca...    155   1e-42   
ref|XP_010419424.1|  PREDICTED: probable polygalacturonase non-ca...    154   1e-42   
ref|XP_002444270.1|  hypothetical protein SORBIDRAFT_07g019310          162   4e-42   Sorghum bicolor [broomcorn]
ref|XP_004236111.1|  PREDICTED: probable polygalacturonase non-ca...    160   9e-42   
ref|XP_006844960.1|  hypothetical protein AMTR_s00058p00173800          160   1e-41   
ref|XP_010028282.1|  PREDICTED: probable polygalacturonase non-ca...    157   2e-40   
gb|ACG28762.1|  polygalacturonase-1 non-catalytic beta subunit pr...    155   6e-40   Zea mays [maize]
ref|NP_001146063.1|  uncharacterized protein LOC100279594 precursor     155   7e-40   Zea mays [maize]
gb|ACN34141.1|  unknown                                                 154   1e-39   Zea mays [maize]
ref|XP_006345047.1|  PREDICTED: probable polygalacturonase non-ca...    153   4e-39   
ref|XP_003574428.1|  PREDICTED: BURP domain-containing protein 12       151   2e-38   
ref|XP_003601289.1|  Polygalacturonase-1 non-catalytic subunit beta     146   9e-37   
ref|NP_001061692.1|  Os08g0380100                                       145   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956601.1|  PREDICTED: BURP domain-containing protein 14...    146   2e-36   
ref|XP_002460065.1|  hypothetical protein SORBIDRAFT_02g022220          144   1e-35   Sorghum bicolor [broomcorn]
ref|XP_008652571.1|  PREDICTED: BURP domain-containing protein 14...    142   4e-35   
ref|XP_002525381.1|  Polygalacturonase non-catalytic subunit AroG...    141   4e-35   Ricinus communis
ref|XP_004973305.1|  PREDICTED: BURP domain-containing protein 12...    141   1e-34   
ref|XP_003610588.1|  BURP domain-containing protein                     137   5e-34   
gb|ABR16440.1|  unknown                                                 135   1e-32   Picea sitchensis
ref|XP_003576424.1|  PREDICTED: BURP domain-containing protein 14...    135   2e-32   
gb|EEC83505.1|  hypothetical protein OsI_29064                          130   4e-31   Oryza sativa Indica Group [Indian rice]
emb|CDP00166.1|  unnamed protein product                                125   3e-29   
dbj|BAJ97940.1|  predicted protein                                      124   2e-28   
emb|CAN81758.1|  hypothetical protein VITISV_043391                     116   3e-26   Vitis vinifera
dbj|BAD23622.1|  polygalacturonase isoenzyme 1 beta subunit-like        115   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062896.2|  Os09g0329000                                       115   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEE68602.1|  hypothetical protein OsJ_27135                          109   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661124.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    105   2e-22   
emb|CBI28512.3|  unnamed protein product                              97.8    9e-22   
gb|EEC84370.1|  hypothetical protein OsI_30914                        89.0    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006659367.1|  PREDICTED: BURP domain-containing protein 12...  85.1    2e-15   
gb|KHN00353.1|  Polygalacturonase-1 non-catalytic subunit beta        82.4    1e-14   
gb|KEH20005.1|  polygalacturonase non-catalytic protein               80.1    4e-14   
gb|EMS64687.1|  hypothetical protein TRIUR3_01269                     76.6    1e-12   
ref|XP_010044626.1|  PREDICTED: polygalacturonase non-catalytic s...  74.7    4e-12   
dbj|BAH57581.1|  BURP domain-containing protein                       71.2    9e-12   Arabidopsis lyrata [lyrate rockcress]
dbj|BAH57586.1|  BURP domain-containing protein                       70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57597.1|  BURP domain-containing protein                       70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57589.1|  BURP domain-containing protein                       70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57598.1|  BURP domain-containing protein                       70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57596.1|  BURP domain-containing protein                       70.1    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100466.1|  hypothetical protein L484_027778                 70.1    2e-11   
ref|XP_010046641.1|  PREDICTED: polygalacturonase non-catalytic s...  72.0    3e-11   
gb|EEE69479.1|  hypothetical protein OsJ_28904                        72.8    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26618.1|  hypothetical protein F775_18544                       72.8    3e-11   
ref|XP_010044627.1|  PREDICTED: polygalacturonase non-catalytic s...  70.5    1e-10   
ref|XP_010046648.1|  PREDICTED: polygalacturonase non-catalytic s...  70.5    1e-10   
ref|XP_010936822.1|  PREDICTED: BURP domain-containing protein 12...  70.9    1e-10   
ref|XP_010046642.1|  PREDICTED: polygalacturonase non-catalytic s...  69.3    2e-10   
ref|XP_010046646.1|  PREDICTED: BURP domain-containing protein 16...  69.7    2e-10   
gb|EMS58973.1|  hypothetical protein TRIUR3_16136                     68.9    5e-10   
gb|KHN27019.1|  Putative polygalacturonase non-catalytic subunit      67.0    5e-10   
gb|EMT30231.1|  hypothetical protein F775_20363                       67.0    2e-09   
gb|AEN81140.1|  AT1G60390-like protein                                63.2    5e-09   
gb|AEN81138.1|  AT1G60390-like protein                                63.2    5e-09   
gb|AEN81134.1|  AT1G60390-like protein                                63.2    5e-09   
gb|AEN81137.1|  AT1G60390-like protein                                62.4    8e-09   
gb|AEN81136.1|  AT1G60390-like protein                                62.4    9e-09   
gb|AEN81139.1|  AT1G60390-like protein                                61.6    2e-08   
ref|XP_008348846.1|  PREDICTED: probable polygalacturonase non-ca...  60.5    3e-08   
ref|XP_010100467.1|  hypothetical protein L484_027779                 60.1    1e-07   
ref|XP_010044635.1|  PREDICTED: probable polygalacturonase non-ca...  60.8    2e-07   
gb|KHN27021.1|  Putative polygalacturonase non-catalytic subunit      53.5    5e-05   



>emb|CDP00165.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 165/215 (77%), Gaps = 3/215 (1%)
 Frame = -1

Query  647  VGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQL  468
             GDSPFT KA LIRYW  ++SNDLP+PWF +N ASPL A Q A FSK+A  D+NSL AQL
Sbjct  39   AGDSPFTAKASLIRYWKKQVSNDLPKPWFFLNKASPLDAVQLATFSKLA--DQNSLPAQL  96

Query  467  PEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            P FCS A+L+CFPDLSPS L KH  +VNF SY FQNFTNYG++ A G DSFKNYT   N+
Sbjct  97   PAFCSKANLICFPDLSPS-LEKHTGDVNFASYSFQNFTNYGTNRAGGVDSFKNYTNGENI  155

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            PVD FRRYSRDS  H D+F+NYA   NV DQSF+TYG A  GGAG+F NY  + NVP L+
Sbjct  156  PVDAFRRYSRDSVGHDDKFTNYALDANVVDQSFNTYGTAATGGAGDFKNYNDNSNVPGLK  215

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            FT+YSD ++GRKQ FK Y+ NAN GD+ FTSYGKN
Sbjct  216  FTSYSDSSNGRKQGFKGYATNANAGDEGFTSYGKN  250


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + FT+YG +     + F +Y  + N+    F+ Y   ++A TD+FS+Y + GNV + +F+
Sbjct  242  EGFTSYGKNGNGAENDFTSYGNNSNVVGSNFKNYGETANAATDKFSSYGSNGNVPENNFN  301

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YGP        F NY    NV +  F +Y+  ++     F +Y ++ N G   FTSYGK
Sbjct  302  NYGPGGNAATETFTNYRDQSNVGDDSFQSYAKGSNAATANFVNYGQSFNEGSDRFTSYGK  361

Query  5    N  3
            +
Sbjct  362  D  362


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 51/106 (48%), Gaps = 0/106 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYG  + A  D F +Y  + N+P + F  Y    +A T+ F+NY    NV D SF +
Sbjct  271  NFKNYGETANAATDKFSSYGSNGNVPENNFNNYGPGGNAATETFTNYRDQSNVGDDSFQS  330

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            Y   +      F NY +  N  + RFT+Y  DA      FK Y  N
Sbjct  331  YAKGSNAATANFVNYGQSFNEGSDRFTSYGKDASSLTVGFKIYGVN  376



>ref|XP_011086565.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=634

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G++PFTPK Y++RYW  +ISNDLP+P FL+  ASPL AAQYA FSK+A  D+N L+ QLP
Sbjct  39   GENPFTPKGYVMRYWKKQISNDLPKPEFLLKKASPLNAAQYAAFSKLA--DQNLLSTQLP  96

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            +FCS A+LLCFPDLSPS L KHD NVNF SY  +NFTNYG+    G DSFKNY+   N+P
Sbjct  97   DFCSKANLLCFPDLSPS-LEKHDGNVNFASYSNKNFTNYGTDRLGGTDSFKNYSDGENVP  155

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            +D+FRRYSRDS+ H D+F++YAT  NV DQSF+TYG +  GG G+F NY   VNVPNLRF
Sbjct  156  LDSFRRYSRDSTGHNDKFTSYATDANVVDQSFNTYGTSATGGKGQFDNYNSQVNVPNLRF  215

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            TAYSD+++GR+Q F  Y++ AN GDQ FTSYGKN
Sbjct  216  TAYSDNSNGRQQSFTQYTDEANAGDQRFTSYGKN  249


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG +    A+ F +Y  D N+   TF  Y    +   D F++Y T  NV + +F 
Sbjct  241  QRFTSYGKNGNGAANEFTSYGKDSNVMGSTFNNYGESGNGANDTFTSYGTNTNVPENNFK  300

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG         F NY    NV +  F +Y  +++  K +F +Y ++ N G   FT YGK
Sbjct  301  NYGSQGNAATDTFKNYRDQSNVGDDSFDSYGKNSNAAKIDFVNYGQSFNEGTDKFTGYGK  360

Query  5    N  3
            +
Sbjct  361  D  361


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 50/105 (48%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG       D+F +Y  + N+P + F+ Y    +A TD F NY    NV D SF +Y
Sbjct  271  FNNYGESGNGANDTFTSYGTNTNVPENNFKNYGSQGNAATDTFKNYRDQSNVGDDSFDSY  330

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            G  +     +F NY +  N    +FT Y  D+ G    FK Y  N
Sbjct  331  GKNSNAAKIDFVNYGQSFNEGTDKFTGYGKDSTGPSVGFKIYGVN  375


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 63/136 (46%), Gaps = 20/136 (15%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y        Q+FT Y   + AG   F +Y  + N   + F  Y +DS+     F
Sbjct  212  NLRFTAYSDNSNGRQQSFTQYTDEANAGDQRFTSYGKNGNGAANEFTSYGKDSNVMGSTF  271

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            +NY   GN A+ +F +YG  T              NVP   F  Y    +     FK+Y 
Sbjct  272  NNYGESGNGANDTFTSYGTNT--------------NVPENNFKNYGSQGNAATDTFKNYR  317

Query  50   ENANVGDQNFTSYGKN  3
            + +NVGD +F SYGKN
Sbjct  318  DQSNVGDDSFDSYGKN  333



>ref|XP_009794726.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=628

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK YLIRYW  ++SNDLP+PWFL+N ASPL AAQYA ++K+  AD+N+L+ QL  FC
Sbjct  33   PFTPKGYLIRYWKKQVSNDLPKPWFLLNKASPLNAAQYATYTKLV-ADQNALSTQLHSFC  91

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            SSA+LLC PDLSPS L KH ++VNF SY  +NFTNYG+  A G D+FKNY+   N+PVD+
Sbjct  92   SSANLLCAPDLSPS-LEKHSNDVNFASYNDKNFTNYGTTRAGGFDAFKNYSDGENIPVDS  150

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRDS  H D+FSNYA  GNV DQ+F+TYG   AGG G+F NY  +VNVPN+RFT+Y
Sbjct  151  FRRYSRDSGGHDDKFSNYAPDGNVIDQAFNTYGTNAAGGTGKFTNYGPNVNVPNIRFTSY  210

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            SD A GR Q+F +YS+NAN GDQ FT+YGKN
Sbjct  211  SDAATGRNQDFTTYSQNANAGDQAFTNYGKN  241


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 62/135 (46%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N +FT+Y        Q FTNYG +       F +Y  D N+   TF  Y + ++     F
Sbjct  218  NQDFTTYSQNANAGDQAFTNYGKNGNGADSKFTSYGTDTNVIGSTFTNYGQTANGGNQNF  277

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            ++Y T GNV + +F  YG    G    F NY    NV +  F  Y  D +  +  F +Y 
Sbjct  278  TSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNYIKDTNAGEANFVNYG  337

Query  50   ENANVGDQNFTSYGK  6
            ++ N G   FT YGK
Sbjct  338  QSFNEGTDKFTGYGK  352


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG  +  G  +F +Y  + N+P + F+ Y    +  T+ F+NY    NV D SF  Y
Sbjct  263  FTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNY  322

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
               T  G   F NY +  N    +FT Y   A+  K  FK+Y  N
Sbjct  323  IKDTNAGEANFVNYGQSFNEGTDKFTGYGKGANDPKVNFKTYGVN  367



>gb|AHC69823.1| polygalacturonase isoenzyme 1 beta subunit [Nicotiana tabacum]
Length=628

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK YLIRYW  ++SNDLP+PWFL+N ASPL AAQYA ++K+  AD+N+L+ QL  FC
Sbjct  33   PFTPKGYLIRYWKKQVSNDLPKPWFLLNKASPLNAAQYATYTKLV-ADQNALSTQLHSFC  91

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            SSA+LLC PDLSPS L KH ++VNF SY  +NFTNYG+  A G D+FKNY+   N+PVD+
Sbjct  92   SSANLLCAPDLSPS-LEKHSNDVNFASYNDKNFTNYGTTRAGGFDAFKNYSDGENIPVDS  150

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRDS  H D+FSNYA  GNV DQ+F+TYG   AGG G+F NY  +VNVPN+RFT+Y
Sbjct  151  FRRYSRDSGGHDDKFSNYAPDGNVIDQAFNTYGTNAAGGTGKFTNYGPNVNVPNIRFTSY  210

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            SD A GR Q+F +YS+NAN GDQ FT+YGKN
Sbjct  211  SDAATGRNQDFTTYSQNANAGDQAFTNYGKN  241


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 62/135 (46%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N +FT+Y        Q FTNYG +       F +Y  D N+   TF  Y + ++     F
Sbjct  218  NQDFTTYSQNANAGDQAFTNYGKNGNGADSKFTSYGTDTNVIGSTFTNYGQTANGGNQNF  277

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            ++Y T GNV + +F  YG    G    F NY    NV +  F  Y  D +  +  F +Y 
Sbjct  278  TSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNYIKDTNAGEANFVNYG  337

Query  50   ENANVGDQNFTSYGK  6
            ++ N G   FT YGK
Sbjct  338  QSFNEGTDKFTGYGK  352


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG  +  G  +F +Y  + N+P + F+ Y    +  T+ F+NY    NV D SF  Y
Sbjct  263  FTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQSNVGDDSFQNY  322

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
               T  G   F NY +  N    +FT Y   A+  K  FK+Y  N
Sbjct  323  IKDTNAGEANFVNYGQSFNEGTDKFTGYGKGANDPKVNFKTYGVN  367



>ref|XP_009596009.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=629

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 166/211 (79%), Gaps = 2/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK YLIRYW  ++SNDLP+PWFL+N ASPL AAQYA ++K+  AD+N+L+ QL  FC
Sbjct  34   PFTPKGYLIRYWKKQVSNDLPKPWFLLNKASPLNAAQYATYTKLV-ADQNALSTQLHSFC  92

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            SSA+LLC PDLSPS L KH  +VNF SY  +NFTNYG+  A G D FKNY+   N+PVD+
Sbjct  93   SSANLLCAPDLSPS-LEKHSQDVNFASYNDKNFTNYGTTRAGGFDGFKNYSDGENIPVDS  151

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRDS  H DRFSNYA  GNV DQSF+TYG   AGG G+F NY  +VNVPN++FT+Y
Sbjct  152  FRRYSRDSGGHDDRFSNYAPDGNVIDQSFNTYGTNAAGGTGKFTNYGPNVNVPNIKFTSY  211

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            SD A GR Q+F +YS+NAN GDQ+F++YGKN
Sbjct  212  SDAATGRNQDFTAYSQNANAGDQSFSNYGKN  242


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 63/135 (47%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N +FT+Y        Q+F+NYG +       F +Y  D N+   TF  Y + ++     F
Sbjct  219  NQDFTAYSQNANAGDQSFSNYGKNGNGADSKFTSYGTDTNVIGSTFTNYGQTANGGNQNF  278

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            ++Y T GNV + +F  YG    G    F NY    NV +  F  Y  D +  +  F +Y 
Sbjct  279  TSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQANVGDDNFQNYIKDTNAGEANFVNYG  338

Query  50   ENANVGDQNFTSYGK  6
            ++ N G   FT YGK
Sbjct  339  QSFNEGTDKFTGYGK  353


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG  +  G  +F +Y  + N+P + F+ Y    +  T+ F+NY    NV D +F  Y
Sbjct  264  FTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAGGNGPTETFTNYRDQANVGDDNFQNY  323

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
               T  G   F NY +  N    +FT Y   A+  K  FK+Y  N
Sbjct  324  IKDTNAGEANFVNYGQSFNEGTDKFTGYGKGANDPKVNFKTYGVN  368



>gb|EYU22487.1| hypothetical protein MIMGU_mgv1a002927mg [Erythranthe guttata]
Length=624

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 165/220 (75%), Gaps = 3/220 (1%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            +   G++PFTPKAYLIRYWN +ISN+ P+P FL + ASPLTAAQ A F K+A  DRNSL+
Sbjct  20   LGVAGENPFTPKAYLIRYWNKQISNNFPKPSFLFDKASPLTAAQSAAFYKLAATDRNSLS  79

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEF--QNFTNYGSHSAAGADSFKNYT  303
            A L +FC+ A+LLCFPDLSPS L KH+DNVNFTSY    QNFTNYG+    GADSFKNY+
Sbjct  80   ANLSDFCNKANLLCFPDLSPS-LEKHNDNVNFTSYLLDGQNFTNYGTGRLGGADSFKNYS  138

Query  302  VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN  123
               N+  + FRRYSR+S+AHTD+F+ YAT  NV D+SF  YG   A G G+F +Y  + N
Sbjct  139  DGGNVVTNNFRRYSRNSTAHTDKFAAYATDTNVPDESFKGYGTTAAAGDGQFTSYNDESN  198

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            VPNL F AYSD+++GRKQ F  Y+ NAN GDQ FTSYGKN
Sbjct  199  VPNLNFAAYSDNSNGRKQTFAEYAGNANHGDQKFTSYGKN  238


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG +    A+ F NY    N+   +F  Y   ++     F++Y    NV + +F 
Sbjct  230  QKFTSYGKNGNGAANGFTNYGKGSNVMASSFENYGETANGGHHTFTSYGDDTNVPENTFR  289

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YGP   G    F +Y  D N     F +Y   ++  +  F++Y ++ N G   FT YG+
Sbjct  290  NYGPEENGAVVSFKSYRNDSNTGQDNFQSYGKKSNAAELGFENYGQSFNDGSSKFTGYGE  349


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG  +  G  +F +Y  D N+P +TFR Y  + +     F +Y    N    +F +Y
Sbjct  260  FENYGETANGGHHTFTSYGDDTNVPENTFRNYGPEENGAVVSFKSYRNDSNTGQDNFQSY  319

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
            G  +      F NY +  N  + +FT Y + A G+  +FK Y +
Sbjct  320  GKKSNAAELGFENYGQSFNDGSSKFTGYGEHAMGQAVDFKVYGQ  363



>ref|XP_009794727.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=625

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 166/217 (76%), Gaps = 5/217 (2%)
 Frame = -1

Query  644  GDS--PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            GDS  PFTPKAYLIRYW  ++SN+LP+PWFL+N ASPL AAQ+A +SK+A  D+ SL+ +
Sbjct  23   GDSINPFTPKAYLIRYWKKQMSNELPKPWFLLNKASPLNAAQFATYSKLA-GDQESLSKE  81

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            +  FCSSA+LLCFPD+S SSL KH  +V F+SY  +NFTNYGS    G DSFK Y  + N
Sbjct  82   ISSFCSSANLLCFPDIS-SSLEKHGQDVQFSSYMSKNFTNYGSKLPRGFDSFKKYAENDN  140

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPA-TAGGAGEFGNYAKDVNVPN  114
            LPV++FR+YSR  + H D+FS YA  GNV DQSF+TYG   +AGG GEF NYA +VNVPN
Sbjct  141  LPVNSFRQYSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVGEFKNYAPNVNVPN  200

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT YS +  GRKQ F SY+++ N GDQ+FTSYG+N
Sbjct  201  LRFTTYSTEVAGRKQSFSSYTKDTNSGDQSFTSYGRN  237


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (52%), Gaps = 0/116 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT Y +  A    SF +YT D N    +F  Y R+S+   + F++YA   NV   +F  Y
Sbjct  203  FTTYSTEVAGRKQSFSSYTKDTNSGDQSFTSYGRNSNGAINDFTSYANNSNVIGSTFTNY  262

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
            G +  GG   F +Y  + NVP   FT Y  D +   + F +Y + +NVGD  FTSY
Sbjct  263  GESGNGGGNTFKSYGSNANVPENTFTNYGADGNAPFETFINYRDKSNVGDDKFTSY  318


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +S    + F +Y  + N+   TF  Y    +   + F +Y +  NV + +F 
Sbjct  229  QSFTSYGRNSNGAINDFTSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENTFT  288

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             YG         F NY    NV + +FT+Y DD +  +  F++Y ++   G   F  YG
Sbjct  289  NYGADGNAPFETFINYRDKSNVGDDKFTSYVDDPNAGRANFENYGQSFGEGSDTFNKYG  347



>ref|XP_008221810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=632

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 161/213 (76%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PF+PKAYL RYWN ++ ND  +P FL++ ASPLTA   A F+K+A   +N L+++LPE
Sbjct  38   ENPFSPKAYLARYWNKEVRNDAEKPSFLLSKASPLTAVDSAAFAKLA--SQNGLSSKLPE  95

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FC+SA+LLCF DL   SL KHD +  FT+Y  +NFTNYG+   AG DSFKNY++D NLPV
Sbjct  96   FCASANLLCFSDLG-QSLEKHDKDSTFTTYAAKNFTNYGTDRLAGVDSFKNYSIDENLPV  154

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSRDS  H D+F+NYA+GGNV DQSF++Y      G GEF  YA  VNVPNLRF 
Sbjct  155  DSFRRYSRDSVNHKDQFTNYASGGNVVDQSFNSYAGGATSGTGEFKKYADSVNVPNLRFN  214

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSDD++GR Q F SY+EN N GDQ+FTSY KN
Sbjct  215  SYSDDSNGRAQSFTSYTENGNAGDQSFTSYSKN  247


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       D F NY  D+N PV+ F+ Y    +A  + F++Y    NV + SF +Y
Sbjct  269  FTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDGGNAAVETFTSYRDKANVGEDSFQSY  328

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               + G    F NY K  NV   +FT Y   A G+   FK Y  N +  D
Sbjct  329  AKNSNGEKINFANYGKSFNVGFDKFTGYGKGAQGQSIGFKIYGVNNSFSD  378


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (45%), Gaps = 14/118 (12%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG+ S      F  Y    N   D F  Y +D +   +RF +Y  GGN A ++F + 
Sbjct  255  FTGYGTSSNVVGSGFTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDGGNAAVETFTS-  313

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
                         Y    NV    F +Y+ +++G K  F +Y ++ NVG   FT YGK
Sbjct  314  -------------YRDKANVGEDSFQSYAKNSNGEKINFANYGKSFNVGFDKFTGYGK  358



>ref|XP_010242994.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=641

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 167/214 (78%), Gaps = 3/214 (1%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G++PFT KA++IRYWN +ISN+LP+P FL++ ASPL+     V +K+A  D+N+L+++LP
Sbjct  40   GENPFTAKAFVIRYWNKQISNNLPKPSFLLSKASPLSTVDSVVLTKLA--DQNALSSRLP  97

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
             FCSSA+L CF DL+PS L KHD + NF SY  +NFTNYG+    G DSFKNY+ ++N+P
Sbjct  98   SFCSSANLFCFSDLTPS-LDKHDKDSNFASYSNRNFTNYGTSQLGGVDSFKNYSDNINVP  156

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSR S+ H D+FSNYA  GNV DQSF+TYG +  GG+G+F NY + VN+PNLRF
Sbjct  157  VDSFRRYSRGSTGHNDKFSNYAPNGNVVDQSFNTYGSSATGGSGDFTNYNQLVNIPNLRF  216

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T+Y  DA+GRKQ F SY++  N GD++FTSYG+N
Sbjct  217  TSYESDANGRKQSFTSYTDETNSGDESFTSYGRN  250


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 54/121 (45%), Gaps = 6/121 (5%)
 Frame = -1

Query  389  VNFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFS  228
            V F+SY  ++      FT YG  +    DSF +Y  D N P + F+ Y    +A  D FS
Sbjct  256  VGFSSYGKESNVVGSTFTAYGETANGANDSFTSYGFDSNNPKNNFKSYGDGGNAAIDSFS  315

Query  227  NYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
            +Y    NV D SF +Y   +      F NY K  N     F  Y   A G+   FK+Y  
Sbjct  316  SYRDRSNVGDDSFLSYAKDSNSAKVNFANYGKSFNEGTDTFKGYGKGALGQAIGFKTYGV  375

Query  47   N  45
            N
Sbjct  376  N  376


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 52/119 (44%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++YG  S     +F  Y    N   D+F  Y  DS+   + F +Y  GGN A  SF +Y
Sbjct  258  FSSYGKESNVVGSTFTAYGETANGANDSFTSYGFDSNNPKNNFKSYGDGGNAAIDSFSSY  317

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G   F +YAKD N   + F  Y    +     FK Y + A      F +YG N
Sbjct  318  RDRSNVGDDSFLSYAKDSNSAKVNFANYGKSFNEGTDTFKGYGKGALGQAIGFKTYGVN  376



>ref|XP_009596020.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=628

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 164/217 (76%), Gaps = 5/217 (2%)
 Frame = -1

Query  644  GDS--PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            GDS  PFTPKAYLIRYW  +ISN LP+PWFL+N ASPL AAQ+A +SK+A  D+ SL+ +
Sbjct  26   GDSINPFTPKAYLIRYWKKQISNQLPKPWFLLNKASPLNAAQFATYSKLA-GDQESLSKE  84

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            +  FCSSA+LLCFPD+S SSL K+  +V F+SY  +NFTNYGS    G DSFK Y  + N
Sbjct  85   ISSFCSSANLLCFPDIS-SSLEKYGQDVQFSSYMSKNFTNYGSKLPRGFDSFKKYAENDN  143

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPA-TAGGAGEFGNYAKDVNVPN  114
            LPV++FR+YSR  + H D+FS YA  GNV DQSF+TYG   +AGG  EF NYA +VNVPN
Sbjct  144  LPVNSFRQYSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVSEFKNYAPNVNVPN  203

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT YS +  GRKQ F SY+++ N GDQ+FTSYGKN
Sbjct  204  LRFTTYSTEVAGRKQSFTSYTKDTNSGDQSFTSYGKN  240


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +S    + F +Y  + N+   TF  Y    +   + F +Y +  NV + SF 
Sbjct  232  QSFTSYGKNSNGAVNDFTSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENSFK  291

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             YG         F NY    NV + +FT+Y DD +  K  F++Y ++   G   F+ YG
Sbjct  292  NYGVDGNAPFETFINYRDKSNVGDDKFTSYVDDPNAGKANFENYGQSFGEGSDTFSKYG  350


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 51/118 (43%), Gaps = 18/118 (15%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +YGS++    +SFKNY VD N P +TF  Y   S+   D+F++Y    N    +F  Y
Sbjct  276  FKSYGSNANVPENSFKNYGVDGNAPFETFINYRDKSNVGDDKFTSYVDDPNAGKANFENY  335

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +   G+  F  Y   +              D +   FK+Y  N       F  YGK
Sbjct  336  GQSFGEGSDTFSKYGSGI-------------TDAQTVGFKTYGVNT-----TFKEYGK  375



>gb|EYU31262.1| hypothetical protein MIMGU_mgv1a002697mg [Erythranthe guttata]
Length=646

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 160/216 (74%), Gaps = 2/216 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
             A G++PFTPK YLIRYW  +ISNDLP+P FL++ ASPL AAQ+A FSK+A AD+NSL+ 
Sbjct  37   TAAGENPFTPKGYLIRYWKKQISNDLPKPEFLLSKASPLNAAQFAAFSKLA-ADQNSLST  95

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            QLPEFC+ ADLLCFPDL+PS L KH  +VNF +Y  +NFTNYG+    G D+F  Y+   
Sbjct  96   QLPEFCAKADLLCFPDLTPS-LEKHSSDVNFATYRNKNFTNYGTGRPGGVDAFSGYSEGE  154

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            NLP+D+FRRYSRD   H ++F+ YAT  NVADQSF++YG A  GG GEF  Y  +VNVPN
Sbjct  155  NLPIDSFRRYSRDGVGHNEKFTGYATEANVADQSFNSYGTAATGGGGEFTKYNSEVNVPN  214

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            LRFTAYSD   G  Q F  Y+  AN GD+ FTSYGK
Sbjct  215  LRFTAYSDSTTGHSQSFTEYTNQANAGDEKFTSYGK  250


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 55/126 (44%), Gaps = 10/126 (8%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG    A  D+F +Y  + N P + FR Y    S+ T+ F  Y    NV D +F +Y
Sbjct  273  FNNYGEKGDAANDTFTSYGTNTNNPQNNFRNYGTLGSSATESFKGYREQANVGDDNFDSY  332

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ----EFKSYSEN------ANVGD  30
            G  +  G  +F NY K  N    +FT Y    D        +FK Y  N      A  G 
Sbjct  333  GKNSNAGKIDFVNYGKSFNEGTDKFTGYGKKDDSTNNSPTVDFKIYGVNNTFKEYAKEGA  392

Query  29   QNFTSY  12
              F++Y
Sbjct  393  ATFSTY  398



>ref|XP_010100469.1| hypothetical protein L484_027781 [Morus notabilis]
 gb|EXB82603.1| hypothetical protein L484_027781 [Morus notabilis]
Length=608

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 164/213 (77%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PF+PKA+LIRYWN +I ND+ +P FL++ ASPLTA Q AVF+K+A   +NSL+ +LPE
Sbjct  12   ENPFSPKAHLIRYWNKEIRNDIEKPSFLLSKASPLTAVQTAVFAKLAA--QNSLSTRLPE  69

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A LLCFPDL PS L  HD + +F+ Y  +NFTNYG+    GAD FKNY+ +VN+PV
Sbjct  70   FCSAAHLLCFPDLGPS-LESHDKDSSFSGYVDRNFTNYGTDRIGGADVFKNYSPEVNIPV  128

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            ++FR YSR S+ H D+F NYA  GNV DQSF+TY   T GGAG+F  YA+ VNVPNLRFT
Sbjct  129  NSFRSYSRHSTGHDDKFHNYAFEGNVVDQSFNTYATKTTGGAGDFSKYAESVNVPNLRFT  188

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YS   +GR+Q FK YS NAN GDQ+F++YGK+
Sbjct  189  SYSFQTNGREQNFKGYSVNANSGDQSFSNYGKD  221


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 69/142 (49%), Gaps = 8/142 (6%)
 Frame = -1

Query  428  DLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS  249
            D S  + S +  N+ FTSY FQ        +     +FK Y+V+ N    +F  Y +D +
Sbjct  172  DFSKYAESVNVPNLRFTSYSFQ--------TNGREQNFKGYSVNANSGDQSFSNYGKDGN  223

Query  248  AHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ  69
               + FS+Y    NV    F +Y   + GG   F  YA D N P   F  Y D A+   +
Sbjct  224  GAENDFSSYGNSSNVIGSEFSSYQRTSNGGQDTFTAYAFDGNNPQNNFRNYGDGANAAVE  283

Query  68   EFKSYSENANVGDQNFTSYGKN  3
            +F SY + +NVGD +F SY KN
Sbjct  284  KFTSYRDQSNVGDDSFQSYAKN  305


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++Y   S  G D+F  Y  D N P + FR Y   ++A  ++F++Y    NV D SF +Y
Sbjct  243  FSSYQRTSNGGQDTFTAYAFDGNNPQNNFRNYGDGANAAVEKFTSYRDQSNVGDDSFQSY  302

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
               + G   +F NY K  N    +FT Y  DA G    FK Y  N
Sbjct  303  AKNSNGEEIKFSNYGKSFNEGTDKFTGYGKDATGHSIGFKIYGVN  347



>gb|EPS67761.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=608

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G+SPFTP+ Y++RYW  +IS+DL +P FL+  ASPLTAA YA F+KIA  D+NSL+A+LP
Sbjct  5    GESPFTPRGYILRYWKRQISSDLAQPDFLMEKASPLTAADYAAFAKIA-GDQNSLSARLP  63

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            EFC  A LLCFPD SPS L KHD +VNF +Y  QNFTNYGS    GADSF+NY+ + N+ 
Sbjct  64   EFCKKAKLLCFPDSSPS-LEKHDGDVNFATYLDQNFTNYGSKRVGGADSFRNYSENDNVV  122

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VDTFRRYSR S+ H D FS YAT  NV DQSF+TYG    GG G+F NY  DVNVPNLRF
Sbjct  123  VDTFRRYSRGSTGHDDGFSAYATSSNVIDQSFNTYGAGGNGGEGKFSNYNSDVNVPNLRF  182

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T+YSD  +GRKQ F  YS +AN GD+ FT+YGKN
Sbjct  183  TSYSDAGNGRKQTFSEYSVDANSGDEGFTNYGKN  216


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDR  234
            S S + +N N       NF NYG    AG+D+F +Y  + N+P + F+ Y+   +  TD 
Sbjct  223  SFSSYGNNSNVIG---SNFNNYGESGNAGSDNFTSYGENQNVPENNFKNYAAGGNGATDA  279

Query  233  FSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY  54
            FS+Y    NV D SF +YG  + G    F NY +  N    +FT Y  DA G + +FK Y
Sbjct  280  FSSYRDQANVGDDSFDSYGKESNGAKLGFSNYGQSFNEGTDKFTGYGKDATGPEVDFKIY  339

Query  53   SEN  45
              N
Sbjct  340  GVN  342


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y         +F  Y+VD N   + F  Y ++ +   + FS+Y    NV   +F+ Y
Sbjct  182  FTSYSDAGNGRKQTFSEYSVDANSGDEGFTNYGKNGNDAANSFSSYGNNSNVIGSNFNNY  241

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +   G+  F +Y ++ NVP   F  Y+   +G    F SY + ANVGD +F SYGK
Sbjct  242  GESGNAGSDNFTSYGENQNVPENNFKNYAAGGNGATDAFSSYRDQANVGDDSFDSYGK  299


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + FTNYG +    A+SF +Y  + N+    F  Y    +A +D F++Y    NV + +F 
Sbjct  208  EGFTNYGKNGNDAANSFSSYGNNSNVIGSNFNNYGESGNAGSDNFTSYGENQNVPENNFK  267

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             Y     G    F +Y    NV +  F +Y  +++G K  F +Y ++ N G   FT YGK
Sbjct  268  NYAAGGNGATDAFSSYRDQANVGDDSFDSYGKESNGAKLGFSNYGQSFNEGTDKFTGYGK  327

Query  5    N  3
            +
Sbjct  328  D  328



>gb|KDP26581.1| hypothetical protein JCGZ_17739 [Jatropha curcas]
Length=629

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 160/217 (74%), Gaps = 3/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            +  G+SP TPKAYLIRYWN +I N+LP+  F++  ASPL A     FSK+A  ++N+L++
Sbjct  30   LLAGESPLTPKAYLIRYWNKEIHNNLPQSSFILAKASPLNAVDAVTFSKLA--EKNALSS  87

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            +LP+FCSSA L CFPDLSPS L KH D+ +FT Y  QNFTNYG+  A G DSFKNY+   
Sbjct  88   KLPDFCSSAHLFCFPDLSPS-LEKHTDDSDFTRYSNQNFTNYGTSRAGGLDSFKNYSDGE  146

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N+PVD+FRRY R+++ H + F+NYA  GNV DQSF+TYG    GG GEF  Y + VNVPN
Sbjct  147  NIPVDSFRRYGRNAAGHNETFANYAHDGNVVDQSFNTYGHGATGGTGEFKKYNEQVNVPN  206

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT+YSDDA+ + Q+F SY+EN N G + F SYGKN
Sbjct  207  LRFTSYSDDANAKGQKFTSYTENTNSGSEAFKSYGKN  243


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 20/149 (13%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS------  249
            N+ FTSY      + Q FT+Y  ++ +G+++FK+Y  + N   D F RY  +S+      
Sbjct  206  NLRFTSYSDDANAKGQKFTSYTENTNSGSEAFKSYGKNGNAIADEFSRYGENSNVIGSDF  265

Query  248  --------AHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYS  93
                    A  D F +Y   GNV + +F  YG         F +Y ++ NV +  F +Y+
Sbjct  266  DSYGAKGNAANDTFKSYGFNGNVPENNFKNYGEGGTFSEASFTSYRQESNVGDDSFASYA  325

Query  92   DDADGRKQEFKSYSENANVGDQNFTSYGK  6
             D+ G K  F +Y ++ N G   F  YGK
Sbjct  326  KDSTGAKANFVNYGKSFNEGTDRFKEYGK  354


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
              K+++ VN  +  F   T+Y   + A    F +YT + N   + F+ Y ++ +A  D F
Sbjct  195  FKKYNEQVNVPNLRF---TSYSDDANAKGQKFTSYTENTNSGSEAFKSYGKNGNAIADEF  251

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S Y    NV    F +YG         F +Y  + NVP   F  Y +     +  F SY 
Sbjct  252  SRYGENSNVIGSDFDSYGAKGNAANDTFKSYGFNGNVPENNFKNYGEGGTFSEASFTSYR  311

Query  50   ENANVGDQNFTSYGKN  3
            + +NVGD +F SY K+
Sbjct  312  QESNVGDDSFASYAKD  327


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 4/128 (3%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
             S++ +N N       +F +YG+   A  D+FK+Y  + N+P + F+ Y    +     F
Sbjct  251  FSRYGENSNVIG---SDFDSYGAKGNAANDTFKSYGFNGNVPENNFKNYGEGGTFSEASF  307

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADG-RKQEFKSY  54
            ++Y    NV D SF +Y   + G    F NY K  N    RF  Y   +DG +K  FK Y
Sbjct  308  TSYRQESNVGDDSFASYAKDSTGAKANFVNYGKSFNEGTDRFKEYGKGSDGSQKIGFKIY  367

Query  53   SENANVGD  30
              N +  D
Sbjct  368  GVNNSFTD  375



>ref|XP_004514684.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X1 [Cicer arietinum]
 ref|XP_004514685.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X2 [Cicer arietinum]
Length=630

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 164/217 (76%), Gaps = 3/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            VA   +PFTPKA+L RYW+ +I N LP+P FL + ASPLT  + A F+K+A    N+L+ 
Sbjct  27   VAGDKNPFTPKAFLNRYWDKEIRNSLPKPSFLFSKASPLTTVEAATFAKLAAG--NTLST  84

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            +LPEFCS+A LLCFP++SPS L KHD + NF  Y+ +NFTNYG+    G DSFKNY+   
Sbjct  85   RLPEFCSAAKLLCFPEVSPS-LEKHDKDANFAVYQDKNFTNYGTSRPGGVDSFKNYSDGE  143

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N+PV+ FRRYSRDS+ H D F+NYA  GNV DQSFHTYG    GGAGEF NYA++ NVPN
Sbjct  144  NIPVNDFRRYSRDSAGHKDSFTNYAKDGNVVDQSFHTYGAGATGGAGEFNNYAEETNVPN  203

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            L FT+YSDD++GRKQ F SYSEN N G+Q+F+SYGKN
Sbjct  204  LVFTSYSDDSNGRKQSFTSYSENGNAGEQSFSSYGKN  240


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + FT+YG+ S      F NY    N   D+F+ Y  D +  T+ F+NYA GGN A Q+F 
Sbjct  246  EEFTSYGTSSNVVGSGFSNYAETSNAANDSFKAYGVDMNNPTNTFTNYANGGNGAIQTFS  305

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQ-NFTSYG  9
            TY      GA  F +YAK  N   + F  Y    +     F SY++++N   + NF  YG
Sbjct  306  TYRETANVGADSFTSYAKTANAAKVGFNNYGKSFNEGTDIFTSYAKSSNGETEVNFKVYG  365

Query  8    KN  3
             N
Sbjct  366  VN  367



>ref|XP_008444317.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=623

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 161/219 (74%), Gaps = 5/219 (2%)
 Frame = -1

Query  656  IVAVGDS--PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNS  483
            + AVGD   PFTPKA+L RYWN ++ ND+P+P FL + ASPLTA Q A F+K+A    N+
Sbjct  24   VPAVGDEDNPFTPKAFLNRYWNKEVRNDIPKPSFLFSKASPLTAVQSAAFAKLAA--ENA  81

Query  482  LAAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYT  303
            L+++LP+FCS+A+LLCFPDLSPS L+KHD + NF  Y  +NFT YG+  + G DSFKNY+
Sbjct  82   LSSRLPDFCSAANLLCFPDLSPS-LAKHDRDSNFAVYSNKNFTTYGTQRSGGIDSFKNYS  140

Query  302  VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN  123
               N+ VD+FRRYS ++  HTDRFS Y T  NV DQSF+TY     GG G+F  Y + VN
Sbjct  141  NGDNVVVDSFRRYSHEALGHTDRFSTYGTETNVPDQSFNTYASKAIGGDGKFTTYEQSVN  200

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            VPNLRFT YS DA GR Q FKSYSENAN GDQ+F +YGK
Sbjct  201  VPNLRFTTYSSDATGRSQAFKSYSENANAGDQSFVNYGK  239


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F NYG     G + F  Y    N+    F  Y  D +   D F+NY    N    +F 
Sbjct  232  QSFVNYGKRGNGGPNEFTGYGTSANVVGSRFSSYGTDGNGANDTFTNYGNDQNNPQNNFR  291

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG    G    F +Y    NV +  F +YS +++  K  F SY ++ N G   F+ YG+
Sbjct  292  SYGEGGNGAIESFSSYRDQANVGDDSFQSYSKNSNSAKVNFASYGKSFNEGTDKFSGYGQ  351

Query  5    N  3
            N
Sbjct  352  N  352


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 63/136 (46%), Gaps = 20/136 (15%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y        Q F +Y  ++ AG  SF NY    N   + F  Y   ++    RF
Sbjct  203  NLRFTTYSSDATGRSQAFKSYSENANAGDQSFVNYGKRGNGGPNEFTGYGTSANVVGSRF  262

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S+Y T GN A+ +F               NY  D N P   F +Y +  +G  + F SY 
Sbjct  263  SSYGTDGNGANDTFT--------------NYGNDQNNPQNNFRSYGEGGNGAIESFSSYR  308

Query  50   ENANVGDQNFTSYGKN  3
            + ANVGD +F SY KN
Sbjct  309  DQANVGDDSFQSYSKN  324


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++YG+      D+F NY  D N P + FR Y    +   + FS+Y    NV D SF +Y
Sbjct  262  FSSYGTDGNGANDTFTNYGNDQNNPQNNFRSYGEGGNGAIESFSSYRDQANVGDDSFQSY  321

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +      F +Y K  N    +F+ Y  + +G+   FK Y  N    D
Sbjct  322  SKNSNSAKVNFASYGKSFNEGTDKFSGYGQNGNGQSVGFKVYGVNTTFKD  371


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG+ +      F +Y  D N   DTF  Y  D +   + F +Y  GGN A +SF +Y
Sbjct  248  FTGYGTSANVVGSRFSSYGTDGNGANDTFTNYGNDQNNPQNNFRSYGEGGNGAIESFSSY  307

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
                  G   F +Y+K+ N   + F +Y    +    +F  Y +N N     F  YG N
Sbjct  308  RDQANVGDDSFQSYSKNSNSAKVNFASYGKSFNEGTDKFSGYGQNGNGQSVGFKVYGVN  366



>ref|XP_008340027.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=636

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 160/213 (75%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PF+PKAYL+RYW+ ++ ND  +P FL++ ASPL A   A F+K+A   +N L+ +LPE
Sbjct  38   ENPFSPKAYLVRYWSKEVRNDAEKPSFLLSKASPLNAVDSAAFAKLAA--QNGLSTRLPE  95

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+LLCFPDL+PS L KHD N NF  Y  +NFTNYG+   AG DSFKNY++  NLPV
Sbjct  96   FCSAANLLCFPDLAPS-LEKHDKNANFAVYTDKNFTNYGTDRLAGVDSFKNYSIGENLPV  154

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSRDS  H D+F++YA  GNV DQSF++Y   + GGAG+F  YA  VNVP+L F 
Sbjct  155  DSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNSYAGGSTGGAGDFKKYADSVNVPHLGFN  214

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSDD++GR   F  YSENAN GDQ+F+SY KN
Sbjct  215  SYSDDSNGRSHGFTGYSENANAGDQSFSSYSKN  247


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       D F NY  D N P + FR Y    +A  + F++Y    NV   SF +Y
Sbjct  269  FTGYGQSGNGANDKFNNYGNDQNNPTNNFRSYGDGGNAGVETFTSYRDSANVGXDSFQSY  328

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               + G   +F NY K  NV + +FT Y   A G++  FK Y  N    D
Sbjct  329  AKNSNGQKMDFTNYGKSFNVGSDKFTGYGQGAKGQEIGFKIYGANTTFKD  378



>ref|XP_004173618.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like, 
partial [Cucumis sativus]
Length=612

 Score =   258 bits (659),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 156/212 (74%), Gaps = 3/212 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            D PFTPKA+L RYWN ++ ND P+P FL + ASPLTA Q A F+K+A    N+L+++LP+
Sbjct  20   DDPFTPKAFLNRYWNKEVRNDFPKPSFLFSKASPLTAVQSAAFAKLAA--ENALSSRLPD  77

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+LLCFPDLSPS L+KHD + NF  Y  +NFT YG+  + G DSFKNY+   N+ V
Sbjct  78   FCSAANLLCFPDLSPS-LAKHDRDSNFAVYSNKNFTTYGTQRSGGIDSFKNYSNGDNVVV  136

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYS ++  HTDRFS Y T  NV DQSF+TY     GG G+F  Y + VNVPNLRFT
Sbjct  137  DSFRRYSHEALGHTDRFSVYGTDTNVPDQSFNTYASKAIGGDGKFTTYEQSVNVPNLRFT  196

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YS DA GR Q FKSYSENAN GDQ+F +YGK
Sbjct  197  TYSSDATGRSQSFKSYSENANAGDQSFVNYGK  228


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F NYG     G + F  Y    N+    F  Y  + +   D F+NY    N    +F 
Sbjct  221  QSFVNYGKRGNGGPNEFTGYGTSANVIGSRFSSYGAEGNGANDTFTNYGNDQNNPQNNFR  280

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG    G    F +Y    NV +  F +YS +++  K  F SY ++ N G   F+ YG+
Sbjct  281  SYGEGGNGAIESFSSYRDQANVGDDSFQSYSKNSNSAKVNFASYGKSFNEGTDKFSGYGQ  340

Query  5    N  3
            N
Sbjct  341  N  341


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++YG+      D+F NY  D N P + FR Y    +   + FS+Y    NV D SF +Y
Sbjct  251  FSSYGAEGNGANDTFTNYGNDQNNPQNNFRSYGEGGNGAIESFSSYRDQANVGDDSFQSY  310

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +      F +Y K  N    +F+ Y  + +G+   FK+Y  N    D
Sbjct  311  SKNSNSAKVNFASYGKSFNEGTDKFSGYGQNGNGQSVGFKTYGVNTTFKD  360



>ref|XP_004142981.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN62285.1| hypothetical protein Csa_2G348230 [Cucumis sativus]
Length=623

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 156/212 (74%), Gaps = 3/212 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            D PFTPKA+L RYWN ++ ND P+P FL + ASPLTA Q A F+K+A    N+L+++LP+
Sbjct  31   DDPFTPKAFLNRYWNKEVRNDFPKPSFLFSKASPLTAVQSAAFAKLAA--ENALSSRLPD  88

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+LLCFPDLSPS L+KHD + NF  Y  +NFT YG+  + G DSFKNY+   N+ V
Sbjct  89   FCSAANLLCFPDLSPS-LAKHDRDSNFAVYSNKNFTTYGTQRSGGIDSFKNYSNGDNVVV  147

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYS ++  HTDRFS Y T  NV DQSF+TY     GG G+F  Y + VNVPNLRFT
Sbjct  148  DSFRRYSHEALGHTDRFSVYGTDTNVPDQSFNTYASKAIGGDGKFTTYEQSVNVPNLRFT  207

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YS DA GR Q FKSYSENAN GDQ+F +YGK
Sbjct  208  TYSSDATGRSQSFKSYSENANAGDQSFVNYGK  239


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F NYG     G + F  Y    N+    F  Y  + +   D F+NY    N    +F 
Sbjct  232  QSFVNYGKRGNGGPNEFTGYGTSANVIGSRFSSYGAEGNGANDTFTNYGNDQNNPQNNFR  291

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG    G    F +Y    NV +  F +YS +++  K  F SY ++ N G   F+ YG+
Sbjct  292  SYGEGGNGAIESFSSYRDQANVGDDSFQSYSKNSNSAKVNFASYGKSFNEGTDKFSGYGQ  351

Query  5    N  3
            N
Sbjct  352  N  352


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++YG+      D+F NY  D N P + FR Y    +   + FS+Y    NV D SF +Y
Sbjct  262  FSSYGAEGNGANDTFTNYGNDQNNPQNNFRSYGEGGNGAIESFSSYRDQANVGDDSFQSY  321

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +      F +Y K  N    +F+ Y  + +G+   FK+Y  N    D
Sbjct  322  SKNSNSAKVNFASYGKSFNEGTDKFSGYGQNGNGQSVGFKTYGVNTTFKD  371



>ref|XP_011071083.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=628

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 158/214 (74%), Gaps = 2/214 (1%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G++PFTPK Y++RYW  +ISN+LP P FL++ ASPLTAA+YA F K+   D+N+L+  LP
Sbjct  32   GENPFTPKGYVVRYWKKQISNNLPEPSFLLDKASPLTAAEYASFCKLVN-DQNALSTHLP  90

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
             FC+ A+L+CFPDLSPS L KH DNV+F +Y  +NFTNYG     G DSFKNY+   N+ 
Sbjct  91   LFCTKANLICFPDLSPS-LEKHMDNVDFATYLNKNFTNYGGDRLGGVDSFKNYSDGDNVV  149

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D FRRYSRD+  H ++F++YAT  N+ADQSF  YG A+ GG GEF NY   VNVPNLRF
Sbjct  150  SDNFRRYSRDAVGHNEKFTSYATEVNMADQSFSGYGTASTGGDGEFSNYNHGVNVPNLRF  209

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
              Y+D+++GRKQ F  Y+ + N GDQ FTSYGKN
Sbjct  210  NEYADNSNGRKQIFTEYTTDINAGDQTFTSYGKN  243


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYG     G D+F +Y  + N P +TF+ Y  + ++  + F +Y +  NV    F +
Sbjct  264  NFKNYGETGNGGNDTFTSYGDETNNPQNTFKNYGAEGNSAVESFKSYRSDSNVGGDDFRS  323

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            YG  +     +F  YA+DV   N +F+ Y +DA  +  +FK Y+ N
Sbjct  324  YGKQSNAAQMDFATYAQDVTDGNTKFSGYGEDASAQTVDFKQYALN  369


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG +S     +FKNY    N   DTF  Y  +++   + F NY   GN A +SF +Y
Sbjct  251  FTNYGKNSNVMGSNFKNYGETGNGGNDTFTSYGDETNNPQNTFKNYGAEGNSAVESFKSY  310

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G  +F +Y K  N   + F  Y+ D      +F  Y E+A+    +F  Y  N
Sbjct  311  RSDSNVGGDDFRSYGKQSNAAQMDFATYAQDVTDGNTKFSGYGEDASAQTVDFKQYALN  369


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG +     + F NY  + N+    F+ Y    +   D F++Y    N    +F 
Sbjct  235  QTFTSYGKNGNGATNEFTNYGKNSNVMGSNFKNYGETGNGGNDTFTSYGDETNNPQNTFK  294

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG         F +Y  D NV    F +Y   ++  + +F +Y+++   G+  F+ YG+
Sbjct  295  NYGAEGNSAVESFKSYRSDSNVGGDDFRSYGKQSNAAQMDFATYAQDVTDGNTKFSGYGE  354

Query  5    N  3
            +
Sbjct  355  D  355



>ref|XP_003519820.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=628

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 151/211 (72%), Gaps = 3/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA+ IRYW+ +I + LP+P FL++ ASPL+AA+ A F K+     NSL+ +LPEFC
Sbjct  33   PFTPKAFAIRYWDKEIRSGLPKPPFLVSKASPLSAAEAAAFLKLVSG--NSLSTRLPEFC  90

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            ++A LLCFP++ P  L KHD + NF  Y   NFTNYG+    G DSFKNY+   N+PV+ 
Sbjct  91   AAAKLLCFPEVGPR-LEKHDKDANFAVYRDNNFTNYGTGRPGGLDSFKNYSEGENIPVND  149

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRDS+ H D F +Y T GNV  QSFHTY     GG GEF +YA + NVPNL FT+Y
Sbjct  150  FRRYSRDSAGHKDGFLSYGTNGNVVQQSFHTYAAGATGGTGEFKHYADETNVPNLGFTSY  209

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            SD+A+GR Q F SYSEN N G+Q FTSYGKN
Sbjct  210  SDNANGRTQSFSSYSENGNAGEQTFTSYGKN  240


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 67/135 (50%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FTSY        Q+F++Y  +  AG  +F +Y  + N P + F  Y  +S+     F
Sbjct  203  NLGFTSYSDNANGRTQSFSSYSENGNAGEQTFTSYGKNGNGPTNVFASYGTESNVVGSGF  262

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            SNYA   N A+ +F  YG         F NYA   N    RF++Y D A+     F SY+
Sbjct  263  SNYAETANAANDTFKGYGIDMNNPTNTFSNYAAGGNGAVERFSSYRDKANVGADSFTSYA  322

Query  50   ENANVGDQNFTSYGK  6
            + AN  D  F++YGK
Sbjct  323  KAANAADIGFSNYGK  337


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +YG+ S      F NY    N   DTF+ Y  D +  T+ FSNYA GGN A + F +Y
Sbjct  248  FASYGTESNVVGSGFSNYAETANAANDTFKGYGIDMNNPTNTFSNYAAGGNGAVERFSSY  307

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQ-NFTSYGKN  3
                  GA  F +YAK  N  ++ F+ Y    +     F +Y+++++   +  FTSYG N
Sbjct  308  RDKANVGADSFTSYAKAANAADIGFSNYGKSFNEGTDTFTTYAKSSDGETKVGFTSYGVN  367



>ref|XP_004298578.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=624

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 156/217 (72%), Gaps = 3/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            +A   +PF+PK YL RYWN ++ ND   P FL++ ASPL+A Q A F+K+A    N+L  
Sbjct  28   IAGDQNPFSPKGYLTRYWNKEVRNDAVGPTFLLSKASPLSAVQSASFAKLA--SENALQT  85

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            +LPEFCS+A LLCFPDL   SL KH  + +FT Y  +NFTNYG+   AGADSFKNY++  
Sbjct  86   KLPEFCSAAKLLCFPDLG-ESLEKHVKDASFTGYSGRNFTNYGTDRLAGADSFKNYSLGE  144

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            NLPVD+FRRYSRDS  H D+F+NYA  GNV DQSF++Y      G G+F  YA   NVPN
Sbjct  145  NLPVDSFRRYSRDSVNHKDKFNNYAADGNVIDQSFNSYAAGATSGTGDFKRYADSTNVPN  204

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT+YSDD++GR Q F +YSENAN G Q+FTSY K+
Sbjct  205  LRFTSYSDDSNGRAQSFTAYSENANAGQQSFTSYAKH  241


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   S   A SF  Y+ + N    +F  Y++  +   + F+ Y T  NVA   F  Y
Sbjct  207  FTSYSDDSNGRAQSFTAYSENANAGQQSFTSYAKHGNGAPNEFTGYGTSSNVAASDFTGY  266

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
              +  G    F NY  D N P  RF +Y D  +   ++F +Y + ANVG+ +F SYGKN
Sbjct  267  SESGNGINDTFTNYGNDENNPTERFKSYGDGGNAGSEKFSNYRDKANVGESSFQSYGKN  325


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y  H     + F  Y    N+    F  YS   +   D F+NY    N   + F 
Sbjct  233  QSFTSYAKHGNGAPNEFTGYGTSSNVAASDFTGYSESGNGINDTFTNYGNDENNPTERFK  292

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G+ +F NY    NV    F +Y  +++  K  F +Y ++ N G ++FT YGK
Sbjct  293  SYGDGGNAGSEKFSNYRDKANVGESSFQSYGKNSNSDKVSFVNYGKSFNNGSESFTGYGK  352


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 49/106 (46%), Gaps = 0/106 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +FT Y        D+F NY  D N P + F+ Y    +A +++FSNY    NV + SF +
Sbjct  262  DFTGYSESGNGINDTFTNYGNDENNPTERFKSYGDGGNAGSEKFSNYRDKANVGESSFQS  321

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            YG  +      F NY K  N  +  FT Y   + G    FK Y  N
Sbjct  322  YGKNSNSDKVSFVNYGKSFNNGSESFTGYGKGSQGGSVGFKIYGFN  367


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 63/135 (47%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FTSY        Q+FT Y  ++ AG  SF +Y    N   + F  Y   S+     F
Sbjct  204  NLRFTSYSDDSNGRAQSFTAYSENANAGQQSFTSYAKHGNGAPNEFTGYGTSSNVAASDF  263

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y+  GN  + +F  YG         F +Y    N  + +F+ Y D A+  +  F+SY 
Sbjct  264  TGYSESGNGINDTFTNYGNDENNPTERFKSYGDGGNAGSEKFSNYRDKANVGESSFQSYG  323

Query  50   ENANVGDQNFTSYGK  6
            +N+N    +F +YGK
Sbjct  324  KNSNSDKVSFVNYGK  338



>ref|XP_006365227.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=629

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 162/223 (73%), Gaps = 8/223 (4%)
 Frame = -1

Query  656  IVAVGDS----PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADR  489
            +V  GD     PFTPK YLIRYW  +ISN+LP+PWFL+N ASPL AAQYA ++K+  AD+
Sbjct  23   VVVAGDGESGNPFTPKGYLIRYWKKQISNELPKPWFLLNKASPLNAAQYATYTKLV-ADQ  81

Query  488  NSLAAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHS-AAGADSFK  312
            N+L  QL  FCSSA+L+C PDLSPS L KH   ++F +Y  +NFTNYG++    G ++FK
Sbjct  82   NALTTQLHTFCSSANLMCAPDLSPS-LEKHSGEIHFATYSDKNFTNYGTNEPGIGVNTFK  140

Query  311  NYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAK  132
            NY+   N+PV++FRRY R  S   ++F NYA  GNV DQSF++Y  +TAGG+GEF NYA 
Sbjct  141  NYSDGENIPVNSFRRYGR-GSPRDNKFDNYAPDGNVIDQSFNSYSTSTAGGSGEFTNYAA  199

Query  131  DVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            + NVPNL FT+YSD   G +Q+F +YS+ AN GDQ F SYGKN
Sbjct  200  NTNVPNLHFTSYSDQGTGGEQKFTTYSQQANAGDQYFKSYGKN  242


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F +YG +       F +Y  D N+   TF  Y + ++    +F++Y   GNV +  F 
Sbjct  234  QYFKSYGKNGNGANGEFVSYGNDTNVLGSTFTNYGQTANGEDQKFTSYGFNGNVPENHFT  293

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G +  F +Y    NV +  FT Y  DA+G +  F +Y ++ N G   FT+YGK
Sbjct  294  NYGVGGNGPSETFTSYRDQSNVGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGK  353


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 46/105 (44%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG  +      F +Y  + N+P + F  Y    +  ++ F++Y    NV D +F TY
Sbjct  264  FTNYGQTANGEDQKFTSYGFNGNVPENHFTNYGVGGNGPSETFTSYRDQSNVGDDTFTTY  323

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
                 GG   F NY +  N     FT Y    +     FK+Y  N
Sbjct  324  VKDANGGEANFTNYGQSFNEGTDVFTTYGKGGNDPHINFKTYGVN  368



>ref|XP_006365226.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=625

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = -1

Query  644  GDS--PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            GDS  PFTPKAY IRYWN +ISN LP+PWFL+N ASPL AAQ+A +SK+A  D+ SL+ +
Sbjct  26   GDSVNPFTPKAYSIRYWNKRISNKLPKPWFLLNKASPLNAAQFAKYSKLATGDQESLSNE  85

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            +  FCSSA+LLCFPD+S +SL KH  +  F+SY  +NFTNYG+    G DSFK Y  + N
Sbjct  86   IQSFCSSANLLCFPDIS-TSLDKHGQDTQFSSYTSKNFTNYGNKLPGGFDSFKKYAENDN  144

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAG-GAGEFGNYAKDVNVPN  114
            LPV++FR+YSR  + H D FS YA  GNV DQSF+TYG   A  G G+F  Y  +VNVPN
Sbjct  145  LPVNSFRQYSRGGAGHDDIFSTYAPNGNVIDQSFNTYGTGLAAFGVGQFKIYGPNVNVPN  204

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT YS +  GRKQ F SYS++ N G Q+FTSY +N
Sbjct  205  LRFTTYSTEGVGRKQSFTSYSKDTNSGSQSFTSYARN  241


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT Y +       SF +Y+ D N    +F  Y+R+++   + F++YA   NV   +F  Y
Sbjct  207  FTTYSTEGVGRKQSFTSYSKDTNSGSQSFTSYARNANGAVNDFTSYANNSNVIGSTFTNY  266

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
            G +  GG   F +Y  + NVP   F +Y    +   + F +Y + +NVGD NF SY
Sbjct  267  GESENGGGNTFNSYGSNANVPKNTFKSYGLSGNAPFETFINYRDKSNVGDDNFVSY  322


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y  ++    + F +Y  + N+   TF  Y    +   + F++Y +  NV   +F 
Sbjct  233  QSFTSYARNANGAVNDFTSYANNSNVIGSTFTNYGESENGGGNTFNSYGSNANVPKNTFK  292

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +YG +       F NY    NV +  F +Y DD +  +  F++Y ++   G   F+ YG
Sbjct  293  SYGLSGNAPFETFINYRDKSNVGDDNFVSYVDDPNSGRAHFQNYGQSFGEGSDGFSKYG  351



>ref|XP_004238669.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum lycopersicum]
Length=622

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = -1

Query  644  GDS--PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            GDS  PFTPKAY IRYWN +ISN LP+PWFL+N ASPL AAQ+A +SK+A  D+ SL+ +
Sbjct  26   GDSVNPFTPKAYSIRYWNKRISNKLPKPWFLLNKASPLNAAQFAKYSKLATGDQESLSNE  85

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            +  FCSSA+LLCFPD+S +SL KH  +  F+SY  +NFTNYG+    G DSFK Y  + N
Sbjct  86   IQSFCSSANLLCFPDIS-TSLDKHGQDTQFSSYMSKNFTNYGNKLPRGFDSFKKYAENDN  144

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAG-GAGEFGNYAKDVNVPN  114
            LPV++FR+YSR  + H D FS YA  GNV DQSF+TYG   A  G G+F  Y  +VNVPN
Sbjct  145  LPVNSFRQYSRGGAGHDDIFSTYAPNGNVIDQSFNTYGTGLAAFGVGQFKIYGANVNVPN  204

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT YS +  GRKQ F SYS++ N G Q+FTSY +N
Sbjct  205  LRFTTYSTEGVGRKQSFTSYSKDTNSGTQSFTSYARN  241


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 0/116 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT Y +       SF +Y+ D N    +F  Y+R+++     F++YA   NV   +F  Y
Sbjct  207  FTTYSTEGVGRKQSFTSYSKDTNSGTQSFTSYARNANGADSDFTSYANNSNVIGSTFTNY  266

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
            G +  GG   F +Y  + NVP   F +Y    +   + F +Y + +NVG  NF SY
Sbjct  267  GESENGGGYTFNSYGSNANVPKNTFKSYGLSGNAPFETFINYRDKSNVGHDNFVSY  322


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = -1

Query  383  FTSYE------FQNFTNYGSHSAAGADS-FKNYTVDVNLPVDTFRRYSRDSSAHTDRFSN  225
            FTSY        Q+FT+Y + +A GADS F +Y  + N+   TF  Y    +     F++
Sbjct  221  FTSYSKDTNSGTQSFTSY-ARNANGADSDFTSYANNSNVIGSTFTNYGESENGGGYTFNS  279

Query  224  YATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            Y +  NV   +F +YG +       F NY    NV +  F +Y DD +  +  F++Y ++
Sbjct  280  YGSNANVPKNTFKSYGLSGNAPFETFINYRDKSNVGHDNFVSYVDDPNSGRAHFQNYGQS  339

Query  44   ANVGDQNFTSYG  9
               G  +F+ YG
Sbjct  340  FGEGSDDFSKYG  351



>ref|XP_011034135.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=636

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 155/215 (72%), Gaps = 4/215 (2%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G+SPFTPKA L+RYW  +I   LP+  FLI+ ASPL     A F+K+A   +N+L+AQLP
Sbjct  34   GESPFTPKASLVRYWKKEIHTVLPKSGFLISKASPLNPVDLATFAKLAS--QNALSAQLP  91

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
             FCSSA L CFPDLSPS L KHD + +F  Y  +NFTNYG+  A GADSFKNY+   N+P
Sbjct  92   AFCSSAKLFCFPDLSPS-LEKHDHDSHFAIYNNKNFTNYGTDRAGGADSFKNYSDGDNIP  150

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRY RD++ H + FSNYA   NV DQSF+TYG +  GG GEF  Y  +VN PNLRF
Sbjct  151  VDSFRRYGRDAAGHGETFSNYAPESNVVDQSFNTYGASATGGTGEFKGYNVEVNNPNLRF  210

Query  104  TAYSDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
             +YSD A+G+ Q+F +Y+ENAN G  Q FTSYGKN
Sbjct  211  ASYSDSANGKGQKFSTYTENANAGPGQAFTSYGKN  245


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 56/123 (46%), Gaps = 6/123 (5%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +FTNYG  +    D+FK+Y  D N+P + F  Y    +A    F+ Y    NV D SF +
Sbjct  266  DFTNYGETANGANDTFKSYGFDGNVPQNNFVNYGDGGNAGVHSFATYREKSNVGDDSFQS  325

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN------ANVGDQNF  21
            Y   +      F NY K  N    +F+ Y + A G++  FK Y  N      AN  D  F
Sbjct  326  YAKNSNAEKANFANYGKSFNEGTDKFSGYGNGAMGQRIGFKIYGVNTTFKDYANKKDVTF  385

Query  20   TSY  12
              Y
Sbjct  386  AGY  388


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG +     + F  Y    N+    F  Y   ++   D F +Y   GNV   +F 
Sbjct  237  QAFTSYGKNGNGVPNEFSGYGTGSNVIGSDFTNYGETANGANDTFKSYGFDGNVPQNNFV  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             YG     G   F  Y +  NV +  F +Y+ +++  K  F +Y ++ N G   F+ YG
Sbjct  297  NYGDGGNAGVHSFATYREKSNVGDDSFQSYAKNSNAEKANFANYGKSFNEGTDKFSGYG  355



>ref|XP_007157462.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
 gb|ESW29456.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
Length=626

 Score =   248 bits (633),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 159/219 (73%), Gaps = 6/219 (3%)
 Frame = -1

Query  650  AVGD---SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSL  480
            AVGD   +PFTPKAY +RYW+ +I + LP+P FL + ASPL+AA+ AVF K+A   +N+L
Sbjct  23   AVGDGEKNPFTPKAYAVRYWDKEIRSTLPKPPFLFSKASPLSAAESAVFVKLA--GQNAL  80

Query  479  AAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTV  300
              +LPEFC++A LLCFP+++PS L KHD + NF  Y  +NFTNYG+    G DSFKNY+ 
Sbjct  81   DKRLPEFCAAAKLLCFPEVAPS-LEKHDKDSNFAVYRDKNFTNYGTGRPGGVDSFKNYSE  139

Query  299  DVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNV  120
              N+PV+ FRRYSRDS+ H D F +Y T GNV  QSFHTYG    GG GEF  Y+   NV
Sbjct  140  GENIPVNDFRRYSRDSAGHKDNFLSYGTDGNVVQQSFHTYGAGATGGTGEFKRYSDQTNV  199

Query  119  PNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            PNL FT+YSDDA+GR Q F SYSEN N G+Q F+SYGKN
Sbjct  200  PNLDFTSYSDDANGRTQTFSSYSENGNAGEQTFSSYGKN  238


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 68/135 (50%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N++FTSY        Q F++Y  +  AG  +F +Y  + N P + F  Y  +S+     F
Sbjct  201  NLDFTSYSDDANGRTQTFSSYSENGNAGEQTFSSYGKNGNGPTNAFASYGTESNVVGSGF  260

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            SNYA   N A+ +F  YG         F NYA   N    RF+ Y D A+     F SY+
Sbjct  261  SNYAENTNAANDTFKGYGVDMNNPTNTFSNYAAGGNGAVERFSNYRDKANVGADTFASYA  320

Query  50   ENANVGDQNFTSYGK  6
            ++AN GD  F++YGK
Sbjct  321  KSANAGDIGFSNYGK  335


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +YG+ S      F NY  + N   DTF+ Y  D +  T+ FSNYA GGN A + F  Y
Sbjct  246  FASYGTESNVVGSGFSNYAENTNAANDTFKGYGVDMNNPTNTFSNYAAGGNGAVERFSNY  305

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQ-NFTSYGKN  3
                  GA  F +YAK  N  ++ F+ Y    +     F SY++++N   +  FTSYG N
Sbjct  306  RDKANVGADTFASYAKSANAGDIGFSNYGKSFNEGTDTFSSYAKSSNGETKVGFTSYGVN  365



>ref|NP_001234835.1| polygalacturonase-1 non-catalytic subunit beta precursor [Solanum 
lycopersicum]
 sp|Q40161.1|GP1_SOLLC RecName: Full=Polygalacturonase-1 non-catalytic subunit beta; 
AltName: Full=AroGP1; AltName: Full=Polygalacturonase converter; 
Short=PG converter; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34181.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
 gb|AAB39547.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
Length=630

 Score =   248 bits (633),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 161/223 (72%), Gaps = 8/223 (4%)
 Frame = -1

Query  656  IVAVGDS----PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADR  489
            +V  GD     PFTPK YLIRYW  +ISNDLP+PWFL+N ASPL AAQYA ++K+  AD+
Sbjct  24   VVVGGDGESGNPFTPKGYLIRYWKKQISNDLPKPWFLLNKASPLNAAQYATYTKLV-ADQ  82

Query  488  NSLAAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHS-AAGADSFK  312
            N+L  QL  FCSSA+L+C PDLSPS L KH  +++F +Y  +NFTNYG++    G ++FK
Sbjct  83   NALTTQLHTFCSSANLMCAPDLSPS-LEKHSGDIHFATYSDKNFTNYGTNEPGIGVNTFK  141

Query  311  NYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAK  132
            NY+   N+PV++FRRY R  S   ++F NYA+ GNV DQSF++Y  +TAGG+G+F NYA 
Sbjct  142  NYSEGENIPVNSFRRYGR-GSPRDNKFDNYASDGNVIDQSFNSYSTSTAGGSGKFTNYAA  200

Query  131  DVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            + N PNL FT+YSD   G  Q+F  YS+ AN GDQ F SYGKN
Sbjct  201  NANDPNLHFTSYSDQGTGGVQKFTIYSQEANAGDQYFKSYGKN  243


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 70/152 (46%), Gaps = 20/152 (13%)
 Frame = -1

Query  401  HDDNVNFTSYE------FQNFTNYGSHSAAGADSFKNYTV--------------DVNLPV  282
            +D N++FTSY        Q FT Y   + AG   FK+Y                D N+  
Sbjct  203  NDPNLHFTSYSDQGTGGVQKFTIYSQEANAGDQYFKSYGKNGNGANGEFVSYGNDTNVIG  262

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
             TF  Y + ++    +F++Y   GNV +  F  YG    G +  F +Y    NV +  FT
Sbjct  263  STFTNYGQTANGGDQKFTSYGFNGNVPENHFTNYGAGGNGPSETFNSYRDQSNVGDDTFT  322

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             Y  DA+G +  F +Y ++ N G   FT+YGK
Sbjct  323  TYVKDANGGEANFTNYGQSFNEGTDVFTTYGK  354


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 47/105 (45%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG  +  G   F +Y  + N+P + F  Y    +  ++ F++Y    NV D +F TY
Sbjct  265  FTNYGQTANGGDQKFTSYGFNGNVPENHFTNYGAGGNGPSETFNSYRDQSNVGDDTFTTY  324

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
                 GG   F NY +  N     FT Y    +     FK+Y  N
Sbjct  325  VKDANGGEANFTNYGQSFNEGTDVFTTYGKGGNDPHINFKTYGVN  369



>ref|XP_007224206.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
 gb|EMJ25405.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
Length=620

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 154/214 (72%), Gaps = 3/214 (1%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G+SPFTPKA+LIRYWN  + ND  +P FL++ ASPLTA   A F+++A   +N+L+ +L 
Sbjct  34   GESPFTPKAHLIRYWNKAVQNDAQKPSFLLSKASPLTAVDSAAFAQLAA--QNALSTRLQ  91

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            EFCSSA+LLCFPD+   SL  HD + NFT+Y  +NFTNYG+   AG DSFKNY+V     
Sbjct  92   EFCSSANLLCFPDVG-QSLENHDGDTNFTAYSTKNFTNYGTARWAGVDSFKNYSVGDTSQ  150

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSRDS  HTD F++Y    N+ DQSF++Y      G GEF NYA  VNVPNLRF
Sbjct  151  VDSFRRYSRDSVNHTDDFNSYGPEANLVDQSFNSYATGAIAGTGEFKNYADSVNVPNLRF  210

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +YSDD+ GR   F +YSENAN GDQ+FTSY K+
Sbjct  211  NSYSDDSTGRAHAFTAYSENANAGDQSFTSYSKH  244


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 75/163 (46%), Gaps = 12/163 (7%)
 Frame = -1

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVN----FTSYEF------QNFTNYGSHSAAGADSF  315
            EF + AD +  P+L  +S S  DD+      FT+Y        Q+FT+Y  H     + F
Sbjct  195  EFKNYADSVNVPNLRFNSYS--DDSTGRAHAFTAYSENANAGDQSFTSYSKHGNGAPNEF  252

Query  314  KNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYA  135
              Y  D N     F  YS   +   D+F+NY    N     F +YG ++      F +Y 
Sbjct  253  TGYGTDANSVGSGFTGYSEAVNGADDKFNNYGNDQNNPQNKFKSYGDSSNAAVETFTSYR  312

Query  134  KDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               NV +  F +Y+ ++DG K  F +Y ++  VG   FT YGK
Sbjct  313  DSANVGDDSFQSYAKNSDGEKVNFVNYGKSFEVGSDKFTGYGK  355


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 64/150 (43%), Gaps = 13/150 (9%)
 Frame = -1

Query  428  DLSPSSLSKHDDNV--NFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTF  273
            D S +S SKH +     FT Y          FT Y        D F NY  D N P + F
Sbjct  235  DQSFTSYSKHGNGAPNEFTGYGTDANSVGSGFTGYSEAVNGADDKFNNYGNDQNNPQNKF  294

Query  272  RRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYS  93
            + Y   S+A  + F++Y    NV D SF +Y   + G    F NY K   V + +FT Y 
Sbjct  295  KSYGDSSNAAVETFTSYRDSANVGDDSFQSYAKNSDGEKVNFVNYGKSFEVGSDKFTGYG  354

Query  92   DDADGRKQEFKSYSENANVGDQNFTSYGKN  3
              A G    FK Y  N      +F+ Y KN
Sbjct  355  KGARGESVGFKIYGVN-----NSFSDYAKN  379



>ref|XP_006365231.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase non-catalytic 
subunit AroGP3-like [Solanum tuberosum]
Length=628

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 153/212 (72%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK YLIRYWN  +SNDLP+PWFL+N ASPL+AAQYA ++K+  AD+N+L   L  FC
Sbjct  36   PFTPKGYLIRYWNKHVSNDLPKPWFLLNKASPLSAAQYAAYTKLV-ADQNALTTHLQSFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHS-AAGADSFKNYTVDVNLPVD  279
            SSA+L+C PDLSPS L KH  +V+F SY  +NFTNYG+     G +SFKNYT D N PV+
Sbjct  95   SSANLMCAPDLSPS-LEKHKGDVHFVSYGDKNFTNYGTKEFGLGFNSFKNYTEDENFPVN  153

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            +FRRY RDS  H ++F NY  GGN   QSF++Y   T GG+G+F NYA   NVP+L FT+
Sbjct  154  SFRRYGRDS-PHDNQFDNYGPGGNTPVQSFNSYSTNTPGGSGQFTNYAPGANVPDLHFTS  212

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YSD   G +Q+FKSY  + N G Q F SYGK+
Sbjct  213  YSDHGTGGEQQFKSYGNDGNAGQQTFKSYGKD  244


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (45%), Gaps = 14/118 (12%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG+++     +F NY    N     F  Y  + +     F+NY  GGN         
Sbjct  252  FTTYGNNTNVDGSAFTNYGQTANGENQNFTSYGFNGNNPASNFNNYGVGGN---------  302

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            GP+       F +Y    NV +  FT Y  DA+G +  F +Y ++ N G   FT+YGK
Sbjct  303  GPSET-----FTSYRDQSNVGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGK  355



>ref|XP_007153633.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
 gb|ESW25627.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
Length=624

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 157/213 (74%), Gaps = 5/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA + RYW+N + N LP+P FL++ ASP+TAA  A F+K+A A  N+L+ +LPEFC
Sbjct  33   PFTPKASVARYWDNHVRNTLPKPSFLLSKASPMTAADTATFAKLAAA--NTLSTRLPEFC  90

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSY-EFQNFTNYGSHSAAGADSFKNYTVDV-NLPV  282
            S+A LLCFP++ PS L KH  + NF +Y + QNFTNYG+    G D+FKNY+ D+ ++PV
Sbjct  91   SAAHLLCFPEVRPS-LEKHTQDENFQTYNDGQNFTNYGTARGGGIDTFKNYSNDLLSIPV  149

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            + FRRYSR ++ H + F+ YA+G NVADQSFHTYG  +AGG+GEF NY+ D NVP+LRF+
Sbjct  150  NDFRRYSRGAAGHEETFTGYASGTNVADQSFHTYGTNSAGGSGEFKNYSSDSNVPDLRFS  209

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             YSD   GR Q F  YSE+ N G Q F SYGKN
Sbjct  210  TYSDSTAGRTQSFSRYSEDGNSGGQTFQSYGKN  242


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 58/119 (49%), Gaps = 2/119 (2%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYGS      D+F NY VD+N+P  TF+ Y+  +   T+ F+NY    NV D +F +Y
Sbjct  264  FTNYGSKGTGPNDTFANYGVDMNVPEITFKSYADGTHGGTETFANYRDQSNVGDDTFQSY  323

Query  179  GPATAGGAG-EFGNYAKDVNVPNLRFTAYSDDADG-RKQEFKSYSENANVGDQNFTSYG  9
               T  G   +F NY    N     F  Y+  A+G  K  F  Y  N N   +++   G
Sbjct  324  AKNTKEGTQVDFKNYGNSANPGTDTFKGYAKGAEGDHKVGFTGYGVNTNATFKDYAKEG  382


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 1/121 (1%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F +YG +SA   + F  Y  + N+    F  Y    +   D F+NY    NV + +F 
Sbjct  234  QTFQSYGKNSAGAENEFTGYGTNSNVASSGFTNYGSKGTGPNDTFANYGVDMNVPEITFK  293

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDA-DGRKQEFKSYSENANVGDQNFTSYG  9
            +Y   T GG   F NY    NV +  F +Y+ +  +G + +FK+Y  +AN G   F  Y 
Sbjct  294  SYADGTHGGTETFANYRDQSNVGDDTFQSYAKNTKEGTQVDFKNYGNSANPGTDTFKGYA  353

Query  8    K  6
            K
Sbjct  354  K  354



>gb|KHG01313.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=616

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 3/216 (1%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
             V  +PFTPK+  IRYWN ++  ++P   FL++  SPLTA   A FSK+A    N+LA++
Sbjct  24   GVSGNPFTPKSSFIRYWNKELHKEIPNTHFLLSKVSPLTAVDSASFSKLAA--HNNLASR  81

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            LP FCSSA L CFPDLSPS L KH  +VNF  Y  +NFTNYGS   AG DSFKNY+ + N
Sbjct  82   LPSFCSSAKLFCFPDLSPS-LEKHSKDVNFAVYLDRNFTNYGSDRLAGLDSFKNYSENDN  140

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            + +D+FRRYSRDS+ H D+FSNYA+  NV DQSF+TYG    GG+  F NY  +VNVPNL
Sbjct  141  VVIDSFRRYSRDSAGHKDQFSNYASASNVVDQSFNTYGGDATGGSENFNNYNHEVNVPNL  200

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            RFT+YSDD++G  Q F  Y+E  N G Q+F++YGKN
Sbjct  201  RFTSYSDDSNGHGQTFTHYTEETNAGQQSFSNYGKN  236


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+ YG  +    D+F +Y  D N PV+ F+ Y    +A  D FS+Y    NV D SF +
Sbjct  257  DFSGYGKTANGAKDTFTSYAFDSNNPVNGFKSYGDGGNAAVDSFSSYRDQSNVGDSSFQS  316

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y  ++ G   +F NY +  N    +FT Y   ADG+   FK Y  N    D
Sbjct  317  YAKSSNGAKVDFDNYGQSFNEGTEKFTGYGQGADGQSIGFKIYGRNTTFKD  367


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 58/135 (43%), Gaps = 20/135 (15%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FTSY        Q FT+Y   + AG  SF NY  + N   + F  Y +DS       
Sbjct  199  NLRFTSYSDDSNGHGQTFTHYTEETNAGQQSFSNYGKNGNGVPNDFTSYGKDS-------  251

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
                   NV    F  YG    G    F +YA D N P   F +Y D  +     F SY 
Sbjct  252  -------NVMGSDFSGYGKTANGAKDTFTSYAFDSNNPVNGFKSYGDGGNAAVDSFSSYR  304

Query  50   ENANVGDQNFTSYGK  6
            + +NVGD +F SY K
Sbjct  305  DQSNVGDSSFQSYAK  319



>ref|XP_008221868.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=619

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 153/214 (71%), Gaps = 3/214 (1%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G+SPFTPKA+LIRYWN  + ND  +P FL++ ASPL+A   A F+++A   +N+L+ +L 
Sbjct  34   GESPFTPKAHLIRYWNKAVQNDAEKPSFLLSKASPLSAVDSAAFAQLAA--QNALSTRLQ  91

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            EFCSSA+LLCFPD+   SL  HD + NFT+Y  +NFTNYG+   AG DSFKNY+V     
Sbjct  92   EFCSSANLLCFPDVG-HSLENHDGDTNFTAYSTKNFTNYGTARWAGVDSFKNYSVGDTSQ  150

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSRDS  HTD F++Y    N+ DQSF+ Y      G GEF NYA  VNVPNLRF
Sbjct  151  VDSFRRYSRDSVNHTDDFNSYGPEANLVDQSFNNYATGAIAGTGEFKNYADSVNVPNLRF  210

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +YSDD+ GR   F +YSENAN GDQ+FTSY K+
Sbjct  211  NSYSDDSTGRAHAFTAYSENANAGDQSFTSYSKH  244


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 63/150 (42%), Gaps = 13/150 (9%)
 Frame = -1

Query  428  DLSPSSLSKHDDNV--NFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTF  273
            D S +S SKH +     FT Y          FT Y        D F NY  D N P + F
Sbjct  235  DQSFTSYSKHGNGAPNEFTGYGTDANSVGSGFTGYSEAVNGADDKFNNYGNDQNNPQNKF  294

Query  272  RRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYS  93
            + Y    +A  + F++Y    NV D SF +Y   + G    F NY K   V + +FT Y 
Sbjct  295  KSYGDSGNAAVETFTSYRDSANVGDDSFQSYAKNSEGEKVNFINYGKSFEVGSDKFTGYG  354

Query  92   DDADGRKQEFKSYSENANVGDQNFTSYGKN  3
              A G    FK Y  N      +F+ Y KN
Sbjct  355  KGAHGESVGFKIYGVN-----NSFSDYSKN  379



>ref|XP_002266341.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Vitis vinifera]
Length=633

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 152/216 (70%), Gaps = 3/216 (1%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
              G++PFTP+A L+RYWN +I + LP+  FL++ ASPL+A + A F+K+A   +N+L+  
Sbjct  37   VAGENPFTPRASLLRYWNKQIGSGLPKSTFLLSKASPLSAVESATFTKLAA--QNALSDN  94

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            LP FC SA+LLCFPDL   SL KHD + NF  Y  +NFTNYG+    G D+F  Y+  VN
Sbjct  95   LPAFCKSANLLCFPDLG-QSLEKHDASSNFAVYSNKNFTNYGTDGLGGTDAFTKYSEGVN  153

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            LPVD F+RYSRDS  + D+F NY   GNV DQSF  YG    GG+GEF  Y ++VNVPNL
Sbjct  154  LPVDAFKRYSRDSVGNNDKFDNYGREGNVVDQSFSGYGAGATGGSGEFKKYNEEVNVPNL  213

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            RF +Y+DD +GR+Q F SY+   N GD++F+SYGKN
Sbjct  214  RFNSYTDDGNGRQQSFTSYTNETNSGDESFSSYGKN  249


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 53/118 (45%), Gaps = 5/118 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG    A  D+FK+Y  D N+P + F++Y    +A TD F +Y    NV D SF +Y
Sbjct  271  FTGYGETGNAANDTFKSYGFDGNVPENNFKKYGDGGNAGTDTFISYRDQSNVGDDSFKSY  330

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               +     +F NY K  N     F  Y   A   K  FK Y  N       FT Y K
Sbjct  331  AKNSNSAEVDFVNYGKSFNEGTDTFAGYGKGATNHKINFKIYGVN-----NTFTDYAK  383


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F++YG +     + F +Y    N+   TF  Y    +A  D F +Y   GNV + +F 
Sbjct  241  ESFSSYGKNGNGSPNEFTSYGSSSNVIGSTFTGYGETGNAANDTFKSYGFDGNVPENNFK  300

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG     G   F +Y    NV +  F +Y+ +++  + +F +Y ++ N G   F  YGK
Sbjct  301  KYGDGGNAGTDTFISYRDQSNVGDDSFKSYAKNSNSAEVDFVNYGKSFNEGTDTFAGYGK  360



>ref|XP_003532010.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=627

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 160/218 (73%), Gaps = 6/218 (3%)
 Frame = -1

Query  647  VGD-SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            +GD +PFTPKAY+ RYW+  + N+LP+P FL++ ASP++A+  A F+K+A A  N L+ +
Sbjct  27   LGDKNPFTPKAYVARYWDQHVRNNLPKPSFLLSKASPMSASDTASFAKLAAA--NKLSTR  84

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSY-EFQNFTNYGSHSAAGADSFKNYTVDV  294
            LPEFCS+A LLCFP++ PS L KH ++  F +Y + QNFTNYG+  A G D+FKNY+ ++
Sbjct  85   LPEFCSAAHLLCFPEVRPS-LEKHTEDAGFQTYNDGQNFTNYGTDFAGGIDTFKNYSNEI  143

Query  293  NL-PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
            +  PV+ FRRYSR ++ H +RFS YA+  NVADQSF TYG   AGG+GEF NY+ + NVP
Sbjct  144  STTPVNDFRRYSRGAAGHEERFSAYASDSNVADQSFSTYGTNAAGGSGEFKNYSSNSNVP  203

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +LRFT YSD   GR Q F SYSEN N G Q F SYGKN
Sbjct  204  DLRFTTYSDSTGGRTQSFSSYSENGNAGGQTFQSYGKN  241


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F +YG +SA  A+ F  Y    N+    F  Y +  +   + F+NY    N   ++F 
Sbjct  233  QTFQSYGKNSAGAANDFSAYGTGSNVASSDFTNYGKGGAGPNNTFTNYGVNMNNPTETFQ  292

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +Y   T GG   F NY    NV    F +Y+    G + +FKSY  + N G   F  Y K
Sbjct  293  SYADGTVGGTQSFSNYRDQANVGADSFKSYAKSTSGSEADFKSYGNSFNPGSDTFKGYAK  352


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +FTNYG   A   ++F NY V++N P +TF+ Y+  +   T  FSNY    NV   SF +
Sbjct  262  DFTNYGKGGAGPNNTFTNYGVNMNNPTETFQSYADGTVGGTQSFSNYRDQANVGADSFKS  321

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            Y  +T+G   +F +Y    N  +  F  Y+  A+  K  F +YS   N   +++   G
Sbjct  322  YAKSTSGSEADFKSYGNSFNPGSDTFKGYAKGAEDSKVGFTTYSAYTNATFKDYAKQG  379



>ref|XP_003517743.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=629

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 154/216 (71%), Gaps = 3/216 (1%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            A   +PFTPKA+ IRYW+ +I + L +P FL++ ASPL AA+ A F K+A    N+L+ +
Sbjct  27   AAEKNPFTPKAFAIRYWDKEIRSGLAKPQFLLSKASPLNAAEAAAFVKLASG--NALSTR  84

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            LPEFC++A LLCFP++  SSL KHD + NF  Y  +NFTNYG+    G DSFKNY+   N
Sbjct  85   LPEFCAAAKLLCFPEVG-SSLEKHDKDANFAVYRDKNFTNYGTGRPGGLDSFKNYSEGEN  143

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            +PV+ FRRYSRDS+ H D F +Y T GNV  QSFHTY     GGAGEF  YA + NVPNL
Sbjct  144  IPVNDFRRYSRDSAGHKDGFLSYGTSGNVVQQSFHTYAAGATGGAGEFKRYADETNVPNL  203

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             FT+YSD+A+GR Q F SYSEN N G+Q FTSYGKN
Sbjct  204  GFTSYSDNANGRTQSFTSYSENGNAGEQTFTSYGKN  239


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 75/153 (49%), Gaps = 6/153 (4%)
 Frame = -1

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            EF   AD    P+L  +S S   DN N  +   Q+FT+Y  +  AG  +F +Y  + N P
Sbjct  190  EFKRYADETNVPNLGFTSYS---DNANGRT---QSFTSYSENGNAGEQTFTSYGKNGNGP  243

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             + F  Y  +S+     FSNY    N A+ +F  YG         F NYA   N    RF
Sbjct  244  TNVFTSYGTESNVVGSGFSNYVETANAANDTFKGYGVDMNNPTNTFSNYAGGGNGAVERF  303

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            ++Y D A+     F SY+++AN  D  F++YGK
Sbjct  304  SSYRDKANVGADSFTSYAKSANAADIGFSNYGK  336


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+YG+ S      F NY    N   DTF+ Y  D +  T+ FSNYA GGN A + F +Y
Sbjct  247  FTSYGTESNVVGSGFSNYVETANAANDTFKGYGVDMNNPTNTFSNYAGGGNGAVERFSSY  306

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQ-NFTSYGKN  3
                  GA  F +YAK  N  ++ F+ Y    +     F SY+++++   +  FTSYG N
Sbjct  307  RDKANVGADSFTSYAKSANAADIGFSNYGKSFNEGTDTFTSYAKSSDGETKVGFTSYGVN  366



>ref|XP_009363553.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363554.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X3 [Pyrus x bretschneideri]
Length=632

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 157/213 (74%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PF+PKAYL+RYWN ++ ND  +P FL++ ASPL A   A F+K+A   +N L+ +LPE
Sbjct  38   ENPFSPKAYLVRYWNKEVQNDAEKPSFLLSKASPLDAVGSAAFAKLAA--QNGLSTRLPE  95

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+LLCFPDL+  SL KHD + NF  Y  +NFTNYG+   AG DSFKNY++  NLPV
Sbjct  96   FCSAANLLCFPDLA-QSLEKHDKDANFAVYADKNFTNYGTDRLAGVDSFKNYSLGENLPV  154

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSRDS  H D+F++YA  GNV DQSF+ Y     GGAG+F  YA  VNVP+L F 
Sbjct  155  DSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAGATGGAGDFKKYADSVNVPHLGFN  214

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSDD++GR   F  YSENAN GDQ+FTSY KN
Sbjct  215  SYSDDSNGRSHGFTGYSENANAGDQSFTSYSKN  247


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
              K+ D+VN        F +Y   S   +  F  Y+ + N    +F  YS++ +   + F
Sbjct  199  FKKYADSVNVPHL---GFNSYSDDSNGRSHGFTGYSENANAGDQSFTSYSKNGNGAPNEF  255

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y T  NV    F  YG +  G   +F NY  D N P   F +Y D  +   + F SY 
Sbjct  256  TGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDGGNAGVETFTSYR  315

Query  50   ENANVGDQNFTSYGKN  3
            E ANVGD +F SY KN
Sbjct  316  ERANVGDDSFQSYAKN  331


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y  +     + F  Y  + N+    F  Y +  +   D+F+NY    N    +F 
Sbjct  239  QSFTSYSKNGNGAPNEFTGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFK  298

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F +Y +  NV +  F +Y+ +++G K +F SY ++ N+G   FT YGK
Sbjct  299  SYGDGGNAGVETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGK  358


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 58/131 (44%), Gaps = 3/131 (2%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAH  243
            +P+  + +  N N        FT YG       D F NY  D N P + F+ Y    +A 
Sbjct  251  APNEFTGYGTNANVVG---SGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDGGNAG  307

Query  242  TDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEF  63
             + F++Y    NV D SF +Y   + G   +F +Y K  N+ + +FT Y   A G+   F
Sbjct  308  VETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGKGARGQDIGF  367

Query  62   KSYSENANVGD  30
            K Y  N    D
Sbjct  368  KIYGVNTTFKD  378



>ref|XP_010471031.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
Length=624

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 153/212 (72%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I ++ PR  FLI+ ASPL A   A FSK+A    NSL  + P+FC
Sbjct  36   PFTPKASLVRYWNKEIRSESPRSEFLISKASPLNAVDSATFSKLAAT--NSLPTRFPDFC  93

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL  +SL KH+++V F++YE +NFTNYGS    G DSFKNY+ D N+  D+
Sbjct  94   SAANLFCFPDLG-TSLEKHEEDVKFSTYEQKNFTNYGSGRPGGGDSFKNYSKDGNVETDS  152

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSR+ + H D+FS Y    NV ++ F++YG +  GGAGEF NY  +VN P  RFTAY
Sbjct  153  FRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNNVNNPTSRFTAY  212

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD A+GR Q FK+Y++NAN G  Q+FTSYGKN
Sbjct  213  SDGANGRTQSFKTYTQNANAGPGQSFTSYGKN  244


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y    N+    F  Y  + +A  D F++Y T GNV   +F 
Sbjct  236  QSFTSYGKNGNGIPNEFASYGASSNVVGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG A       F NY    NV +  F++Y+ D+   K +F +Y ++ N G + FT YGK
Sbjct  296  NYGAAGNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGK  355


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+F +Y  D N+P + F+ Y    ++  D FSNY    NV D SF +Y
Sbjct  266  FSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNYRDKANVGDDSFSSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               ++    +F NY +  N  + +FT Y   A+  +  FK+Y+ N+      F  Y KN
Sbjct  326  AKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGAEDSRISFKTYTPNS-----TFKDYAKN  379



>ref|XP_010471032.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=624

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 153/212 (72%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I ++ PR  FLI+ ASPL A   A FSK+A    NSL  + P+FC
Sbjct  36   PFTPKASLVRYWNKEIRSESPRSEFLISKASPLNAVDSATFSKLAAT--NSLPTRFPDFC  93

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL  +SL KH+++V F++YE +NFTNYGS    G DSFKNY+ D N+  D+
Sbjct  94   SAANLFCFPDLG-TSLEKHEEDVKFSTYEQKNFTNYGSGRPGGGDSFKNYSKDGNVETDS  152

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSR+ + H D+FS Y    NV ++ F++YG +  GGAGEF NY  +VN P  RFTAY
Sbjct  153  FRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNNVNNPTSRFTAY  212

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD A+GR Q FK+Y++NAN G  Q+FTSYGKN
Sbjct  213  SDGANGRTQSFKTYTQNANAGPGQSFTSYGKN  244


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F++Y T GNV   +F 
Sbjct  236  QSFTSYGKNGNGIPNEFASYGVSSNVVGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG A       F NY    NV +  F++Y+ D+   K +F +Y ++ N G + FT YGK
Sbjct  296  NYGAAGNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGK  355


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+F +Y  D N+P + F+ Y    ++  D FSNY    NV D SF +Y
Sbjct  266  FSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNYRDKANVGDDSFSSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               ++    +F NY +  N  + +FT Y   A+  +  FK+Y+ N+      F  Y KN
Sbjct  326  AKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGAEDSRISFKTYTPNS-----TFKDYAKN  379



>ref|XP_009363551.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Pyrus x bretschneideri]
Length=646

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 157/213 (74%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PF+PKAYL+RYWN ++ ND  +P FL++ ASPL A   A F+K+A   +N L+ +LPE
Sbjct  38   ENPFSPKAYLVRYWNKEVQNDAEKPSFLLSKASPLDAVGSAAFAKLAA--QNGLSTRLPE  95

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+LLCFPDL+  SL KHD + NF  Y  +NFTNYG+   AG DSFKNY++  NLPV
Sbjct  96   FCSAANLLCFPDLA-QSLEKHDKDANFAVYADKNFTNYGTDRLAGVDSFKNYSLGENLPV  154

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSRDS  H D+F++YA  GNV DQSF+ Y     GGAG+F  YA  VNVP+L F 
Sbjct  155  DSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAGATGGAGDFKKYADSVNVPHLGFN  214

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSDD++GR   F  YSENAN GDQ+FTSY KN
Sbjct  215  SYSDDSNGRSHGFTGYSENANAGDQSFTSYSKN  247


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
              K+ D+VN        F +Y   S   +  F  Y+ + N    +F  YS++ +   + F
Sbjct  199  FKKYADSVNVPHL---GFNSYSDDSNGRSHGFTGYSENANAGDQSFTSYSKNGNGAPNEF  255

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y T  NV    F  YG +  G   +F NY  D N P   F +Y D  +   + F SY 
Sbjct  256  TGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDGGNAGVETFTSYR  315

Query  50   ENANVGDQNFTSYGKN  3
            E ANVGD +F SY KN
Sbjct  316  ERANVGDDSFQSYAKN  331


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y  +     + F  Y  + N+    F  Y +  +   D+F+NY    N    +F 
Sbjct  239  QSFTSYSKNGNGAPNEFTGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFK  298

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F +Y +  NV +  F +Y+ +++G K +F SY ++ N+G   FT YGK
Sbjct  299  SYGDGGNAGVETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGK  358


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 58/131 (44%), Gaps = 3/131 (2%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAH  243
            +P+  + +  N N        FT YG       D F NY  D N P + F+ Y    +A 
Sbjct  251  APNEFTGYGTNANVVG---SGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDGGNAG  307

Query  242  TDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEF  63
             + F++Y    NV D SF +Y   + G   +F +Y K  N+ + +FT Y   A G+   F
Sbjct  308  VETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGKGARGQDIGF  367

Query  62   KSYSENANVGD  30
            K Y  N    D
Sbjct  368  KIYGVNTTFKD  378



>ref|XP_004238668.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2 [Solanum 
lycopersicum]
 sp|P93217.1|GP2_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP2; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39556.1| AROGP2 [Solanum lycopersicum]
Length=629

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 156/212 (74%), Gaps = 6/212 (3%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK Y+IRYWN  +SNDLP+PWFL+N ASPL AAQYA ++K+  AD+N+L+  L  FC
Sbjct  36   PFTPKGYVIRYWNKHVSNDLPKPWFLLNKASPLNAAQYATYTKLV-ADQNALSTHLQSFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHS-AAGADSFKNYTVDVNLPVD  279
            SSA+L+C PDL PS L KH  +++FT+Y  +NFTNYG++    G ++FKNY+ D +  V+
Sbjct  95   SSANLMCAPDLLPS-LEKHTGDIHFTTYGNKNFTNYGTNEPGIGVNTFKNYSEDAS--VN  151

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            +FRRY R  S   ++F NYA  GNV DQSF++Y   T GG+G+F NYA + NVP+LRFTA
Sbjct  152  SFRRYGR-GSPRDNKFDNYAPDGNVIDQSFNSYSTNTPGGSGQFTNYAPNTNVPDLRFTA  210

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YSD   G +QEFK+Y E  N G Q+F SYGKN
Sbjct  211  YSDQGTGGEQEFKTYLEQGNSGGQSFKSYGKN  242


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F +YG +       F +Y  + N+   TF+ Y ++++     F++Y+T GN    +F 
Sbjct  234  QSFKSYGKNGNGADSKFTSYGNETNVAASTFKNYGQNANGENQNFTSYSTNGNNPQNNFK  293

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G +  F NY  + NV + +F+ Y  DA+  +  F +Y ++ N G   F +YGK
Sbjct  294  NYGVGGNGPSETFTNYRDESNVGDDKFSNYVKDANAGEANFTNYGQSFNEGTDVFITYGK  353


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+YG+ +   A +FKNY  + N     F  YS + +   + F NY  GGN   ++F  Y
Sbjct  250  FTSYGNETNVAASTFKNYGQNANGENQNFTSYSTNGNNPQNNFKNYGVGGNGPSETFTNY  309

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G  +F NY KD N     FT Y    +     F +Y +  N    NF +YG N
Sbjct  310  RDESNVGDDKFSNYVKDANAGEANFTNYGQSFNEGTDVFITYGKGGNDPHINFKTYGVN  368


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 52/106 (49%), Gaps = 5/106 (5%)
 Frame = -1

Query  371  EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQS  192
            E QNFT+Y ++     ++FKNY V  N P +TF  Y  +S+   D+FSNY    N  + +
Sbjct  274  ENQNFTSYSTNGNNPQNNFKNYGVGGNGPSETFTNYRDESNVGDDKFSNYVKDANAGEAN  333

Query  191  FHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY  54
            F  YG +   G   F  Y K  N P++ F  Y     G    FK Y
Sbjct  334  FTNYGQSFNEGTDVFITYGKGGNDPHINFKTY-----GVNNTFKDY  374



>ref|XP_006300881.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
 gb|EOA33779.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
Length=625

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 155/214 (72%), Gaps = 4/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+RYWN +I N  PR  FLI+ ASPL A   A FSK+A    NSL  + P+
Sbjct  34   ENPFTPKASLVRYWNKEIRNVSPRSEFLISKASPLNAVDSATFSKLAAT--NSLPTRFPD  91

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL  +SL KH+D+V F++Y+ +NFTNYGS  A GADSFKNY+ D N+  
Sbjct  92   FCSAANLFCFPDLG-ASLEKHEDDVKFSTYDQKNFTNYGSGRAGGADSFKNYSKDANVVT  150

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSR+++ H D+F+ Y    NV ++ F++YG    GGAGEF NY  +VN P  RFT
Sbjct  151  DSFRRYSRNAAGHDDKFTVYGESSNVVEEGFNSYGTFGTGGAGEFTNYQNNVNNPTSRFT  210

Query  101  AYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            AYSD  +GR Q FK+Y+ +AN G+ Q+FTSYGKN
Sbjct  211  AYSDGGNGRSQSFKTYTHDANAGEGQSFTSYGKN  244


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 4/132 (3%)
 Frame = -1

Query  401  HDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            HD N      E Q+FT+YG +     + F +Y    N+    F  Y    +A  D F++Y
Sbjct  228  HDANAG----EGQSFTSYGKNGNGLPNKFASYGASSNVIGSGFSNYGESGNAANDTFTSY  283

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
             T GNV   +F  YG +       F NY    NV +  F++Y+ D++  K  F +Y ++ 
Sbjct  284  GTDGNVPQNNFKNYGASGNSAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSF  343

Query  41   NVGDQNFTSYGK  6
            N G + FT YGK
Sbjct  344  NPGSETFTGYGK  355


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG    A  D+F +Y  D N+P + F+ Y    ++  D F+NY    NV D SF +Y
Sbjct  266  FSNYGESGNAANDTFTSYGTDGNVPQNNFKNYGASGNSAVDTFANYRDKANVGDDSFSSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQN  24
               +      F NY +  N  +  FT Y   A+  K  FK+Y+ N+   D N
Sbjct  326  AKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAENHKISFKTYTPNSTFKDYN  377



>gb|KCW86731.1| hypothetical protein EUGRSUZ_B03343 [Eucalyptus grandis]
Length=610

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 145/211 (69%), Gaps = 2/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKAYL+RYWN +++NDLP+P FL++ ASPLTAA    F+K+A   R +++  LP FC
Sbjct  14   PFTPKAYLVRYWNQRVTNDLPKPPFLLSKASPLTAADAVAFAKLAA--RGAISDHLPSFC  71

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            ++A LLC PDL  + + +HD + NF +Y  +NFT YG++     DSFK Y+VD NLPV +
Sbjct  72   AAARLLCLPDLPSAIVERHDRDSNFAAYSNKNFTAYGANGVGRRDSFKGYSVDENLPVSS  131

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSR S+ H D FS Y   GNVADQSF++YG A+ GG GEF  Y KDVN+PNL F  Y
Sbjct  132  FRRYSRGSTIHRDEFSTYGAQGNVADQSFNSYGVASTGGHGEFIEYNKDVNIPNLNFNNY  191

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
                +GR   F  Y+E  N G + FT+Y +N
Sbjct  192  GSSGEGRSHSFSGYTEGTNAGAETFTTYSRN  222


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYGS     + SF  YT   N   +TF  YSR+ +     F+ YAT  N     F  
Sbjct  187  NFNNYGSSGEGRSHSFSGYTEGTNAGAETFTTYSRNGNRAPSEFTAYATDSNTVGSGFSA  246

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y     G    F +Y  + N P+ RF +Y +  +G  + FK+Y E+ANVG+ +FTSY K+
Sbjct  247  YSQGGDGANNSFTSYGFNGNNPHNRFNSYGNGVNGAVENFKTYRESANVGEDSFTSYVKD  306



>ref|XP_010044636.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=621

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 145/211 (69%), Gaps = 2/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKAYL+RYWN +++NDLP+P FL++ ASPLTAA    F+K+A   R +++  LP FC
Sbjct  25   PFTPKAYLVRYWNQRVTNDLPKPPFLLSKASPLTAADAVAFAKLAA--RGAISDHLPSFC  82

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            ++A LLC PDL  + + +HD + NF +Y  +NFT YG++     DSFK Y+VD NLPV +
Sbjct  83   AAARLLCLPDLPSAIVERHDRDSNFAAYSNKNFTAYGANGVGRRDSFKGYSVDENLPVSS  142

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSR S+ H D FS Y   GNVADQSF++YG A+ GG GEF  Y KDVN+PNL F  Y
Sbjct  143  FRRYSRGSTIHRDEFSTYGAQGNVADQSFNSYGVASTGGHGEFIEYNKDVNIPNLNFNNY  202

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
                +GR   F  Y+E  N G + FT+Y +N
Sbjct  203  GSSGEGRSHSFSGYTEGTNAGAETFTTYSRN  233


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYGS     + SF  YT   N   +TF  YSR+ +     F+ YAT  N     F  
Sbjct  198  NFNNYGSSGEGRSHSFSGYTEGTNAGAETFTTYSRNGNRAPSEFTAYATDSNTVGSGFSA  257

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y     G    F +Y  + N P+ RF +Y +  +G  + FK+Y E+ANVG+ +FTSY K+
Sbjct  258  YSQGGDGANNSFTSYGFNGNNPHNRFNSYGNGVNGAVENFKTYRESANVGEDSFTSYVKD  317



>ref|XP_006365228.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=632

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 159/227 (70%), Gaps = 14/227 (6%)
 Frame = -1

Query  656  IVAVGD--------SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIA  501
            IV  GD        +PFTPK YLIRYW   +SNDLP+PWFL+N ASPL AAQYA ++K+ 
Sbjct  24   IVVAGDGENSGDAGNPFTPKGYLIRYWKKHVSNDLPKPWFLLNKASPLNAAQYATYTKLV  83

Query  500  KADRNSLAAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHS-AAGA  324
             AD+N+L   L  FCSSA+L+C  DLSPS L KH  +++FT+Y  +NFTNYG++    G 
Sbjct  84   -ADQNALTTHLQSFCSSANLMCASDLSPS-LVKHTGDIHFTTYGNKNFTNYGTNEPGIGV  141

Query  323  DSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFG  144
            +SFKNY+ D +  V++FRRY R  S   ++F NYA  GNV DQSF++Y   T GG+G+F 
Sbjct  142  NSFKNYSEDAS--VNSFRRYGR-GSPRDNKFDNYAPDGNVIDQSFNSYSTNTPGGSGKFT  198

Query  143  NYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            NYA + NVP+LRFTAYSD   G +QEFK+Y E  N G Q+F SYGKN
Sbjct  199  NYAPNTNVPDLRFTAYSDQGTGGEQEFKTYLEQGNSGGQSFKSYGKN  245


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F +YG +       F +Y  + N+   TF  Y ++++     F++Y+T GN    +F 
Sbjct  237  QSFKSYGKNGNGADSKFTSYGNETNVAASTFTNYGQNANGENQNFTSYSTNGNNPQNNFR  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G +  F NY    NV + +F  Y  DA+  +  F +Y ++ N G   FT+YGK
Sbjct  297  NYGVGGNGPSETFTNYIDQSNVGDDKFINYVKDANAGEANFTNYGQSFNEGTDVFTTYGK  356


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+YG+ +   A +F NY  + N     F  YS + +   + F NY  GGN   ++F  Y
Sbjct  253  FTSYGNETNVAASTFTNYGQNANGENQNFTSYSTNGNNPQNNFRNYGVGGNGPSETFTNY  312

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G  +F NY KD N     FT Y    +     F +Y +  N    NF +YG N
Sbjct  313  IDQSNVGDDKFINYVKDANAGEANFTNYGQSFNEGTDVFTTYGKGGNDPHINFKTYGVN  371


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 49/114 (43%), Gaps = 0/114 (0%)
 Frame = -1

Query  386  NFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGN  207
            N T+     FTNYG ++     +F +Y+ + N P + FR Y    +  ++ F+NY    N
Sbjct  258  NETNVAASTFTNYGQNANGENQNFTSYSTNGNNPQNNFRNYGVGGNGPSETFTNYIDQSN  317

Query  206  VADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            V D  F  Y      G   F NY +  N     FT Y    +     FK+Y  N
Sbjct  318  VGDDKFINYVKDANAGEANFTNYGQSFNEGTDVFTTYGKGGNDPHINFKTYGVN  371



>ref|XP_011009539.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=633

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 156/216 (72%), Gaps = 3/216 (1%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            A G+SPFT KA LIRYWN +I   LP+  FL++ ASPL+    A FSK+A   +N+L+ Q
Sbjct  32   ANGESPFTAKASLIRYWNKEIHTGLPKAAFLLSKASPLSPVDLATFSKLAS--QNALSTQ  89

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
             P FCSSA L CFPDLSPS L KHD + +F  Y  +NFTNYG+  A GADSFKNY+  +N
Sbjct  90   FPAFCSSAKLFCFPDLSPS-LEKHDQDSHFAFYLNKNFTNYGTGRAGGADSFKNYSDGIN  148

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            LPVD+FRRY RD++ H + FSNYA   NVADQSF+TYG    GG GEF  Y   +N P+L
Sbjct  149  LPVDSFRRYGRDAAGHDETFSNYAPETNVADQSFNTYGAGATGGTGEFKGYNVRINKPDL  208

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            RF +YSD A+G+ Q+F +Y+E+AN GD+ FTSYGKN
Sbjct  209  RFVSYSDGANGKGQKFSTYTEDANAGDEAFTSYGKN  244


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +Y   +      F  YT D N   + F  Y ++ +   + FS Y    NV    F  Y
Sbjct  210  FVSYSDGANGKGQKFSTYTEDANAGDEAFTSYGKNGNGVPNEFSGYGKSSNVIGSDFSNY  269

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G A  G +  F  Y  D NVP   +  Y D  +G    F +Y E +NVGD +F SY KN
Sbjct  270  GEAGNGASDTFKTYGVDGNVPENNYKNYGDGGNGGVDSFANYREKSNVGDDSFQSYAKN  328


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 53/106 (50%), Gaps = 0/106 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG      +D+FK Y VD N+P + ++ Y    +   D F+NY    NV D SF +
Sbjct  265  DFSNYGEAGNGASDTFKTYGVDGNVPENNYKNYGDGGNGGVDSFANYREKSNVGDDSFQS  324

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            Y   +     +F NY K  N    +FT Y   A G++  FK Y  N
Sbjct  325  YAKNSNAQKADFVNYGKSFNEGTDKFTGYGKGAVGQQIGFKIYGVN  370


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + FT+YG +     + F  Y    N+    F  Y    +  +D F  Y   GNV + ++ 
Sbjct  236  EAFTSYGKNGNGVPNEFSGYGKSSNVIGSDFSNYGEAGNGASDTFKTYGVDGNVPENNYK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    GG   F NY +  NV +  F +Y+ +++ +K +F +Y ++ N G   FT YGK
Sbjct  296  NYGDGGNGGVDSFANYREKSNVGDDSFQSYAKNSNAQKADFVNYGKSFNEGTDKFTGYGK  355



>gb|KHG24447.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=628

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 154/216 (71%), Gaps = 4/216 (2%)
 Frame = -1

Query  647  VGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQL  468
            V ++PFTPKA +IRYWN +I  ++ +  FL++  SPLTA   A FSK+A   +N LA+ L
Sbjct  30   VSENPFTPKASVIRYWNKEIRREITKTHFLLSKVSPLTAVDSASFSKLAA--QNDLASHL  87

Query  467  PEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            P FCSSA L CFPDLSPS L KH  +  F  Y   NF+NYG+   AG DSFKNY+ D N+
Sbjct  88   PSFCSSAKLFCFPDLSPS-LEKHPKDERFAVYSNMNFSNYGTDRLAGVDSFKNYSEDSNI  146

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
             VD+F RYSRDS+ H ++F+NYA+ GNV DQ+FH+Y  +  GG+G F NY ++VN PNLR
Sbjct  147  VVDSFHRYSRDSTGHKEQFANYASEGNVVDQNFHSYAASATGGSGNFNNYNREVNNPNLR  206

Query  107  FTAYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            F++Y DD++G  Q F  Y+ENAN G+ Q+F+ YGKN
Sbjct  207  FSSYGDDSNGHGQTFTQYTENANAGNGQSFSGYGKN  242


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG  +    DSF +Y  D N P +TF+ Y    +A  + FS+Y    NV D SF +Y
Sbjct  264  FSGYGEAANGANDSFTSYGFDSNAPQNTFKSYGDGGNAAVNTFSSYRDQSNVGDDSFQSY  323

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               + G   +F NY +  N    +FT Y   A  +   FK Y  N+   D
Sbjct  324  AKNSNGEKVDFSNYGQSFNEGTDKFTGYGQGAVVQSIGFKIYGRNSTFKD  373


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F+ YG +     + F +Y    N+    F  Y   ++   D F++Y    N    +F 
Sbjct  234  QSFSGYGKNGNGVPNEFSSYGKGANVIGSGFSGYGEAANGANDSFTSYGFDSNAPQNTFK  293

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG         F +Y    NV +  F +Y+ +++G K +F +Y ++ N G   FT YG+
Sbjct  294  SYGDGGNAAVNTFSSYRDQSNVGDDSFQSYAKNSNGEKVDFSNYGQSFNEGTDKFTGYGQ  353


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++YG  +      F  Y    N   D+F  Y  DS+A  + F +Y  GGN A  +F +Y
Sbjct  250  FSSYGKGANVIGSGFSGYGEAANGANDSFTSYGFDSNAPQNTFKSYGDGGNAAVNTFSSY  309

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G   F +YAK+ N   + F+ Y    +    +F  Y + A V    F  YG+N
Sbjct  310  RDQSNVGDDSFQSYAKNSNGEKVDFSNYGQSFNEGTDKFTGYGQGAVVQSIGFKIYGRN  368



>gb|AAL08244.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
 gb|AAN18083.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
Length=517

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 153/214 (71%), Gaps = 4/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+RYWN +I    PR  FLI+ ASPL A   A FSK+A A  NSL  + P+
Sbjct  34   ENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNAVDSATFSKLAAA--NSLPTRFPD  91

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL  +SL KHDD+V F+ Y+ +NFTNYG+  A GADSFKNY+ D N+  
Sbjct  92   FCSAANLFCFPDLG-ASLEKHDDDVKFSVYDQKNFTNYGNARAGGADSFKNYSKDGNVVT  150

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSR+++ H D+F+ Y    NV ++ F++YG    GGAG+F NY  +VN P  RFT
Sbjct  151  DSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFT  210

Query  101  AYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            AYSD  +GR Q FK+Y+  AN G+ Q+FTSYGKN
Sbjct  211  AYSDGGNGRSQTFKTYTHEANAGNGQSFTSYGKN  244


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +F+
Sbjct  236  QSFTSYGKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFN  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +       F NY    NV +  F++Y+ D++  K  F +Y ++ N G + FT YGK
Sbjct  296  NYGASGNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGK  355


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG    A  D+F +Y  D N+P + F  Y    +A  D F+NY    NV D SF +Y
Sbjct  266  FSNYGESGNAANDTFTSYGSDGNVPQNNFNNYGASGNAAVDTFANYRDKANVGDDSFSSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +      F NY +  N  +  FT Y   A+G K  FK+Y+ N+   D
Sbjct  326  AKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGSKLSFKTYTPNSTFKD  375



>ref|XP_002314620.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
 gb|EEF00791.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
Length=633

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 156/216 (72%), Gaps = 3/216 (1%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            A G+SPFT KA LIRYWN +I   LP+  FL++ ASPL+    A FSK+A   +N+L+ Q
Sbjct  32   ANGESPFTAKASLIRYWNKEIHTGLPKSAFLLSKASPLSPVDLATFSKLAS--QNALSTQ  89

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
             P FCSSA L CFPDLSPS L KHD + +F  Y  +NFTNYG+  A GADSFKNY+  VN
Sbjct  90   FPAFCSSAKLFCFPDLSPS-LEKHDQDSHFAFYFNKNFTNYGTGRAGGADSFKNYSDGVN  148

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            LPVD+FRRY RD++ H + FSNYA   NVADQSF+TYG    GG GEF  Y   +N P+L
Sbjct  149  LPVDSFRRYGRDAAGHDETFSNYAPETNVADQSFNTYGAGATGGTGEFKGYNVRINKPDL  208

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            RF +YSD A+G+ Q+F +Y+E+AN GD+ FTSYGKN
Sbjct  209  RFVSYSDGANGKGQKFSTYTEDANAGDEAFTSYGKN  244


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +Y   +      F  YT D N   + F  Y ++ +   + FS Y    NV    F  Y
Sbjct  210  FVSYSDGANGKGQKFSTYTEDANAGDEAFTSYGKNGNGVPNEFSGYGKSSNVIGSDFSNY  269

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G A  G +  F  Y  D NVP   +  Y D  +G    F +Y E +NVGD +F SY KN
Sbjct  270  GEAGNGASDTFKTYGVDGNVPENNYKNYGDGGNGGVDSFANYREKSNVGDDSFQSYAKN  328


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG      +D+FK Y VD N+P + ++ Y    +   D F+NY    NV D SF +
Sbjct  265  DFSNYGEAGNGASDTFKTYGVDGNVPENNYKNYGDGGNGGVDSFANYREKSNVGDDSFQS  324

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y   +     +F NY K  N    +FT Y   A G++  FK Y  N    D
Sbjct  325  YAKNSNAQKADFVNYGKSFNEGTDKFTGYGKGAVGQQIGFKIYGVNTTFKD  375


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + FT+YG +     + F  Y    N+    F  Y    +  +D F  Y   GNV + ++ 
Sbjct  236  EAFTSYGKNGNGVPNEFSGYGKSSNVIGSDFSNYGEAGNGASDTFKTYGVDGNVPENNYK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    GG   F NY +  NV +  F +Y+ +++ +K +F +Y ++ N G   FT YGK
Sbjct  296  NYGDGGNGGVDSFANYREKSNVGDDSFQSYAKNSNAQKADFVNYGKSFNEGTDKFTGYGK  355



>emb|CBI28514.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 146/214 (68%), Gaps = 5/214 (2%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G +PFTPKA L+RYWN +I +DL +  FL++ ASPL+A + A F+K+A   +N+L+  LP
Sbjct  32   GANPFTPKAALVRYWNKQIGSDLQKSTFLLSRASPLSAVESATFTKLAA--QNALSNYLP  89

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
             FC SA+L CFPDL   SL KH  N NF  Y  +NFTNYG+    G DSFKNYT D   P
Sbjct  90   AFCKSANLFCFPDLG-QSLEKHGPNSNFAVYSNKNFTNYGTGGHGGTDSFKNYT-DY-FP  146

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSRDS+ H D F NY   GN  D SF+ YG     G GEF  Y+++ NVPN+RF
Sbjct  147  VDSFRRYSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSGATRGVGEFKKYSEESNVPNVRF  206

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +YS D + RKQ F+SYS  +N GDQ FTSYGKN
Sbjct  207  NSYSSDGNTRKQSFRSYSTESNAGDQYFTSYGKN  240



>gb|KDO82432.1| hypothetical protein CISIN_1g044596mg [Citrus sinensis]
Length=644

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 161/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            ++   ++PF+PKAYL+RYW+  +S + P+P FL++ ASPL A + A +SK+A  ++ +L+
Sbjct  44   VLKGKENPFSPKAYLMRYWDKTVSKNSPKPQFLLSKASPLNAVETATYSKLA--EQKTLS  101

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            + LP FCSSA L CFPDLSPS L KH  + NF  YE +NFTNYG+    G +SFKNY+ D
Sbjct  102  SVLPSFCSSAKLFCFPDLSPS-LEKHGADANFAVYENKNFTNYGTAGLGGVNSFKNYSED  160

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+ VD+FRRYSRDS+ H D+FS YA+  NV D SF+TYG    GGAG+F +Y ++VNVP
Sbjct  161  GNVEVDSFRRYSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVP  220

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            NLRFT+YSD  +GR Q F SY+EN N G ++F+SYGKN
Sbjct  221  NLRFTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKN  258


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 5/125 (4%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NFT+YG    A  D+FK+Y  D N+P   F+ Y    ++  + F++Y    NV   +F +
Sbjct  279  NFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKS  338

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD-----QNFT  18
            Y  ++      F NY +D N  + RF+ Y ++ADG+K  FK Y  + +  D       F 
Sbjct  339  YAKSSNTEKVNFANYQEDFNSVSHRFSGYGENADGQKIGFKVYGPDRSFKDYAKTGVTFA  398

Query  17   SYGKN  3
            SY KN
Sbjct  399  SYSKN  403


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y       A +F +YT + N   ++F  Y ++ +   + F +YA   NV   +F +Y
Sbjct  224  FTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSY  283

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G A       F +Y  D NVP   F +Y D  +   + F SY+  +NVG  NF SY K
Sbjct  284  GEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKSYAK  341


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 0/117 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +Y   S     +F +Y    N   DTF+ Y  D +     F +Y  GGN   +SF +Y
Sbjct  266  FMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             P +  GA  F +YAK  N   + F  Y +D +     F  Y ENA+     F  YG
Sbjct  326  NPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHRFSGYGENADGQKIGFKVYG  382


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F++YG +     + F +Y  + N+    F  Y    +A  D F +Y + GNV +Q+F 
Sbjct  250  ESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFK  309

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F +Y    NV    F +Y+  ++  K  F +Y E+ N     F+ YG+
Sbjct  310  SYGDGGNSGIESFTSYNPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHRFSGYGE  369

Query  5    N  3
            N
Sbjct  370  N  370


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 67/133 (50%), Gaps = 6/133 (5%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FTSY        Q F++Y  ++ +G +SF +Y  + N   + F  Y+++S+     F
Sbjct  221  NLRFTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNF  280

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            ++Y   GN A+ +F +YG         F +Y    N     FT+Y+  ++     FKSY+
Sbjct  281  TSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKSYA  340

Query  50   ENANVGDQNFTSY  12
            +++N    NF +Y
Sbjct  341  KSSNTEKVNFANY  353



>ref|XP_006483847.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
Length=644

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 161/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            ++   ++PF+PKAYL+RYW+  +S + P+P FL++ ASPL A + A +SK+A  ++ +L+
Sbjct  44   VLKGKENPFSPKAYLMRYWDKTVSKNSPKPHFLLSKASPLNAVETATYSKLA--EQKTLS  101

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            + LP FCSSA L CFPDLSPS L KH  + NF  YE +NFTNYG+    G +SFKNY+ D
Sbjct  102  SVLPSFCSSAKLFCFPDLSPS-LEKHGADANFAVYENKNFTNYGTAGLGGVNSFKNYSED  160

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+ VD+FRRYSRDS+ H D+FS YA+  NV D SF+TYG    GGAG+F +Y ++VNVP
Sbjct  161  GNVEVDSFRRYSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVP  220

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            NLRFT+YSD  +GR Q F SY+EN N G ++F+SYGKN
Sbjct  221  NLRFTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKN  258


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y       A +F +YT + N   ++F  Y ++ +   + F +YA   NV   +F +Y
Sbjct  224  FTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSY  283

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G A       F +Y  D NVP   F +Y D  +   + F SY+  +NVG  NF SY K
Sbjct  284  GEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKSYAK  341


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 5/119 (4%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NFT+YG    A  D+FK+Y  D N+P   F+ Y    ++  + F++Y    NV   +F +
Sbjct  279  NFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKS  338

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            Y  ++      F NY +D N  + +F+ Y ++ADG+K  FK Y       D++F  Y K
Sbjct  339  YAKSSNTEKVNFANYQEDFNSVSHKFSGYGENADGQKIGFKVYGP-----DRSFKDYAK  392


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 53/117 (45%), Gaps = 0/117 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +Y   S     +F +Y    N   DTF+ Y  D +     F +Y  GGN   +SF +Y
Sbjct  266  FMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             P +  GA  F +YAK  N   + F  Y +D +    +F  Y ENA+     F  YG
Sbjct  326  NPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHKFSGYGENADGQKIGFKVYG  382


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F++YG +     + F +Y  + N+    F  Y    +A  D F +Y + GNV +Q+F 
Sbjct  250  ESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFK  309

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F +Y    NV    F +Y+  ++  K  F +Y E+ N     F+ YG+
Sbjct  310  SYGDGGNSGIESFTSYNPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHKFSGYGE  369

Query  5    N  3
            N
Sbjct  370  N  370


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 67/133 (50%), Gaps = 6/133 (5%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FTSY        Q F++Y  ++ +G +SF +Y  + N   + F  Y+++S+     F
Sbjct  221  NLRFTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNF  280

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            ++Y   GN A+ +F +YG         F +Y    N     FT+Y+  ++     FKSY+
Sbjct  281  TSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKSYA  340

Query  50   ENANVGDQNFTSY  12
            +++N    NF +Y
Sbjct  341  KSSNTEKVNFANY  353



>ref|XP_006438392.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
 gb|ESR51632.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
Length=644

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 161/218 (74%), Gaps = 3/218 (1%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            ++   ++PF+PKAYL+RYW+  +S + P+P FL++ ASPL A + A +SK+A  ++ +L+
Sbjct  44   VLKGKENPFSPKAYLMRYWDKTVSKNSPKPHFLLSKASPLNAVETATYSKLA--EQKTLS  101

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            + LP FCSSA L CFPDLSPS L KH  + NF  YE +NFTNYG+    G +SFKNY+ D
Sbjct  102  SVLPSFCSSAKLFCFPDLSPS-LEKHGADANFAVYENKNFTNYGTAGLGGVNSFKNYSED  160

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+ VD+FRRYSRDS+ H D+FS YA+  NV D SF+TYG    GGAG+F +Y ++VNVP
Sbjct  161  GNVEVDSFRRYSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVP  220

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            NLRFT+YSD  +GR Q F SY+EN N G ++F+SYGKN
Sbjct  221  NLRFTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKN  258


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y       A +F +YT + N   ++F  Y ++ +   + F +YA   NV   +F +Y
Sbjct  224  FTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSY  283

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G A       F +Y  D NVP   F +Y D  +   + F SY+  +NVG  NF SY K
Sbjct  284  GEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKSYAK  341


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 5/119 (4%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NFT+YG    A  D+FK+Y  D N+P   F+ Y    ++  + F++Y    NV   +F +
Sbjct  279  NFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKS  338

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            Y  ++      F NY +D N  + +F+ Y ++ADG+K  FK Y       D++F  Y K
Sbjct  339  YAKSSNTEKVNFANYQEDFNSVSHKFSGYGENADGQKIGFKVYGP-----DRSFKDYAK  392


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 53/117 (45%), Gaps = 0/117 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +Y   S     +F +Y    N   DTF+ Y  D +     F +Y  GGN   +SF +Y
Sbjct  266  FMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             P +  GA  F +YAK  N   + F  Y +D +    +F  Y ENA+     F  YG
Sbjct  326  NPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHKFSGYGENADGQKIGFKVYG  382


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F++YG +     + F +Y  + N+    F  Y    +A  D F +Y + GNV +Q+F 
Sbjct  250  ESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFK  309

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F +Y    NV    F +Y+  ++  K  F +Y E+ N     F+ YG+
Sbjct  310  SYGDGGNSGIESFTSYNPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHKFSGYGE  369

Query  5    N  3
            N
Sbjct  370  N  370


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 67/133 (50%), Gaps = 6/133 (5%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FTSY        Q F++Y  ++ +G +SF +Y  + N   + F  Y+++S+     F
Sbjct  221  NLRFTSYSDAGNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNF  280

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            ++Y   GN A+ +F +YG         F +Y    N     FT+Y+  ++     FKSY+
Sbjct  281  TSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDGGNSGIESFTSYNPQSNVGANNFKSYA  340

Query  50   ENANVGDQNFTSY  12
            +++N    NF +Y
Sbjct  341  KSSNTEKVNFANY  353



>ref|XP_010415713.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=624

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 152/212 (72%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I ++ PR  FLI+ ASPL A   A FSK+A    NSL  + P+FC
Sbjct  36   PFTPKASLVRYWNKEIRSESPRSDFLISKASPLNAVDSATFSKLAAT--NSLPTRFPDFC  93

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL  +SL KH+ +V F++Y+ +NFTNYGS    G DSFKNY+ D N+  D+
Sbjct  94   SAANLFCFPDLG-TSLEKHEGDVKFSTYDQKNFTNYGSGRPGGGDSFKNYSKDGNVETDS  152

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSR+ + H D+FS Y    NV ++ F++YG +  GGAGEF NY  +VN P  RFTAY
Sbjct  153  FRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNNVNNPTSRFTAY  212

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD A+GR Q FK+Y++NAN G  Q+FTSYGKN
Sbjct  213  SDGANGRTQSFKTYTQNANAGPGQSFTSYGKN  244


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F++Y T GNV   +F 
Sbjct  236  QSFTSYGKNGNGIPNEFASYGVSSNVIGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG A       F NY    NV +  F++Y+ D+   K +F +Y ++ N G + FT YGK
Sbjct  296  NYGAAGNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGK  355


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+F +Y  D N+P + F+ Y    ++  D FSNY    NV D SF +Y
Sbjct  266  FSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNYRDKANVGDDSFSSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               ++    +F NY +  N  + +FT Y   ++G +  FK+Y+ N+      F  Y KN
Sbjct  326  AKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGSEGSRISFKTYTPNS-----TFKEYAKN  379



>ref|XP_008389645.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=632

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 155/213 (73%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PF+PKAYL+RYWN ++ ND  +P FL++ ASPL     A F+K+A   +N L+ +LPE
Sbjct  38   ENPFSPKAYLVRYWNKEVRNDAEKPSFLLSKASPLNTVDSAAFAKLAA--QNGLSTRLPE  95

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+LLCFPDL+  SL KHD + NF  Y  +NFTNYG+   AG DSFKNY++  N+PV
Sbjct  96   FCSAANLLCFPDLA-QSLEKHDKDANFAIYADKNFTNYGTDRLAGVDSFKNYSLGNNIPV  154

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSRDS  H D+F++YA  GNV DQSF+ Y     GGAG+F  YA  VNVP+L F 
Sbjct  155  DSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAGATGGAGDFKKYADSVNVPHLGFN  214

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSDD++GR   F  YSENAN GDQ+FT Y KN
Sbjct  215  SYSDDSNGRSHGFTGYSENANAGDQSFTGYSKN  247


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 64/136 (47%), Gaps = 3/136 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
              K+ D+VN        F +Y   S   +  F  Y+ + N    +F  YS++ +   + F
Sbjct  199  FKKYADSVNVPHL---GFNSYSDDSNGRSHGFTGYSENANAGDQSFTGYSKNGNGAPNEF  255

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y +  NV    F +YG +  G   +F NY  D N P   F +Y D  +   + F SY 
Sbjct  256  TGYGSNANVVGSGFTSYGQSGNGANDKFSNYGNDQNNPKNNFQSYGDGGNAGVETFTSYR  315

Query  50   ENANVGDQNFTSYGKN  3
            E ANVGD +F SY KN
Sbjct  316  ERANVGDDSFQSYAKN  331


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT Y  +     + F  Y  + N+    F  Y +  +   D+FSNY    N    +F 
Sbjct  239  QSFTGYSKNGNGAPNEFTGYGSNANVVGSGFTSYGQSGNGANDKFSNYGNDQNNPKNNFQ  298

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F +Y +  NV +  F +Y+ +++G K +F SY ++ N+G   FT YGK
Sbjct  299  SYGDGGNAGVETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGK  358


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 59/131 (45%), Gaps = 3/131 (2%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAH  243
            +P+  + +  N N        FT+YG       D F NY  D N P + F+ Y    +A 
Sbjct  251  APNEFTGYGSNANVVG---SGFTSYGQSGNGANDKFSNYGNDQNNPKNNFQSYGDGGNAG  307

Query  242  TDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEF  63
             + F++Y    NV D SF +Y   + G   +F +Y K  N+ + +FT Y   A G+   F
Sbjct  308  VETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGKGAKGQDIGF  367

Query  62   KSYSENANVGD  30
            K Y  N    D
Sbjct  368  KIYGVNTTFKD  378



>ref|XP_006392169.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
 gb|ESQ29455.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
Length=622

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 154/218 (71%), Gaps = 3/218 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            +   ++PFTPKA LIRYWN +I+ DLP P F ++ ASPLTA +   F+ +A   R++L  
Sbjct  30   ITASENPFTPKASLIRYWNKRINGDLPNPSFFLSKASPLTAVESTRFASLAS--RHALHT  87

Query  473  QLPEFCSSADLLCFPDLSPSSLS-KHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            +  EFCS+A L CFP+L+  S++ KH D+V+F  Y  +NFTNYGS   +G DSFKNY+  
Sbjct  88   RPSEFCSAAKLFCFPELAAHSIADKHGDDVSFVVYSRKNFTNYGSDRLSGVDSFKNYSGG  147

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+ VD+FRRYSRDS+ H D FSNYA   NVADQSF TY   + GG+G+F +Y  + N P
Sbjct  148  DNIAVDSFRRYSRDSAGHGDGFSNYAGDVNVADQSFTTYATESTGGSGDFTSYHTNANQP  207

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            N RFT+YSD A+GR Q F +YSENAN G Q+FTSY KN
Sbjct  208  NGRFTSYSDKANGRSQSFTAYSENANTGAQSFTSYSKN  245


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + SF  Y+ + N    +F  YS++ +   + FS Y +G NV    F  Y
Sbjct  211  FTSYSDKANGRSQSFTAYSENANTGAQSFTSYSKNGNGAPNGFSGYGSGSNVLKSGFTGY  270

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + N+P   F  Y ++ +G    FK+Y + +N+G  +F+SY K+
Sbjct  271  GETENGANDTFTSYGGNGNLPVNDFKKYGEEGNGAVYGFKNYRDQSNIGVDSFSSYAKD  329


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y  +     + F  Y    N+    F  Y    +   D F++Y   GN+    F 
Sbjct  237  QSFTSYSKNGNGAPNGFSGYGSGSNVLKSGFTGYGETENGANDTFTSYGGNGNLPVNDFK  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F NY    N+    F++Y+ D++  K  F +Y ++ N+G  NFT YG+
Sbjct  297  KYGEEGNGAVYGFKNYRDQSNIGVDSFSSYAKDSNNEKVNFVNYGKSFNLGSDNFTGYGQ  356


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 47/104 (45%), Gaps = 0/104 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       D+F +Y  + NLPV+ F++Y  + +     F NY    N+   SF +Y
Sbjct  267  FTGYGETENGANDTFTSYGGNGNLPVNDFKKYGEEGNGAVYGFKNYRDQSNIGVDSFSSY  326

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
               +      F NY K  N+ +  FT Y     G    FK+Y +
Sbjct  327  AKDSNNEKVNFVNYGKSFNLGSDNFTGYGQGNTGGNVSFKTYGQ  370



>ref|NP_177194.1| polygalacturonase 2 [Arabidopsis thaliana]
 ref|NP_001185361.1| polygalacturonase 2 [Arabidopsis thaliana]
 sp|P92990.2|JP650_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP650; AltName: Full=Aromatic-rich glycoprotein JP650; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC18803.1| Identical to polygalacuronase isoenzyme 1 beta subunit homolog 
mRNA gb|U63373. EST gb|AA404878 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAE98965.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35050.1| polygalacturonase 2 [Arabidopsis thaliana]
 gb|AEE35051.1| polygalacturonase 2 [Arabidopsis thaliana]
Length=626

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 153/214 (71%), Gaps = 4/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+RYWN +I    PR  FLI+ ASPL A   A FSK+A A  NSL  + P+
Sbjct  34   ENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNAVDSATFSKLAAA--NSLPTRFPD  91

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL  +SL KHDD+V F+ Y+ +NFTNYG+  A GADSFKNY+ D N+  
Sbjct  92   FCSAANLFCFPDLG-ASLEKHDDDVKFSVYDQKNFTNYGNARAGGADSFKNYSKDGNVVT  150

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSR+++ H D+F+ Y    NV ++ F++YG    GGAG+F NY  +VN P  RFT
Sbjct  151  DSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFT  210

Query  101  AYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            AYSD  +GR Q FK+Y+  AN G+ Q+FTSYGKN
Sbjct  211  AYSDGGNGRSQTFKTYTHEANAGNGQSFTSYGKN  244


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +F+
Sbjct  236  QSFTSYGKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFN  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +       F NY    NV +  F++Y+ D++  K  F +Y ++ N G + FT YGK
Sbjct  296  NYGASGNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGK  355


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = -1

Query  383  FTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY   +      F+NYG    A  D+F +Y  D N+P + F  Y    +A  D F+NY
Sbjct  252  FTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFNNYGASGNAAVDTFANY  311

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
                NV D SF +Y   +      F NY +  N  +  FT Y   A+G K  FK+Y+ N+
Sbjct  312  RDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGSKLSFKTYTPNS  371

Query  41   NVGD  30
               D
Sbjct  372  TFKD  375



>ref|XP_004238667.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP3 [Solanum 
lycopersicum]
 sp|P93218.1|GP3_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP3; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39557.1| AROGP3 [Solanum lycopersicum]
Length=632

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 152/213 (71%), Gaps = 5/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK YLIRYWN  +SNDLP+PWFL+N ASPL AAQYA ++K+  AD+N+    L  FC
Sbjct  36   PFTPKGYLIRYWNKHVSNDLPKPWFLLNKASPLNAAQYATYTKLV-ADQNAFTTHLQSFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGS-HSAAGADSFKNYTVDVNLPVD  279
            SSA+L+C  DL PS L KH  +V+F SY  +NFTNYG+  S  G +SFKNYT + N PV+
Sbjct  95   SSANLMCALDLLPS-LEKHKGDVHFVSYGDKNFTNYGTKESGLGFNSFKNYTEEENFPVN  153

Query  278  TFRRYSRDSSAHTDRFSNY-ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            +FRRY RD S H ++F NY A GGN   QSF++Y   T GG+G+F NYA   NVP+L FT
Sbjct  154  SFRRYGRD-SPHDNQFDNYGAPGGNTPVQSFNSYSTNTPGGSGQFTNYAPGSNVPDLHFT  212

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSD   G +Q+FKSY  + N G Q+F SYGK+
Sbjct  213  SYSDHGTGGEQDFKSYGNDGNAGQQSFKSYGKD  245


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 53/118 (45%), Gaps = 14/118 (12%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG+++      F NY    N     F  Y  + +     F+NY  GGN         
Sbjct  253  FTTYGNNTNVDGSDFTNYGEAANGENQNFTSYGFNGNNPASSFNNYGVGGN---------  303

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            GP+ A     F +Y    NV +  FT Y  DA+G +  F +Y ++ N G   FT+YGK
Sbjct  304  GPSEA-----FNSYRDQSNVGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGK  356


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 51/114 (45%), Gaps = 0/114 (0%)
 Frame = -1

Query  386  NFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGN  207
            N T+ +  +FTNYG  +     +F +Y  + N P  +F  Y    +  ++ F++Y    N
Sbjct  258  NNTNVDGSDFTNYGEAANGENQNFTSYGFNGNNPASSFNNYGVGGNGPSEAFNSYRDQSN  317

Query  206  VADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            V D +F TY     GG   F NY +  N     FT Y    +     FK+Y  N
Sbjct  318  VGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGKGGNDPHINFKTYGVN  371



>ref|XP_010251282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=639

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            + G++PFT KA++IRYW  ++SN+LP+P FL++ ASPL A   A+ +K+A  D+N+L++ 
Sbjct  39   SAGENPFTAKAFVIRYWRKQVSNNLPKPSFLVSKASPLNAVDSALLTKLA--DQNALSSH  96

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
               FCSSA++ CFPD+SPS L KHD + NF SY   NFTNYG+  A G DSFKNY+ +  
Sbjct  97   FSSFCSSANMFCFPDISPS-LEKHDKDANFASYSNINFTNYGTSRAGGMDSFKNYSDNFG  155

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD-VNVPN  114
             P+D+FRRYSRDS+ H D+F+NYA   NV +Q F+TYG +  GG GEF NY  + VNVPN
Sbjct  156  GPIDSFRRYSRDSAGHDDKFANYAPNNNVIEQDFNTYGVSATGGTGEFKNYMNEGVNVPN  215

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRF+ Y  DA+GR+Q F SY++ AN GD++F+SYG N
Sbjct  216  LRFSTYESDANGREQSFSSYTDEANAGDESFSSYGNN  252


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F++YG++       FK+Y  D N+   +F+ Y  + +   D F++Y   GNV +  F 
Sbjct  244  ESFSSYGNNGNGLPLEFKSYGKDSNVMGSSFKAYGEEGNGANDSFTSYGVNGNVPENKFV  303

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F  Y    NV +  F +Y+ +++  K  F +Y ++ N G   F  YGK
Sbjct  304  SYGDGGNAGVDSFSTYRDQSNVGDDSFQSYAKNSNSAKVNFANYGKSFNEGSDTFKGYGK  363


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 46/105 (44%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F  YG       DSF +Y V+ N+P + F  Y    +A  D FS Y    NV D SF +Y
Sbjct  274  FKAYGEEGNGANDSFTSYGVNGNVPENKFVSYGDGGNAGVDSFSTYRDQSNVGDDSFQSY  333

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
               +      F NY K  N  +  F  Y   A G+   FK+Y  N
Sbjct  334  AKNSNSAKVNFANYGKSFNEGSDTFKGYGKGAVGQAIGFKTYGVN  378



>ref|XP_010427809.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
 ref|XP_010427810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=625

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I ++ PR  FLI+ ASPL A   A FSK+A    NSL  + P+FC
Sbjct  36   PFTPKASLVRYWNKEIRSESPRSEFLISKASPLNAVDSATFSKLAAT--NSLPTRFPDFC  93

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL  +SL KH+++V F++Y+ +NFTNYGS    G DSFKNY+ D N+  D+
Sbjct  94   SAANLFCFPDLG-TSLEKHEEDVKFSTYDQKNFTNYGSGRPGGGDSFKNYSKDGNVETDS  152

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSR+ + H D+FS Y    NV ++ F++YG    GGAGEF NY  +VN P   FTAY
Sbjct  153  FRRYSRNGAGHDDKFSVYGESSNVVEEGFNSYGTFGTGGAGEFTNYQNNVNNPTSTFTAY  212

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD A+GR Q FK+Y++NAN G  Q+FTSYGKN
Sbjct  213  SDGANGRTQSFKTYTQNANAGPGQSFTSYGKN  244


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+F +Y  D N+P + F+ Y    ++  D FSNY    NV D SF +Y
Sbjct  266  FSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAAGNSADDTFSNYRDKANVGDDSFSSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               ++    +F NY +  N  + +FT Y   A+G K  FK+Y+ N+      F  Y KN
Sbjct  326  AKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGAEGSKISFKTYTPNS-----TFKDYAKN  379


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y    N+    F  Y  + +A  D F++Y T GNV   +F 
Sbjct  236  QSFTSYGKNGNGLPNEFASYGASSNVVGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG A       F NY    NV +  F++Y+ D+   K +F +Y ++ N G + FT YGK
Sbjct  296  NYGAAGNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGK  355



>ref|XP_002311777.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
 gb|EEE89144.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
Length=633

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 157/215 (73%), Gaps = 4/215 (2%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G+SPFTPKA L+RYWN +I   LP+  F I+ ASPL+    A F+K+A   +N+L+AQLP
Sbjct  34   GESPFTPKASLVRYWNKEIHTVLPKSGFFISKASPLSPVDLATFAKLAS--QNALSAQLP  91

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
             FCSSA+L CFPDLSPS L KHD + +F  Y  +NF+NYG+  A GADSFKNY+   N+P
Sbjct  92   AFCSSAELFCFPDLSPS-LEKHDHDSHFAIYNNKNFSNYGTDRAGGADSFKNYSDGDNIP  150

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRY RD++ H + FS+YA   NV DQSF+TYG    GGAGEF  Y  +VN PNLRF
Sbjct  151  VDSFRRYGRDAAGHGELFSSYAPDSNVVDQSFNTYGAGATGGAGEFKGYNVEVNNPNLRF  210

Query  104  TAYSDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
             +YSD A+G+ Q+F +Y+ENAN G  Q FTSYGKN
Sbjct  211  VSYSDSANGKGQKFSTYTENANAGPGQAFTSYGKN  245


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +FTNYG  +    D+FK+Y VD N+P + F  Y    +A  D F+ Y    NV D SF T
Sbjct  266  DFTNYGETANGANDTFKSYGVDGNVPQNNFVNYGDGGNAGVDSFATYREKSNVGDDSFQT  325

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y   +      F NY K  N    +F+ Y + A G++  FK Y  N    D
Sbjct  326  YAKNSNAEKANFANYGKSFNEGTDKFSGYGNGAMGQQIGFKIYGVNTTFKD  376


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 52/120 (43%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNL-PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            F +Y   +      F  YT + N  P   F  Y ++ +   + FS Y T  NV    F  
Sbjct  210  FVSYSDSANGKGQKFSTYTENANAGPGQAFTSYGKNGNGAPNEFSGYGTSSNVVGSDFTN  269

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YG    G    F +Y  D NVP   F  Y D  +     F +Y E +NVGD +F +Y KN
Sbjct  270  YGETANGANDTFKSYGVDGNVPQNNFVNYGDGGNAGVDSFATYREKSNVGDDSFQTYAKN  329


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 52/119 (44%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG +     + F  Y    N+    F  Y   ++   D F +Y   GNV   +F 
Sbjct  237  QAFTSYGKNGNGAPNEFSGYGTSSNVVGSDFTNYGETANGANDTFKSYGVDGNVPQNNFV  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             YG     G   F  Y +  NV +  F  Y+ +++  K  F +Y ++ N G   F+ YG
Sbjct  297  NYGDGGNAGVDSFATYREKSNVGDDSFQTYAKNSNAEKANFANYGKSFNEGTDKFSGYG  355



>ref|XP_006365229.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=611

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 161/241 (67%), Gaps = 33/241 (14%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK YLIRYW+  +SNDLP+PWFL+N ASPL+AAQYA +SK+   D+N+L  QL  FC
Sbjct  15   PFTPKGYLIRYWSKHVSNDLPKPWFLLNKASPLSAAQYATYSKLV-TDQNALTTQLQSFC  73

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGS-HSAAGADSFKNYTVDVNLPVD  279
            SSA+L+C PDLSP SL KH  +++F SY  +NFTNYG+  S  G +SFKNY+ + N PV+
Sbjct  74   SSANLMCAPDLSP-SLEKHTGDIHFASYGDKNFTNYGTKESGVGFNSFKNYSDEGNFPVN  132

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNV-------  120
            +FRRYSRD S H ++F NYA  GNV DQSF++Y   T GG+G+F NY  + NV       
Sbjct  133  SFRRYSRD-SPHDNQFDNYAPDGNVPDQSFNSYSKNTPGGSGQFNNYDPNSNVANMGFNS  191

Query  119  ----------------------PNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
                                  PN+ FT+YSD   G ++EFKSYS++AN G Q+F +YGK
Sbjct  192  YADNGAGSVQKFTNYAPSGSNIPNMHFTSYSDHGTGGEEEFKSYSDDANGGVQSFKNYGK  251

Query  5    N  3
            +
Sbjct  252  D  252


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 3/121 (2%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y  H   G + FK+Y+ D N  V +F+ Y +D +    +F  Y    N    +F+ Y
Sbjct  218  FTSYSDHGTGGEEEFKSYSDDANGGVQSFKNYGKDGNGPNGKFIEYGNKANDPQNNFNNY  277

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANV---GDQNFTSYG  9
            G    G +  F NY     + + +FT Y  DA+G +  F +Y ++ +    G   FT+YG
Sbjct  278  GVEGNGISETFTNYRDQSTLGDDKFTVYVKDANGGEANFTNYGQSTDEFDNGTDEFTTYG  337

Query  8    K  6
            +
Sbjct  338  E  338


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 9/139 (6%)
 Frame = -1

Query  392  NVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N++FTSY        + F +Y   +  G  SFKNY  D N P   F  Y   ++   + F
Sbjct  215  NMHFTSYSDHGTGGEEEFKSYSDDANGGVQSFKNYGKDGNGPNGKFIEYGNKANDPQNNF  274

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY---SDDADGRKQEFK  60
            +NY   GN   ++F  Y   +  G  +F  Y KD N     FT Y   +D+ D    EF 
Sbjct  275  NNYGVEGNGISETFTNYRDQSTLGDDKFTVYVKDANGGEANFTNYGQSTDEFDNGTDEFT  334

Query  59   SYSENANVGDQNFTSYGKN  3
            +Y E  N    NF +YG N
Sbjct  335  TYGEGGNDPHINFKTYGVN  353



>ref|XP_004509821.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=624

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 154/212 (73%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA++IRYW+  I N+LP+P F+I+ ASPL+A+  A  +    A  N+L+ +LPEFC
Sbjct  31   PFTPKAFVIRYWDRVIKNNLPKPSFIISKASPLSASDAA--AFTKHAAANTLSTKLPEFC  88

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSY-EFQNFTNYGSHSAAGADSFKNYTVDVNLPVD  279
            S+A LLCFPD++PS L+KH  +  F  Y + QNFTNYG++   G DSFKNY+ D +  V+
Sbjct  89   SAAHLLCFPDVNPS-LAKHTKDAKFAVYNDAQNFTNYGTNRPGGIDSFKNYSNDFSSEVN  147

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
             FR+YSR S+ H D F+NYA   NV DQ+F+TYG   AGG+GEF  Y+KD NVPNLRFT 
Sbjct  148  EFRQYSRSSAGHKDSFTNYAIESNVVDQNFNTYGTGAAGGSGEFKEYSKDSNVPNLRFTT  207

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YS    GR+Q+F SYSE+ N GDQ+F +YGK+
Sbjct  208  YSTSTAGREQKFSSYSEDGNAGDQSFANYGKD  239


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 56/113 (50%), Gaps = 3/113 (3%)
 Frame = -1

Query  359  FTNY-GSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            F++Y G  S +  D+F NY V++N P + F+ Y + S    ++FSNY    NV   SF +
Sbjct  261  FSSYAGEQSTSENDTFTNYGVNMNNPTENFKNYGKGSFVANEKFSNYRDQANVGADSFSS  320

Query  182  YGPATAGGAG-EFGNYAKDVNVPNLRFTAYSDDAD-GRKQEFKSYSENANVGD  30
            YG  + GG   +F NY K  N     F  Y+  AD   K  FK Y  N    D
Sbjct  321  YGKDSRGGIHVDFNNYGKSFNEGTDTFKGYAKGADLDHKVSFKGYGVNNTFKD  373



>ref|XP_002888771.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65030.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 154/214 (72%), Gaps = 4/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+RYWN +I  + PR  FLI+ ASPL A   A FSK+A A  NSL  + P+
Sbjct  34   ENPFTPKASLVRYWNKEIRGESPRSEFLISKASPLNAVDSATFSKLAAA--NSLPTRFPD  91

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL  +SL KHDD+V F+ Y+ +NFTNYG+  A GADSFKNY+ D N+  
Sbjct  92   FCSAANLFCFPDLG-ASLEKHDDDVKFSVYDQKNFTNYGNARAGGADSFKNYSRDGNVVT  150

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSR+++ H D+F+ Y    NV ++ F++YG    GGAG F NY  +VN P  RFT
Sbjct  151  DSFRRYSRNAAGHDDKFTVYGDNSNVVEEGFNSYGTFGTGGAGVFTNYQNNVNNPTSRFT  210

Query  101  AYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            AYSD  +GR Q FK+Y+ +AN G+ Q+F+SYGKN
Sbjct  211  AYSDGGNGRSQSFKTYTHDANAGNGQSFSSYGKN  244


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F++YG +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +F 
Sbjct  236  QSFSSYGKNGNGAPNEFASYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +       F NY    NV +  F++Y+ D++  K  F +Y ++ N G + FT YGK
Sbjct  296  NYGASGNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGK  355


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG    A  D+F +Y  D N+P + F+ Y    +A  D F+NY    NV D SF +Y
Sbjct  266  FSNYGESGNAANDTFTSYGSDGNVPQNNFKNYGASGNAAVDTFANYRDKANVGDDSFSSY  325

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +      F NY +  N  +  FT Y   A+G K  FK+Y+ N+   D
Sbjct  326  AKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGNKISFKTYTPNSTFKD  375



>ref|XP_007044636.1| Polygalacturonase 2 [Theobroma cacao]
 gb|EOY00468.1| Polygalacturonase 2 [Theobroma cacao]
Length=682

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            +V ++PFTPKA LIRYWN +I N +P+  FL++  SPLTA   A FSK+A   +N LA++
Sbjct  84   SVSENPFTPKASLIRYWNKEIRNQIPKTHFLLSKVSPLTAVDSASFSKLAA--QNDLASR  141

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            LP FCSSA L CFPDLSPS L KH  + NF  Y  +NFTNYG+   AG DSFKNY+   N
Sbjct  142  LPSFCSSAKLFCFPDLSPS-LEKHPKDANFAFYANKNFTNYGTDRLAGVDSFKNYSEGDN  200

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            + VD+FRRYSRDS+ H D FSNYA+  NV DQSF+TYG A  GG G F NY ++VN PNL
Sbjct  201  VIVDSFRRYSRDSAGHKDLFSNYASESNVVDQSFNTYGAAATGGGGNFNNYNREVNNPNL  260

Query  110  RFTAYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            RFT+YSDD++GR Q F  Y+ENAN G+ Q+F+SYGKN
Sbjct  261  RFTSYSDDSNGRGQTFTRYTENANAGNGQSFSSYGKN  297


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG  +    D+F +Y  D N+P++TF+ Y    +A  D FS+Y    NV D SF +Y
Sbjct  319  FSGYGESANGANDTFTSYGFDSNVPLNTFKSYGDGGNAAVDSFSSYRDQSNVGDDSFQSY  378

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +     +F NY +  N    +FT Y   A+G+   FK Y  N    D
Sbjct  379  AKNSNAAKVDFNNYGQSFNEGTDKFTGYGQGAEGQSIGFKIYGRNTTFKD  428


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLP-VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            FT+Y   S     +F  YT + N     +F  Y ++ +   + FS+Y  G NV    F  
Sbjct  262  FTSYSDDSNGRGQTFTRYTENANAGNGQSFSSYGKNGNGVPNDFSSYGKGANVVGSGFSG  321

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YG +  G    F +Y  D NVP   F +Y D  +     F SY + +NVGD +F SY KN
Sbjct  322  YGESANGANDTFTSYGFDSNVPLNTFKSYGDGGNAAVDSFSSYRDQSNVGDDSFQSYAKN  381


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F++YG +     + F +Y    N+    F  Y   ++   D F++Y    NV   +F 
Sbjct  289  QSFSSYGKNGNGVPNDFSSYGKGANVVGSGFSGYGESANGANDTFTSYGFDSNVPLNTFK  348

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG         F +Y    NV +  F +Y+ +++  K +F +Y ++ N G   FT YG+
Sbjct  349  SYGDGGNAAVDSFSSYRDQSNVGDDSFQSYAKNSNAAKVDFNNYGQSFNEGTDKFTGYGQ  408


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F++YG  +      F  Y    N   DTF  Y  DS+   + F +Y  GGN A  SF +
Sbjct  304  DFSSYGKGANVVGSGFSGYGESANGANDTFTSYGFDSNVPLNTFKSYGDGGNAAVDSFSS  363

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y   +  G   F +YAK+ N   + F  Y    +    +F  Y + A      F  YG+N
Sbjct  364  YRDQSNVGDDSFQSYAKNSNAAKVDFNNYGQSFNEGTDKFTGYGQGAEGQSIGFKIYGRN  423



>gb|AAB39546.1| polygalacturonase isoenzyme 1 beta subunit homolog [Arabidopsis 
thaliana]
Length=626

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 152/214 (71%), Gaps = 4/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+RYWN +I    PR  FLI+ ASPL A   A FSK+A A  NSL  + P+
Sbjct  34   ENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNAVDSATFSKLAAA--NSLPTRFPD  91

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL  +SL KHDD+V F+ Y+ +NFTNYG+  A GADSFKNY+ D N+  
Sbjct  92   FCSAANLFCFPDLG-ASLEKHDDDVKFSVYDQKNFTNYGNARAGGADSFKNYSKDGNVVT  150

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSR+++ H D+F+ Y    NV ++ F++YG    GGAG+F NY  +VN P  RFT
Sbjct  151  DSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFT  210

Query  101  AYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            AYSD  +GR Q FK+Y+  AN G+ Q+FTSY KN
Sbjct  211  AYSDGGNGRSQTFKTYTHEANAGNGQSFTSYAKN  244


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y  +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +F+
Sbjct  236  QSFTSYAKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFN  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +       F NY    NV +  F++Y+ D++  K  F +Y ++ N G + FT YGK
Sbjct  296  NYGASGNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGK  355


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = -1

Query  383  FTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY   +      F+NYG    A  D+F +Y  D N+P + F  Y    +A  D F+NY
Sbjct  252  FTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFNNYGASGNAAVDTFANY  311

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
                NV D SF +Y   +      F NY +  N  +  FT Y   A+G K  FK+Y+ N+
Sbjct  312  RDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGSKLSFKTYTPNS  371

Query  41   NVGD  30
               D
Sbjct  372  TFKD  375



>gb|KDO82433.1| hypothetical protein CISIN_1g036311mg [Citrus sinensis]
Length=632

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 160/217 (74%), Gaps = 3/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            + +  +PFTPKA+LIRYW+ +I ++LP+  FL++ ASPL A   A F+K+A   +N+L++
Sbjct  35   IDMKQNPFTPKAHLIRYWDKEIRSNLPKSPFLLSKASPLNAVDSASFAKLAA--QNALSS  92

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
             LP FCSSA L CFPDLS +SL KHD + NF  Y  +NFTNYG+    GADSFKNY+   
Sbjct  93   VLPSFCSSAKLFCFPDLS-NSLEKHDTDSNFARYLNKNFTNYGTSRVGGADSFKNYSDGD  151

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            NLPVD+FRRYSRD+  H D+FSNYA G NVADQSF+TYG + +GGAG F NY ++VNVP+
Sbjct  152  NLPVDSFRRYSRDAVGHQDKFSNYAPGSNVADQSFNTYGASASGGAGSFKNYNEEVNVPH  211

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT+Y+ + +GR   F +Y+E  N G + F +YGKN
Sbjct  212  LRFTSYASEGNGRAHSFTAYAEKTNSGSEEFANYGKN  248


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 53/119 (45%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG  +    DSF +Y  D N+P + F  Y    +A  + FSNY    NV D SF +Y
Sbjct  270  FSNYGEGANGANDSFTSYGEDGNVPNNRFNNYGAGGNAAVESFSNYRDQANVGDDSFQSY  329

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G  +  G   F NY    N     F  Y + A G+   FK Y  N       F  Y KN
Sbjct  330  GKDSKSGKVNFANYGNSFNEGTDVFKGYGEAARGQTVGFKMYGVN-----NTFKDYAKN  383


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + F NYG ++    ++F  Y  + N+    F  Y   ++   D F++Y   GNV +  F+
Sbjct  240  EEFANYGKNANGAPNAFTGYGKETNVIGSGFSNYGEGANGANDSFTSYGEDGNVPNNRFN  299

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG         F NY    NV +  F +Y  D+   K  F +Y  + N G   F  YG+
Sbjct  300  NYGAGGNAAVESFSNYRDQANVGDDSFQSYGKDSKSGKVNFANYGNSFNEGTDVFKGYGE  359


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 58/148 (39%), Gaps = 11/148 (7%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQN-----------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRR  267
            S + + +  N  S EF N           FT YG  +      F NY    N   D+F  
Sbjct  227  SFTAYAEKTNSGSEEFANYGKNANGAPNAFTGYGKETNVIGSGFSNYGEGANGANDSFTS  286

Query  266  YSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDD  87
            Y  D +   +RF+NY  GGN A +SF  Y      G   F +Y KD     + F  Y + 
Sbjct  287  YGEDGNVPNNRFNNYGAGGNAAVESFSNYRDQANVGDDSFQSYGKDSKSGKVNFANYGNS  346

Query  86   ADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +     FK Y E A      F  YG N
Sbjct  347  FNEGTDVFKGYGEAARGQTVGFKMYGVN  374



>ref|XP_003613234.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96192.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=630

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            VA   +PFTPKA+L RYW+ +I N LP+P FL + ASPL+  + A F+K+A    N L+ 
Sbjct  27   VAGDKNPFTPKAFLNRYWDKEIRNGLPKPSFLFSKASPLSTVEAATFAKLASG--NVLST  84

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            +LPEFCS+A+LLC P+++  SL KH D+VNF  Y  +NFTNYG+    G DSFKNY+   
Sbjct  85   RLPEFCSAANLLCLPEVA-QSLEKHGDDVNFAIYRDKNFTNYGTDRPGGFDSFKNYSDGE  143

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N+ V+ FRRYSR+S+ H + F++YAT  NVADQSFHTYG    GG GEF  Y  + NVPN
Sbjct  144  NVLVNDFRRYSRNSAGHKETFTSYATNANVADQSFHTYGAGATGGGGEFKTYTTETNVPN  203

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
              FT+YSD A+GR Q F SY+EN N G Q+FTSYGKN
Sbjct  204  EVFTSYSDSANGRTQSFNSYTENGNSGQQSFTSYGKN  240


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 0/108 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + FT+YG+ S      F NY    N   D+F+ Y  D +  T+ FSNYA GGN A Q+F 
Sbjct  246  EEFTSYGTSSNTAGSGFSNYAETSNAGNDSFKSYGVDMNNPTNSFSNYANGGNGATQTFS  305

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
            TY   +  GA  F +YAK  N   + F  Y    +     F SY++ +
Sbjct  306  TYREKSNVGADSFTSYAKTANAAKIGFDNYGKSFNDGTDTFTSYAKTS  353


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 62/132 (47%), Gaps = 20/132 (15%)
 Frame = -1

Query  383  FTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q+F +Y  +  +G  SF +Y  + N P + F  Y   S+     FSNY
Sbjct  206  FTSYSDSANGRTQSFNSYTENGNSGQQSFTSYGKNGNGPTEEFTSYGTSSNTAGSGFSNY  265

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
            A   N  + SF +YG               D+N P   F+ Y++  +G  Q F +Y E +
Sbjct  266  AETSNAGNDSFKSYGV--------------DMNNPTNSFSNYANGGNGATQTFSTYREKS  311

Query  41   NVGDQNFTSYGK  6
            NVG  +FTSY K
Sbjct  312  NVGADSFTSYAK  323



>ref|XP_006438394.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
 ref|XP_006483846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
 gb|ESR51634.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
Length=632

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 160/217 (74%), Gaps = 3/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            + +  +PFTPKA+LIRYW+ +I ++LP+  FL++ ASPL A   A F+K+A   +N+L++
Sbjct  35   IDMKQNPFTPKAHLIRYWDKEIRSNLPKSPFLLSKASPLNAVDSASFAKLAA--QNALSS  92

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
             LP FCSSA L CFPDLS +SL KHD + NF  Y  +NFTNYG+    GADSFKNY+   
Sbjct  93   VLPSFCSSAKLFCFPDLS-NSLEKHDTDSNFARYLNKNFTNYGTSRVGGADSFKNYSDGD  151

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            NLPVD+FRRYSRD+  H D+FSNYA G NVADQSF+TYG + +GGAG F NY ++VNVP+
Sbjct  152  NLPVDSFRRYSRDAVGHHDKFSNYAPGSNVADQSFNTYGASASGGAGSFKNYNEEVNVPH  211

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT+Y+ + +GR   F +Y+E  N G + F +YGKN
Sbjct  212  LRFTSYASEGNGRAHSFTTYAEKTNSGSEEFANYGKN  248


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (50%), Gaps = 20/135 (15%)
 Frame = -1

Query  389  VNFTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFS  228
            + FTSY  +      +FT Y   + +G++ F NY  + N   + F  Y ++++     FS
Sbjct  212  LRFTSYASEGNGRAHSFTTYAEKTNSGSEEFANYGKNANGAPNAFTGYGKETNVIGSGFS  271

Query  227  NYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
            NY  G N A+ SF +YG              +D NVPN RF  Y    +   + F +Y +
Sbjct  272  NYGEGANGANDSFTSYG--------------EDGNVPNNRFNNYGAGGNAAVESFSNYRD  317

Query  47   NANVGDQNFTSYGKN  3
             ANVGD +F SYGK+
Sbjct  318  QANVGDDSFQSYGKD  332


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 53/119 (45%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG  +    DSF +Y  D N+P + F  Y    +A  + FSNY    NV D SF +Y
Sbjct  270  FSNYGEGANGANDSFTSYGEDGNVPNNRFNNYGAGGNAAVESFSNYRDQANVGDDSFQSY  329

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G  +  G   F NY    N     F  Y + A G+   FK Y  N       F  Y KN
Sbjct  330  GKDSKSGKVNFANYGNSFNEGTDVFKGYGEAARGQTVGFKMYGVN-----NTFKDYAKN  383


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 58/148 (39%), Gaps = 11/148 (7%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQN-----------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRR  267
            S + + +  N  S EF N           FT YG  +      F NY    N   D+F  
Sbjct  227  SFTTYAEKTNSGSEEFANYGKNANGAPNAFTGYGKETNVIGSGFSNYGEGANGANDSFTS  286

Query  266  YSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDD  87
            Y  D +   +RF+NY  GGN A +SF  Y      G   F +Y KD     + F  Y + 
Sbjct  287  YGEDGNVPNNRFNNYGAGGNAAVESFSNYRDQANVGDDSFQSYGKDSKSGKVNFANYGNS  346

Query  86   ADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +     FK Y E A      F  YG N
Sbjct  347  FNEGTDVFKGYGEAARGQTVGFKMYGVN  374



>ref|XP_006303930.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
 gb|EOA36828.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
Length=623

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 152/212 (72%), Gaps = 5/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I N  P   FL++ ASPLTA   A F+K+A   +NSL  +LP+FC
Sbjct  39   PFTPKASLVRYWNKQIQNQSPGSAFLLSKASPLTAVASATFAKLA--SQNSLPDRLPDFC  96

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL P+ L KH D+V F+ Y+ +NFTNYGSH   GADSF+ Y+ D N+  D+
Sbjct  97   SAANLFCFPDLGPT-LEKHSDDVKFSVYDQRNFTNYGSH-PGGADSFEKYSQDGNVVTDS  154

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRD++ H D F+ YA   NV D+SF+TYG +  GG+ EF +Y  +VN P  RFTAY
Sbjct  155  FRRYSRDAAGHDDTFTGYADNSNVVDESFNTYGTSATGGSDEFKSYQSEVNNPTSRFTAY  214

Query  95   SDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            SD+ +GR Q FK+Y+ + N G  Q+FTSYGKN
Sbjct  215  SDNGNGRTQTFKTYAHDGNAGSGQSFTSYGKN  246


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG ++ +  D+FK Y  D N+P + F+ Y    +A  D F NY    N  D +F +
Sbjct  267  DFSNYGENANSANDTFKGYGGDGNVPRNNFKNYGASGNAAVDTFLNYRDKANAGDDTFSS  326

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            Y   +     +F NY K  N  +  FT Y   A+G K  FK+Y++N+      F SY K
Sbjct  327  YAKKSNSQKVDFVNYGKSFNPGSETFTGYGKGAEGNKIGFKTYTKNS-----TFKSYAK  380


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  ++++  D F  Y   GNV   +F 
Sbjct  238  QSFTSYGKNGNGAPNEFASYGVSSNVIGSDFSNYGENANSANDTFKGYGGDGNVPRNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +       F NY    N  +  F++Y+  ++ +K +F +Y ++ N G + FT YGK
Sbjct  298  NYGASGNAAVDTFLNYRDKANAGDDTFSSYAKKSNSQKVDFVNYGKSFNPGSETFTGYGK  357



>ref|XP_003552018.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=622

 Score =   231 bits (590),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 155/217 (71%), Gaps = 5/217 (2%)
 Frame = -1

Query  647  VGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQL  468
            V  +PFT +AY+ RYW+  + N+LP+P FL++ ASP++A+  A F+ +A    NSL+ +L
Sbjct  27   VDKNPFTEQAYVARYWDKHVGNNLPKPSFLLSKASPMSASDTASFANLAAT--NSLSTRL  84

Query  467  PEFCSSADLLCFPDLSPSSLSKHDDNVNFTSY-EFQNFTNYGSHSAAGADSFKNYTVDV-  294
            PEFCS+A LLCFP++ PS L KH  + +F +Y + QNFTNYG+  A G D+FKNY+ D+ 
Sbjct  85   PEFCSAAHLLCFPEVRPS-LEKHTGDSDFQTYNDGQNFTNYGTDFAGGLDTFKNYSNDLF  143

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            + PV+ FRRYSR ++ H +RFS YA   NVADQSF TYG    GG+GEF NY+++ NVP+
Sbjct  144  STPVNDFRRYSRGAAGHEERFSAYAGDTNVADQSFSTYGTNAGGGSGEFKNYSRNSNVPD  203

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT YSD   GR Q F SYSE+ N G Q F SYGKN
Sbjct  204  LRFTTYSDSTGGRTQSFSSYSEDGNAGGQTFQSYGKN  240


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +FTNYG   A   D+F NY V++N P +TF+ Y+  +   T  FSNY    NV   SF +
Sbjct  261  DFTNYGKGGAGPNDTFTNYGVNMNNPTETFQSYADGTVGGTQSFSNYRDQANVGADSFQS  320

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            Y   T G   +F NY    N  +  F  Y+  A+  K  F +YS N N   +++  +G
Sbjct  321  YAKNTLGSEADFKNYGNSFNPGSDTFKGYAKGAEDNKVGFTTYSANTNATFKDYAKHG  378


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F +YG +SA  A+ F  Y  D N+    F  Y +  +   D F+NY    N   ++F 
Sbjct  232  QTFQSYGKNSAGAANDFAAYGTDSNVASSDFTNYGKGGAGPNDTFTNYGVNMNNPTETFQ  291

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +Y   T GG   F NY    NV    F +Y+ +  G + +FK+Y  + N G   F  Y K
Sbjct  292  SYADGTVGGTQSFSNYRDQANVGADSFQSYAKNTLGSEADFKNYGNSFNPGSDTFKGYAK  351



>ref|XP_006365230.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=627

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 157/241 (65%), Gaps = 33/241 (14%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK YLIRYWN  +SNDLP+PWFL+N ASPL AAQYA +SK+  AD+N+L  QL  FC
Sbjct  36   PFTPKGYLIRYWNKHVSNDLPKPWFLLNKASPLNAAQYATYSKLV-ADQNALTTQLQSFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAA-GADSFKNYTVDVNLPVD  279
            SSA+L+C PDLSPS L KH  +++F SY  +NFTNYG+  A  G +SFKNYT + N P++
Sbjct  95   SSANLMCAPDLSPS-LEKHTGDIHFASYGNKNFTNYGTKEAGIGVNSFKNYTEEENFPMN  153

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN--------  123
            +FRRY RDS    ++F NY   GN A QSF++Y   T GG+G+F NY  + N        
Sbjct  154  SFRRYGRDS-PRDNQFDNYGPDGNTAVQSFNSYSTNTPGGSGKFNNYGPNSNDANMGFNS  212

Query  122  ---------------------VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
                                 +PN+ FT+YSD   G +QEFKSYS++AN  +Q+F +YGK
Sbjct  213  YADNGAGSVQKFTNYAPIRSNIPNIHFTSYSDHGTGGEQEFKSYSDDANEANQSFINYGK  272

Query  5    N  3
            +
Sbjct  273  D  273


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 4/121 (3%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y  H   G   FK+Y+ D N    +F  Y +D +    +F++Y   G+  ++ F  Y
Sbjct  239  FTSYSDHGTGGEQEFKSYSDDANEANQSFINYGKDGNGANSKFNSYGNKGSSINK-FKNY  297

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANV---GDQNFTSYG  9
            G    G +  F NY +  +  N RFT Y  DA+G +  F +Y ++ +    G   FT+YG
Sbjct  298  GVEGNGISETFTNYREQSSFGNDRFTNYVKDANGGEANFTNYGQSTDELDPGTDEFTTYG  357

Query  8    K  6
            K
Sbjct  358  K  358


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 4/94 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +YG+  ++  + FKNY V+ N   +TF  Y   SS   DRF+NY    N  + +F  Y
Sbjct  281  FNSYGNKGSS-INKFKNYGVEGNGISETFTNYREQSSFGNDRFTNYVKDANGGEANFTNY  339

Query  179  GPATAG---GAGEFGNYAKDVNVPNLRFTAYSDD  87
            G +T     G  EF  Y K  N P++ F +Y  D
Sbjct  340  GQSTDELDPGTDEFTTYGKGGNDPHINFKSYGGD  373



>emb|CDY47228.1| BnaC09g14770D [Brassica napus]
Length=623

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 151/214 (71%), Gaps = 3/214 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA LIRYWN +I+   P P F ++ ASPLT      F+ +A   R++L  +L +
Sbjct  35   ENPFTPKASLIRYWNKRINGGSPPPSFFLSKASPLTTVDSTRFATLAS--RHALDTRLYD  92

Query  461  FCSSADLLCFPDLSPSSLS-KHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            FC++A L CFP+L+  S++ KH D+V F+ Y  +NFTNYGS   AGAD+FKNY+   N+ 
Sbjct  93   FCTAAKLFCFPELAAHSVTEKHGDDVGFSVYSDKNFTNYGSDRLAGADTFKNYSGGDNIG  152

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSRDS+ H D FSNYA   NVADQSF TY   + GGAG+F NY  + N PN RF
Sbjct  153  VDSFRRYSRDSAGHDDGFSNYAGEVNVADQSFTTYATGSTGGAGDFTNYHTNANQPNGRF  212

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T+YSD+A+GR Q F +YSENAN G Q FTSY KN
Sbjct  213  TSYSDEANGRSQSFTTYSENANSGAQTFTSYSKN  246


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + SF  Y+ + N    TF  YS++ +   + FS Y +G NV    F  Y
Sbjct  212  FTSYSDEANGRSQSFTTYSENANSGAQTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGY  271

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  D N+P   F  Y +  +G    FKSY + +N+G  +F+SY K+
Sbjct  272  GETANGANDTFTSYGGDGNLPVNDFKKYGERGNGAVYGFKSYRDQSNIGADSFSSYAKD  330


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 48/104 (46%), Gaps = 0/104 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG  +    D+F +Y  D NLPV+ F++Y    +     F +Y    N+   SF +Y
Sbjct  268  FSGYGETANGANDTFTSYGGDGNLPVNDFKKYGERGNGAVYGFKSYRDQSNIGADSFSSY  327

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
               +      F NY K  N+ +  FT Y    DG    FK+Y +
Sbjct  328  AKDSHNEKVNFVNYGKSFNLGSDDFTGYGQGNDGGNVSFKTYGQ  371



>ref|XP_002266815.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=624

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 146/214 (68%), Gaps = 5/214 (2%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G +PFTPKA L+RYWN +I +DL +  FL++ ASPL+A + A F+K+A   +N+L+  LP
Sbjct  32   GANPFTPKAALVRYWNKQIGSDLQKSTFLLSRASPLSAVESATFTKLAA--QNALSNYLP  89

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
             FC SA+L CFPDL   SL KH  N NF  Y  +NFTNYG+    G DSFKNYT D   P
Sbjct  90   AFCKSANLFCFPDLG-QSLEKHGPNSNFAVYSNKNFTNYGTGGHGGTDSFKNYT-DY-FP  146

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSRDS+ H D F NY   GN  D SF+ YG     G GEF  Y+++ NVPN+RF
Sbjct  147  VDSFRRYSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSGATRGVGEFKKYSEESNVPNVRF  206

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +YS D + RKQ F+SYS  +N GDQ FTSYGKN
Sbjct  207  NSYSSDGNTRKQSFRSYSTESNAGDQYFTSYGKN  240


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG +S    + F +Y  + N+   TF  Y R ++A  D+F++Y  GGNV   +F 
Sbjct  232  QYFTSYGKNSQGSPNEFTSYGENTNVIGSTFTGYGRTANAANDKFTSYGFGGNVPVNNFK  291

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G   F +Y    NV +  F +Y+ ++   +  F +Y ++ N G   FT YGK
Sbjct  292  SYGDGGNSGIDTFKSYRNQSNVGDDSFRSYAKNSHSAEVNFANYGQSFNEGTDTFTGYGK  351


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 59/139 (42%), Gaps = 8/139 (6%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAH  243
            SP+  + + +N N        FT YG  + A  D F +Y    N+PV+ F+ Y    ++ 
Sbjct  244  SPNEFTSYGENTNVIG---STFTGYGRTANAANDKFTSYGFGGNVPVNNFKSYGDGGNSG  300

Query  242  TDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEF  63
             D F +Y    NV D SF +Y   +      F NY +  N     FT Y   A G K  F
Sbjct  301  IDTFKSYRNQSNVGDDSFRSYAKNSHSAEVNFANYGQSFNEGTDTFTGYGKGATGHKIGF  360

Query  62   KSYSENANVGDQNFTSYGK  6
            K Y  N       FT Y K
Sbjct  361  KFYGVN-----NTFTDYAK  374



>emb|CDY53059.1| BnaA09g14240D [Brassica napus]
Length=623

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 151/214 (71%), Gaps = 3/214 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA LIRYWN +I+   P P F ++ ASPLT      F+ +A   R++L  +L +
Sbjct  35   ENPFTPKASLIRYWNKRINGGSPPPSFFLSKASPLTTVDSTRFASLAS--RHALDTRLSD  92

Query  461  FCSSADLLCFPDLSPSSLS-KHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            FC++A L CFP+L+  S++ KH D+V F+ Y  +NFTNYGS   AGAD+FKNY+   N+ 
Sbjct  93   FCTAAKLFCFPELAAHSVTEKHGDDVGFSVYSDKNFTNYGSDRLAGADTFKNYSGGDNIG  152

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSRDS+ H D F+NYA   NVADQSF TY   + GG+G+F NY  + N PN RF
Sbjct  153  VDSFRRYSRDSAGHDDGFTNYAGEVNVADQSFTTYATGSTGGSGDFTNYHTNANQPNGRF  212

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T+YSD+A+GR Q F +YSENAN G Q FTSY KN
Sbjct  213  TSYSDEANGRSQSFTAYSENANSGAQTFTSYSKN  246


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + SF  Y+ + N    TF  YS++ +   + FS Y +G NV    F  Y
Sbjct  212  FTSYSDEANGRSQSFTAYSENANSGAQTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGY  271

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G  + G    F +Y  D N+P   F  Y +  +G    FKSY + +N+G  +F+SY K+
Sbjct  272  GETSNGANDTFTSYGGDGNLPVNDFKKYGEGGNGAVYGFKSYRDQSNIGADSFSSYAKD  330


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+Y  +     + F  Y    N+    F  Y   S+   D F++Y   GN+    F 
Sbjct  238  QTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETSNGANDTFTSYGGDGNLPVNDFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F +Y    N+    F++Y+ D+   K  F +Y ++ N+G  +FT YG+
Sbjct  298  KYGEGGNGAVYGFKSYRDQSNIGADSFSSYAKDSHNEKVNFVNYGKSFNLGSDDFTGYGQ  357


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 48/104 (46%), Gaps = 0/104 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG  S    D+F +Y  D NLPV+ F++Y    +     F +Y    N+   SF +Y
Sbjct  268  FSGYGETSNGANDTFTSYGGDGNLPVNDFKKYGEGGNGAVYGFKSYRDQSNIGADSFSSY  327

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
               +      F NY K  N+ +  FT Y    DG    FK+Y +
Sbjct  328  AKDSHNEKVNFVNYGKSFNLGSDDFTGYGQGNDGGNVSFKTYGQ  371



>ref|XP_009113216.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Brassica rapa]
Length=623

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 151/214 (71%), Gaps = 3/214 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA LIRYWN +I+   P P F ++ ASPLT      F+ +A   R++L  +L +
Sbjct  35   ENPFTPKASLIRYWNKRINGGSPPPSFFLSKASPLTTVDSTRFASLAS--RHALDTRLSD  92

Query  461  FCSSADLLCFPDLSPSSLS-KHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            FC++A L CFP+L+  S++ KH D+V F+ Y  +NFTNYGS   AGAD+FKNY+   N+ 
Sbjct  93   FCTAAKLFCFPELAAHSVTEKHGDDVGFSVYSDKNFTNYGSDRLAGADTFKNYSGGDNIG  152

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSRDS+ H D F+NYA   NVADQSF TY   + GG+G+F NY  + N PN RF
Sbjct  153  VDSFRRYSRDSAGHDDGFTNYAGEVNVADQSFTTYATGSTGGSGDFTNYHTNANQPNGRF  212

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T+YSD+A+GR Q F +YSENAN G Q FTSY KN
Sbjct  213  TSYSDEANGRSQSFTAYSENANSGAQTFTSYSKN  246


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + SF  Y+ + N    TF  YS++ +   + FS Y +G NV    F  Y
Sbjct  212  FTSYSDEANGRSQSFTAYSENANSGAQTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGY  271

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G  + G    F +Y  D N+P   F  Y +  +G    FKSY + +N+G  +F+SY K+
Sbjct  272  GETSNGANDTFTSYGGDGNLPVNDFKKYGEGGNGAVYGFKSYRDQSNIGADSFSSYAKD  330


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+Y  +     + F  Y    N+    F  Y   S+   D F++Y   GN+    F 
Sbjct  238  QTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETSNGANDTFTSYGGDGNLPVNDFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F +Y    N+    F++Y+ D+   K  F +Y ++ N+G  +FT YG+
Sbjct  298  KYGEGGNGAVYGFKSYRDQSNIGADSFSSYAKDSHNEKVNFVNYGKSFNLGSDDFTGYGQ  357


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 48/104 (46%), Gaps = 0/104 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG  S    D+F +Y  D NLPV+ F++Y    +     F +Y    N+   SF +Y
Sbjct  268  FSGYGETSNGANDTFTSYGGDGNLPVNDFKKYGEGGNGAVYGFKSYRDQSNIGADSFSSY  327

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
               +      F NY K  N+ +  FT Y    DG    FK+Y +
Sbjct  328  AKDSHNEKVNFVNYGKSFNLGSDDFTGYGQGDDGGNVSFKTYGQ  371



>ref|XP_006390895.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
 gb|ESQ28181.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
Length=627

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 154/215 (72%), Gaps = 5/215 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLP-RPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            ++PFTPKA L+RYWN +I +D   R  FLI+ ASPL A   A F+K+A   +NSL  +LP
Sbjct  34   ENPFTPKASLVRYWNKEIRSDKSLRSEFLISKASPLNAVDSATFAKLAA--QNSLPTRLP  91

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            +FCS+A+L CFPDL+PS L+KHDD+V F+ Y  +NFTNYG+  A GADSFK Y+ D N+ 
Sbjct  92   DFCSAANLFCFPDLTPS-LNKHDDDVKFSVYNQKNFTNYGNARAGGADSFKTYSKDGNVV  150

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D+FRRYSR ++ H D+F+ Y+   NV +++F++YG    GGAGEF NY   VN P  RF
Sbjct  151  TDSFRRYSRGAAGHDDKFTVYSDNSNVVEENFNSYGTFGTGGAGEFTNYQNGVNNPTSRF  210

Query  104  TAYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            TAYSD  +GR Q F SY+  AN G+ Q+FTSYGKN
Sbjct  211  TAYSDGGNGRSQSFNSYTHEANAGNGQSFTSYGKN  245


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 66/139 (47%), Gaps = 8/139 (6%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+S S +  + N        F+NYG    A  DSF NY  D N+P + F+ Y    +A  
Sbjct  250  PNSFSSYGVSANVIG---SGFSNYGEKGNAANDSFTNYGNDGNVPQNNFKNYGASGNAAV  306

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            D FSNY    NV D SF +Y   +  G   F NY +  N  +  FT Y   A+G K  FK
Sbjct  307  DTFSNYRDKANVGDDSFSSYAKDSNSGKVNFVNYGQSFNPGSESFTGYGKGAEGHKIGFK  366

Query  59   SYSENANVGDQNFTSYGKN  3
            +Y+ N+      F  Y KN
Sbjct  367  TYTPNS-----TFKDYAKN  380


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     +SF +Y V  N+    F  Y    +A  D F+NY   GNV   +F 
Sbjct  237  QSFTSYGKNGNGLPNSFSSYGVSANVIGSGFSNYGEKGNAANDSFTNYGNDGNVPQNNFK  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +       F NY    NV +  F++Y+ D++  K  F +Y ++ N G ++FT YGK
Sbjct  297  NYGASGNAAVDTFSNYRDKANVGDDSFSSYAKDSNSGKVNFVNYGQSFNPGSESFTGYGK  356



>ref|XP_010498883.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=633

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 148/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I N  P   FL++ ASPLTA   A F+K+A   +NSL  +LP+FC
Sbjct  48   PFTPKASLVRYWNKQIQNQSPGSAFLLSKASPLTAVASATFAKLA--SQNSLPDRLPDFC  105

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL P+ L KH ++V F+ Y+ +NFTNYG+    GADSF+ Y+ + N+  D+
Sbjct  106  SAANLFCFPDLGPT-LEKHSNDVKFSVYDQRNFTNYGTTRPGGADSFEKYSQNGNVVTDS  164

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRD++ H D F+ YA   NV D++F +YG +  GG+GEF  Y   VN P  RFTAY
Sbjct  165  FRRYSRDAAGHDDSFTGYADNSNVVDENFKSYGTSATGGSGEFKAYQSGVNNPTSRFTAY  224

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SDD +GR Q FK+Y+   N G  Q+FTSYGKN
Sbjct  225  SDDGNGRAQTFKTYTHEGNAGPGQSFTSYGKN  256


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG ++ A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D +F +
Sbjct  277  DFSNYGENANAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDTFSS  336

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y   +      F NY K  N  +  FT Y   A+G K +FK+Y++N+   D
Sbjct  337  YAKNSNSEKVGFVNYGKSFNPGSESFTGYGKGAEGNKIDFKTYTKNSTFKD  387


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  +++A  D F  Y   GNV   +F 
Sbjct  248  QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENANAANDTFKGYGGDGNVPRNNFK  307

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY    NV +  F++Y+ +++  K  F +Y ++ N G ++FT YGK
Sbjct  308  SYGASGNAAVDTFLNYRDKANVGDDTFSSYAKNSNSEKVGFVNYGKSFNPGSESFTGYGK  367



>ref|XP_006300871.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
 gb|EOA33769.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
Length=628

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 147/214 (69%), Gaps = 3/214 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKI-SNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            ++PFTPKA L+RYWNN I   D P+P F I+ ASPLT  +   F+ +A    ++L  +  
Sbjct  40   ENPFTPKASLLRYWNNHINGGDSPKPSFFISKASPLTHVEATRFASLAS--NHALHTRSS  97

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
             FCS+A L CFP+LS  SL KH D+V+F +Y  +NFTNYGS   +GADSFKNY+   N+ 
Sbjct  98   YFCSAAKLFCFPELSSHSLEKHGDDVDFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIA  157

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VD+FRRYSR+S+ H D F+NYA   NVADQSF TY   T GG+GEF +Y  + N PN  F
Sbjct  158  VDSFRRYSRNSAGHDDGFTNYAGDVNVADQSFSTYATGTTGGSGEFASYNTNANEPNGIF  217

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T+YSD A+GR Q F SYS N N G+Q FTSY KN
Sbjct  218  TSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKN  251


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F +Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  217  FTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKY  276

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  277  GENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  335


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 60/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y
Sbjct  231  FTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSY  290

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV    F  YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ 
Sbjct  291  GGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSF  350

Query  41   NVGDQNFTSYGK  6
            N+G  NFT YG+
Sbjct  351  NLGSDNFTGYGQ  362



>emb|CDX68345.1| BnaA07g23850D [Brassica napus]
Length=618

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 154/214 (72%), Gaps = 5/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLP-RPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            ++PFTPKA L+RYWN +IS D   R  FLI+ ASPL A   A F+K+A   +NSL  +LP
Sbjct  34   ENPFTPKASLVRYWNKEISADKSLRSEFLISKASPLNAVDSATFAKLAA--QNSLPTRLP  91

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            +FCS+A+L CFPDL+PS L KHDDNV F+ Y+ +NFT+YG+  AAGADSFK Y+   N  
Sbjct  92   DFCSAANLFCFPDLTPS-LEKHDDNVKFSVYDQKNFTSYGNARAAGADSFKTYSKGNNGA  150

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D+FRRYSR+++ H D+F+ Y   GNV ++ F++YG   AGGAG+F NY  DVN P  RF
Sbjct  151  FDSFRRYSRNAAGHEDKFTVYGERGNVDEKDFNSYGTFAAGGAGDFTNYQNDVNDPMSRF  210

Query  104  TAYSDDADGRKQEFKSYSENANVGD-QNFTSYGK  6
            TAYSD   GR Q FK+Y+ +AN G+ Q+FTSY K
Sbjct  211  TAYSDGGTGRSQTFKTYTHDANAGNGQSFTSYSK  244


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (47%), Gaps = 11/143 (8%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSR---DS  252
            SP+  S + D+ N    +F+N   YG    A  D+F +Y    N+P++ F+ Y       
Sbjct  249  SPNEFSSYGDSSNVIGSDFKN---YGEEENAAKDTFTSYASGGNVPLNNFKNYGDYGVSG  305

Query  251  SAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRK  72
            +   D F+NY    NV D SF  Y   +  G  +F NY +  N  +  FT Y   ++G K
Sbjct  306  NDAVDTFANYRDKANVGDDSFSGYAKDSNAGTVKFTNYGQSYNPGSESFTGYGKGSEGHK  365

Query  71   QEFKSYSENANVGDQNFTSYGKN  3
              FK+Y+ N+      F  Y KN
Sbjct  366  ISFKTYTPNS-----TFKDYAKN  383


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y        + F +Y    N+    F+ Y  + +A  D F++YA+GGNV   +F 
Sbjct  237  QSFTSYSKKGNTSPNEFSSYGDSSNVIGSDFKNYGEEENAAKDTFTSYASGGNVPLNNFK  296

Query  185  TYGPATAGG---AGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTS  15
             YG     G      F NY    NV +  F+ Y+ D++    +F +Y ++ N G ++FT 
Sbjct  297  NYGDYGVSGNDAVDTFANYRDKANVGDDSFSGYAKDSNAGTVKFTNYGQSYNPGSESFTG  356

Query  14   YGK  6
            YGK
Sbjct  357  YGK  359


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 51/109 (47%), Gaps = 14/109 (13%)
 Frame = -1

Query  383  FTSYE------FQNFTNYGSHSAAG---ADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            FTSY         NF NYG +  +G    D+F NY    N+  D+F  Y++DS+A T +F
Sbjct  281  FTSYASGGNVPLNNFKNYGDYGVSGNDAVDTFANYRDKANVGDDSFSGYAKDSNAGTVKF  340

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDA  84
            +NY    N   +SF  YG  + G    F  Y      PN  F  Y+ + 
Sbjct  341  TNYGQSYNPGSESFTGYGKGSEGHKISFKTY-----TPNSTFKDYAKNG  384



>emb|CDY23501.1| BnaC06g24700D [Brassica napus]
Length=625

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 154/217 (71%), Gaps = 5/217 (2%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLP-RPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            + G++PFTPKA LIRYWN +IS D   R  FLI+ ASPL A   A F+K+A   +NSL  
Sbjct  31   SAGENPFTPKASLIRYWNKEISADKSLRSEFLISKASPLNAVDSATFAKLAA--QNSLPT  88

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            +L +FCS+A+L CFPDL+PS L KHDDNV F+ Y+ +NF+ YG   AAGADSFK Y+   
Sbjct  89   RLSDFCSAANLFCFPDLTPS-LEKHDDNVKFSVYDQKNFSTYGDARAAGADSFKTYSKGN  147

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N  +DTFRRYSR+++ H D+F+ Y   GNV ++ F++YG   AGGAG+F NY  DVN P 
Sbjct  148  NGAMDTFRRYSRNAAGHEDKFTVYGERGNVDEKDFNSYGTFGAGGAGDFTNYQNDVNDPM  207

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGD-QNFTSYGK  6
             RFTAYSD   GR Q FK+Y+ +AN G+ Q+FTSY K
Sbjct  208  SRFTAYSDGGTGRSQTFKTYTHDANAGNGQSFTSYSK  244


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+Y     A  + F +Y    N+    F+ Y  + +A  D F++YA+GGNV   +F 
Sbjct  237  QSFTSYSKKGNASPNEFASYGDSSNVIGSDFKNYGEEENAAKDTFTSYASGGNVLLNNFK  296

Query  185  TYGPATAGGAG---EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTS  15
             YG     G G    F NY    NV +  F+ Y+ D++    +F +Y ++ N G ++FTS
Sbjct  297  NYGDYGVSGNGAVDTFANYRDKANVGDDSFSGYAKDSNSGTVKFTNYGQSYNPGSESFTS  356

Query  14   YGK  6
            YGK
Sbjct  357  YGK  359


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 68/143 (48%), Gaps = 11/143 (8%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSR---DS  252
            SP+  + + D+ N    +F+N   YG    A  D+F +Y    N+ ++ F+ Y       
Sbjct  249  SPNEFASYGDSSNVIGSDFKN---YGEEENAAKDTFTSYASGGNVLLNNFKNYGDYGVSG  305

Query  251  SAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRK  72
            +   D F+NY    NV D SF  Y   +  G  +F NY +  N  +  FT+Y   ++G+K
Sbjct  306  NGAVDTFANYRDKANVGDDSFSGYAKDSNSGTVKFTNYGQSYNPGSESFTSYGKGSEGQK  365

Query  71   QEFKSYSENANVGDQNFTSYGKN  3
              FK+Y+ N+      F  Y KN
Sbjct  366  ISFKTYTPNS-----TFKDYAKN  383



>gb|AAN60310.1| unknown [Arabidopsis thaliana]
Length=226

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 139/196 (71%), Gaps = 3/196 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+RYWN +I    PR  FLI+ ASPL +   A FSK+A A  NSL  + P+
Sbjct  34   ENPFTPKASLVRYWNKEIRGQSPRSEFLISKASPLNSVDSATFSKLAAA--NSLPTRFPD  91

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL  +SL KHDD+V F+ Y+ +NFTNYG+  A GADSFKNY+ D N+  
Sbjct  92   FCSAANLFCFPDLG-ASLEKHDDDVKFSVYDQKNFTNYGNARAGGADSFKNYSKDGNVVT  150

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSR+++ H D+F+ Y    NV ++ F++YG    GGAG+F NY  +VN P  RFT
Sbjct  151  DSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFT  210

Query  101  AYSDDADGRKQEFKSY  54
            AYSD  +GR Q FK+Y
Sbjct  211  AYSDGGNGRSQTFKTY  226


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = -1

Query  206  VADQ-SFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            V DQ +F  YG A AGGA  F NY+KD NV    F  YS +A G   +F  Y EN+NV +
Sbjct  119  VYDQKNFTNYGNARAGGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVE  178

Query  29   QNFTSYG  9
            + F SYG
Sbjct  179  EGFNSYG  185



>ref|XP_010460151.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 148/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I N  P   FL++ ASPLTA   A F+K+A   +NSL  +LP+FC
Sbjct  38   PFTPKASLVRYWNKQIQNKSPGSAFLLSKASPLTAVASATFAKLA--SQNSLPDRLPDFC  95

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL P+ L KH ++V F+ Y+ +NFTNYG+    GADSF+ Y+ + N+  D+
Sbjct  96   SAANLFCFPDLGPT-LDKHSNDVKFSVYDQRNFTNYGTTRPGGADSFQKYSQNGNVVTDS  154

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRD++ H D F+ YA   NV D++F++YG +  GG+ EF  Y   VN P  RFTAY
Sbjct  155  FRRYSRDAAGHDDSFTGYADNSNVVDENFNSYGTSATGGSDEFKTYQSGVNNPTSRFTAY  214

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SDD +GR Q FK+Y+   N G  Q+FTSYGKN
Sbjct  215  SDDGNGRAQTFKTYTHKGNAGPGQSFTSYGKN  246


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG ++ A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D +F +
Sbjct  267  DFSNYGENANAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDTFSS  326

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            Y   +      F NY K  N  +  FT Y   A+G K +FK+Y++N+   D   T  G
Sbjct  327  YAKNSNSQKVNFVNYGKSFNPGSESFTGYGKGAEGNKIDFKTYTKNSTFKDYAKTGVG  384


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  +++A  D F  Y   GNV   +F 
Sbjct  238  QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENANAANDTFKGYGGDGNVPRNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY    NV +  F++Y+ +++ +K  F +Y ++ N G ++FT YGK
Sbjct  298  SYGASGNAAVDTFLNYRDKANVGDDTFSSYAKNSNSQKVNFVNYGKSFNPGSESFTGYGK  357



>dbj|BAE99852.1| putative polygalacuronase isoenzyme 1 beta subunit [Arabidopsis 
thaliana]
Length=622

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 148/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I +  P   FL++ ASPLTA   A F+K+A    N+L  +LP+FC
Sbjct  37   PFTPKASLVRYWNKQIHHQSPGSAFLLSKASPLTAVASATFAKLA--SENALPDRLPDFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL P+ L KH ++V F+ Y+ +NFTNYG+    GADSFK Y+ + N   D+
Sbjct  95   SAANLFCFPDLGPT-LEKHSNDVKFSVYDQRNFTNYGTIHPGGADSFKKYSQNGNAVTDS  153

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRD++ H D+F+ YA   NV ++ F++YG +  GG+G+F NY   VN P  RF AY
Sbjct  154  FRRYSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGDFKNYQSGVNNPTTRFKAY  213

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD+ +GR Q FK+Y+  AN G  Q+FTSYGKN
Sbjct  214  SDEGNGRAQTFKTYTHEANSGPGQSFTSYGKN  245


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG +  A  D+FK Y  D N+P + F+ +    +A  D F NY    NV D SF +
Sbjct  266  DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSHGASGNAAVDTFLNYRDNANVGDDSFSS  325

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y   +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  326  YAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  376


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  237  QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            ++G +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  297  SHGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  356



>ref|NP_173788.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
 sp|P92982.2|JP630_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP630; AltName: Full=Aromatic-rich glycoprotein JP630; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC98031.1| Identical to gb|ATU59467 aromatic rich glycoprotein which is 
strongly similar to gb|U63373 polygalacturonase isozyme 1 from 
Arabidopsis thaliana. EST gb|AA395212 comes from this gene 
[Arabidopsis thaliana]
 gb|AEE30429.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
Length=622

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 148/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I +  P   FL++ ASPLTA   A F+K+A    N+L  +LP+FC
Sbjct  37   PFTPKASLVRYWNKQIHHQSPGSAFLLSKASPLTAVASATFAKLA--SENALPDRLPDFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL P+ L KH ++V F+ Y+ +NFTNYG+    GADSFK Y+ + N   D+
Sbjct  95   SAANLFCFPDLGPT-LEKHSNDVKFSVYDQRNFTNYGTIHPGGADSFKKYSQNGNAVTDS  153

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRD++ H D+F+ YA   NV ++ F++YG +  GG+G+F NY   VN P  RF AY
Sbjct  154  FRRYSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGDFKNYQSGVNNPTTRFKAY  213

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD+ +GR Q FK+Y+  AN G  Q+FTSYGKN
Sbjct  214  SDEGNGRAQTFKTYTHEANSGPGQSFTSYGKN  245


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG +  A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +
Sbjct  266  DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  325

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y   +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  326  YAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  376


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  237  QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  297  SYGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  356



>gb|AAB39538.1| aromatic rich glycoprotein JP630 [Arabidopsis thaliana]
Length=622

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 148/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I +  P   FL++ ASPLTA   A F+K+A    N+L  +LP+FC
Sbjct  37   PFTPKASLVRYWNKQIHHQSPGSAFLLSKASPLTAVASATFAKLA--SENALPDRLPDFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A+L CFPDL P+ L KH ++V F+ Y+ +NFTNYG+    GADSFK Y+ + N   D+
Sbjct  95   SAANLFCFPDLGPT-LEKHSNDVKFSVYDQRNFTNYGTIHPGGADSFKKYSQNGNAVTDS  153

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSRD++ H D+F+ YA   NV ++ F++YG +  GG+G+F NY   VN P  RF AY
Sbjct  154  FRRYSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGDFKNYQSGVNNPTTRFKAY  213

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD+ +GR Q FK+Y+  AN G  Q+FTSYGKN
Sbjct  214  SDEGNGRAQTFKTYTHEANSGPGQSFTSYGKN  245


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG +  A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +
Sbjct  266  DFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSS  325

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y   +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  326  YAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  376


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  237  QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  297  SYGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  356



>ref|XP_010477679.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 5/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISND-LPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF  459
            PFTPKA L+RYWN +I N  LP   FL++ ASPLTA   A F+K+A   +NSL  +LP+F
Sbjct  37   PFTPKASLVRYWNKQIQNQSLPGSAFLLSKASPLTAVASATFAKLA--SQNSLPDRLPDF  94

Query  458  CSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVD  279
            CS+A+L CFPDL P+ L KH ++V F+ Y+ +NFTNYG+    GADSF+ Y+ + N+  D
Sbjct  95   CSAANLFCFPDLGPT-LEKHSNDVKFSVYDQRNFTNYGTTRPGGADSFEKYSQNGNVVTD  153

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            +FRRYSRD++ H D F  YA   NV D++F++YG +  GG+GEF  Y    N P  RFTA
Sbjct  154  SFRRYSRDAAGHDDSFKGYADNSNVVDENFNSYGRSATGGSGEFKTYQSGDNNPTSRFTA  213

Query  98   YSDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            YSDD +GR Q FK+Y+   N G  Q+FTSYGKN
Sbjct  214  YSDDGNGRAQTFKTYTHEGNAGPGQSFTSYGKN  246


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 3/138 (2%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAH  243
            +P+ LS +  + N    EF   +NYG ++ +  D+FK Y  D N+P + F+ Y    +A 
Sbjct  250  APNELSSYGVSSNVIGSEF---SNYGQNANSANDTFKGYGGDGNVPRNNFKSYGASGNAA  306

Query  242  TDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEF  63
             D F NY    NV D +F +Y   +     +F NY K  N  +  FT Y   A+G K +F
Sbjct  307  VDTFLNYRDKANVGDDTFSSYAKNSNSEKVDFVNYGKSFNPGSESFTGYGKGAEGNKIDF  366

Query  62   KSYSENANVGDQNFTSYG  9
            K+Y++N+   D   T  G
Sbjct  367  KTYTKNSTFKDYAKTGVG  384


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     +   +Y V  N+    F  Y +++++  D F  Y   GNV   +F 
Sbjct  238  QSFTSYGKNGNGAPNELSSYGVSSNVIGSEFSNYGQNANSANDTFKGYGGDGNVPRNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY    NV +  F++Y+ +++  K +F +Y ++ N G ++FT YGK
Sbjct  298  SYGASGNAAVDTFLNYRDKANVGDDTFSSYAKNSNSEKVDFVNYGKSFNPGSESFTGYGK  357



>ref|XP_010551569.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=625

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 158/214 (74%), Gaps = 5/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+RYWN +I ++ PR  FL++ ASPL+A   A F+K+A  D  SL  +LPE
Sbjct  38   ENPFTPKASLVRYWNKEIRSESPRSEFLLSKASPLSAVDSASFAKLAAVD--SLPTRLPE  95

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL  +SL KH D+V F+ Y+ +NFTNYG+  A G DSFKNY+ D N+  
Sbjct  96   FCSAANLFCFPDLG-ASLEKHTDDVKFSVYDQKNFTNYGTTRAGGVDSFKNYSQDSNVVA  154

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSRDS+ H D+FSNYAT  NV ++SF++YG +TAGG+G F NY  DVN P   FT
Sbjct  155  DSFRRYSRDSAGHDDKFSNYATSSNVVEESFNSYGGSTAGGSGTFTNYHNDVNNPTSTFT  214

Query  101  AYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            +YSD A  R Q FK+YS +AN G  Q+FTSYGK+
Sbjct  215  SYSDSAI-RTQTFKTYSRDANAGSGQSFTSYGKH  247


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG+H     +SF NY +D N+P + FR Y  + +A T  FSNY    NV D  F +Y
Sbjct  269  FANYGTHGHVANESFTNYGIDSNVPQNNFRSYGSEGNAATQTFSNYRDRSNVGDDRFSSY  328

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +      F NY +  N  +  FT Y   A G K  FK+Y  N    D
Sbjct  329  AKNSNAEKVNFVNYGQTFNPGSDTFTGYGKGAKGHKIGFKTYGVNTTFKD  378


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG H     D F +Y V+ N+    F  Y        + F+NY    NV   +F 
Sbjct  239  QSFTSYGKHGTGDVDDFSSYAVNSNVVGSGFANYGTHGHVANESFTNYGIDSNVPQNNFR  298

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG         F NY    NV + RF++Y+ +++  K  F +Y +  N G   FT YGK
Sbjct  299  SYGSEGNAATQTFSNYRDRSNVGDDRFSSYAKNSNAEKVNFVNYGQTFNPGSDTFTGYGK  358



>ref|XP_002890594.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66853.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 150/213 (70%), Gaps = 5/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I +  P   FL++ ASPLTA   A F+K+A    N+L  +LP+FC
Sbjct  37   PFTPKASLVRYWNKQIQHQSPGSAFLLSKASPLTAVASATFAKLA--SENALPDRLPDFC  94

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYG-SHSAAGADSFKNYTVDVNLPVD  279
            S+A+L CFPDL P+ L KH ++V F+ Y+ +NFTNYG +    GADSFK Y+ + N+  D
Sbjct  95   SAANLFCFPDLGPT-LEKHSNDVKFSVYDQRNFTNYGGTIHPGGADSFKKYSQNGNVVTD  153

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            +FRRYSRD++ H D+F+ YA   NV +++F++YG +  GG+G+F NY   VN P  RF A
Sbjct  154  SFRRYSRDAAGHEDKFTGYADNSNVVEENFNSYGTSATGGSGDFKNYQSGVNNPTSRFKA  213

Query  98   YSDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            YSDD +GR Q FK+Y+  AN G  Q+FTSYGKN
Sbjct  214  YSDDGNGRAQTFKTYTHEANAGPGQSFTSYGKN  246


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG +S A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +
Sbjct  267  DFSNYGENSNAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDSFAS  326

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            Y   +     +F NY K +N  +  FT Y   A+G K  FK+Y++N+   D
Sbjct  327  YAKNSNFEKVDFVNYGKSINPGSESFTGYGKGAEGNKIGFKTYTQNSTFKD  377


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  +S+A  D F  Y   GNV   +F 
Sbjct  238  QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENSNAANDTFKGYGGDGNVPRNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY    NV +  F +Y+ +++  K +F +Y ++ N G ++FT YGK
Sbjct  298  SYGASGNAAVDTFLNYRDKANVGDDSFASYAKNSNFEKVDFVNYGKSINPGSESFTGYGK  357



>ref|XP_002525383.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF37021.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=631

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 156/213 (73%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            +SP +PKA LIRYWN +I N+LP+  F+++ ASPL   + A FSK+A   +N+L+ +LP 
Sbjct  35   ESPLSPKASLIRYWNKEIHNNLPKSQFILSKASPLNVIEAATFSKLAA--QNALSTKLPA  92

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCSSA LLCFPDLSPS L KHD + NF +Y  +NFTNYG+  A G ++FKNY+ + NLPV
Sbjct  93   FCSSAKLLCFPDLSPS-LEKHDRDTNFANYLNKNFTNYGNEMAGGVNAFKNYSDNDNLPV  151

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRY R  +   ++FSNYA GGNV D+SF  YG +  GG  +F NYA+ VNVPNL FT
Sbjct  152  DSFRRYGRGGAGRDEKFSNYAPGGNVIDESFSGYGTSGTGGKSDFKNYAEQVNVPNLVFT  211

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSD A+G++Q F  YS + N G++ FTSYGKN
Sbjct  212  SYSDAANGKQQSFTRYSGDTNSGNEKFTSYGKN  244


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + FT+YG +      +FK Y  + N+    F  Y   ++A  D F++Y   GNV +  F 
Sbjct  236  EKFTSYGKNGNGVPTNFKGYGENSNVIGSDFNNYGETANAEFDNFTSYGFNGNVPENKFK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    GG   F +Y    NV +  F +Y+ +++G++  F +Y ++ N G   F  YG+
Sbjct  296  NYGAGGNGGGSGFTSYRDQSNVGDDSFQSYAKESNGQEVNFNNYGKSFNEGTDTFKGYGQ  355



>gb|KFK44451.1| hypothetical protein AALP_AA1G258600 [Arabis alpina]
Length=621

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 147/212 (69%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I +  P   FL++ ASPLTA   AVF+K+A    NSL  +LP+FC
Sbjct  36   PFTPKASLVRYWNREIQSQSPGSEFLLSKASPLTAVASAVFAKLA--SENSLPDRLPDFC  93

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
             +A+L CFPDL PS L +H +NV F+ Y+ +NFTNYG+  A G DSFK Y+ D N+  D+
Sbjct  94   FAANLFCFPDLGPS-LERHGNNVKFSVYDQRNFTNYGTVRAGGDDSFKKYSQDGNVVTDS  152

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FR+YSR+ + H ++F  Y    NV +++F++YG A  GG+G+F +Y   VN P  RFT+Y
Sbjct  153  FRQYSREGAGHDEKFKGYGGNSNVVEENFNSYGKAATGGSGDFRSYQTGVNNPTSRFTSY  212

Query  95   SDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            SD+ +G  Q FK+Y+  AN G  Q+FTSYGKN
Sbjct  213  SDNGNGESQTFKTYTHEANAGPGQSFTSYGKN  244


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 6/124 (5%)
 Frame = -1

Query  383  FTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY         +F+NYG +     D+FK Y  D N+P + F+ Y    +A  D F NY
Sbjct  252  FTSYGVSSNVIGSDFSNYGENGNVANDTFKGYGGDGNVPKNNFKSYGASGNAGVDTFLNY  311

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
                NV D SF +Y   +   +  F NY K  N  +  F  Y   A+G K +FK+Y++N+
Sbjct  312  RDKANVGDDSFSSYAKNSNSESVGFVNYGKSFNPGSESFKGYGKGAEGNKIDFKTYTQNS  371

Query  41   NVGD  30
               D
Sbjct  372  TFKD  375


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +   D F  Y   GNV   +F 
Sbjct  236  QSFTSYGKNGNGAPNEFTSYGVSSNVIGSDFSNYGENGNVANDTFKGYGGDGNVPKNNFK  295

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +   G   F NY    NV +  F++Y+ +++     F +Y ++ N G ++F  YGK
Sbjct  296  SYGASGNAGVDTFLNYRDKANVGDDSFSSYAKNSNSESVGFVNYGKSFNPGSESFKGYGK  355



>ref|XP_010553600.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Tarenaya hassleriana]
Length=626

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 4/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPW-FLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF  459
            PFTPKA L+RYW+ +I  D  +P  F ++ ASPL+A     F  ++ A R++L  +L +F
Sbjct  38   PFTPKASLVRYWDKRIDGDSTKPTPFFLSKASPLSAVDSTRF--VSLASRHALHTRLRDF  95

Query  458  CSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGA-DSFKNYTVDVNLPV  282
            C++A L CFP+L+     +HD +VNF+ Y  +NFTNYGS+  AGA D FKNY+   N+ +
Sbjct  96   CTAAVLFCFPELANFPAKQHDGDVNFSVYTNKNFTNYGSNRLAGAGDEFKNYSTGDNIAI  155

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSRDS+ H+D FS YA   NVADQSF+TYG  + GG+G+F  Y   VN PN RFT
Sbjct  156  DSFRRYSRDSAGHSDGFSTYADDANVADQSFNTYGAGSTGGSGDFTAYLAGVNGPNGRFT  215

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSDDA+GR Q F SYS +AN G Q FTSY KN
Sbjct  216  SYSDDANGRSQSFTSYSSDANAGVQAFTSYSKN  248


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 62/119 (52%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + SF +Y+ D N  V  F  YS++ +   + FS Y TG NV    F  Y
Sbjct  214  FTSYSDDANGRSQSFTSYSSDANAGVQAFTSYSKNGNGAPNEFSGYGTGSNVVQSDFSGY  273

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  D N+P   F +Y D  +G    FKSY +++N+G  +F+SY KN
Sbjct  274  GQTANGENDTFTSYGTDGNIPVNNFRSYGDGGNGGVYGFKSYRDDSNIGADSFSSYAKN  332


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 5/120 (4%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+ YG  +    D+F +Y  D N+PV+ FR Y    +     F +Y    N+   SF +
Sbjct  269  DFSGYGQTANGENDTFTSYGTDGNIPVNNFRSYGDGGNGGVYGFKSYRDDSNIGADSFSS  328

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y   +     +F NYAK VN+ +  FT+Y   A  ++  FKSY  N      NF  Y KN
Sbjct  329  YAKNSDNAKIDFENYAKSVNLGSDNFTSYGHGAQNQETGFKSYGPNP-----NFKEYTKN  383



>ref|NP_176242.1| polygalacturonase 1 [Arabidopsis thaliana]
 sp|O80760.1|Y639_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
At1g60390; AltName: Full=Aromatic-rich glycoprotein At1g60390; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24065.1| Strong similarity to AR0GP2 gene gb|1762634 from Lycopersicon 
esculentum [Arabidopsis thaliana]
 dbj|BAE99558.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33681.1| polygalacturonase 1 [Arabidopsis thaliana]
Length=624

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 150/213 (70%), Gaps = 2/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA LIRYWNN I+ D P+P F ++ ASPLTA     F+ +A    ++L     +
Sbjct  37   ENPFTPKASLIRYWNNHINGDSPKPSFFLSKASPLTAVDSTRFASLAS--NHALNTHHSD  94

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A L CFP+L+  SL KH D+VNF +Y  +NFTNYGS   +GADSFKNY+   N+ V
Sbjct  95   FCSAAKLFCFPELAAHSLEKHGDDVNFAAYSGKNFTNYGSDRLSGADSFKNYSGGDNIAV  154

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRYSR+S+ H D F+NYA   NVADQSF TY   T GG+GEF NY  D N PN RFT
Sbjct  155  DSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATGTTGGSGEFTNYNTDANEPNGRFT  214

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +YSD A+GR Q F +YSEN N G Q+FTSY KN
Sbjct  215  SYSDKANGRSQTFTTYSENGNTGYQSFTSYSKN  247


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F  Y+ + N    +F  YS++ +   + FS Y TG NV +  F  Y
Sbjct  213  FTSYSDKANGRSQTFTTYSENGNTGYQSFTSYSKNGNGAPNEFSGYGTGSNVVNTGFTKY  272

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G +  G    F +Y ++ NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  273  GESANGANDSFTSYGENGNVPVNEFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  331


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 6/133 (5%)
 Frame = -1

Query  383  FTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FT+Y       +Q+FT+Y  +     + F  Y    N+    F +Y   ++   D F++Y
Sbjct  227  FTTYSENGNTGYQSFTSYSKNGNGAPNEFSGYGTGSNVVNTGFTKYGESANGANDSFTSY  286

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV    F  YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ 
Sbjct  287  GENGNVPVNEFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSF  346

Query  41   NVGDQNFTSYGKN  3
            N+G  NFT YG++
Sbjct  347  NLGSDNFTGYGQD  359


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 53/119 (45%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG  +    DSF +Y  + N+PV+ F+ Y    +     F NY    N+   SF +Y
Sbjct  269  FTKYGESANGANDSFTSYGENGNVPVNEFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  328

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +      F NY K  N+ +  FT Y  D  G    FK+Y +      Q+F  Y K+
Sbjct  329  AKNSNNEKVNFVNYGKSFNLGSDNFTGYGQDNVGGNVSFKTYGQG-----QSFKVYTKD  382



>ref|XP_010520580.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=614

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 158/221 (71%), Gaps = 8/221 (4%)
 Frame = -1

Query  653  VAVG---DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNS  483
            VAVG      F+ +A L+RYW  +I  + PR  FL++ ASPL A   A F+K+A   RNS
Sbjct  19   VAVGRLIGGEFSAEASLVRYWIKEIRGESPRSEFLLSKASPLNAVDSATFAKLAA--RNS  76

Query  482  LAAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYT  303
            L+ +LPEFCS+A L CFPDL PS L +H ++V+F+ Y+ +NFTNYG+ S  G DSFKNY+
Sbjct  77   LSTRLPEFCSAAKLFCFPDLDPS-LEQHAEDVSFSVYDQKNFTNYGTSSVGGVDSFKNYS  135

Query  302  VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN  123
             D N+  D+FRRYSRDS+ H D FSNYAT  NVA+++F++YG +TAGG+G F NY  DVN
Sbjct  136  QDGNVVTDSFRRYSRDSADHDDEFSNYATSSNVAEENFNSYGHSTAGGSGTFSNYQFDVN  195

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
             P  RFT+YSD +  R Q FK+YS +AN G  Q+FTSYGK+
Sbjct  196  DPTSRFTSYSDSSS-RSQTFKTYSHDANAGLGQSFTSYGKH  235


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 5/120 (4%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F+NYG+   A  +SF +Y  D N P + FR Y  D +A T  FSNY     + D +F +
Sbjct  256  DFSNYGADGHAANESFTSYGTDSNEPQNNFRNYGTDGNASTLTFSNYRDSTTIGDDTFTS  315

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y   +      F NY + V + +  FT Y +DA+G+K  FK+Y      G+ +F  Y K+
Sbjct  316  YAKDSEDEKVNFVNYGQSVTLGSDTFTGYGEDAEGQKIGFKTYD-----GNTSFKHYAKD  370



>gb|KFK41456.1| hypothetical protein AALP_AA2G132700 [Arabis alpina]
Length=617

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 152/214 (71%), Gaps = 4/214 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA LIRYWN +I     R  FLI+ ASPLT  + A FSK+A A  NSL  + P+
Sbjct  24   ENPFTPKASLIRYWNKEIHGQSLRSEFLISKASPLTTIESATFSKLAAA--NSLQTRFPD  81

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCS+A+L CFPDL+ +SL KHD +  F+ Y+ +NFTNYG+  A G DSFK Y+ D N+  
Sbjct  82   FCSAANLFCFPDLT-ASLEKHDGDSKFSVYDQKNFTNYGNARAGGTDSFKAYSKDGNVVT  140

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+FRRY R+++AH ++F+ YA G NV +++F++YG    GGAGEF NY   VN P  RFT
Sbjct  141  DSFRRYGRNAAAHDEKFTVYAEGSNVVEENFNSYGTGGTGGAGEFTNYQNGVNNPTSRFT  200

Query  101  AYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            AYSD  +G+ Q FK+Y+  AN G+ Q+FTSYGKN
Sbjct  201  AYSDSGNGKTQSFKTYTHEANAGEGQSFTSYGKN  234


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = -1

Query  371  EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQS  192
            E Q+FT+YG +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +
Sbjct  224  EGQSFTSYGKNGNGLPNEFASYGVSANVIGSGFANYGESGNAANDTFTSYGSDGNVPQNN  283

Query  191  FHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
            F  YG         F NY    NV +  FT+Y+ D++  K  F +Y ++ N G + FTSY
Sbjct  284  FKNYGAEGNSAVDTFTNYRDAANVGDDSFTSYAKDSNAEKVNFVNYGQSFNPGSETFTSY  343

Query  11   GK  6
            GK
Sbjct  344  GK  345


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG    A  D+F +Y  D N+P + F+ Y  + ++  D F+NY    NV D SF +Y
Sbjct  256  FANYGESGNAANDTFTSYGSDGNVPQNNFKNYGAEGNSAVDTFTNYRDAANVGDDSFTSY  315

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +      F NY +  N  +  FT+Y  +A   K  FK+Y+ N+   D
Sbjct  316  AKDSNAEKVNFVNYGQSFNPGSETFTSYGKEAVNHKISFKTYTPNSTFKD  365


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 54/120 (45%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNL-PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            FT Y         SFK YT + N     +F  Y ++ +   + F++Y    NV    F  
Sbjct  199  FTAYSDSGNGKTQSFKTYTHEANAGEGQSFTSYGKNGNGLPNEFASYGVSANVIGSGFAN  258

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YG +       F +Y  D NVP   F  Y  + +     F +Y + ANVGD +FTSY K+
Sbjct  259  YGESGNAANDTFTSYGSDGNVPQNNFKNYGAEGNSAVDTFTNYRDAANVGDDSFTSYAKD  318



>ref|XP_010925453.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 141/212 (67%), Gaps = 2/212 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNS-LAAQLPEF  459
            PFT KA LIRYWN K+ N  P P FL++  SPL+A   A FS +A +   + L+ +LP  
Sbjct  38   PFTAKAALIRYWNRKVPNGRPHPDFLVSKLSPLSALDTASFSSLAASGGGAALSPRLPAL  97

Query  458  CSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVD  279
            C++A LLC P LS S+ S H  +  F +Y   NF+NYG+  A GADSFKNY+   NLPVD
Sbjct  98   CAAARLLCSPSLSTSTAS-HPSDSAFATYADSNFSNYGTDRAGGADSFKNYSASENLPVD  156

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            TFRRYSRDS+ H D F+ Y   GNV   +F +Y  A  GGAG+F +YA + NVPNL+FT 
Sbjct  157  TFRRYSRDSAGHDDSFAVYQPDGNVVTANFTSYASAATGGAGDFSSYAHEGNVPNLKFTN  216

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y  DADGR Q+F  YS++ N GDQ+F  YGK+
Sbjct  217  YDADADGRVQKFSRYSDDTNSGDQSFAGYGKH  248


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F  YG H      SF +Y  + N+    F  Y  D +   D F+NY   GNV + +F 
Sbjct  240  QSFAGYGKHGNGIPLSFTSYGNNSNVINSDFNNYGEDGNGANDTFTNYGENGNVPENNFR  299

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     G+ EF NY    NV +  FT+Y+   +    +FK+Y  + N G  +F  YG+
Sbjct  300  SYGSGGNAGSEEFSNYRDQANVGDDTFTSYAKGENAGSADFKNYGNSFNQGSDSFKGYGE  359


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 3/123 (2%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P S + + +N N  +    +F NYG       D+F NY  + N+P + FR Y    +A +
Sbjct  253  PLSFTSYGNNSNVIN---SDFNNYGEDGNGANDTFTNYGENGNVPENNFRSYGSGGNAGS  309

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            + FSNY    NV D +F +Y      G+ +F NY    N  +  F  Y + +   K  F 
Sbjct  310  EEFSNYRDQANVGDDTFTSYAKGENAGSADFKNYGNSFNQGSDSFKGYGEGSTNHKITFA  369

Query  59   SYS  51
            SYS
Sbjct  370  SYS  372



>ref|XP_002318036.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
 gb|EEE96256.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
Length=637

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 136/210 (65%), Gaps = 3/210 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+P+A LIRYWN  ISN LP+P FL++ ASPL+A   A+ +K+A   +NSL+  L  FC
Sbjct  46   PFSPRASLIRYWNKHISNSLPKPLFLLSKASPLSAIDSAILTKLAT--QNSLSLHLDSFC  103

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S A+L CF D +  SL  HD + NF  Y  + F NYG    +G DSFKNY+  +N   D+
Sbjct  104  SLANLFCFFD-TKQSLRNHDQDSNFALYSNKRFANYGGSRLSGVDSFKNYSNGLNTVADS  162

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            F RYSR+S+ H++ F+NY   GNVA+ +F  YG A  GG+G F NY   VNVP LRFT Y
Sbjct  163  FIRYSRESTGHSETFTNYGNDGNVANATFGNYGSAATGGSGTFKNYDNRVNVPGLRFTTY  222

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            + D +  K  F SYS+  NVG Q F SYGK
Sbjct  223  ASDGNDHKLSFSSYSDETNVGAQGFNSYGK  252


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++Y   +  GA  F +Y    N     F  YSRDS+    +F+ Y   GN A+ SF +Y
Sbjct  233  FSSYSDETNVGAQGFNSYGKKGNGVPSEFVSYSRDSNGIESKFTGYGELGNAANDSFTSY  292

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +       F +Y    N  + RF++Y + A+  +  F+SY++++N G  +F +YGK
Sbjct  293  GNSGNNPHNNFKSYGSGANSASDRFSSYRNGANVGQDSFQSYAKDSNSGKVSFANYGK  350


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG    A  DSF +Y    N P + F+ Y   +++ +DRFS+Y  G NV   SF +Y
Sbjct  275  FTGYGELGNAANDSFTSYGNSGNNPHNNFKSYGSGANSASDRFSSYRNGANVGQDSFQSY  334

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYS  51
               +  G   F NY K  N  N  F  Y   + G     FKSYS
Sbjct  335  AKDSNSGKVSFANYGKSFNPGNDSFIDYGKGSKGMTTIGFKSYS  378


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 62/138 (45%), Gaps = 6/138 (4%)
 Frame = -1

Query  401  HDDNVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            +D  ++F+SY        Q F +YG         F +Y+ D N     F  Y    +A  
Sbjct  227  NDHKLSFSSYSDETNVGAQGFNSYGKKGNGVPSEFVSYSRDSNGIESKFTGYGELGNAAN  286

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            D F++Y   GN    +F +YG      +  F +Y    NV    F +Y+ D++  K  F 
Sbjct  287  DSFTSYGNSGNNPHNNFKSYGSGANSASDRFSSYRNGANVGQDSFQSYAKDSNSGKVSFA  346

Query  59   SYSENANVGDQNFTSYGK  6
            +Y ++ N G+ +F  YGK
Sbjct  347  NYGKSFNPGNDSFIDYGK  364



>ref|XP_006586545.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=411

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 147/217 (68%), Gaps = 7/217 (3%)
 Frame = -1

Query  647  VGD-SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            +GD +PFTPKAY+ RYW+  + N+LP+P FL++ AS ++A+    F+K+A A  N L+ +
Sbjct  10   LGDKNPFTPKAYVARYWDKHVLNNLPKPSFLLSKASSMSASDTTSFAKLAAA--NKLSTR  67

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSY-EFQNFTNYGSHSAAGADSFKNYTVDV  294
            LPEFCS+A LLCF ++ PS L KH ++  F +Y + QNFTNYG + A G D+FKNY+  +
Sbjct  68   LPEFCSAAHLLCFQEVRPS-LEKHTEDAGFETYNDGQNFTNYGIYFAGGIDAFKNYSKTI  126

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
               V+ FRRYSR S+ H + F+ Y    NVAD+SFHTY     GG+GEF NY+ + NVP+
Sbjct  127  --LVNDFRRYSRSSAGHGESFTGYGEDTNVADKSFHTYSTNAGGGSGEFKNYSSNSNVPD  184

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +RF  Y D   GR Q F S +E+ N   Q+F SYGKN
Sbjct  185  VRFATYFDSIGGRTQSFSSNNEDDNYDRQSFQSYGKN  221


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 71/147 (48%), Gaps = 21/147 (14%)
 Frame = -1

Query  401  HDDNVNFTSYEFQNFTNYGSHSAAGADSFK--------------NYTVDVNLPVDTFRRY  264
             DDN     Y+ Q+F +YG +SA  A+SF               NY V++N+P  TF+ Y
Sbjct  206  EDDN-----YDRQSFQSYGKNSADAANSFAGYGTNSNVATLAFINYGVEMNVPEVTFKSY  260

Query  263  SRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG-EFGNYAKDVNVPNLRFTAYSDD  87
            +  + A T+ F+NY    N+AD SF +Y   T      +F NY    N  +  F  Y+  
Sbjct  261  AVRTHASTESFANYRDQANIADDSFQSYAKNTKERTKLDFKNYGNSFNPGSDTFKGYAKG  320

Query  86   ADG-RKQEFKSYSENANVGDQNFTSYG  9
            A+G  K  F +Y+ N N   +++   G
Sbjct  321  AEGDHKVGFTTYNVNTNATFKDYAKQG  347



>ref|XP_010682558.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 149/221 (67%), Gaps = 10/221 (5%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G++PFTPKAY IRYWNNKI   +PRP FL++ ASPL+++  A F+++A    NSL+  L 
Sbjct  43   GENPFTPKAYAIRYWNNKIYK-VPRPQFLLSKASPLSSSDSARFTQLAST--NSLSTHLT  99

Query  464  EFCSSADLLCFPD-------LSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNY  306
             FC  A+LLCFPD        + SS  KH  +  F++Y   NFTNY + +A G +SF NY
Sbjct  100  TFCKLANLLCFPDPTTFSLSSTSSSSKKHPSDAKFSAYSDNNFTNYATGAAGGLNSFTNY  159

Query  305  TVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDV  126
            + + N P+D+FRRYSRDS+ H D F NYA  GNV  Q+F+TY     GGAG F +YA +V
Sbjct  160  SAEENEPLDSFRRYSRDSAGHNDEFINYAKDGNVISQTFNTYAAGATGGAGSFSSYADNV  219

Query  125  NVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            N P L+FT+Y D+A+GR   FKSYS  AN GDQ F +YGKN
Sbjct  220  NAPGLQFTSYLDEANGRVNSFKSYSTEANAGDQGFGNYGKN  260


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 79/160 (49%), Gaps = 8/160 (5%)
 Frame = -1

Query  461  FCSSADLLCFPDLSPSS-LSKHDDNVN-FTSYEF------QNFTNYGSHSAAGADSFKNY  306
            F S AD +  P L  +S L + +  VN F SY        Q F NYG +     + F  Y
Sbjct  212  FSSYADNVNAPGLQFTSYLDEANGRVNSFKSYSTEANAGDQGFGNYGKNGNGLINGFSRY  271

Query  305  TVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDV  126
              + N+   TF  YS+  ++  D F++Y   GNV +  F++Y      G   F +Y    
Sbjct  272  GENTNVVGSTFSGYSQTGNSGNDSFTSYGFNGNVPENKFNSYADGGNAGVESFSSYRDQS  331

Query  125  NVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            NV +  F +Y+  ++ +K EF +Y+++ N G  NFT YG+
Sbjct  332  NVGDDVFKSYAKSSNIQKVEFGNYAQSFNQGSDNFTGYGE  371


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 3/136 (2%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDR  234
            S S + DNVN    +F   T+Y   +    +SFK+Y+ + N     F  Y ++ +   + 
Sbjct  211  SFSSYADNVNAPGLQF---TSYLDEANGRVNSFKSYSTEANAGDQGFGNYGKNGNGLING  267

Query  233  FSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY  54
            FS Y    NV   +F  Y      G   F +Y  + NVP  +F +Y+D  +   + F SY
Sbjct  268  FSRYGENTNVVGSTFSGYSQTGNSGNDSFTSYGFNGNVPENKFNSYADGGNAGVESFSSY  327

Query  53   SENANVGDQNFTSYGK  6
             + +NVGD  F SY K
Sbjct  328  RDQSNVGDDVFKSYAK  343


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (50%), Gaps = 8/135 (6%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
             S++ +N N     F  ++  G+   +G DSF +Y  + N+P + F  Y+   +A  + F
Sbjct  268  FSRYGENTNVVGSTFSGYSQTGN---SGNDSFTSYGFNGNVPENKFNSYADGGNAGVESF  324

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S+Y    NV D  F +Y  ++     EFGNYA+  N  +  FT Y + A G+   F +Y 
Sbjct  325  SSYRDQSNVGDDVFKSYAKSSNIQKVEFGNYAQSFNQGSDNFTGYGEGAKGQDIGFSTYG  384

Query  50   ENANVGDQNFTSYGK  6
            + +     NF SY K
Sbjct  385  QGS-----NFKSYAK  394



>emb|CDY57845.1| BnaA07g38770D [Brassica napus]
Length=627

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLP--RPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQL  468
            ++PFTPKA L+RYWN +I +D    R  FLI+ ASPL A + A F+K+A   +NSL  +L
Sbjct  34   ENPFTPKASLVRYWNKEIRSDKSSIRSEFLISKASPLNAVESATFAKLAA--QNSLPTRL  91

Query  467  PEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            P+FCS+A+L CFPDLSPS L +H+ +V F+ Y+ +NFTNYG+ +A G DSFK Y+ D N+
Sbjct  92   PDFCSAANLFCFPDLSPS-LEQHNADVKFSVYDEKNFTNYGNAAAGGTDSFKTYSKDGNV  150

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
              D+FRRYSR+++ H D+F+ Y    NV +++F++YG    GG GEF NY   VN P  R
Sbjct  151  VTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSYGTFGTGGTGEFTNYQNGVNNPTSR  210

Query  107  FTAYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            FTAYSD  +G+ Q FK+Y+  AN GD Q+FTSYGKN
Sbjct  211  FTAYSDGGNGKAQSFKTYTHEANAGDGQSFTSYGKN  246


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG    A  DSF +Y  D N+P + F+ Y    +A +D F+NY    NV D SF +Y
Sbjct  268  FSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGASGNAASDTFANYRDKSNVGDDSFSSY  327

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G  +F NY +  N  +  FT Y   A+G K  FK+Y+ N+      F  Y KN
Sbjct  328  AKDSNSGTAKFTNYGQSFNPGSETFTGYGKGAEGHKISFKTYTPNS-----TFKDYAKN  381


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +F 
Sbjct  238  QSFTSYGKNGNGVPNEFASYGVSANVIGSGFSNYGEKGNAANDSFTSYGSDGNVPQNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +    +  F NY    NV +  F++Y+ D++    +F +Y ++ N G + FT YGK
Sbjct  298  NYGASGNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFTNYGQSFNPGSETFTGYGK  357


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 6/111 (5%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYG+   A +D+F NY    N+  D+F  Y++DS++ T +F+NY    N   ++F  
Sbjct  295  NFKNYGASGNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFTNYGQSFNPGSETFTG  354

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            YG    G    F  Y      PN  F  Y+ +  G  + +   S +A +GD
Sbjct  355  YGKGAEGHKISFKTY-----TPNSTFKDYAKNGVGFAK-YNVSSTSATLGD  399



>ref|XP_009105700.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Brassica rapa]
Length=627

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLP--RPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQL  468
            ++PFTPKA L+RYWN +I +D    R  FLI+ ASPL A + A F+K+A   +NSL  +L
Sbjct  34   ENPFTPKASLVRYWNKEIRSDKSSIRSEFLISKASPLNAVESATFAKLAA--QNSLPTRL  91

Query  467  PEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            P+FCS+A+L CFPDLSPS L +H+ +V F+ Y+ +NFTNYG+ +A G DSFK Y+ D N+
Sbjct  92   PDFCSAANLFCFPDLSPS-LEQHNADVKFSVYDQKNFTNYGNAAAGGTDSFKTYSKDGNV  150

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
              D+FRRYSR+++ H D+F+ Y    NV +++F++YG    GG GEF NY   VN P  R
Sbjct  151  VTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSYGTFGTGGTGEFTNYQNGVNNPTSR  210

Query  107  FTAYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            FTAYSD  +G+ Q FK+Y+  AN GD Q+FTSYGKN
Sbjct  211  FTAYSDGGNGKAQSFKTYTHEANAGDGQSFTSYGKN  246


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG    A  DSF +Y  D N+P + F+ Y    +A +D F+NY    NV D SF +Y
Sbjct  268  FSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGASGNAASDTFANYRDKSNVGDDSFSSY  327

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G  +F NY +  N  +  FT Y   A+G K  FK+Y+ N+      F  Y KN
Sbjct  328  AKDSNSGTAKFNNYGQSFNPGSETFTGYGKGAEGHKISFKTYTPNS-----TFKDYAKN  381


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +F 
Sbjct  238  QSFTSYGKNGNGVPNEFASYGVSANVIGSGFSNYGEKGNAANDSFTSYGSDGNVPQNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +    +  F NY    NV +  F++Y+ D++    +F +Y ++ N G + FT YGK
Sbjct  298  NYGASGNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFNNYGQSFNPGSETFTGYGK  357


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 53/120 (44%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLP-VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            FT Y       A SFK YT + N     +F  Y ++ +   + F++Y    NV    F  
Sbjct  211  FTAYSDGGNGKAQSFKTYTHEANAGDGQSFTSYGKNGNGVPNEFASYGVSANVIGSGFSN  270

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YG         F +Y  D NVP   F  Y    +     F +Y + +NVGD +F+SY K+
Sbjct  271  YGEKGNAANDSFTSYGSDGNVPQNNFKNYGASGNAASDTFANYRDKSNVGDDSFSSYAKD  330


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 6/111 (5%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYG+   A +D+F NY    N+  D+F  Y++DS++ T +F+NY    N   ++F  
Sbjct  295  NFKNYGASGNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFNNYGQSFNPGSETFTG  354

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            YG    G    F  Y      PN  F  Y+ +  G  + +   S +A +GD
Sbjct  355  YGKGAEGHKISFKTY-----TPNSTFKDYAKNGVGFAK-YNVSSTSATLGD  399



>ref|XP_009393062.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 147/213 (69%), Gaps = 2/213 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT +A +IRYWN K+    P+P FL+   SPL+A   A FS +A AD ++L+ +LP  C
Sbjct  39   PFTARAAVIRYWNRKVPMSRPQPAFLLAKLSPLSAVDSATFSSLAAADPSALSTRLPALC  98

Query  455  SSADLLCFPDLSP--SSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            ++A LLC P  +   S+ ++ DD+  F SY+  NF++YG+ ++ G  +FK+Y+ D+N+PV
Sbjct  99   AAARLLCSPAQANTYSAAARKDDSSAFASYQNSNFSDYGTGASGGRSAFKHYSDDLNVPV  158

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            DTFRRYSRDS+ H D F++YA  GNV   +F +YG +  GGAG+F +Y  + NVP+L+FT
Sbjct  159  DTFRRYSRDSTGHNDSFASYAPDGNVVTANFTSYGSSATGGAGDFASYDHESNVPDLKFT  218

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             Y  DA GR++ F SYS++ N GDQ+F  YGK+
Sbjct  219  NYDADATGRRRSFSSYSDDTNAGDQSFAGYGKD  251


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 63/133 (47%), Gaps = 6/133 (5%)
 Frame = -1

Query  386  NFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSN  225
            +F SY+ ++      FTNY + +     SF +Y+ D N    +F  Y +D       F++
Sbjct  202  DFASYDHESNVPDLKFTNYDADATGRRRSFSSYSDDTNAGDQSFAGYGKDGDRVPTSFTS  261

Query  224  YATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            YA   NV   SF  YG    G    F +Y  + NVP   F +Y    +   + F SY + 
Sbjct  262  YANNSNVIGSSFAGYGEGAKGANDSFASYGFNGNVPENNFRSYGAGGNSGSERFSSYRDQ  321

Query  44   ANVGDQNFTSYGK  6
            +NVGD +F SY K
Sbjct  322  SNVGDDSFASYAK  334


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 66/142 (46%), Gaps = 7/142 (5%)
 Frame = -1

Query  428  DLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS  249
            D  P+S + + +N N       +F  YG  +    DSF +Y  + N+P + FR Y    +
Sbjct  253  DRVPTSFTSYANNSNVIG---SSFAGYGEGAKGANDSFASYGFNGNVPENNFRSYGAGGN  309

Query  248  AHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ  69
            + ++RFS+Y    NV D SF +Y         +F NY    N  +  F  Y + +   + 
Sbjct  310  SGSERFSSYRDQSNVGDDSFASYAKGGGAATADFVNYGDSFNPGSDSFKGYGEGSAKHRV  369

Query  68   EFKSYSENANVGDQNFTSYGKN  3
             FKSY+ +    + +F  Y K+
Sbjct  370  TFKSYAGD----NTSFKGYAKS  387


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (45%), Gaps = 3/136 (2%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDR  234
            S S + D+ N      Q+F  YG        SF +Y  + N+   +F  Y   +    D 
Sbjct  230  SFSSYSDDTNAGD---QSFAGYGKDGDRVPTSFTSYANNSNVIGSSFAGYGEGAKGANDS  286

Query  233  FSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY  54
            F++Y   GNV + +F +YG     G+  F +Y    NV +  F +Y+        +F +Y
Sbjct  287  FASYGFNGNVPENNFRSYGAGGNSGSERFSSYRDQSNVGDDSFASYAKGGGAATADFVNY  346

Query  53   SENANVGDQNFTSYGK  6
             ++ N G  +F  YG+
Sbjct  347  GDSFNPGSDSFKGYGE  362



>ref|XP_002886622.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62881.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 152/218 (70%), Gaps = 3/218 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            +   ++PFTPKA LIRYWNN I+ D P+P F ++ ASPLTA     F+ +A    + L  
Sbjct  33   ITASENPFTPKASLIRYWNNHINGDSPKPSFFLSKASPLTAVDSTRFASLAST--HVLHT  90

Query  473  QLPEFCSSADLLCFPDLSPS-SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            +  +FCS+A L CFP+L+ + S+ KH D+V+F +Y  +NFTNYGS   +GADSFKNY+  
Sbjct  91   RHSDFCSAAKLFCFPELANAHSVDKHGDDVSFAAYSGKNFTNYGSDRLSGADSFKNYSGG  150

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+ VD+FRRYSR+S+ H D F+NYA   NVADQSF TY   T GG+GEF +Y  + N P
Sbjct  151  DNIAVDSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATGTTGGSGEFTSYNTNANEP  210

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            N RFT+YSD A+GR Q F +YS+N N GDQ FTSY KN
Sbjct  211  NGRFTSYSDKANGRSQTFTTYSDNGNTGDQTFTSYSKN  248


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F  Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  214  FTSYSDKANGRSQTFTTYSDNGNTGDQTFTSYSKNGNGAPNEFSGYGTGSNVVITGFTKY  273

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y ++ NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  274  GETANGANDSFTSYGENGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  332


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+Y  +     + F  Y    N+ +  F +Y   ++   D F++Y   GNV    F 
Sbjct  240  QTFTSYSKNGNGAPNEFSGYGTGSNVVITGFTKYGETANGANDSFTSYGENGNVPVNDFK  299

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ N+G  NFT YG+
Sbjct  300  GYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQ  359


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 52/119 (44%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG  +    DSF +Y  + N+PV+ F+ Y    +     F NY    N+   SF +Y
Sbjct  270  FTKYGETANGANDSFTSYGENGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  329

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +      F NY K  N+ +  FT Y     G    FK+Y +      Q+F  Y K+
Sbjct  330  AKNSNNEKVNFVNYGKSFNLGSDNFTGYGQGNVGGNVSFKTYGQG-----QSFKVYTKD  383



>emb|CCD74525.1| polygalacturonase 1 [Arabidopsis halleri subsp. halleri]
Length=626

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 153/219 (70%), Gaps = 4/219 (2%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            +   ++PFTPKA LIRYWNN I+ D P+P F ++ ASPLTA     F+ +A    ++L  
Sbjct  33   ITASENPFTPKASLIRYWNNHINGDSPKPSFFLSKASPLTAVDSTRFASLAS--NHALHT  90

Query  473  QLPEFCSSADLLCFPDLSPS-SLS-KHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTV  300
            +  +FCS+A L CFP+L+ + S+S KH D+V F +Y  +NFTNYGS   +GADSFKNY+ 
Sbjct  91   RHSDFCSAAKLFCFPELANAHSISDKHGDDVTFAAYSGKNFTNYGSDRLSGADSFKNYSG  150

Query  299  DVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNV  120
              N+ VD+FRRYSR+S+ H D F+NYA   NVADQSF TY   T GG+GEF NY  + N 
Sbjct  151  GDNIAVDSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATGTTGGSGEFTNYNTNANE  210

Query  119  PNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            PN RFT+YSD A+GR Q F +YS+N N GDQ FTSY KN
Sbjct  211  PNGRFTSYSDKANGRSQTFTTYSDNGNTGDQTFTSYSKN  249


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F  Y+ + N    TF  YS++ +   + FS Y TG NV +  F  Y
Sbjct  215  FTSYSDKANGRSQTFTTYSDNGNTGDQTFTSYSKNGNGAPNEFSGYGTGSNVVNTGFTKY  274

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y ++ NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  275  GETANGANDSFTSYGENGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  333


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+Y  +     + F  Y    N+    F +Y   ++   D F++Y   GNV    F 
Sbjct  241  QTFTSYSKNGNGAPNEFSGYGTGSNVVNTGFTKYGETANGANDSFTSYGENGNVPVNDFK  300

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ N+G  NFT YG+
Sbjct  301  GYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQ  360


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 52/119 (44%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG  +    DSF +Y  + N+PV+ F+ Y    +     F NY    N+   SF +Y
Sbjct  271  FTKYGETANGANDSFTSYGENGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSY  330

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +      F NY K  N+ +  FT Y     G    FK+Y +      Q+F  Y K+
Sbjct  331  AKNSNNEKVNFVNYGKSFNLGSDNFTGYGQGNVGGNVSFKTYGQG-----QSFKVYTKD  384



>ref|XP_010023570.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
Length=624

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 141/209 (67%), Gaps = 3/209 (1%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
            FTP+A L+RYW+  I+N LP+P FL++ ASPL A   A  +    A R +L   LP FC+
Sbjct  34   FTPRASLLRYWDQHIANSLPKPAFLLSKASPLGAVDAA--AFAKLAARGALPDHLPAFCA  91

Query  452  SADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTF  273
            +A LLCFPDL+PS L KH  + +F SY  +NFTNYG+    G DSFKNY+  +N+ VDTF
Sbjct  92   AAGLLCFPDLAPS-LEKHPADSDFASYSNKNFTNYGTDRLGGLDSFKNYSDGLNVIVDTF  150

Query  272  RRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYS  93
            RRYSRDSS H DRF+NY + GN+ DQSF +Y    AGG GEF NY   VNVPNL F  Y 
Sbjct  151  RRYSRDSSGHDDRFANYGSDGNLVDQSFQSYAGGAAGGTGEFKNYNPGVNVPNLNFNNYG  210

Query  92   DDADGRKQEFKSYSENANVGDQNFTSYGK  6
              A GR Q F +Y++  N G ++F++YGK
Sbjct  211  SGATGRPQNFAAYTDETNAGAESFSNYGK  239


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYGS +     +F  YT + N   ++F  Y +      ++F+ YA+  NV +  F+ 
Sbjct  205  NFNNYGSGATGRPQNFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNG  264

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y  A  G    F NY K+ NVP   F  Y D  +G    F +Y + +NVGD +F SY KN
Sbjct  265  YSQAGNGANDTFTNYGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSYAKN  324


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 65/141 (46%), Gaps = 8/141 (6%)
 Frame = -1

Query  428  DLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS  249
            D SP+  +++  + N  +  F  ++  G+      D+F NY  + N+P + FR Y    +
Sbjct  242  DGSPNKFTEYASDSNVINSGFNGYSQAGN---GANDTFTNYGKEGNVPENNFRNYGDGGN  298

Query  248  AHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ  69
              +D F+NY    NV D SF +Y   +      F NY K  NV   +FT Y   A G+K 
Sbjct  299  GISDGFANYRDQSNVGDDSFQSYAKNSNSAKVNFANYGKSFNVGTDKFTGYGQGAKGQKI  358

Query  68   EFKSYSENANVGDQNFTSYGK  6
             FK Y  N       F  YGK
Sbjct  359  GFKGYGVN-----NTFKEYGK  374


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 3/138 (2%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P + + + D  N  +   ++F+NYG       + F  Y  D N+    F  YS+  +   
Sbjct  217  PQNFAAYTDETNAGA---ESFSNYGKSGDGSPNKFTEYASDSNVINSGFNGYSQAGNGAN  273

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            D F+NY   GNV + +F  YG    G +  F NY    NV +  F +Y+ +++  K  F 
Sbjct  274  DTFTNYGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSYAKNSNSAKVNFA  333

Query  59   SYSENANVGDQNFTSYGK  6
            +Y ++ NVG   FT YG+
Sbjct  334  NYGKSFNVGTDKFTGYGQ  351



>ref|XP_009394250.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=646

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 142/214 (66%), Gaps = 3/214 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA ++RYWN K++ + P+P FL++  SPL+A  YA FS +A A  ++L+ +LP  C
Sbjct  44   PFTAKAAVMRYWNRKVTANRPQPAFLLSKLSPLSALDYATFSSLAAAGPSALSPRLPALC  103

Query  455  SSADLLCFP---DLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            ++A LLCFP   +   S+ +  D   +F +Y+  NF+NY + +  G  SF+NY+  +N+P
Sbjct  104  AAARLLCFPTRFESYASATTARDGPSDFATYQTSNFSNYATGAVGGTQSFENYSESLNVP  163

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
            VDTFRRYSRDS+ H D F++YA GGNV    F +Y  +  GG G+F +Y  D N P L+F
Sbjct  164  VDTFRRYSRDSAGHNDSFASYAPGGNVVTAKFTSYASSATGGTGDFTSYGDDTNNPELKF  223

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T Y   A+GR Q F SYS++AN GDQ+F  YGK+
Sbjct  224  TNYDAQANGRHQSFGSYSDDANSGDQSFAGYGKD  257


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 58/118 (49%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNY + +     SF +Y+ D N    +F  Y +D +     F++YA   NV    F  Y
Sbjct  223  FTNYDAQANGRHQSFGSYSDDANSGDQSFAGYGKDGNGVVSAFASYANDSNVIGSGFAGY  282

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G         F NY  + NVP   F +Y D  +G  + F SY + +NVGD +FTSY K
Sbjct  283  GEGANAARDSFTNYGFNGNVPENNFRSYGDRGNGGSERFSSYRDESNVGDDSFTSYAK  340


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F  YG        +F +Y  D N+    F  Y   ++A  D F+NY   GNV + +F 
Sbjct  249  QSFAGYGKDGNGVVSAFASYANDSNVIGSGFAGYGEGANAARDSFTNYGFNGNVPENNFR  308

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG    GG+  F +Y  + NV +  FT+Y+  ++    EF +Y  + N G  +F  YG+
Sbjct  309  SYGDRGNGGSERFSSYRDESNVGDDSFTSYAKGSNAGTAEFDNYGNSFNPGSDSFKGYGQ  368


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 56/120 (47%), Gaps = 6/120 (5%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F  YG  + A  DSF NY  + N+P + FR Y    +  ++RFS+Y    NV D SF +Y
Sbjct  279  FAGYGEGANAARDSFTNYGFNGNVPENNFRSYGDRGNGGSERFSSYRDESNVGDDSFTSY  338

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQN-FTSYGKN  3
               +  G  EF NY    N  +  F  Y       +  FKSY     +G+ N F  Y K+
Sbjct  339  AKGSNAGTAEFDNYGNSFNPGSDSFKGYGQGFGNHEITFKSY-----IGENNSFKGYAKS  393



>gb|KCW59875.1| hypothetical protein EUGRSUZ_H02608 [Eucalyptus grandis]
Length=623

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 141/209 (67%), Gaps = 3/209 (1%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
            FTP+A L+RYW+  I+N LP+P FL++ ASPL A   A  +    A R +L   LP FC+
Sbjct  33   FTPRASLLRYWDQHIANSLPKPAFLLSKASPLGAVDAA--AFAKLAARGALPDHLPAFCA  90

Query  452  SADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTF  273
            +A LLCFPDL+PS L KH  + +F SY  +NFTNYG+    G DSFKNY+  +N+ VDTF
Sbjct  91   AAGLLCFPDLAPS-LEKHPADSDFASYSNKNFTNYGTDRLGGLDSFKNYSDGLNVIVDTF  149

Query  272  RRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYS  93
            RRYSRDSS H DRF+NY + GN+ DQSF +Y    AGG GEF NY   VNVPNL F  Y 
Sbjct  150  RRYSRDSSGHDDRFANYGSDGNLVDQSFQSYAGGAAGGTGEFKNYNPGVNVPNLNFNNYG  209

Query  92   DDADGRKQEFKSYSENANVGDQNFTSYGK  6
              A GR Q F +Y++  N G ++F++YGK
Sbjct  210  SGATGRPQNFAAYTDETNAGAESFSNYGK  238


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYGS +     +F  YT + N   ++F  Y +      ++F+ YA+  NV +  F+ 
Sbjct  204  NFNNYGSGATGRPQNFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNG  263

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y  A  G    F NY K+ NVP   F  Y D  +G    F +Y + +NVGD +F SY KN
Sbjct  264  YSQAGNGANDTFTNYGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSYAKN  323


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 65/141 (46%), Gaps = 8/141 (6%)
 Frame = -1

Query  428  DLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS  249
            D SP+  +++  + N  +  F  ++  G+      D+F NY  + N+P + FR Y    +
Sbjct  241  DGSPNKFTEYASDSNVINSGFNGYSQAGN---GANDTFTNYGKEGNVPENNFRNYGDGGN  297

Query  248  AHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ  69
              +D F+NY    NV D SF +Y   +      F NY K  NV   +FT Y   A G+K 
Sbjct  298  GISDGFANYRDQSNVGDDSFQSYAKNSNSAKVNFANYGKSFNVGTDKFTGYGQGAKGQKI  357

Query  68   EFKSYSENANVGDQNFTSYGK  6
             FK Y  N       F  YGK
Sbjct  358  GFKGYGVN-----NTFKEYGK  373


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 3/138 (2%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P + + + D  N  +   ++F+NYG       + F  Y  D N+    F  YS+  +   
Sbjct  216  PQNFAAYTDETNAGA---ESFSNYGKSGDGSPNKFTEYASDSNVINSGFNGYSQAGNGAN  272

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            D F+NY   GNV + +F  YG    G +  F NY    NV +  F +Y+ +++  K  F 
Sbjct  273  DTFTNYGKEGNVPENNFRNYGDGGNGISDGFANYRDQSNVGDDSFQSYAKNSNSAKVNFA  332

Query  59   SYSENANVGDQNFTSYGK  6
            +Y ++ NVG   FT YG+
Sbjct  333  NYGKSFNVGTDKFTGYGQ  350



>gb|KEH20007.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=627

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA+ IRYW+  I N LP+P F++N ASPL+A +    +    A  N+L+ +LPEFC
Sbjct  32   PFTAKAFAIRYWDRVIKNKLPKPTFILNKASPLSATE--TAAFAKHAAANTLSTKLPEFC  89

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSY-EFQNFTNYGSHSAAGADSFKNYTVDV-NLPV  282
            S+A LLCFP+++P+ L+KH  +  F+ Y + QNFTNYG+    G DSFKNY+    N P+
Sbjct  90   SAAHLLCFPEVTPN-LAKHSQDGKFSVYNDGQNFTNYGTERPGGLDSFKNYSNGFENNPI  148

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            + FR+YSR S+ H D F+NYA   NVADQ+F+TYG   AGG+G+F  YAK  NVPNLRFT
Sbjct  149  NEFRQYSRSSAGHNDSFTNYALETNVADQNFNTYGSGAAGGSGDFKAYAKGTNVPNLRFT  208

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             YS    GR+QEF SYSE  N GDQ+F +YGK+
Sbjct  209  TYSVGVAGRQQEFTSYSEAGNAGDQSFGNYGKD  241


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 20/136 (15%)
 Frame = -1

Query  392  NVNFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y        Q FT+Y     AG  SF N              Y +DS+   ++F
Sbjct  204  NLRFTTYSVGVAGRQQEFTSYSEAGNAGDQSFGN--------------YGKDSAGAENKF  249

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y T  NVA   F +Y     G    F NY  ++N P   F  Y+  + G  ++F +Y 
Sbjct  250  TAYGTDSNVASSGFSSYADQGTGNKDTFVNYGVNMNNPTENFKNYASGSLGAAEKFSNYR  309

Query  50   ENANVGDQNFTSYGKN  3
            + ANVG  +FTSY K+
Sbjct  310  DQANVGADSFTSYAKD  325


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 57/121 (47%), Gaps = 1/121 (1%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F NYG  SA   + F  Y  D N+    F  Y+   + + D F NY    N   ++F 
Sbjct  233  QSFGNYGKDSAGAENKFTAYGTDSNVASSGFSSYADQGTGNKDTFVNYGVNMNNPTENFK  292

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYG  9
             Y   + G A +F NY    NV    FT+Y+ D+ G    +F +Y ++ N G  +F  Y 
Sbjct  293  NYASGSLGAAEKFSNYRDQANVGADSFTSYAKDSTGGTHVDFDNYGKSFNEGTDSFKGYA  352

Query  8    K  6
            K
Sbjct  353  K  353



>ref|XP_010417970.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=628

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 151/218 (69%), Gaps = 2/218 (1%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            I A  ++PFTPKA LIRYWNN I+ D P+P F I+ ASPLT      F+ +A    +SL 
Sbjct  35   ITASSENPFTPKASLIRYWNNHINGDSPKPLFFISKASPLTPVDSTRFASLAS--NHSLH  92

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
             +  +FCS+A L CFP+L+  SL KH D+V+F +Y  +NFTNYGS   +GADSFKNY+  
Sbjct  93   TRHSDFCSAAKLFCFPELAAHSLEKHGDDVDFAAYSGKNFTNYGSDRLSGADSFKNYSGG  152

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+ VD+FRRYSR+S+ H + F+ YA   NVADQ+F TY   T GG+GEF +Y  + N P
Sbjct  153  DNIAVDSFRRYSRNSAGHDEGFTTYAGDVNVADQTFTTYATGTTGGSGEFTSYNTNANEP  212

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            N RFT+YSD A+GR Q F +YS+N N G+Q FTSY KN
Sbjct  213  NGRFTSYSDKANGRSQTFTTYSDNGNNGEQTFTSYSKN  250


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F  Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  216  FTSYSDKANGRSQTFTTYSDNGNNGEQTFTSYSKNGNGAPNEFSGYGTGSNVVKSGFTKY  275

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G         F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F SY KN
Sbjct  276  GENGNEANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFASYAKN  334


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y   GNV    F 
Sbjct  242  QTFTSYSKNGNGAPNEFSGYGTGSNVVKSGFTKYGENGNEANDSFTSYGGNGNVPVNDFK  301

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F NY    N+    F +Y+ +++  K  F +Y ++ N+G  NFT YGK
Sbjct  302  GYGDGGNGAVYGFKNYRDQSNIGVDSFASYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGK  361



>emb|CDY59986.1| BnaC06g43610D [Brassica napus]
Length=611

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 153/216 (71%), Gaps = 6/216 (3%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLP--RPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQL  468
            ++PFTPKA L+RYWN +I +D    R  FLI+ ASPL A + A F+K+A   +NSL  + 
Sbjct  34   ENPFTPKASLVRYWNKEIRSDKSSIRSEFLISKASPLNAVESATFAKLAA--QNSLPTRF  91

Query  467  PEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            P+FCS+A+L CFPDLSPS L +H+ +V F+ Y+ +NFTNYG+ +A G DSFK Y+ D N+
Sbjct  92   PDFCSAANLFCFPDLSPS-LEQHNADVKFSVYDQKNFTNYGNAAAGGVDSFKTYSKDGNV  150

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
              D+FRRYSR+++ H D+F+ Y    NV +++F++YG    GG GEF NY   VN P  R
Sbjct  151  VTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSYGTFGTGGTGEFTNYQNGVNNPTSR  210

Query  107  FTAYSDDADGRKQEFKSYSENANVGD-QNFTSYGKN  3
            FTAYSD  +G+ Q FK+Y+  AN G+ Q+FTSYGKN
Sbjct  211  FTAYSDGGNGKAQSFKTYTHEANAGNGQSFTSYGKN  246


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG    A  DSF +Y  D N+P + F+ Y    +A +D F+NY    NV D SF +Y
Sbjct  268  FSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGASGNAASDTFANYRDKSNVGDDSFSSY  327

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               +  G  +F NY +  N  +  FT Y   A+G K  FK+Y+ N+      F  Y KN
Sbjct  328  AKDSNSGTAKFTNYGQSFNPGSETFTGYGKGAEGHKISFKTYTPNS-----TFKDYAKN  381


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y    +A  D F++Y + GNV   +F 
Sbjct  238  QSFTSYGKNGNGVPNEFASYGVSANVIGSGFSNYGEKGNAANDSFTSYGSDGNVPQNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG +    +  F NY    NV +  F++Y+ D++    +F +Y ++ N G + FT YGK
Sbjct  298  NYGASGNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFTNYGQSFNPGSETFTGYGK  357


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 6/111 (5%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF NYG+   A +D+F NY    N+  D+F  Y++DS++ T +F+NY    N   ++F  
Sbjct  295  NFKNYGASGNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFTNYGQSFNPGSETFTG  354

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            YG    G    F  Y      PN  F  Y+ +  G  + +   S +A +GD
Sbjct  355  YGKGAEGHKISFKTY-----TPNSTFKDYAKNGVGFAK-YNVSSTSATLGD  399



>ref|XP_010510953.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=626

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 150/217 (69%), Gaps = 2/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            +   ++PFTPKA LIRYWNN I+ D P+P F I+ ASPLT      F+ +A    +SL  
Sbjct  35   ITASENPFTPKASLIRYWNNHINGDSPKPSFFISKASPLTPVDSTRFASLAS--NHSLHT  92

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            +  +FCS+A L CFP+L+  SL KH D+V+F SY  +NFTNYGS   +GADSFKNY+   
Sbjct  93   RHSDFCSAAKLFCFPELAAHSLEKHGDDVDFASYSGKNFTNYGSDRLSGADSFKNYSGGD  152

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N+ VD+FRRYSR+S+ H + F+ YA   NVADQ+F TY   T GG+GEF +Y  + N PN
Sbjct  153  NIAVDSFRRYSRNSAGHDEGFTTYAGDVNVADQTFTTYATGTTGGSGEFTSYNTNANEPN  212

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             RFT+YSD A+GR Q F +YS+N N G+Q FTSY KN
Sbjct  213  GRFTSYSDKANGRSQTFTAYSDNGNNGEQTFTSYSKN  249


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F  Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  215  FTSYSDKANGRSQTFTAYSDNGNNGEQTFTSYSKNGNGAPNEFSGYGTGSNVVKSGFTKY  274

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F SY KN
Sbjct  275  GENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFASYAKN  333


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y   GNV    F 
Sbjct  241  QTFTSYSKNGNGAPNEFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFK  300

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F NY    N+    F +Y+ +++  K  F +Y ++ N+G  NFT+YG+
Sbjct  301  GYGDGGNGAVYGFKNYRDQSNIGVDSFASYAKNSNNEKVNFVNYGKSFNLGSDNFTAYGQ  360


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 47/104 (45%), Gaps = 0/104 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG +     DSF +Y  + N+PV+ F+ Y    +     F NY    N+   SF +Y
Sbjct  271  FTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFASY  330

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
               +      F NY K  N+ +  FTAY     G    FK+Y +
Sbjct  331  AKNSNNEKVNFVNYGKSFNLGSDNFTAYGQGNVGGNVSFKTYGQ  374



>ref|XP_011044316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=637

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 135/210 (64%), Gaps = 3/210 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+P+A LIRYWN  ISN LP+P FL++ ASPL+A   A+ +K+A   +NSL+  L  FC
Sbjct  46   PFSPRASLIRYWNKHISNSLPKPLFLLSKASPLSAVDSAILTKLAT--QNSLSLHLDSFC  103

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S A+L CF D    SL  HD + NF  Y  + F NYG+   +G DSFKNY+  +N   D+
Sbjct  104  SLANLFCFFD-PKQSLRNHDHDSNFALYSNKRFANYGASRLSGVDSFKNYSNGLNSVADS  162

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            F RYSR+S+  ++ F+NY   GNVA+ +F  YG A  GG+G F NY   VNVP LRFT Y
Sbjct  163  FIRYSRESTGQSETFTNYGNDGNVANATFGNYGSAATGGSGTFKNYDSQVNVPGLRFTTY  222

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            + + +  K  F SYS+  NVG Q F SYGK
Sbjct  223  ASEGNDHKLSFSSYSDETNVGAQGFNSYGK  252


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 48/104 (46%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG    A  DSF  Y    N P D F+ Y   +++  DRFS+Y  G NV   SF +Y
Sbjct  275  FTGYGELGNAANDSFTGYGNSGNNPHDNFKSYGSGANSAIDRFSSYRKGANVGQDSFQSY  334

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYS  51
               +  G   F NY K  N  N  F  Y   + G     FKSYS
Sbjct  335  AKNSNSGKVSFANYGKSFNPGNDSFIDYGKGSKGMTTIGFKSYS  378


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 62/138 (45%), Gaps = 6/138 (4%)
 Frame = -1

Query  401  HDDNVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            +D  ++F+SY        Q F +YG         F +Y+ D N+    F  Y    +A  
Sbjct  227  NDHKLSFSSYSDETNVGAQGFNSYGKKGNGVPSEFISYSRDSNIIESKFTGYGELGNAAN  286

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            D F+ Y   GN    +F +YG         F +Y K  NV    F +Y+ +++  K  F 
Sbjct  287  DSFTGYGNSGNNPHDNFKSYGSGANSAIDRFSSYRKGANVGQDSFQSYAKNSNSGKVSFA  346

Query  59   SYSENANVGDQNFTSYGK  6
            +Y ++ N G+ +F  YGK
Sbjct  347  NYGKSFNPGNDSFIDYGK  364



>ref|XP_010473218.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=629

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 149/218 (68%), Gaps = 2/218 (1%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            I A  ++PFTPKA LIRYWNN I+ D P+P F I+ ASPLT      F+ +A    +SL 
Sbjct  37   ITASSENPFTPKASLIRYWNNHINGDSPKPSFFISKASPLTPVDSTRFASLAS--YHSLH  94

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
             +  +FCS+A L CFP+L+  SL KH D+V F +Y  +NFTNYGS   +GADSFKNY+  
Sbjct  95   TRHSDFCSAAKLFCFPELAAHSLEKHGDDVEFAAYSGKNFTNYGSDRLSGADSFKNYSGG  154

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+ VD+FRRY R+S+ H + F+ YA   NVADQ+F TY   T GG+GEF +Y  + N P
Sbjct  155  DNIAVDSFRRYGRNSAGHDEGFTTYAGDVNVADQTFTTYATGTTGGSGEFTSYNTNANEP  214

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            N RFT+YSD A+GR Q F +YS+N N G+Q FTSY KN
Sbjct  215  NGRFTSYSDKANGRSQTFTTYSDNGNNGEQTFTSYSKN  252


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F  Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  218  FTSYSDKANGRSQTFTTYSDNGNNGEQTFTSYSKNGNGAPNEFSGYGTGSNVVKSGFTKY  277

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F SY KN
Sbjct  278  GENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFASYAKN  336


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y   GNV    F 
Sbjct  244  QTFTSYSKNGNGAPNEFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFK  303

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    G    F NY    N+    F +Y+ +++  K  F +Y ++ N+G  NFT YG+
Sbjct  304  GYGDGGNGAVYGFKNYRDQSNIGVDSFASYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQ  363



>ref|XP_009415276.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 144/213 (68%), Gaps = 2/213 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT +A LIRYW   +  + P+  FL+   SPL+A   A FS +  AD ++L+ +LP  C
Sbjct  39   PFTARAALIRYWKRMVPTNRPQADFLLAKLSPLSALDSATFSSLVAADPSALSRRLPAIC  98

Query  455  SSADLLCFPDLSP--SSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            ++A LLC P  +   S+ ++ DD+  F SY+  NF++YG+ +A G  SFKNY+ D+N+PV
Sbjct  99   AAARLLCSPATANTYSAAARKDDSSAFASYQNSNFSDYGTGAAGGRSSFKNYSDDLNVPV  158

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            DTFRRYSRDS+ H D F++Y+  GNV   +F +YG +  GGAG+F +Y  + NVP+L+FT
Sbjct  159  DTFRRYSRDSTGHNDSFASYSPEGNVVTANFTSYGSSATGGAGDFASYDHESNVPDLKFT  218

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             Y  DA GR++ F SYS++ N GDQ+F  YGK+
Sbjct  219  NYDADATGRRRSFSSYSDDTNAGDQSFAGYGKD  251


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 65/133 (49%), Gaps = 6/133 (5%)
 Frame = -1

Query  386  NFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSN  225
            +F SY+ ++      FTNY + +     SF +Y+ D N    +F  Y +D +     F++
Sbjct  202  DFASYDHESNVPDLKFTNYDADATGRRRSFSSYSDDTNAGDQSFAGYGKDGNGVPTSFTS  261

Query  224  YATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            YA   NV   SF  YG    G    F +Y  + NVP   F +Y D  +   + F SY + 
Sbjct  262  YADNSNVIGSSFAGYGEGANGANDSFASYGFNGNVPENNFRSYGDGGNSGSERFTSYRDQ  321

Query  44   ANVGDQNFTSYGK  6
            +NVGD  FTSY K
Sbjct  322  SNVGDDRFTSYAK  334


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (47%), Gaps = 7/139 (5%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+S + + DN N       +F  YG  +    DSF +Y  + N+P + FR Y    ++ +
Sbjct  256  PTSFTSYADNSNVIG---SSFAGYGEGANGANDSFASYGFNGNVPENNFRSYGDGGNSGS  312

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            +RF++Y    NV D  F +Y       A +F NY    N  +  F  Y + +      FK
Sbjct  313  ERFTSYRDQSNVGDDRFTSYAKGGNAAAADFVNYGNSFNEGSDSFKGYGEGSSKHSVTFK  372

Query  59   SYSENANVGDQNFTSYGKN  3
            SY+ +    + +F +Y K+
Sbjct  373  SYAAD----NTSFKAYAKS  387


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 64/136 (47%), Gaps = 3/136 (2%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDR  234
            S S + D+ N      Q+F  YG        SF +Y  + N+   +F  Y   ++   D 
Sbjct  230  SFSSYSDDTNAGD---QSFAGYGKDGNGVPTSFTSYADNSNVIGSSFAGYGEGANGANDS  286

Query  233  FSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY  54
            F++Y   GNV + +F +YG     G+  F +Y    NV + RFT+Y+   +    +F +Y
Sbjct  287  FASYGFNGNVPENNFRSYGDGGNSGSERFTSYRDQSNVGDDRFTSYAKGGNAAAADFVNY  346

Query  53   SENANVGDQNFTSYGK  6
              + N G  +F  YG+
Sbjct  347  GNSFNEGSDSFKGYGE  362



>gb|KEH20006.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=644

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 146/219 (67%), Gaps = 10/219 (5%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKAY+IRYW+  I N+LP+P F+++ ASPL+A + A F+K A A  N+L+ +LPEFC
Sbjct  38   PFTPKAYVIRYWDRVIKNNLPKPSFILSKASPLSATEAATFTKHAAA--NTLSTKLPEFC  95

Query  455  SSADLLCFPDLS------PSSLSKHDDNVNFTSYEF-QNFTNYGSHSAAGADSFKNYTVD  297
            S+A L CFP+L+      PS  + ++ + NFT Y   +NFT YG+H   G D+FKNY+  
Sbjct  96   SAAHLFCFPELTKQRPFDPSHFTVYETDQNFTFYSLGENFTTYGTHKLNGIDAFKNYSNG  155

Query  296  V-NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNV  120
            + N   + F RYS+ S+ H D F NYA   N   Q+F++YG  +  G GEF  Y+++ N+
Sbjct  156  LYNEKHNEFARYSKISTGHNDSFKNYALNNNEGVQTFNSYGTKSMAGFGEFKAYSEESNI  215

Query  119  PNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            PNL+FT Y+    GR+Q F SYS+  N G+Q+F SYGK+
Sbjct  216  PNLKFTTYTASVTGREQSFVSYSDGGNSGNQSFASYGKD  254



>gb|KDP31113.1| hypothetical protein JCGZ_11489 [Jatropha curcas]
Length=627

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 131/210 (62%), Gaps = 3/210 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+PKA LIRYWN  ISN LP P FL + ASPLTA   A FSK+A    NSL++    FC
Sbjct  41   PFSPKASLIRYWNKHISNSLPNPPFLFSKASPLTAIDSAFFSKLAT--HNSLSSHFDSFC  98

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            SSA+L C  D S + L+ H+ + NF  Y  + F+NYG   + G DSFKNY+  +N   D+
Sbjct  99   SSANLFCSFD-SKAELANHNKDANFALYSNKRFSNYGGSRSGGVDSFKNYSNGLNSVTDS  157

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            F +YSRD + H++ F+NYA   NVA+ +F  YG    GG+GEF NY   VNVP LRFT Y
Sbjct  158  FIKYSRDGTGHSETFTNYAADANVANATFGNYGTGATGGSGEFKNYDDRVNVPGLRFTTY  217

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
              D +  K  F  YS   N G Q FTSYGK
Sbjct  218  DSDGNNHKLSFSHYSGETNSGSQTFTSYGK  247


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG    A    F NY+ D N+   TF  Y    +   D F+ Y   GN    +F 
Sbjct  240  QTFTSYGKKGNAVPSEFINYSEDSNIIDSTFTGYGELGNVANDSFTGYGVSGNNPHTNFK  299

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG      +  F NY    NV    F +Y+ +A+  K  F +Y +  N G+  F  YGK
Sbjct  300  SYGAGENAASDSFSNYRNGANVGQDSFQSYAKNANAGKVSFTNYGKTFNPGNDTFKEYGK  359


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 40/94 (43%), Gaps = 0/94 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       DSF  Y V  N P   F+ Y    +A +D FSNY  G NV   SF +Y
Sbjct  270  FTGYGELGNVANDSFTGYGVSGNNPHTNFKSYGAGENAASDSFSNYRNGANVGQDSFQSY  329

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADG  78
                  G   F NY K  N  N  F  Y   + G
Sbjct  330  AKNANAGKVSFTNYGKTFNPGNDTFKEYGKGSKG  363



>ref|XP_011071835.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Sesamum indicum]
Length=635

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 138/217 (64%), Gaps = 3/217 (1%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
             ++  +PFTP+A ++RYW   ISN+LP+P FL++ ASPL+  + A F+K+A     +L+A
Sbjct  38   TSISSNPFTPRASVVRYWAKHISNNLPQPSFLLSKASPLSPVESAFFTKLAA--EKALSA  95

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
             L  FCS+ADL C     P+ +  H  + NF  Y  +NF NYG+    G D FKNY+  V
Sbjct  96   HLSAFCSAADLFCLHGSKPA-VESHKSDANFAFYTNKNFANYGNARLGGVDQFKNYSDGV  154

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N    +F RYSR S+ H + F++YA+ GNVA  +F +YG +  GGAG+F  Y   VNVP+
Sbjct  155  NFATGSFARYSRGSTGHHEGFASYASDGNVASSNFTSYGSSATGGAGDFKTYMPRVNVPD  214

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFT+Y  D +G K  F SY+++ N G+Q F  YGKN
Sbjct  215  LRFTSYDSDGNGHKLTFASYADDTNSGNQGFAGYGKN  251


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F  YG +  A    F +Y    N+   TF  Y    ++  D F  Y T  N    +F 
Sbjct  243  QGFAGYGKNGNAVPVEFTSYGQTSNVVGSTFTGYGELGNSANDSFKGYDTNANNPSNNFK  302

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG    GG+  F NY    N     F +Y  +++  K  F +Y  + NVG  +F  Y K
Sbjct  303  NYGVGGNGGSDTFTNYRDSANAGTDTFQSYGRNSNSEKSTFVNYGNSFNVGFDSFKEYAK  362


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 49/121 (40%), Gaps = 6/121 (5%)
 Frame = -1

Query  389  VNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFS  228
            V FTSY          FT YG    +  DSFK Y  + N P + F+ Y    +  +D F+
Sbjct  257  VEFTSYGQTSNVVGSTFTGYGELGNSANDSFKGYDTNANNPSNNFKNYGVGGNGGSDTFT  316

Query  227  NYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
            NY    N    +F +YG  +      F NY    NV    F  Y+     +   FK Y  
Sbjct  317  NYRDSANAGTDTFQSYGRNSNSEKSTFVNYGNSFNVGFDSFKEYAKGGVDQTVGFKIYGV  376

Query  47   N  45
            N
Sbjct  377  N  377



>gb|KDO69698.1| hypothetical protein CISIN_1g0378482mg, partial [Citrus sinensis]
Length=495

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
             + G +P+T KA LIRYWNN ISN+LP+P F+++ ASPL A   A  + +A   +N+L++
Sbjct  69   TSTGGNPYTAKASLIRYWNNHISNNLPKPEFILSKASPLNAIHLAKLTILAA--QNTLSS  126

Query  473  QLPEFCSSADLLC---FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYT  303
             LP FCS A+L+C   F D S SS+     + +F  Y  +NF NYG     G DSFKNY+
Sbjct  127  HLPAFCSLANLICTLEFDDQSSSSIR----DASFAVYSNKNFANYGDSKLGGIDSFKNYS  182

Query  302  VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN  123
              +N P D+F++YSR+S+ HT+ F++YA  GNVA+++F +Y      G+G F NYA+ VN
Sbjct  183  QALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFTNYAERVN  242

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            VPNLRF +Y  D +  K  F SY  + N G + F SYGKN
Sbjct  243  VPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKN  282


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+YGS + +GA+ F +Y  + N     F  Y+  ++     F+ YA  GN A+ SF  Y
Sbjct  262  FTSYGSDTNSGAEGFMSYGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAANDSFKAY  321

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +       F +Y    N     FT+Y + A+     F+SY++NAN G  NF +YGK
Sbjct  322  GVSGNNPHNNFKSYGIGANSAVAGFTSYRNGANVGDDSFQSYAKNANSGKVNFANYGK  379


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 72/160 (45%), Gaps = 8/160 (5%)
 Frame = -1

Query  461  FCSSADLLCFPDLSPSSLSKHDDN--VNFTSYE------FQNFTNYGSHSAAGADSFKNY  306
            F + A+ +  P+L  +S     +N  ++FTSY        + F +YG +  AG   F +Y
Sbjct  234  FTNYAERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNGNAGPTDFTSY  293

Query  305  TVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDV  126
                N    +F  Y+   +A  D F  Y   GN    +F +YG         F +Y    
Sbjct  294  ADSANTVGSSFTGYAESGNAANDSFKAYGVSGNNPHNNFKSYGIGANSAVAGFTSYRNGA  353

Query  125  NVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            NV +  F +Y+ +A+  K  F +Y +  N+G+  F  YGK
Sbjct  354  NVGDDSFQSYAKNANSGKVNFANYGKTFNLGNDTFKEYGK  393


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 56/123 (46%), Gaps = 4/123 (3%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  + + D+ N       +FT Y     A  DSFK Y V  N P + F+ Y   +++  
Sbjct  287  PTDFTSYADSANTVG---SSFTGYAESGNAANDSFKAYGVSGNNPHNNFKSYGIGANSAV  343

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EF  63
              F++Y  G NV D SF +Y      G   F NY K  N+ N  F  Y   + GR    F
Sbjct  344  AGFTSYRNGANVGDDSFQSYAKNANSGKVNFANYGKTFNLGNDTFKEYGKGSVGRTSIGF  403

Query  62   KSY  54
            KSY
Sbjct  404  KSY  406



>ref|XP_010555103.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=602

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 140/217 (65%), Gaps = 27/217 (12%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            A  ++PFTPKA L+RYWN +I  +  R  FL++ ASPLTA + A F+K+A  D  SL+ +
Sbjct  31   AAEENPFTPKASLVRYWNKEIRRESHRSEFLLSKASPLTAVESASFAKLAAVD--SLSTR  88

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            LPEFCS+A+L CFPDL PS L KH D+V+F+ Y+ +NFTNYG+  A G DSFKNY++D N
Sbjct  89   LPEFCSAANLFCFPDLGPS-LEKHTDDVSFSVYDQKNFTNYGTSRAGGVDSFKNYSLDGN  147

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            +  D+FRRYSR+S                      T G +  GG G+F NY   VN P  
Sbjct  148  VVADSFRRYSRNS----------------------TCGRSATGGGGDFSNYQTGVNNPTS  185

Query  110  RFTAYSDDADGRKQEFKSYSENANVG-DQNFTSYGKN  3
            RFT+YSD +  R Q FK+YS  AN G  Q+FTSYGK+
Sbjct  186  RFTSYSDSSI-RSQTFKTYSHEANAGPGQSFTSYGKH  221


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG H    A+ F +Y V  N+    F  Y+   +   D F++Y + GNV   +F 
Sbjct  213  QSFTSYGKHGNGAANEFSSYAVSSNVVGSGFSNYAEHGNGANDTFTSYGSDGNVPQNNFR  272

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG A   G   F NY    NV +  F++Y+ +++  K  F +Y +  N G   F+ YGK
Sbjct  273  NYGAAGNAGVEAFSNYRDTANVGDDSFSSYAKNSNAEKVNFVNYGKTFNPGSDTFSGYGK  332


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 64/142 (45%), Gaps = 8/142 (6%)
 Frame = -1

Query  431  PDLSPSSLSKHDDNV--NFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            P  S +S  KH +     F+SY   +      F+NY  H     D+F +Y  D N+P + 
Sbjct  211  PGQSFTSYGKHGNGAANEFSSYAVSSNVVGSGFSNYAEHGNGANDTFTSYGSDGNVPQNN  270

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FR Y    +A  + FSNY    NV D SF +Y   +      F NY K  N  +  F+ Y
Sbjct  271  FRNYGAAGNAGVEAFSNYRDTANVGDDSFSSYAKNSNAEKVNFVNYGKTFNPGSDTFSGY  330

Query  95   SDDADGRKQEFKSYSENANVGD  30
               A+ +K  FKSY  N    D
Sbjct  331  GKGAESQKVAFKSYGVNTTFKD  352



>ref|XP_006439797.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
 gb|ESR53037.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
Length=608

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
             + G +P+T KA LIRYWNN ISN+LP+P F+++ ASPL A   A  + +A   +N+L++
Sbjct  31   TSTGGNPYTAKASLIRYWNNHISNNLPKPEFILSKASPLNAIHLAKLTILAA--QNTLSS  88

Query  473  QLPEFCSSADLLC---FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYT  303
             LP FCS A+L+C   F D S SS+     + +F  Y  +NF NYG     G DSFKNY+
Sbjct  89   HLPAFCSLANLICTLEFDDQSSSSIR----DASFAVYSNKNFANYGDSKLGGIDSFKNYS  144

Query  302  VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN  123
              +N P D+F++YSR+S+ HT+ F++YA  GNVA+++F +Y      G+G F NYA+ VN
Sbjct  145  QALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFTNYAERVN  204

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            VPNLRF +Y  D +  K  F SY  + N G + F SYGKN
Sbjct  205  VPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKN  244


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+YGS + +GA+ F +Y  + N     F  Y+  ++     F+ YA  GN A+ SF  Y
Sbjct  224  FTSYGSDTNSGAEGFMSYGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAANDSFKAY  283

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +       F +Y    N     FT+Y + A+     F+SY++NAN G+  F  YGK
Sbjct  284  GVSGNNPHNNFKSYGIGANSAVAGFTSYRNGANVGDDSFQSYAKNANSGNDTFKEYGK  341



>ref|XP_006476763.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390-like 
[Citrus sinensis]
Length=624

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
             + G +P+T KA LIRYWNN ISN+LP+P F+++ ASPL A   A  + +A   +N+L++
Sbjct  33   TSTGGNPYTAKASLIRYWNNHISNNLPKPEFILSKASPLNAIHLAKLTILAA--QNTLSS  90

Query  473  QLPEFCSSADLLC---FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYT  303
             LP FCS A+L+C   F D S SS+     + +F  Y  +NF NYG     G DSFKNY+
Sbjct  91   HLPAFCSLANLICTFEFDDQSSSSIR----DASFAVYSNKNFANYGDSKLGGIDSFKNYS  146

Query  302  VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN  123
              +N P D+F++YSR+S+ HT+ F++YA  GNVA+++F +Y      G+G F NYA+ VN
Sbjct  147  QALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFNNYAERVN  206

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            VPNLRF +Y  D +  K  F SY  + N G + F SYGKN
Sbjct  207  VPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKN  246


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+YGS + +GA+ F +Y  + N     F  Y+  ++     F+ YA  GN A+ SF  Y
Sbjct  226  FTSYGSDTNSGAEGFMSYGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAANDSFKAY  285

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +       F +Y    N     FT+Y + A+     F+SY++NAN G  NF +YGK
Sbjct  286  GVSGNNPHNNFKSYGIGANSAVAGFTSYRNGANVGDDSFQSYAKNANSGKVNFANYGK  343


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 70/156 (45%), Gaps = 8/156 (5%)
 Frame = -1

Query  449  ADLLCFPDLSPSSLSKHDDN--VNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDV  294
            A+ +  P+L  +S     +N  ++FTSY        + F +YG +  AG   F +Y    
Sbjct  202  AERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNGNAGPTDFTSYADSA  261

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N    +F  Y+   +A  D F  Y   GN    +F +YG         F +Y    NV +
Sbjct  262  NTVGSSFTGYAESGNAANDSFKAYGVSGNNPHNNFKSYGIGANSAVAGFTSYRNGANVGD  321

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
              F +Y+ +A+  K  F +Y +  N+G+  F  YGK
Sbjct  322  DSFQSYAKNANSGKVNFANYGKTFNLGNDTFKEYGK  357


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 56/123 (46%), Gaps = 4/123 (3%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  + + D+ N       +FT Y     A  DSFK Y V  N P + F+ Y   +++  
Sbjct  251  PTDFTSYADSANTVG---SSFTGYAESGNAANDSFKAYGVSGNNPHNNFKSYGIGANSAV  307

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EF  63
              F++Y  G NV D SF +Y      G   F NY K  N+ N  F  Y   + GR    F
Sbjct  308  AGFTSYRNGANVGDDSFQSYAKNANSGKVNFANYGKTFNLGNDTFKEYGKASVGRTSIGF  367

Query  62   KSY  54
            K+Y
Sbjct  368  KNY  370



>ref|XP_004509826.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=636

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 143/213 (67%), Gaps = 5/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA+ IRYW+  I N+LP+P F+ + ASPL+A   A  +    A  N+L+ +LPEFC
Sbjct  40   PFTPKAFAIRYWDRVIKNNLPKPSFIFSKASPLSAVDAA--AFAKHAAANTLSTKLPEFC  97

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSY-EFQNFTNYGSHSAAGADSFKNYTVDV-NLPV  282
            S+A LLCF D++PS L K   + +F  Y + +NFTNYG+    G  SFKNY++ + +  +
Sbjct  98   SAAHLLCFQDINPS-LEKFPKDTDFAVYNKAENFTNYGTSQPGGLSSFKNYSIGLLSAEL  156

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            + FR YSRDS++H + F+ YA   N A++ F+TYG   A G+G+F  YAKD NVPNL F 
Sbjct  157  NEFRTYSRDSASHNESFTTYAENTNAAEEKFNTYGTFAAAGSGDFKVYAKDSNVPNLDFN  216

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             YS    GR+Q F SYSE  N G+Q+FT+YGK+
Sbjct  217  TYSVSTAGREQTFTSYSEAGNAGNQSFTNYGKD  249



>ref|XP_002511417.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF52019.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=637

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 4/212 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+PKA LIRYWN  I N LP+  FL++ ASPLTA   A  S++A   +NSL++    FC
Sbjct  48   PFSPKASLIRYWNKHIFNTLPKSPFLLSKASPLTAIDSAFLSRLAT--QNSLSSHFESFC  105

Query  455  SSADLLCFPDLSPSSLSKHDDN--VNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            S A+L C  D  P +L   +DN   NF  Y  + F NYG     G DSFKNY+  +N   
Sbjct  106  SLANLFCSFDSKPMNLGDKNDNKDANFALYSNKQFANYGRSQLGGVDSFKNYSNGLNSVS  165

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D+F +YSRD++ H++ F+NYAT GNVA+ +F  YG    GG+G F NY   VNVP LRFT
Sbjct  166  DSFVKYSRDATGHSEAFTNYATDGNVANATFGNYGAGATGGSGVFKNYDDRVNVPGLRFT  225

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             Y  D +  K  F SYS + N G ++FTSYGK
Sbjct  226  TYDSDGNNHKLSFSSYSGDTNSGSESFTSYGK  257


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 41/94 (44%), Gaps = 0/94 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       DSF  Y +  N P + F+ Y    ++  D FS+Y  G NV   SF +Y
Sbjct  280  FTGYGELGNVANDSFAGYGLSGNNPHNNFKSYGTGGNSAIDSFSSYRNGANVGQDSFQSY  339

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADG  78
               T  G   F NY K  N  N  F  Y   + G
Sbjct  340  ARNTNAGKVSFTNYGKTFNPGNDTFKEYGKGSKG  373


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++FT+YG         F  Y+ D N+   TF  Y    +   D F+ Y   GN    +F 
Sbjct  250  ESFTSYGKKGNGVPAEFATYSGDSNIIESTFTGYGELGNVANDSFAGYGLSGNNPHNNFK  309

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG         F +Y    NV    F +Y+ + +  K  F +Y +  N G+  F  YGK
Sbjct  310  SYGTGGNSAIDSFSSYRNGANVGQDSFQSYARNTNAGKVSFTNYGKTFNPGNDTFKEYGK  369



>ref|XP_008239752.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=627

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 140/216 (65%), Gaps = 8/216 (4%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPK+ L RYW+N ISN+LP+P FL + ASPL     A+ +++A    NSL+A    FC
Sbjct  26   PFTPKSSLNRYWDNHISNNLPKPNFLFSKASPLDRVNSAILTQLAA--HNSLSAHFASFC  83

Query  455  SSADLLCFPDLSPSS------LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            S A+L C  D   +       +++H  + NF +Y  +NF NYGS   AG DSFKNY+  +
Sbjct  84   SLANLYCSFDSQSAQTHQQDLVARHFKDANFAAYSNKNFANYGSPQPAGGDSFKNYSDGL  143

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N P D+F++YS+D+++H+++F+ YA   NVA+ SF +YG  +AGG+GEF +Y   VNVPN
Sbjct  144  NSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSYGADSAGGSGEFTSYDDQVNVPN  203

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            LRF AY  DA+  +  F  YS + N G + F SYGK
Sbjct  204  LRFAAYDSDANNHRLSFIGYSHDTNSGSETFVSYGK  239


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 61/140 (44%), Gaps = 9/140 (6%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  S + ++ N        FT YG       DSFK Y    N P + F+ Y    ++  
Sbjct  245  PTEFSSYAEDANIIG---SGFTGYGESGTGQNDSFKGYGQSANNPHNNFKSYGGGGTSGI  301

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EF  63
            D FSNY +G NV D SF +Y   +  G   F NY K  N  N  F  Y   + GR    F
Sbjct  302  DGFSNYRSGANVGDDSFQSYARNSNSGKVSFSNYGKSFNPGNDSFKEYGTGSKGRTSVGF  361

Query  62   KSYSENANVGDQNFTSYGKN  3
            KSY        +NF  Y KN
Sbjct  362  KSYGLG-----RNFKEYAKN  376


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 67/160 (42%), Gaps = 8/160 (5%)
 Frame = -1

Query  464  EFCSSADLLCFPDLSPSSLSKHDDN--VNFTSYEF------QNFTNYGSHSAAGADSFKN  309
            EF S  D +  P+L  ++     +N  ++F  Y        + F +YG    A    F +
Sbjct  191  EFTSYDDQVNVPNLRFAAYDSDANNHRLSFIGYSHDTNSGSETFVSYGKTGNANPTEFSS  250

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            Y  D N+    F  Y    +   D F  Y    N    +F +YG     G   F NY   
Sbjct  251  YAEDANIIGSGFTGYGESGTGQNDSFKGYGQSANNPHNNFKSYGGGGTSGIDGFSNYRSG  310

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             NV +  F +Y+ +++  K  F +Y ++ N G+ +F  YG
Sbjct  311  ANVGDDSFQSYARNSNSGKVSFSNYGKSFNPGNDSFKEYG  350



>ref|XP_010101197.1| hypothetical protein L484_015001 [Morus notabilis]
 gb|EXB87871.1| hypothetical protein L484_015001 [Morus notabilis]
Length=637

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 133/211 (63%), Gaps = 2/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA LIRYWN +ISN+LP+P FL++ ASPL   + A+  K+A   + +L+A L  FC
Sbjct  49   PFTAKASLIRYWNKQISNNLPKPNFLLSKASPLGPTETAILIKLAT--QKNLSAHLESFC  106

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S A L C  D S + +     + NF +Y  +NF NYG+    G DSFKNY+ ++N P D+
Sbjct  107  SLAHLFCSFDDSKNDVVSSKKDSNFATYANKNFANYGAARLGGGDSFKNYSAELNSPNDS  166

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FR+YSR S++H + F NYA   NVA  +F  YG     G+GEF  Y + VNVPNLRF++Y
Sbjct  167  FRKYSRGSNSHGEGFDNYAADANVATSTFTNYGADATAGSGEFKTYHRQVNVPNLRFSSY  226

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               A+G +  F SY+   N G ++F SY KN
Sbjct  227  DSAANGHRLSFSSYAAETNSGAESFVSYSKN  257


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 49/104 (47%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG     G D+FK Y +  N P   F+ Y    +A  D+F NY  G NV   SF +Y
Sbjct  279  FTGYGESGNGGNDTFKGYGLSGNNPKSDFKSYGSGGTAGIDQFWNYRNGANVGGDSFLSY  338

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYS  51
               +  G   F NY K  N+ N  F  Y   A GR    FKSYS
Sbjct  339  ARNSNSGKAIFVNYGKSFNLGNDSFKEYGKGATGRTTIGFKSYS  382



>ref|XP_007210277.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
 gb|EMJ11476.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
Length=613

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 142/221 (64%), Gaps = 10/221 (5%)
 Frame = -1

Query  647  VGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQL  468
             G +PFTPKA L RYW+N ISN+LP+P FL + ASPL     A+ +++A    NSL A  
Sbjct  8    TGTNPFTPKASLNRYWDNHISNNLPKPNFLFSKASPLDRVNSAILTQLAA--HNSLPAHF  65

Query  467  PEFCSSADLLCFPDLSPSS-------LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKN  309
              FCS A+L C  D SPS+       +++H  + NF +Y  +NF NYGS      DSFKN
Sbjct  66   ASFCSLANLYCSFD-SPSAQTHQQDLVARHFKDANFAAYSNKNFANYGSSQLGDGDSFKN  124

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            Y+  +N P D+F++YS+D+++H+++F+ YA   NVA+ SF +YG  +AGG+G+F +Y   
Sbjct  125  YSDGLNSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSYGADSAGGSGQFTSYDDQ  184

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            VNVPNLRF AY  DA+  +  F  YS + N G + F SYGK
Sbjct  185  VNVPNLRFAAYDSDANNHRLSFIGYSHDTNSGSETFVSYGK  225


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 62/140 (44%), Gaps = 9/140 (6%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  S + ++ N        FT YG       DSFK Y    N P + F+ Y    ++  
Sbjct  231  PTEFSSYAEDANIIG---SGFTGYGESGTGQNDSFKGYGQSANNPHNNFKSYGGGGTSGI  287

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EF  63
            D FSNY +G NV D SF +Y   +  G   F NY K  N  N  F  Y   + GR    F
Sbjct  288  DGFSNYRSGANVGDDSFQSYARNSNSGKVSFSNYGKSFNPGNDSFKEYGTGSKGRTSVGF  347

Query  62   KSYSENANVGDQNFTSYGKN  3
            KSY+       ++F  Y KN
Sbjct  348  KSYALG-----RSFKEYAKN  362



>gb|EPS60630.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=595

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 134/215 (62%), Gaps = 4/215 (2%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            A G +PFTPK YL+RYW   I  +   P FL+  ASPLTAAQ A F++IA  D + L+A+
Sbjct  1    AEGANPFTPKGYLLRYWKAHILGESAFPEFLLEKASPLTAAQNAAFAEIA-GDGSRLSAK  59

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            LPEFC+ A L CFPDLS S   KHD N +F +Y  +NF++YG   + G DSF++Y     
Sbjct  60   LPEFCAQAGLFCFPDLSQSP-EKHDRNADFATYLDRNFSSYGDKRSYGTDSFQHYAEHGT  118

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
              V+ FR YSR+S +H D+F +Y T  NVADQSF TYG     GAG F NY   VN  NL
Sbjct  119  TAVNAFRSYSRESFSHFDKFDSYGTDNNVADQSFDTYGKEANTGAGTFENYNNRVNDQNL  178

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            RF  YS       Q F +YS  +N G++ F +YGK
Sbjct  179  RFATYSGGQ--LYQSFATYSTASNTGEEGFANYGK  211


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 62/150 (41%), Gaps = 18/150 (12%)
 Frame = -1

Query  401  HDDNVNFTSYE----FQNFTNYGSHSAAGADSFKNYTVDVNLP--------------VDT  276
            +D N+ F +Y     +Q+F  Y + S  G + F NY    N P                 
Sbjct  174  NDQNLRFATYSGGQLYQSFATYSTASNTGEEGFANYGKAGNGPENLFIGYANGANSVTSN  233

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            F  Y R+ +   D FS+Y   GN    +F  Y     GG   F  Y    N+ N  F +Y
Sbjct  234  FNSYDRNGNGGNDTFSSYGENGNNPTNNFRNYDSQGNGGTDSFTTYRNQSNIGNDNFNSY  293

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               ++G    F  Y E+ N G  NFT+YGK
Sbjct  294  GTKSNGLTIGFAHYGESYNQGTDNFTTYGK  323


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 48/108 (44%), Gaps = 0/108 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NF +Y  +   G D+F +Y  + N P + FR Y    +  TD F+ Y    N+ + +F++
Sbjct  233  NFNSYDRNGNGGNDTFSSYGENGNNPTNNFRNYDSQGNGGTDSFTTYRNQSNIGNDNFNS  292

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENAN  39
            YG  + G    F +Y +  N     FT Y    +     FK Y    N
Sbjct  293  YGTKSNGLTIGFAHYGESYNQGTDNFTTYGKGGNAPDVSFKIYGHAEN  340



>ref|XP_010678748.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=628

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 140/218 (64%), Gaps = 11/218 (5%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+ KA LIRYWN  ISN+ P+P FL++ ASPL A   AVF+K+     ++L  +L  FC
Sbjct  36   PFSAKASLIRYWNTHISNNHPKPSFLLSKASPLNAIDTAVFTKLVA--EHALNTRLTSFC  93

Query  455  SSADLLCFPDLS-------PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            S+A+L C  D S       P+   K D   NF SY  + FT YG     G DSFKNY+ +
Sbjct  94   SAANLYCDFDTSLQDQINRPAPPRKED--ANFISYTNKQFTTYGRSRGGGVDSFKNYSDN  151

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
            +N+PV++F RYS +S+ H ++F+NYA  GNVA+ SF +YG    GG GEF NY  +VNVP
Sbjct  152  INMPVNSFTRYSSNSAGHGEKFANYADNGNVANDSFMSYGAGGTGGLGEFKNYESNVNVP  211

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            NL F++YS   +  KQ F SY+E+ N G Q FTSYGKN
Sbjct  212  NLHFSSYSASGNNHKQSFGSYAEDTNSGTQVFTSYGKN  249


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 47/105 (45%), Gaps = 0/105 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +YG  + A  DSFK Y    N P +TF+ Y    S+  + F NY  G NV D +F  Y
Sbjct  271  FASYGQLANAANDSFKGYGGSANNPHNTFKNYGSKVSSGVEGFENYREGANVGDDTFQNY  330

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
               +      F NY K  N    +F  Y   A  R  +FK Y  N
Sbjct  331  LRDSTSTKASFVNYGKSFNQGIDKFKGYGKGAVNRHIDFKGYGVN  375


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q FT+YG +       F +Y+   N+   TF  Y + ++A  D F  Y    N    +F 
Sbjct  241  QVFTSYGKNGNGVPTEFNSYSKSSNIVGSTFASYGQLANAANDSFKGYGGSANNPHNTFK  300

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG   + G   F NY +  NV +  F  Y  D+   K  F +Y ++ N G   F  YGK
Sbjct  301  NYGSKVSSGVEGFENYREGANVGDDTFQNYLRDSTSTKASFVNYGKSFNQGIDKFKGYGK  360



>emb|CBI15046.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            + G +PFT KA LIRYWN +ISN LP+P FL++ ASPL A   AV +K+A   +N+L++ 
Sbjct  36   STGGNPFTAKASLIRYWNKQISNKLPKPSFLLSKASPLNAVDSAVLTKLAT--QNALSSH  93

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            L  FCSSA+L C  D SP+S  K   + NF  Y  + F NYG     G DSFKNY+  +N
Sbjct  94   LSSFCSSANLFCVFDSSPTS-EKQVKDANFAFYSNRGFANYGDSRIGGVDSFKNYSDGLN  152

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            +P  +FRRYS DS+ H + F++YA  GNVA  SF  YG    GG+GEF NY   VNVP+L
Sbjct  153  MPSGSFRRYSGDSTDHHEEFTSYARDGNVATGSFAGYGSGATGGSGEFTNYDPLVNVPHL  212

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             FT Y  + +  K  F +Y+++ N G ++FTSYGKN
Sbjct  213  EFTTYDPNGNNHKLTFAAYTDDTNSGTESFTSYGKN  248


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 52/108 (48%), Gaps = 3/108 (3%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  + + DN N        FT YG  + +  DSFK Y    N P + F+ YS   +A T
Sbjct  253  PAEFTSYGDNSNIIG---STFTAYGQLANSQNDSFKAYGHSSNNPHNNFKSYSLGGNAAT  309

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            D FSNY  G NV D SF +Y  ++      F NY +  NV N  F  Y
Sbjct  310  DTFSNYRDGANVGDDSFQSYARSSNSAEVNFANYGRTFNVGNDTFKEY  357



>ref|XP_006438393.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
 gb|ESR51633.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
Length=618

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 139/218 (64%), Gaps = 5/218 (2%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            V   ++PFTPKAYL+RYW+  I N LP+  FL++ ASPL A   + F+K+A  ++ +L+ 
Sbjct  16   VNAKENPFTPKAYLMRYWDKTIHNSLPKSPFLLSKASPLDAVDSSRFAKLA--EQGTLST  73

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
             LP FCSSA+L CFPDLSPSS   H+ + +F  Y  +NFTNYGS    G DSFKNY+   
Sbjct  74   ALPSFCSSANLFCFPDLSPSS--NHNTDSDFAVYNNKNFTNYGSGKVGGVDSFKNYSDGE  131

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
             +P  +F RYS +S++H D+F++Y++ G   +Q F  YG +   GAG+F  Y  D N   
Sbjct  132  PVPNLSFHRYSGESTSHNDKFNSYSSQGQFINQRFDKYGSSATDGAGDFSTYNPDNNDLG  191

Query  113  L-RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            L +F  YS+  + R Q F +YS   N G ++F+SYG N
Sbjct  192  LSQFATYSNQGNRRAQSFSTYSNKGNAGKESFSSYGNN  229



>ref|XP_006484316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630-like 
[Citrus sinensis]
Length=632

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 139/218 (64%), Gaps = 5/218 (2%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
            V   ++PFTPKAYL+RYW+  I N LP+  FL++ ASPL A   + F+K+A  ++ +L+ 
Sbjct  30   VNAKENPFTPKAYLMRYWDKTIHNSLPKSPFLLSKASPLDAVDSSRFAKLA--EQGTLST  87

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
             LP FCSSA+L CFPDLSPSS   H+ + +F  Y  +NFTNYGS    G DSFKNY+   
Sbjct  88   ALPSFCSSANLFCFPDLSPSS--NHNTDSDFAVYNNKNFTNYGSGKVGGVDSFKNYSDGE  145

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
             +P  +F RYS +S++H D+F++Y++ G   +Q F  YG +   GAG+F  Y  D N   
Sbjct  146  PVPNLSFHRYSGESTSHNDKFNSYSSQGQFINQRFDKYGSSATDGAGDFSTYNPDNNDLG  205

Query  113  L-RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            L +F  YS+  + R Q F +YS   N G ++F+SYG N
Sbjct  206  LSQFATYSNQGNRRAQSFSTYSNKGNAGKESFSSYGNN  243



>ref|XP_002279813.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=633

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            + G +PFT KA LIRYWN +ISN LP+P FL++ ASPL A   AV +K+A   +N+L++ 
Sbjct  36   STGGNPFTAKASLIRYWNKQISNKLPKPSFLLSKASPLNAVDSAVLTKLAT--QNALSSH  93

Query  470  LPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            L  FCSSA+L C  D SP+S  K   + NF  Y  + F NYG     G DSFKNY+  +N
Sbjct  94   LSSFCSSANLFCVFDSSPTS-EKQVKDANFAFYSNRGFANYGDSRIGGVDSFKNYSDGLN  152

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
            +P  +FRRYS DS+ H + F++YA  GNVA  SF  YG    GG+GEF NY   VNVP+L
Sbjct  153  MPSGSFRRYSGDSTDHHEEFTSYARDGNVATGSFAGYGSGATGGSGEFTNYDPLVNVPHL  212

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             FT Y  + +  K  F +Y+++ N G ++FTSYGKN
Sbjct  213  EFTTYDPNGNNHKLTFAAYTDDTNSGTESFTSYGKN  248


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 57/125 (46%), Gaps = 3/125 (2%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  + + DN N        FT YG  + +  DSFK Y    N P + F+ YS   +A T
Sbjct  253  PAEFTSYGDNSNIIG---STFTAYGQLANSQNDSFKAYGHSSNNPHNNFKSYSLGGNAAT  309

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            D FSNY  G NV D SF +Y  ++      F NY +  NV N  F  Y   +      FK
Sbjct  310  DTFSNYRDGANVGDDSFQSYARSSNSAEVNFANYGRTFNVGNDTFKEYGKGSTDSSVGFK  369

Query  59   SYSEN  45
             Y  N
Sbjct  370  IYGLN  374



>ref|XP_007036187.1| Polygalacturonase 2, putative [Theobroma cacao]
 gb|EOY20688.1| Polygalacturonase 2, putative [Theobroma cacao]
Length=628

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 138/215 (64%), Gaps = 4/215 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            +SPFT +A LIRYWN +ISN+LP+P FLI+ ASPL A   A  +K+A   + SL++ +  
Sbjct  31   ESPFTARASLIRYWNKQISNNLPKPPFLISKASPLNAIDLAKLTKLA--SQKSLSSHIES  88

Query  461  FCSSADLLCFPDLS--PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            FCS A+L C  + S  P ++ K D + NF  Y  ++FT YG+    G DSFKNY+ ++N 
Sbjct  89   FCSLANLFCLLEDSSEPDAVGKRDQDANFAVYSSKSFTGYGTSRLGGVDSFKNYSDELNT  148

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P ++F++YSR S+ H + F++YA   NVA  +F  YG +  GG+G F NY + VNVPNLR
Sbjct  149  PNESFKKYSRGSNGHREEFTSYAKDANVATDNFTNYGTSATGGSGGFNNYQERVNVPNLR  208

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            FT Y  D +  K  F SYS   N G + F SYGKN
Sbjct  209  FTTYDSDGNNHKLSFTSYSGETNSGSEAFVSYGKN  243


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y+        +FT+Y   + +G+++F +Y  + N     F  YS +++     F
Sbjct  206  NLRFTTYDSDGNNHKLSFTSYSGETNSGSEAFVSYGKNGNAVPAEFTSYSDNANTIGSSF  265

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y   GN  + SF  YG +       F +Y    N     FT+Y D A+     F+SY+
Sbjct  266  TGYGELGNAPNNSFKAYGDSGNNPHNNFKSYDLAANAGTNSFTSYRDSANVGDDSFQSYA  325

Query  50   ENANVGDQNFTSYGK  6
             N+N G  NF +YGK
Sbjct  326  RNSNSGKVNFANYGK  340


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 3/114 (3%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  + + DN N       +FT YG    A  +SFK Y    N P + F+ Y   ++A T
Sbjct  248  PAEFTSYSDNANTIG---SSFTGYGELGNAPNNSFKAYGDSGNNPHNNFKSYDLAANAGT  304

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADG  78
            + F++Y    NV D SF +Y   +  G   F NY K  NV N  F  Y   + G
Sbjct  305  NSFTSYRDSANVGDDSFQSYARNSNSGKVNFANYGKSFNVGNDTFKEYGKGSTG  358


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 6/134 (4%)
 Frame = -1

Query  389  VNFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFS  228
            ++FTSY  +       F +YG +  A    F +Y+ + N    +F  Y    +A  + F 
Sbjct  221  LSFTSYSGETNSGSEAFVSYGKNGNAVPAEFTSYSDNANTIGSSFTGYGELGNAPNNSFK  280

Query  227  NYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSE  48
             Y   GN    +F +Y  A   G   F +Y    NV +  F +Y+ +++  K  F +Y +
Sbjct  281  AYGDSGNNPHNNFKSYDLAANAGTNSFTSYRDSANVGDDSFQSYARNSNSGKVNFANYGK  340

Query  47   NANVGDQNFTSYGK  6
            + NVG+  F  YGK
Sbjct  341  SFNVGNDTFKEYGK  354



>ref|XP_008776735.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=641

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 138/213 (65%), Gaps = 3/213 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTA--AQYAVFSKIAKADRNSLAAQLPE  462
            PFT KA LIRYWN K+ N  P P FL++  SPL+A           +    ++L+ +LP 
Sbjct  38   PFTAKAALIRYWNRKVPNGRPHPDFLVSKLSPLSALDTASFSSLAASSGGSSALSPRLPA  97

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
             C++A LLC P LS SS + H  +  F +Y   NFTNYG+  A GADSFKNY+   NLP+
Sbjct  98   LCAAARLLCSPSLS-SSTASHPSDSGFAAYSDSNFTNYGTDRAGGADSFKNYSASENLPI  156

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            DTFRRYSRDS+ H D F+ Y   GNV   +F +Y  A  GGAG+F +YA +VNVPNL+FT
Sbjct  157  DTFRRYSRDSAGHDDSFAVYQPDGNVVTANFTSYASAATGGAGDFSSYASEVNVPNLKFT  216

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             Y  DA+GR Q F SYS++ N GDQ+F  YGK+
Sbjct  217  NYDADANGRVQRFSSYSDDTNAGDQSFAGYGKH  249


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 66/150 (44%), Gaps = 8/150 (5%)
 Frame = -1

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQN--------FTNYGSHSAAGAD  321
             ++  F S +D     D S +   KH + +  T   + N        F NYG       D
Sbjct  224  GRVQRFSSYSDDTNAGDQSFAGYGKHGNGIPLTFISYGNNSNVINSDFNNYGEDGNGAND  283

Query  320  SFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGN  141
            +F NY  + N+P  TFR Y    +A +++FSNY    NV D SF +Y      G+ +F N
Sbjct  284  TFTNYGENGNVPETTFRSYGSSGNAGSEKFSNYRDQANVGDDSFTSYTKGGNAGSADFKN  343

Query  140  YAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            Y    N  +  F  Y + +   K  F SYS
Sbjct  344  YGNSFNQGSDSFKGYGEGSTNHKIRFASYS  373


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F  YG H      +F +Y  + N+    F  Y  D +   D F+NY   GNV + +F 
Sbjct  241  QSFAGYGKHGNGIPLTFISYGNNSNVINSDFNNYGEDGNGANDTFTNYGENGNVPETTFR  300

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +   G+ +F NY    NV +  FT+Y+   +    +FK+Y  + N G  +F  YG+
Sbjct  301  SYGSSGNAGSEKFSNYRDQANVGDDSFTSYTKGGNAGSADFKNYGNSFNQGSDSFKGYGE  360



>ref|XP_008800877.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=637

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 139/212 (66%), Gaps = 2/212 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNS-LAAQLPEF  459
            PFT KA LIRYWN K+ N  P P FL++  SPL+A   A FS +A +   + L+ +LP+ 
Sbjct  40   PFTAKAALIRYWNRKVPNGRPLPAFLVSKLSPLSALDTASFSSLAASGGGAALSPRLPDL  99

Query  458  CSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVD  279
            C++A LLC P LS SS + H  +  F  Y   NF+NYG+  A GADSFKNY+   N P+D
Sbjct  100  CAAARLLCSPSLS-SSNASHPSDSAFAGYSNSNFSNYGADRAGGADSFKNYSASENSPID  158

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            TFRRYSRDS  H D F+ Y   GN+   +F +Y  A  GGAG+F +YA + NVP+L+FT 
Sbjct  159  TFRRYSRDSVGHDDSFALYQPDGNIDTANFTSYATAATGGAGDFSSYAHEGNVPDLKFTN  218

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y  DA+GR Q+F SYS++ N G Q+F  YGK+
Sbjct  219  YEADANGRVQKFSSYSDDTNSGGQSFAGYGKH  250


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F  YG H      SF +Y  + N+    F  Y  D +   D F+NY   GNV + +F 
Sbjct  242  QSFAGYGKHGNGIPLSFTSYGSNSNVMNSDFNNYGEDGNGANDTFTNYGQNGNVPENNFR  301

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG A    + +F NY    NV +  FT+Y+ + +    +FK+Y  + N G  +F  YG+
Sbjct  302  SYGAAGNAASEKFSNYRDQANVGDDSFTSYAKEDNAGAADFKNYGNSFNQGTDSFKGYGQ  361


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 65/133 (49%), Gaps = 6/133 (5%)
 Frame = -1

Query  386  NFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSN  225
            +F+SY  +       FTNY + +      F +Y+ D N    +F  Y +  +     F++
Sbjct  201  DFSSYAHEGNVPDLKFTNYEADANGRVQKFSSYSDDTNSGGQSFAGYGKHGNGIPLSFTS  260

Query  224  YATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            Y +  NV +  F+ YG    G    F NY ++ NVP   F +Y    +   ++F +Y + 
Sbjct  261  YGSNSNVMNSDFNNYGEDGNGANDTFTNYGQNGNVPENNFRSYGAAGNAASEKFSNYRDQ  320

Query  44   ANVGDQNFTSYGK  6
            ANVGD +FTSY K
Sbjct  321  ANVGDDSFTSYAK  333


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 62/142 (44%), Gaps = 18/142 (13%)
 Frame = -1

Query  404  KHDDNV--NFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS  249
            KH + +  +FTSY         +F NYG       D+F NY  + N+P + FR Y    +
Sbjct  249  KHGNGIPLSFTSYGSNSNVMNSDFNNYGEDGNGANDTFTNYGQNGNVPENNFRSYGAAGN  308

Query  248  AHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD----  81
            A +++FSNY    NV D SF +Y      GA +F NY    N     F  Y   +     
Sbjct  309  AASEKFSNYRDQANVGDDSFTSYAKEDNAGAADFKNYGNSFNQGTDSFKGYGQGSINFTI  368

Query  80   ------GRKQEFKSYSENANVG  33
                  G    FK+Y++   +G
Sbjct  369  TFGSYYGDNTTFKAYAKTGIIG  390



>gb|KDP26582.1| hypothetical protein JCGZ_17740 [Jatropha curcas]
Length=625

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 130/211 (62%), Gaps = 3/211 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L RYW+N+I+  LP   F+++ ASPL A     FSK+A   +N+L+  LP FC
Sbjct  43   PFTPKASLTRYWSNQITTKLPISPFILSKASPLDALTSVSFSKLA--SQNALSTHLPAFC  100

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A L C+P  SPS L +   + +F +Y+ QNFTNYG+     A SFK Y+   N   D 
Sbjct  101  SAAKLFCYPHSSPS-LQEQRKDSDFATYQNQNFTNYGTGQVGLAASFKEYSESENEANDA  159

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            F RYSR +  + ++FS YA   N+A  +F TYG    GG+G+F +Y   VN  NL FT+Y
Sbjct  160  FLRYSRSAEDNKEKFSEYAHAANLAVGNFKTYGTGATGGSGDFKSYHNGVNFENLEFTSY  219

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             D + GR   F SY  + N+G + FTSYGKN
Sbjct  220  GDRSKGRANTFTSYVNSTNLGVEWFTSYGKN  250


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 3/132 (2%)
 Frame = -1

Query  401  HDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            + + VNF + EF   T+YG  S   A++F +Y    NL V+ F  Y ++ +   + F  Y
Sbjct  205  YHNGVNFENLEF---TSYGDRSKGRANTFTSYVNSTNLGVEWFTSYGKNGNKANNEFVKY  261

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
              G N+ D +F  YG +       F +Y  + N     FT+Y D  +   + F SY E A
Sbjct  262  DEGVNLHDSNFTNYGESGIRSNESFKSYGFNGNEARNYFTSYGDRGESGIERFTSYGEKA  321

Query  41   NVGDQNFTSYGK  6
            ++G + F SYGK
Sbjct  322  SIGQEAFKSYGK  333


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (49%), Gaps = 10/133 (8%)
 Frame = -1

Query  404  KHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSN  225
            K+D+ VN       NFTNYG       +SFK+Y  + N   + F  Y     +  +RF++
Sbjct  260  KYDEGVNLHD---SNFTNYGESGIRSNESFKSYGFNGNEARNYFTSYGDRGESGIERFTS  316

Query  224  YATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            Y    ++  ++F +YG  + G   +F +Y  + N  N  FT Y + A+G    FK Y E 
Sbjct  317  YGEKASIGQEAFKSYGKKSNGEKIDFASYG-EFNRDN--FTGYGEGAEGNSIGFKIYGE-  372

Query  44   ANVGDQNFTSYGK  6
               G+ NF SY K
Sbjct  373  ---GETNFKSYAK  382


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 55/128 (43%), Gaps = 3/128 (2%)
 Frame = -1

Query  389  VNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGG  210
            VN T+   + FT+YG +     + F  Y   VNL    F  Y        + F +Y   G
Sbjct  234  VNSTNLGVEWFTSYGKNGNKANNEFVKYDEGVNLHDSNFTNYGESGIRSNESFKSYGFNG  293

Query  209  NVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
            N A   F +YG     G   F +Y +  ++    F +Y   ++G K +F SY E      
Sbjct  294  NEARNYFTSYGDRGESGIERFTSYGEKASIGQEAFKSYGKKSNGEKIDFASYGE---FNR  350

Query  29   QNFTSYGK  6
             NFT YG+
Sbjct  351  DNFTGYGE  358



>ref|XP_010924225.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 137/212 (65%), Gaps = 2/212 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNS-LAAQLPEF  459
            PFT KA LIRYWN K+ N  P P FL++  SPL+A   A FS +A +   + L+++LP  
Sbjct  39   PFTAKAALIRYWNRKVPNGRPHPSFLVSKLSPLSALDTASFSSLATSGGGAALSSRLPAL  98

Query  458  CSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVD  279
            C++A LLC P LS S+ + H  +  F  Y   NF+NYG+    GADSFKNY+   N P+D
Sbjct  99   CAAARLLCSPSLSSSA-AFHPSDSAFAGYSNSNFSNYGTDRGGGADSFKNYSASENTPID  157

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            TFRRYSRDS  H D F+ Y   GNV   +F +Y  A  GGAG+F +YA + NVP+L+FT 
Sbjct  158  TFRRYSRDSVDHDDSFALYQPDGNVVTTNFTSYATAATGGAGDFSSYAHEGNVPDLKFTN  217

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y  DA+GR Q+F  YS++ N G Q+F  YGK+
Sbjct  218  YEADANGRVQKFSRYSDDTNSGGQSFAGYGKH  249


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 64/135 (47%), Gaps = 3/135 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
             S++ D+ N      Q+F  YG H      SF +Y  + N+ +  F  Y  D +   D F
Sbjct  229  FSRYSDDTNSGG---QSFAGYGKHGNGIPLSFTSYGNNSNVILSDFNNYGEDGNGANDTF  285

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            +NY   GNV + +F +YG      + +F NY    NV +  F +Y+   +    +F++Y 
Sbjct  286  TNYGRNGNVPENNFRSYGAGGNAASEKFSNYRDQANVGDDSFASYAKQGNAGAADFENYG  345

Query  50   ENANVGDQNFTSYGK  6
             + N G  +F  YG+
Sbjct  346  NSFNEGSDSFNGYGE  360


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 65/146 (45%), Gaps = 15/146 (10%)
 Frame = -1

Query  404  KHDDNV--NFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS  249
            KH + +  +FTSY         +F NYG       D+F NY  + N+P + FR Y    +
Sbjct  248  KHGNGIPLSFTSYGNNSNVILSDFNNYGEDGNGANDTFTNYGRNGNVPENNFRSYGAGGN  307

Query  248  AHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ  69
            A +++FSNY    NV D SF +Y      GA +F NY    N  +  F  Y + +     
Sbjct  308  AASEKFSNYRDQANVGDDSFASYAKQGNAGAADFENYGNSFNEGSDSFNGYGEGSINHTI  367

Query  68   EFKSYSEN-------ANVGDQNFTSY  12
             F SYS +       A  G   F SY
Sbjct  368  TFASYSGDNTTFKGYAKTGSIGFKSY  393


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 69/159 (43%), Gaps = 23/159 (14%)
 Frame = -1

Query  413  SLSKHDDNV---NFTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYS  261
            +L + D NV   NFTSY         +F++Y          F NY  D N  V  F RYS
Sbjct  174  ALYQPDGNVVTTNFTSYATAATGGAGDFSSYAHEGNVPDLKFTNYEADANGRVQKFSRYS  233

Query  260  RDSSAHTDRFSNYATGGN--------------VADQSFHTYGPATAGGAGEFGNYAKDVN  123
             D+++    F+ Y   GN              V    F+ YG    G    F NY ++ N
Sbjct  234  DDTNSGGQSFAGYGKHGNGIPLSFTSYGNNSNVILSDFNNYGEDGNGANDTFTNYGRNGN  293

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            VP   F +Y    +   ++F +Y + ANVGD +F SY K
Sbjct  294  VPENNFRSYGAGGNAASEKFSNYRDQANVGDDSFASYAK  332



>ref|XP_007223063.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
 gb|EMJ24262.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
Length=554

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDR  234
            SL KHD +  FT Y  +NFTNYG+   AG DSFKNY++D NLPVD+FRRYS DS  H D+
Sbjct  33   SLEKHDKDSTFTGYAAKNFTNYGTDRLAGVDSFKNYSIDENLPVDSFRRYSHDSVNHKDQ  92

Query  233  FSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY  54
            F+NYA+GGNV DQSF++Y      GAGEF  YA  VNVPNLRF +YSDD++GR Q F SY
Sbjct  93   FTNYASGGNVVDQSFNSYAGGATSGAGEFKKYADSVNVPNLRFNSYSDDSNGRAQSFTSY  152

Query  53   SENANVGDQNFTSYGKN  3
            +EN N GDQ+FTSY KN
Sbjct  153  TENGNAGDQSFTSYSKN  169


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/245 (30%), Positives = 103/245 (42%), Gaps = 39/245 (16%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNK-ISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            ++PF+PKAYL+RYWN + +        F    A   T       + +      S+   LP
Sbjct  16   ENPFSPKAYLVRYWNKESLEKHDKDSTFTGYAAKNFTNYGTDRLAGVDSFKNYSIDENLP  75

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNFTS---YEFQNFTNYGSHSAAGADSFKNYTVDV  294
                   +  F   S  S++  D   N+ S      Q+F +Y   + +GA  FK Y   V
Sbjct  76   -------VDSFRRYSHDSVNHKDQFTNYASGGNVVDQSFNSYAGGATSGAGEFKKYADSV  128

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY----------------------  180
            N+P   F  YS DS+     F++Y   GN  DQSF +Y                      
Sbjct  129  NVPNLRFNSYSDDSNGRAQSFTSYTENGNAGDQSFTSYSKNGNGAPNEFTGYGTSSNVVG  188

Query  179  ------GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFT  18
                  G    G   +F NY KD+N P  RF +Y D  +   + F SY + ANVG+ +F 
Sbjct  189  SGFTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDGGNAAVETFTSYRDKANVGEDSFQ  248

Query  17   SYGKN  3
            SY KN
Sbjct  249  SYAKN  253


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       D F NY  D+N PV+ F+ Y    +A  + F++Y    NV + SF +Y
Sbjct  191  FTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDGGNAAVETFTSYRDKANVGEDSFQSY  250

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               + G    F NY K  NV   +FT Y   A G+   FK Y  N +  D
Sbjct  251  AKNSNGEKINFANYGKSFNVGFDKFTGYGKGAQGQSIGFKIYGVNNSFSD  300



>ref|XP_003528153.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=629

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 128/211 (61%), Gaps = 1/211 (0%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE-F  459
            PF+PKA LIRYWN ++SN+   P FL++ ASPLT   YAV +K+    +      L    
Sbjct  39   PFSPKASLIRYWNTRVSNNNQIPHFLLSKASPLTPQNYAVLNKLLTNQKPRPNENLHHSL  98

Query  458  CSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVD  279
            CSS +LLC  D +P++ ++ +D+ NF  Y  + F NYGS    G DSFKNY+  +N   D
Sbjct  99   CSSPNLLCSFDDTPNAQTRKNDDANFALYNNKRFANYGSSRVGGVDSFKNYSNGLNANND  158

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
             FRRYS  S+   ++F+NYA  GNVA+ +F +YG A    +GEF NY K VNVPNL FT 
Sbjct  159  AFRRYSAASTRRGEQFNNYADNGNVANTNFSSYGSAANQTSGEFSNYDKTVNVPNLGFTT  218

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            Y   A   K  F SY    N G Q+FTSYGK
Sbjct  219  YDSGASNHKLSFSSYGNETNSGSQSFTSYGK  249


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 3/122 (2%)
 Frame = -1

Query  416  SSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTD  237
            S  + + D+ N    EF ++ +  +   A  DSFK Y+ + N P   F+ Y+  S++  D
Sbjct  256  SEFASYADDANILQSEFNSYGDLST--GASNDSFKFYSFNGNNPRHVFKSYAAGSASGVD  313

Query  236  RFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFK  60
             F +Y    NV D SF +Y   +  GA  F NY    NV N  FT Y   A G+    FK
Sbjct  314  NFISYRNRANVGDDSFQSYAARSKSGAATFANYGMSFNVGNDSFTEYGKGATGKTSFGFK  373

Query  59   SY  54
            SY
Sbjct  374  SY  375


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 56/121 (46%), Gaps = 1/121 (1%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSS-AHTDRFSNYATGGNVADQSF  189
            Q+FT+YG     G   F +Y  D N+    F  Y   S+ A  D F  Y+  GN     F
Sbjct  242  QSFTSYGKRVRGGTSEFASYADDANILQSEFNSYGDLSTGASNDSFKFYSFNGNNPRHVF  301

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             +Y   +A G   F +Y    NV +  F +Y+  +      F +Y  + NVG+ +FT YG
Sbjct  302  KSYAAGSASGVDNFISYRNRANVGDDSFQSYAARSKSGAATFANYGMSFNVGNDSFTEYG  361

Query  8    K  6
            K
Sbjct  362  K  362



>ref|XP_008346742.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=630

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 136/217 (63%), Gaps = 7/217 (3%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L RYW+  ISN+LP+P FL   AS L      + +K+A   +NSL++    
Sbjct  28   NNPFTPKASLNRYWDXHISNNLPKPAFLFAKASQLDPVNSTILTKLAA--QNSLSSHFTS  85

Query  461  FCSSADLLCFPDLSPSS-----LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            FCS A+L C  D S  +      ++H  N NF  Y  +NF NYGS    G DSFKNY+ +
Sbjct  86   FCSLANLCCSFDSSAETHQQDIATRHPKNANFAVYADKNFANYGSSQLGGVDSFKNYSEE  145

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
            +N P D+F++YS+ S +H ++F++YA   NVA+ +F +YG  + GG+GEF +Y   VNVP
Sbjct  146  LNSPRDSFKKYSKGSHSHLEKFTSYAHDANVANSNFTSYGADSGGGSGEFTSYDDRVNVP  205

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +L FT+Y  +A+  +  F  Y  + N G ++FTSYGK
Sbjct  206  SLGFTSYDSNANDHRLSFTGYGHDTNSGSESFTSYGK  242


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 71/160 (44%), Gaps = 8/160 (5%)
 Frame = -1

Query  464  EFCSSADLLCFPDLSPSSL--SKHDDNVNFTSYEF------QNFTNYGSHSAAGADSFKN  309
            EF S  D +  P L  +S   + +D  ++FT Y        ++FT+YG    +  + F  
Sbjct  194  EFTSYDDRVNVPSLGFTSYDSNANDHRLSFTGYGHDTNSGSESFTSYGKSGNSNPNQFTR  253

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            Y    N+    F  Y    +   D F+ Y   GN    +F +YG     G   F NY   
Sbjct  254  YAEGSNIIGSGFTGYGESGNGQNDSFTGYGQSGNNPHNNFKSYGAGGNAGLDGFSNYRSW  313

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             NV +  F +Y+ +++  K  F +Y ++ N G+ +F  YG
Sbjct  314  ANVGDDTFQSYARNSNSGKVRFSNYGKSFNPGNDSFKEYG  353


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 52/120 (43%), Gaps = 6/120 (5%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       DSF  Y    N P + F+ Y    +A  D FSNY +  NV D +F +Y
Sbjct  265  FTGYGESGNGQNDSFTGYGQSGNNPHNNFKSYGAGGNAGLDGFSNYRSWANVGDDTFQSY  324

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYGKN  3
               +  G   F NY K  N  N  F  Y   + GR    FK+Y        ++F  Y KN
Sbjct  325  ARNSNSGKVRFSNYGKSFNPGNDSFKEYGAGSKGRTTVGFKTYGLG-----RSFKEYAKN  379



>gb|KHN30893.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=541

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 121/210 (58%), Gaps = 0/210 (0%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+PKA LIRYWN ++SN+LP P  L++ AS LT   YA+ SK+               C
Sbjct  19   PFSPKASLIRYWNTRVSNNLPIPHLLLSKASTLTPHHYAILSKLLNQKPKPNENLHHSLC  78

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            SS +LLC  D +P + +  +D+ NF  Y  + F NYGS    G DSFKNY+  +N   D 
Sbjct  79   SSPNLLCSFDDTPFAQTHKNDDGNFAVYSNKRFANYGSSRVGGVDSFKNYSNGLNANNDA  138

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYS  S+   ++F NYA  GNVA+ +F +YG A    + EF NY K VNVPNL FT Y
Sbjct  139  FRRYSAASTRRGEQFKNYADNGNVANTNFSSYGSAANQASAEFSNYDKTVNVPNLGFTTY  198

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               A   K  F SY    N G Q FTSYGK
Sbjct  199  DSGASNHKLSFSSYGNETNSGSQTFTSYGK  228



>ref|XP_007141610.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
 gb|ESW13604.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
Length=611

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 132/213 (62%), Gaps = 5/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+PKA+LIRYW+NKI+N  P+P FL++ ASPLT A+ A F+K+A    N+L+A LP FC
Sbjct  26   PFSPKAFLIRYWDNKITNKSPKPHFLLSKASPLTVAETATFAKLAA--NNTLSAHLPRFC  83

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV--NLPV  282
            S+A LLC       S  +   +  F  Y  +NF++YG+    G +SFKNY+ +   N P 
Sbjct  84   SAARLLCHSKPLSLSAQRTSRDAKFAVYNNRNFSDYGTSRLGGLNSFKNYSDNQRENGPQ  143

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN-VPNLRF  105
            + FR+YS+ S  H+D F  Y + GNV + +F +YG     G   + NYA+ VN   +L F
Sbjct  144  NDFRQYSKASVNHSDDFITYGSFGNVINDTFRSYGGGATAGTSSYKNYAEPVNGFDDLEF  203

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             +YSDDA  R Q F  Y+EN N G Q+F  YGK
Sbjct  204  ASYSDDARKRTQSFIGYTENGNGGQQSFAGYGK  236


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 53/124 (43%), Gaps = 10/124 (8%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F++YG+      D+FKNY    N P +TF  Y        DRF  Y    N    SF  Y
Sbjct  259  FSSYGNDGVRVNDTFKNYANQGNNPTNTFESYGNGGDGAVDRFDTYRVESNGGSDSFQNY  318

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEF--------KSYSENANVGDQN  24
            G  + GG  +F  Y K  N  + +F  Y     G KQ F         S++E A  G Q 
Sbjct  319  GKESNGGDVDFKGYDKSDNSNSDKFIGYG--KGGEKQRFGFSGYRINSSFTEYAKQGAQT  376

Query  23   FTSY  12
            F SY
Sbjct  377  FASY  380


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+F  YG       +SF+NY    N  +  F  Y  D     D F NYA  GN    +F 
Sbjct  229  QSFAGYGKRGNETENSFQNYGTSSNPTLTGFSSYGNDGVRVNDTFKNYANQGNNPTNTFE  288

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG    G    F  Y  + N  +  F  Y  +++G   +FK Y ++ N     F  YGK
Sbjct  289  SYGNGGDGAVDRFDTYRVESNGGSDSFQNYGKESNGGDVDFKGYDKSDNSNSDKFIGYGK  348



>gb|EPS68955.1| hypothetical protein M569_05812, partial [Genlisea aurea]
Length=592

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 135/213 (63%), Gaps = 2/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            D+PF+P+A+LIRYW N+I +D P   FL++ ASPLTAA+ A+FS +    R++L ++LPE
Sbjct  1    DNPFSPRAHLIRYWGNRIKSDRPMSEFLLSKASPLTAAETAMFSGMVS--RDTLFSRLPE  58

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FC++ADL C  +       +HD++ NF+ Y  +NF NYG+    G D FKNY+  VN   
Sbjct  59   FCAAADLFCPAEGEAVGTERHDEDSNFSFYGNKNFANYGNGRLNGVDQFKNYSNGVNYAG  118

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
              F RY R+++ + + F++Y    NVA  +F +YG    GG G+F NY   VNVPNLRF 
Sbjct  119  GGFSRYGREATGNREGFASYGDDSNVAGANFTSYGGGATGGGGDFRNYMPRVNVPNLRFG  178

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +Y  +AD  +  F  YS++ N G Q F  YG+N
Sbjct  179  SYDSEADEHRLTFAGYSDDTNSGSQGFAGYGRN  211


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F  YG +  + A+ F +Y    N+ V TF  Y    ++  D F +YAT  N     F 
Sbjct  203  QGFAGYGRNGNSAAEEFSSYGRTSNVVVSTFSGYGGGGNSANDSFKSYATNSNNPTNGFK  262

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG     GA +F NY    N     F +Y  D++ +K  F +Y +  + G  +F  Y K
Sbjct  263  SYGAGGNDGADDFANYRDSANAGADTFQSYGKDSNAQKSNFANYGKTLSGGVDSFKEYAK  322


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 59/135 (44%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ F SY+ +       F  Y   + +G+  F  Y  + N   + F  Y R S+     F
Sbjct  174  NLRFGSYDSEADEHRLTFAGYSDDTNSGSQGFAGYGRNGNSAAEEFSSYGRTSNVVVSTF  233

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S Y  GGN A+ SF +Y   +      F +Y    N     F  Y D A+     F+SY 
Sbjct  234  SGYGGGGNSANDSFKSYATNSNNPTNGFKSYGAGGNDGADDFANYRDSANAGADTFQSYG  293

Query  50   ENANVGDQNFTSYGK  6
            +++N    NF +YGK
Sbjct  294  KDSNAQKSNFANYGK  308


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 53/121 (44%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + F++YG  S     +F  Y    N   D+F+ Y+ +S+  T+ F +Y  GGN     F 
Sbjct  217  EEFSSYGRTSNVVVSTFSGYGGGGNSANDSFKSYATNSNNPTNGFKSYGAGGNDGADDFA  276

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             Y  +   GA  F +Y KD N     F  Y     G    FK Y++ A      F  YG+
Sbjct  277  NYRDSANAGADTFQSYGKDSNAQKSNFANYGKTLSGGVDSFKEYAKGAAAQSIGFKIYGE  336

Query  5    N  3
            N
Sbjct  337  N  337


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 48/106 (45%), Gaps = 0/106 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG    +  DSFK+Y  + N P + F+ Y    +   D F+NY    N    +F +Y
Sbjct  233  FSGYGGGGNSANDSFKSYATNSNNPTNGFKSYGAGGNDGADDFANYRDSANAGADTFQSY  292

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
            G  +      F NY K ++     F  Y+  A  +   FK Y ENA
Sbjct  293  GKDSNAQKSNFANYGKTLSGGVDSFKEYAKGAAAQSIGFKIYGENA  338



>gb|KHG12475.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=649

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 138/215 (64%), Gaps = 5/215 (2%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFT KA LIRYWNN ISN+LP+P FLI+ ASPL A   A  +++A  + NSL++ +  
Sbjct  63   ENPFTAKASLIRYWNNHISNNLPKPPFLISKASPLNAIDLAKLTQLA--NHNSLSSHIES  120

Query  461  FCSSADLLC-FPDLSPS--SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVN  291
            FCS A+L C F + S    ++ K   + NF  Y  +NF  YGS S  G DSFKNY+  +N
Sbjct  121  FCSLANLFCSFQEESSKLDAVGKGKGDANFAVYSSKNFKGYGSLSRGGIDSFKNYSDGLN  180

Query  290  LPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNL  111
             P ++F++YSR SSAH++ F++YA   NVA  +F  YG +  GG+G F NY   VNVPNL
Sbjct  181  TPNESFKKYSRGSSAHSEDFTSYAKDANVAIDNFTNYGSSATGGSGGFNNYQDRVNVPNL  240

Query  110  RFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            RFT+Y  D +  K  F +YS   N G + F +YGK
Sbjct  241  RFTSYDSDGNKHKLSFSTYSSETNSGSEAFINYGK  275


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            + F NYG    A    F +Y+ + N    +F  Y    ++  D F  Y   GN    +F 
Sbjct  268  EAFINYGKKGKAVPAEFTSYSSNANTIGSSFAGYGVLGNSANDSFKAYGDSGNNPRNNFK  327

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             YG A+  G   F +Y    NV    F +Y+ DA+  K  F +Y +  NVG+  F  YGK
Sbjct  328  IYGLASKLGIDNFTSYRDSANVGVDSFQSYARDANSGKANFVNYGKTFNVGNSTFKEYGK  387



>ref|XP_004166494.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
Length=688

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 134/219 (61%), Gaps = 4/219 (2%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            I +   +PFTPKA L+RYW   +S DLP P F ++ ASPL+A   A  +    A   SL+
Sbjct  93   ISSASSNPFTPKASLVRYWKTHVSTDLPTPDFFLSKASPLSAVDAA--ALATHAAGASLS  150

Query  476  AQLPEFCSSADLLC-FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTV  300
            ++L  FC SA+L C F   S +S+ +  D  +F  Y  +NF NYG +   G DSFKNY+ 
Sbjct  151  SRLESFCYSANLFCSFDSQSETSVPRSKD-ADFKLYGNKNFVNYGGNRLGGTDSFKNYSD  209

Query  299  DVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNV  120
             +N    +F+RY  +SS H + F++YA  GNVA+ +F +YG  +  G+GEF NY K VNV
Sbjct  210  GLNTAEHSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAGSKSGSGEFTNYGKLVNV  269

Query  119  PNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            PNLRFTAY  ++   K  F SY    N G Q+FTSYGKN
Sbjct  270  PNLRFTAYDLNSRSHKLSFTSYGNETNSGSQSFTSYGKN  308


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 65/140 (46%), Gaps = 9/140 (6%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P   S + D  N  +     FT YG       DSFK Y +  N P   F+ Y +  ++  
Sbjct  313  PQDFSSYSDGSNILT---STFTGYGESGKTANDSFKEYGISGNNPHTNFKNYGKGGNSEI  369

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EF  63
            D FSNY  G NV D SF +Y   +  G   F NY K  N  N  FT Y   + G+    F
Sbjct  370  DTFSNYRNGANVGDDSFQSYAKNSNSGRVNFANYGKSFNHGNDSFTEYGKGSMGKTTVGF  429

Query  62   KSYSENANVGDQNFTSYGKN  3
            KSYS      D+NFT+Y KN
Sbjct  430  KSYSV-----DRNFTTYAKN  444


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y+  +      FT+YG+ + +G+ SF +Y  + N     F  YS  S+  T  F
Sbjct  271  NLRFTAYDLNSRSHKLSFTSYGNETNSGSQSFTSYGKNGNGVPQDFSSYSDGSNILTSTF  330

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y   G  A+ SF  YG +       F NY K  N     F+ Y + A+     F+SY+
Sbjct  331  TGYGESGKTANDSFKEYGISGNNPHTNFKNYGKGGNSEIDTFSNYRNGANVGDDSFQSYA  390

Query  50   ENANVGDQNFTSYGK  6
            +N+N G  NF +YGK
Sbjct  391  KNSNSGRVNFANYGK  405


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 72/161 (45%), Gaps = 8/161 (5%)
 Frame = -1

Query  464  EFCSSADLLCFPDLSPSS--LSKHDDNVNFTSYE------FQNFTNYGSHSAAGADSFKN  309
            EF +   L+  P+L  ++  L+     ++FTSY        Q+FT+YG +       F +
Sbjct  259  EFTNYGKLVNVPNLRFTAYDLNSRSHKLSFTSYGNETNSGSQSFTSYGKNGNGVPQDFSS  318

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            Y+   N+   TF  Y        D F  Y   GN    +F  YG         F NY   
Sbjct  319  YSDGSNILTSTFTGYGESGKTANDSFKEYGISGNNPHTNFKNYGKGGNSEIDTFSNYRNG  378

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             NV +  F +Y+ +++  +  F +Y ++ N G+ +FT YGK
Sbjct  379  ANVGDDSFQSYAKNSNSGRVNFANYGKSFNHGNDSFTEYGK  419



>ref|XP_006578624.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=631

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 120/210 (57%), Gaps = 0/210 (0%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+PKA LIRYWN ++SN+LP P  L++ AS LT   YA+ SK+               C
Sbjct  42   PFSPKASLIRYWNTRVSNNLPIPHLLLSKASTLTPHHYAILSKLLNQKPKPNENLHHSLC  101

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            SS +LLC  D +P + +  +D+ NF  Y  + F NYGS    G DSFKNY+  +N   D 
Sbjct  102  SSPNLLCSFDDTPFAQTHKNDDGNFAVYSNKRFANYGSSRVGGVDSFKNYSNGLNANNDA  161

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYS  S+   ++F NYA  GNVA+ +F +YG      + EF NY K VNVPNL FT Y
Sbjct  162  FRRYSAASTRRGEQFKNYADNGNVANTNFSSYGSTANQASAEFSNYDKTVNVPNLGFTTY  221

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               A   K  F SY    N G Q FTSYGK
Sbjct  222  DSGASNHKLSFSSYGNETNSGSQTFTSYGK  251


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 55/121 (45%), Gaps = 1/121 (1%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYS-RDSSAHTDRFSNYATGGNVADQSF  189
            Q FT+YG     G   F NY  D N+    F  Y    + A  D F  Y+  GN     F
Sbjct  244  QTFTSYGKRVRGGTSEFANYADDANILQSEFSSYGDLTTGASNDSFKFYSFNGNNPRHVF  303

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             +YG  +A G   F +Y    NV +  F +Y+  +      F +Y  + NVG+ +FT YG
Sbjct  304  KSYGDGSAAGVDSFISYRNRANVGDDSFQSYAVRSKSGAATFANYGMSFNVGNDSFTEYG  363

Query  8    K  6
            K
Sbjct  364  K  364



>ref|XP_004138283.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN63588.1| Polygalacturonase-1 non-catalytic subunit beta [Cucumis sativus]
Length=645

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 133/219 (61%), Gaps = 4/219 (2%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            I +   +PFTPKA L+RYW   +S DLP P F ++ ASPL+A   A  +    A   SL+
Sbjct  50   ISSASSNPFTPKASLVRYWKTHVSTDLPTPDFFLSKASPLSAVDAA--ALATHAAGASLS  107

Query  476  AQLPEFCSSADLLC-FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTV  300
            ++L  FC SA+L C F   S +S+ +  D  +F  Y  +NF NYG     G DSFKNY+ 
Sbjct  108  SRLESFCFSANLFCSFDSQSETSVPRSKD-ADFKLYGNKNFVNYGGSRLGGTDSFKNYSD  166

Query  299  DVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNV  120
             +N    +F+RY  +SS H + F++YA  GNVA+ +F +YG  +  G+GEF NY K VNV
Sbjct  167  GLNTAEHSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAGSKSGSGEFTNYDKLVNV  226

Query  119  PNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            PNLRFTAY  ++   K  F SY    N G Q+FTSYGKN
Sbjct  227  PNLRFTAYDLNSRSHKLSFTSYGNETNSGSQSFTSYGKN  265


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 65/140 (46%), Gaps = 9/140 (6%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P   S + D  N  +     FT YG       DSFK Y +  N P   F+ Y +  ++  
Sbjct  270  PQDFSSYSDGSNILT---STFTGYGESGKTANDSFKEYGISGNNPHTNFKNYGKGGNSEI  326

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EF  63
            D FSNY  G NV D SF +Y   +  G   F NY K  N  N  FT Y   + G+    F
Sbjct  327  DTFSNYRNGANVGDDSFQSYAKNSNSGRVNFANYGKSFNHGNDSFTEYGKGSMGKTTVGF  386

Query  62   KSYSENANVGDQNFTSYGKN  3
            KSYS      D+NFT+Y KN
Sbjct  387  KSYSV-----DRNFTTYAKN  401


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y+  +      FT+YG+ + +G+ SF +Y  + N     F  YS  S+  T  F
Sbjct  228  NLRFTAYDLNSRSHKLSFTSYGNETNSGSQSFTSYGKNGNGVPQDFSSYSDGSNILTSTF  287

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y   G  A+ SF  YG +       F NY K  N     F+ Y + A+     F+SY+
Sbjct  288  TGYGESGKTANDSFKEYGISGNNPHTNFKNYGKGGNSEIDTFSNYRNGANVGDDSFQSYA  347

Query  50   ENANVGDQNFTSYGK  6
            +N+N G  NF +YGK
Sbjct  348  KNSNSGRVNFANYGK  362



>ref|XP_008453099.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=648

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 132/217 (61%), Gaps = 4/217 (2%)
 Frame = -1

Query  650  AVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQ  471
            A   +PFTPKA L+RYW   +S DLP P F ++ ASPL++   AV +  A     SL+++
Sbjct  55   AASSNPFTPKASLVRYWKTHVSTDLPTPDFFLSKASPLSSVDAAVLATHAAGA--SLSSR  112

Query  470  LPEFCSSADLLC-FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            L  FC SA+L C F   S  S+ +  D  +F  Y  +NF NYG +   G DSFKNY+  +
Sbjct  113  LESFCYSANLFCSFDSQSEISVPRFKD-ADFKLYGNKNFANYGGNRLGGTDSFKNYSDGL  171

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N    +F+RY  +SS H + F++YA  GNVA+ +F +YG  +  G+G F NY K VNVPN
Sbjct  172  NTAEHSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAESKSGSGGFTNYDKLVNVPN  231

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            LRFTAY  ++   K  F SY    N G Q+FTSYGKN
Sbjct  232  LRFTAYDLNSRSHKLTFTSYGNETNSGSQSFTSYGKN  268


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 65/140 (46%), Gaps = 9/140 (6%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P   S + D  N  +     FT YG       DSFK Y V  N P   F+ Y +  ++  
Sbjct  273  PQDFSSYSDGSNILT---STFTGYGESGKTANDSFKEYGVSGNNPHTNFKNYGKGGNSEI  329

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EF  63
            D FSNY  G NV D SF +Y   +  G   F NY K  N  N  FT Y   + G+    F
Sbjct  330  DTFSNYRNGANVGDDSFQSYAKNSNSGRVNFANYGKSFNHGNDSFTEYGKGSIGKTTVGF  389

Query  62   KSYSENANVGDQNFTSYGKN  3
            KSYS      D+NFT+Y KN
Sbjct  390  KSYSI-----DRNFTTYAKN  404


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 6/135 (4%)
 Frame = -1

Query  392  NVNFTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y+  +      FT+YG+ + +G+ SF +Y  + N     F  YS  S+  T  F
Sbjct  231  NLRFTAYDLNSRSHKLTFTSYGNETNSGSQSFTSYGKNGNGVPQDFSSYSDGSNILTSTF  290

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + Y   G  A+ SF  YG +       F NY K  N     F+ Y + A+     F+SY+
Sbjct  291  TGYGESGKTANDSFKEYGVSGNNPHTNFKNYGKGGNSEIDTFSNYRNGANVGDDSFQSYA  350

Query  50   ENANVGDQNFTSYGK  6
            +N+N G  NF +YGK
Sbjct  351  KNSNSGRVNFANYGK  365



>ref|XP_009593470.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana tomentosiformis]
Length=636

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 126/213 (59%), Gaps = 2/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFT KA L+RYWN KISN LP P FL + ASPL+A   A ++ +A   + SL+  LP 
Sbjct  42   ENPFTVKASLVRYWNKKISNKLPIPSFLFSKASPLSAVDAAFYTSLAT--QKSLSGHLPS  99

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCSSA L CF D  P   +    + NF  Y  + F+NYGS    G D+FKNY+  VN   
Sbjct  100  FCSSAKLFCFFDSKPYLDASPSKDANFAVYNNKKFSNYGSSRLGGGDNFKNYSDGVNFAT  159

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
              F +YSR S+ H + F++YA  GNVA  +F +Y     GG G F NY   VNVP+LRF 
Sbjct  160  GDFTKYSRSSTGHREDFNSYAADGNVASGNFTSYAAGATGGGGTFQNYMPRVNVPDLRFA  219

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +Y  D +  K  F SY  + N G++ F SY KN
Sbjct  220  SYDSDGNNHKLSFTSYVGDTNSGNEAFISYAKN  252



>ref|XP_004300895.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 126/214 (59%), Gaps = 5/214 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT +A LIRYW+  +SN LP P FL + +S L     A+ +K+A   +NSL +    FC
Sbjct  34   PFTHRASLIRYWDTHVSNHLPIPTFLFSKSSTLNPVDSAILTKLAA--QNSLPSHFTSFC  91

Query  455  SSADLLCFPDLSPSS---LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            S A+L C  D S  S   L+      NF  Y  +NF  YG+    GADSFKNY+ D+N P
Sbjct  92   SLANLYCSFDASSQSDQLLTSRSKGSNFAGYANKNFATYGTSQLGGADSFKNYSGDLNSP  151

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D+F +YS+ S +H++ F++YA   NVA+ +F  Y      G+G+F +Y   VNVPNLRF
Sbjct  152  HDSFTKYSKTSRSHSEHFTSYAHDANVANDTFTNYAAGAVAGSGDFNSYHDHVNVPNLRF  211

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +Y   +   K  F +YS++ N G + F SYGKN
Sbjct  212  ASYDSGSSNHKLSFTAYSDDTNAGAETFISYGKN  245


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 55/120 (46%), Gaps = 6/120 (5%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG    A  DSFK Y ++ N P   F+ Y     +  D FS+Y  G NV D SF +Y
Sbjct  267  FTGYGESGKAANDSFKGYGLNGNNPHSNFKSYGAGGKSGIDSFSSYRNGANVGDDSFLSY  326

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYGKN  3
                  G   F NY K  N+ N  F  Y   + GR    FKSYS       ++F  Y KN
Sbjct  327  AKNANSGKVTFSNYGKSFNLGNDSFKEYGAGSTGRTSVGFKSYSLG-----RSFKEYAKN  381


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +Y S S+    SF  Y+ D N   +TF  Y ++ +A+ + F++YA   N+    F  Y
Sbjct  211  FASYDSGSSNHKLSFTAYSDDTNAGAETFISYGKNGNANPNEFNSYAGNANIVGSGFTGY  270

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G +       F  Y  + N P+  F +Y          F SY   ANVGD +F SY KN
Sbjct  271  GESGKAANDSFKGYGLNGNNPHSNFKSYGAGGKSGIDSFSSYRNGANVGDDSFLSYAKN  329


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 72/160 (45%), Gaps = 8/160 (5%)
 Frame = -1

Query  464  EFCSSADLLCFPDLSPSSLSKHDDN--VNFTSYE------FQNFTNYGSHSAAGADSFKN  309
            +F S  D +  P+L  +S      N  ++FT+Y        + F +YG +  A  + F +
Sbjct  196  DFNSYHDHVNVPNLRFASYDSGSSNHKLSFTAYSDDTNAGAETFISYGKNGNANPNEFNS  255

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            Y  + N+    F  Y     A  D F  Y   GN    +F +YG     G   F +Y   
Sbjct  256  YAGNANIVGSGFTGYGESGKAANDSFKGYGLNGNNPHSNFKSYGAGGKSGIDSFSSYRNG  315

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             NV +  F +Y+ +A+  K  F +Y ++ N+G+ +F  YG
Sbjct  316  ANVGDDSFLSYAKNANSGKVTFSNYGKSFNLGNDSFKEYG  355



>ref|XP_008374449.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=629

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 133/217 (61%), Gaps = 7/217 (3%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L RYW+  ISN+LP+P FL   AS L      + +K+A   +NSL++    
Sbjct  27   NNPFTPKASLNRYWDIHISNNLPKPAFLFAKASQLDPVNSTILTKVA--SQNSLSSHFTS  84

Query  461  FCSSADLLCFPDLSPSS-----LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
            FCS A+L C  D S  +      ++H    NF  Y  +NF NYGS    G DSFKNY+ +
Sbjct  85   FCSLANLCCSFDSSAETHQQDIATRHPKIANFAVYADKNFANYGSSQLGGVDSFKNYSEE  144

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
            +N P D+F++YS+ S +H ++F++YA   NVA+ +F +YG  + GG+GEF +Y   VNV 
Sbjct  145  LNSPRDSFKKYSKGSHSHLEKFTSYAQDANVANANFTSYGADSGGGSGEFTSYDDRVNVH  204

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +L FT+Y  +A+  +  F +Y  + N G ++F  YGK
Sbjct  205  SLGFTSYVSNANDHRLSFTAYGHDTNSGSESFARYGK  241


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 64/136 (47%), Gaps = 3/136 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
             + +DD VN  S     FT+Y S++     SF  Y  D N   ++F RY +  +++ ++F
Sbjct  194  FTSYDDRVNVHSL---GFTSYVSNANDHRLSFTAYGHDTNSGSESFARYGKSGNSNPNQF  250

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            + YA G N+    F  YG +  G    F  Y +  N P+  F +Y    +     F +Y 
Sbjct  251  TRYAEGSNIIGSGFTGYGESGNGQNDSFTGYGQSSNNPHNNFKSYGAGGNAGLNGFSNYR  310

Query  50   ENANVGDQNFTSYGKN  3
              A VGD  F SY +N
Sbjct  311  SWATVGDDMFQSYARN  326


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 50/120 (42%), Gaps = 6/120 (5%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       DSF  Y    N P + F+ Y    +A  + FSNY +   V D  F +Y
Sbjct  264  FTGYGESGNGQNDSFTGYGQSSNNPHNNFKSYGAGGNAGLNGFSNYRSWATVGDDMFQSY  323

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYGKN  3
               +  G   F NY K  N  N  F  Y   + GR    FK+Y        ++F  Y KN
Sbjct  324  ARNSNSGKVRFSNYGKSFNPGNDSFKEYGAGSKGRTTVGFKTYGLG-----RSFKEYAKN  378



>ref|XP_007138090.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
 gb|ESW10084.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
Length=627

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 125/213 (59%), Gaps = 3/213 (1%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE-F  459
            PF+PKA LIRYWN ++++ +P P FL+  ASPLT   Y + +K+          +L    
Sbjct  36   PFSPKASLIRYWNTRVTSKVPIPHFLLAKASPLTPQHYGILNKLLNEKPKPYNPKLHHSL  95

Query  458  CSSADLLCFPDLSPSS--LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            CSS +L C  D +P++  L + +D+ NF  Y  ++F NYG+    G DSFKNY+  +N  
Sbjct  96   CSSPNLYCSFDDTPNTPTLQRKNDDANFAVYNNKHFANYGTSRVDGVDSFKNYSNGLNAN  155

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D FRRYS  S+   ++F NYA  GNVA+ +F +YG A A  + +F NY K VNVPNL F
Sbjct  156  NDAFRRYSDSSTRRGEQFKNYADNGNVANTNFTSYGSAAAQSSSDFNNYDKTVNVPNLGF  215

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            T Y   +   K  F SY    N G Q+F SYGK
Sbjct  216  TTYDSGSSNHKLSFASYGNETNSGAQSFMSYGK  248



>dbj|BAK05386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 121/210 (58%), Gaps = 5/210 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F ++  SPL AA  A F     +    + A+LP  C
Sbjct  32   PFTAKAAFIRYWNRKVPNNRPHPAFFVSKLSPLPAADAASF----PSSLPDIRARLPTLC  87

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S A LLC P  S S          FT Y   NFTNYGS + AG D FKNY+ DVN+  D+
Sbjct  88   SKAALLC-PSSSGSESDVAARKGPFTGYRDANFTNYGSGAGAGTDGFKNYSPDVNIAGDS  146

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRY RDSSA  D FS Y   GNV   +F +Y     GG+G F +YA + NVP  RFT Y
Sbjct  147  FRRYGRDSSARADLFSTYEANGNVVTANFTSYAGGATGGSGSFTSYAANTNVPESRFTNY  206

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               A+GR + F SYS  AN G+ +F+ YGK
Sbjct  207  DAGANGRSRGFTSYSPEANSGESSFSGYGK  236


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 7/120 (6%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG  +    D+F  Y V+ N+P +TFR Y    +A  D F  Y  G NV D SF +Y
Sbjct  259  FANYGESANGATDTFTGYGVEGNVPENTFRSYGAGGNAGVDTFKGYRDGSNVGDDSFASY  318

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQE--FKSYSENANVGDQNFTSYGK  6
                 GGA EF +Y    N  ++ F  Y    + R  E  FK+Y+ +    +  F +Y K
Sbjct  319  AKGANGGAAEFESYGGSANAGSVGFKGYGQGTN-RNHEIGFKAYAGD----NTTFKAYAK  373


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY  +      +F+ YG    +  ++F +Y  D N     F  Y   ++  TD F+ Y
Sbjct  217  FTSYSPEANSGESSFSGYGKTGNSLRETFTSYGNDTNTLSSGFANYGESANGATDTFTGY  276

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV + +F +YG     G   F  Y    NV +  F +Y+  A+G   EF+SY  +A
Sbjct  277  GVEGNVPENTFRSYGAGGNAGVDTFKGYRDGSNVGDDSFASYAKGANGGAAEFESYGGSA  336

Query  41   NVGDQNFTSYGK  6
            N G   F  YG+
Sbjct  337  NAGSVGFKGYGQ  348


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 54/118 (46%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNY + +   +  F +Y+ + N    +F  Y +  ++  + F++Y    N     F  Y
Sbjct  203  FTNYDAGANGRSRGFTSYSPEANSGESSFSGYGKTGNSLRETFTSYGNDTNTLSSGFANY  262

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +  G    F  Y  + NVP   F +Y    +     FK Y + +NVGD +F SY K
Sbjct  263  GESANGATDTFTGYGVEGNVPENTFRSYGAGGNAGVDTFKGYRDGSNVGDDSFASYAK  320



>ref|XP_004501939.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=627

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 120/214 (56%), Gaps = 6/214 (3%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF+PKA LIRYWN KISN LP P F ++  SPLT  QYA    + K    S        C
Sbjct  36   PFSPKASLIRYWNTKISNKLPIPNFFLSKVSPLTPYQYANLVNLLKQKPFSSKFHY-SLC  94

Query  455  SSADLLCFPD----LSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            S+  LLC  D    L  +  +K DD  NF  Y  + F NYGS    G DSFKNY+  +N 
Sbjct  95   STPYLLCSFDHPNKLQQTKTTKRDD-ANFAVYSNKRFANYGSSQLGGVDSFKNYSNGLNT  153

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
              D+F+RYS  S+ H   F++YA  GNVA+ +F +YG  +  G GEF NY K VNVPNL 
Sbjct  154  NNDSFKRYSTTSTRHGGNFNSYAENGNVANTNFTSYGSGSTSGTGEFKNYDKLVNVPNLG  213

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            FT Y   A   +  F SY    N G Q+F SYGK
Sbjct  214  FTTYDSAAKNHELSFSSYGNETNSGSQSFNSYGK  247


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 62/118 (53%), Gaps = 1/118 (1%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NFT+YGS S +G   FKNY   VN+P   F  Y   +  H   FS+Y    N   QSF++
Sbjct  185  NFTSYGSGSTSGTGEFKNYDKLVNVPNLGFTTYDSAAKNHELSFSSYGNETNSGSQSFNS  244

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQE-FKSYSENANVGDQNFTSY  12
            YG     G  +F NYA D N+    FT+YS+   G   + F+SYS N N    NF +Y
Sbjct  245  YGKRVRSGNSDFTNYAVDANILQSTFTSYSELGTGAANDSFRSYSFNGNNPRNNFKTY  302


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 58/121 (48%), Gaps = 8/121 (7%)
 Frame = -1

Query  392  NVNFTSYEF------QNFTNYGSHSAAGA-DSFKNYTVDVNLPVDTFRRYSRDSSAHTDR  234
            N +FT+Y          FT+Y       A DSF++Y+ + N P + F+ YS  S   +D 
Sbjct  253  NSDFTNYAVDANILQSTFTSYSELGTGAANDSFRSYSFNGNNPRNNFKTYSAGSDFGSDT  312

Query  233  FSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKS  57
            F +Y    NV D SF +YG  +  G   F NY +  N  N  FT Y   + G+    FK+
Sbjct  313  FISYRDRANVGDDSFQSYGSKSKSGTASFANYGQSFNEGNDTFTEYGKGSSGKTAFGFKT  372

Query  56   Y  54
            Y
Sbjct  373  Y  373



>dbj|BAJ92348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 123/211 (58%), Gaps = 7/211 (3%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F ++  SPL AA  A F     A    + A+LP  C
Sbjct  37   PFTAKAAFIRYWNRKVPNNRPHPAFFVSKLSPLPAADAASFPSSLPA----ITARLPTLC  92

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S A LLC P    SSL+  D    F SY   NFTNYGS + AG D F +Y+ DVN+  D+
Sbjct  93   SKAALLC-PSSDVSSLA--DRKGQFKSYSNANFTNYGSGAGAGTDGFSSYSPDVNVAGDS  149

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRY RDSSA  D F+ Y   GNV   +F +Y     GG+G F  YA D NVP  +FT Y
Sbjct  150  FRRYGRDSSARADSFATYEANGNVVTANFTSYAGGATGGSGSFSAYAADTNVPESQFTNY  209

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               A+GR + F SYS+ AN G+ +F  YGK+
Sbjct  210  DAGANGRARGFTSYSQEANHGENSFAGYGKS  240


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY  +      +F  YG    +  ++F +Y  D N     F  Y   ++  TD F+ Y
Sbjct  220  FTSYSQEANHGENSFAGYGKSGNSLRETFTSYGGDTNTLTSGFANYGESANGATDTFTGY  279

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
                NV   +F +YG     G   F  Y  D NV +  F +Y+  A+G   EF+SY  +A
Sbjct  280  GVEANVPKNTFRSYGAGGNAGVDTFKGYRGDANVGDDSFASYAKGANGGAAEFQSYGGSA  339

Query  41   NVGDQNFTSYGK  6
            N G   F  YG+
Sbjct  340  NQGSVAFKGYGE  351



>ref|XP_009775426.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana sylvestris]
Length=638

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 123/213 (58%), Gaps = 2/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFT KA L+RYWN +ISN LP P FL + ASPL+A   A F+ +A   + SL+  +  
Sbjct  44   ENPFTVKASLVRYWNKQISNKLPIPSFLFSKASPLSAVDAAFFTSLAT--QKSLSGHISS  101

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCSSA L CF D  P        + NF  Y  + F +YGS    G D+FKNY+  VN   
Sbjct  102  FCSSAKLFCFFDSKPYLAPSPGKDANFAVYNNKKFADYGSSRLGGGDNFKNYSDGVNFAS  161

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
              F +YSR S+ H + F++YA+ GNVA  +F +Y     GG G F NY   VNVP+LRF 
Sbjct  162  GDFTKYSRSSTGHREDFNSYASDGNVASGNFTSYAAGATGGGGTFQNYMPRVNVPDLRFA  221

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +Y  D +  K  F SY  + N G + F SY KN
Sbjct  222  SYDSDGNNHKLSFTSYVGDTNSGKEAFISYAKN  254



>emb|CDP12374.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 132/213 (62%), Gaps = 3/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            +SP T +A LIRYWN  ISN LP+P FL++ ASPL+    A F+K+A   + +L++ L  
Sbjct  60   ESPLTARASLIRYWNKHISNYLPKPHFLLSKASPLSIVDSAYFTKLAA--QKALSSHLSS  117

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCSSA+L C  D    +L+    + +F  Y  ++F NYGS    G D FKNY+  VN   
Sbjct  118  FCSSANLFCLFD-EKDALTNSKKDADFAFYTNKHFANYGSSRLGGIDMFKNYSNGVNFAT  176

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
             +F RYSR S+   + F++YA  GNVA+ +F +YG    GG+GEF NY   VNVP+LRFT
Sbjct  177  GSFARYSRSSNDLHEDFTSYADDGNVANANFTSYGSGARGGSGEFKNYLPRVNVPDLRFT  236

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +Y  D +  K  F SY ++ N G Q FT+Y KN
Sbjct  237  SYDSDGNNHKLSFSSYVDDTNSGSQAFTNYAKN  269


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 49/119 (41%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG    A  DSFK Y  + N P + F+ Y    ++  D F +Y    N    +F +Y
Sbjct  291  FSGYGELGNAANDSFKAYGRNANNPSNNFKNYGSGGNSGIDSFMSYRDSANAGTDTFQSY  350

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G ++      F NY K  N     F  Y   A G+   FK Y  N       F  Y KN
Sbjct  351  GRSSNSETANFVNYGKSFNEGIDTFKEYGKGAKGQSIGFKIYGVN-----NTFKDYAKN  404


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 60/148 (41%), Gaps = 11/148 (7%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEFQN-----------FTNYGSHSAAGADSFKNYTVDVNLPVDTFRR  267
            S S + D+ N  S  F N           FT+YG  S     +F  Y    N   D+F+ 
Sbjct  248  SFSSYVDDTNSGSQAFTNYAKNGNGVPLDFTSYGDTSNVIGSAFSGYGELGNAANDSFKA  307

Query  266  YSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDD  87
            Y R+++  ++ F NY +GGN    SF +Y  +   G   F +Y +  N     F  Y   
Sbjct  308  YGRNANNPSNNFKNYGSGGNSGIDSFMSYRDSANAGTDTFQSYGRSSNSETANFVNYGKS  367

Query  86   ADGRKQEFKSYSENANVGDQNFTSYGKN  3
             +     FK Y + A      F  YG N
Sbjct  368  FNEGIDTFKEYGKGAKGQSIGFKIYGVN  395



>ref|XP_010436291.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=209

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 109/176 (62%), Gaps = 9/176 (5%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA L+RYWN +I ++ PR  FLI+ ASPL       FSK A    NSL  + P+FC
Sbjct  18   PFTPKASLVRYWNKEIRSESPRSEFLISKASPLNVVDSTTFSKPATT--NSLPTRFPDFC  75

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A++ CFPDL  +SL KHD++V F++Y+ +NFTNYGS    G +SFK Y  D N+  D+
Sbjct  76   SAANIFCFPDLG-TSLEKHDEDVKFSTYDQKNFTNYGSGRPEGDESFKYYAKDGNVVTDS  134

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            FRRYS +S+AH D+F+ Y    NV DQ F+            F    K +N  NL+
Sbjct  135  FRRYSHNSAAHDDKFTVYGENSNVIDQGFNVVDIVM------FSQMRKPLNYENLK  184



>ref|XP_010419424.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=195

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = -1

Query  656  IVAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLA  477
            I A  ++PFTPKA LIRYWNN I+ D P+P F I+ ASPLT      F+ +A    +SL 
Sbjct  35   ITASSENPFTPKASLIRYWNNHINGDSPKPSFFISKASPLTPVDSTRFASLAS--NHSLH  92

Query  476  AQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVD  297
             +  +FCS+A L CFP+L+  SL KH D+V+F +Y  +NFTNYGS   +GADSFKNY+  
Sbjct  93   TRHSDFCSAAKLFCFPELAAHSLEKHGDDVDFAAYSGKNFTNYGSDRLSGADSFKNYSGG  152

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNV  204
             N+ VD+FRRYSR+S+ H + F+ YA   NV
Sbjct  153  DNIAVDSFRRYSRNSAGHDEGFTTYAGDVNV  183



>ref|XP_002444270.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
 gb|EES13765.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
Length=658

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 122/215 (57%), Gaps = 8/215 (4%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F +   SPL AA  A F       R    A+LPE C
Sbjct  45   PFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPTALPDIR----ARLPELC  100

Query  455  SSADLLC----FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            + A LLC      D +  + S       F  Y   NF+NYG+   AGADSF+NY+ D+N+
Sbjct  101  TKAALLCPGPATTDAASLAASGPRGGGPFKGYSNANFSNYGTGGVAGADSFRNYSPDLNI  160

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
              D+FRRY RDSS   D F++Y + GNV   +F +Y     GG+G F  YA + NVP+  
Sbjct  161  AADSFRRYGRDSSGRADSFASYESDGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDST  220

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            FT Y   A+GR + F SYS+ AN G+  F+ YGK+
Sbjct  221  FTNYDAGANGRGRSFASYSQEANHGENGFSGYGKS  255


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG       ++F +Y  + N+    F  Y + ++  TD F+ Y   GNV + +F  Y
Sbjct  249  FSGYGKSGNGVRETFSSYGNESNVLGSGFANYGQSANGATDTFTGYGVEGNVPENTFRNY  308

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G     G   F  Y  D NV + RFT+Y+  A+G   EF+SY  +AN G   F  YG+
Sbjct  309  GAGGNAGVDTFKKYRDDANVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTTFKGYGE  366


 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNY + +     SF +Y+ + N   + F  Y +  +   + FS+Y    NV    F  Y
Sbjct  221  FTNYDAGANGRGRSFASYSQEANHGENGFSGYGKSGNGVRETFSSYGNESNVLGSGFANY  280

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +  G    F  Y  + NVP   F  Y    +     FK Y ++ANVGD  FTSY K
Sbjct  281  GQSANGATDTFTGYGVEGNVPENTFRNYGAGGNAGVDTFKKYRDDANVGDDRFTSYAK  338


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 52/119 (44%), Gaps = 5/119 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG  +    D+F  Y V+ N+P +TFR Y    +A  D F  Y    NV D  F +Y
Sbjct  277  FANYGQSANGATDTFTGYGVEGNVPENTFRNYGAGGNAGVDTFKKYRDDANVGDDRFTSY  336

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYGK  6
                 GGA EF +Y    N  +  F  Y + ++      FK Y+   N     F  Y K
Sbjct  337  AKGANGGAAEFQSYGNSANPGSTTFKGYGEGSNPNHHIGFKEYAGENNT----FKGYAK  391



>ref|XP_004236111.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Solanum lycopersicum]
Length=636

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 121/213 (57%), Gaps = 2/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PF+ KA L+RYWN +ISN LP+P FL + ASPL+A   A F+ +A   + SL+  +  
Sbjct  45   ENPFSVKASLVRYWNKQISNKLPKPDFLFSKASPLSAVDAAFFTNLAT--QKSLSGHIST  102

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCSSA L CF + +P        +  F  Y  + F  YGS    G D FKNY+  +N   
Sbjct  103  FCSSAKLFCFSESNPYLDKTPSTDAKFAVYNNKKFATYGSGRLGGGDDFKNYSDGINFAT  162

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
              F +YSR S+ H + F++YA  GNVA  +F +Y     GG G F +Y   VNVP+LRF 
Sbjct  163  GEFTKYSRSSTGHHEDFTSYAADGNVATGNFTSYAAGATGGGGTFQSYMPRVNVPDLRFA  222

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +Y  D +  K  F SY  + N G + F SY KN
Sbjct  223  SYDSDGNNHKLSFNSYVRDTNSGREFFISYAKN  255


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 53/120 (44%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG  S     SF  Y    N   D+F+ YS +S+   + F NY +GGN    SF +Y
Sbjct  263  FTNYGDTSNVIGSSFSGYGESGNAANDSFKAYSSNSNNPNNNFKNYGSGGNSGIDSFESY  322

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY-SENANVGDQNFTSYGKN  3
              A   G   F +YA+  N   + F  Y    +     FK Y S+ A      F  YG N
Sbjct  323  RDAANAGTDTFTSYARGSNTGKVNFLNYGKSFNEGHDIFKGYGSQGAKFPSVGFKVYGVN  382



>ref|XP_006844960.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
 gb|ERN06635.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
Length=583

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 134/217 (62%), Gaps = 5/217 (2%)
 Frame = -1

Query  653  VAVGDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAA  474
             ++  +P +P+A + RYW + + N  P P FL++ +SPL     A+FS     D+NSL++
Sbjct  32   TSISPNPLSPRASVKRYWQSLLPNS-PIPHFLLDKSSPLDHLHTAIFSNFI--DKNSLSS  88

Query  473  QLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGAD-SFKNYTVD  297
             L  FC +A L CFP  S +S  +  DN +F  Y  +NF++YG+ +  G   SFKNY+  
Sbjct  89   HLSSFCQTAHLFCFPRQSLASHGR-TDNFDFKKYTERNFSDYGTGAVGGTGGSFKNYSDS  147

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
             N+   TF RYSRD++ H D F++Y+   NV D SF  YG  + G + EF NYA D NVP
Sbjct  148  ENVVAQTFVRYSRDATGHGDSFAHYSPDTNVFDGSFSGYGSGSVGKSSEFVNYAGDANVP  207

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             LRF  YS D+ GR+Q F SYS+NAN GDQ F SYGK
Sbjct  208  ELRFNVYSSDSTGREQRFASYSDNANAGDQGFKSYGK  244


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 3/123 (2%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            PSS + +  + N        F  YG       DSF +Y    N+P + FR Y    +   
Sbjct  250  PSSFTSYGKDSNVMG---STFVAYGESGNGANDSFVSYAESGNVPQNNFRSYGDSGNGAI  306

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            + F  Y    NV D +F +YG  +  G+  F NY K  N  +  F  Y + A+ +   FK
Sbjct  307  ESFIKYRDSANVGDDTFQSYGKGSNSGSASFSNYGKSFNEGSDLFKGYGEGANAQTVNFK  366

Query  59   SYS  51
             Y+
Sbjct  367  GYA  369


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F +YG        SF +Y  D N+   TF  Y    +   D F +YA  GNV   +F 
Sbjct  237  QGFKSYGKRGNGVPSSFTSYGKDSNVMGSTFVAYGESGNGANDSFVSYAESGNVPQNNFR  296

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +  G    F  Y    NV +  F +Y   ++     F +Y ++ N G   F  YG+
Sbjct  297  SYGDSGNGAIESFIKYRDSANVGDDTFQSYGKGSNSGSASFSNYGKSFNEGSDLFKGYGE  356



>ref|XP_010028282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
 gb|KCW83445.1| hypothetical protein EUGRSUZ_B00367 [Eucalyptus grandis]
Length=643

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 134/215 (62%), Gaps = 9/215 (4%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PF PKA  +RYW  ++S     P FL++ ASPL+AA  A  +K+A    ++LA+ L  FC
Sbjct  45   PFAPKAAFLRYWKAQLSGGGAPPPFLLSKASPLSAAAAAQLAKLAAG--STLASHLRLFC  102

Query  455  SSADLLCFPDLSPSSLSKH----DDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            S ADL C  D     L +H    D++VNF  Y  + F  YG+    GADSFKNY+  +N 
Sbjct  103  SLADLFCSFD---EGLRRHRKDVDEDVNFAVYANKRFAGYGTGRLGGADSFKNYSEGLNT  159

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P  +F++Y+++ S H++ F+NYAT GNVA+ SF  Y     GG+G+F NY   VNVPNL 
Sbjct  160  PDFSFKKYTKEGSGHSEGFANYATDGNVANSSFANYAFGANGGSGDFKNYHLRVNVPNLL  219

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            FT Y  D +  K+ F SY+++AN G Q+FTSY K+
Sbjct  220  FTTYDSDGNDHKRSFTSYNQDANTGGQSFTSYAKH  254


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 66/140 (47%), Gaps = 9/140 (6%)
 Frame = -1

Query  422  SPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAH  243
            SP+  + +  + N  S     F+ YG    AG ++F +Y  + N P +TF+ YS   ++ 
Sbjct  258  SPTHFATYSGDSNTIS---STFSGYGLLGNAGNETFTSYGGNANDPHNTFKGYSTGGNSA  314

Query  242  TDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-E  66
            T+ F++Y    NV D SF +Y  +       F +Y K  N  N  F  Y   + G+   +
Sbjct  315  TESFTSYRNKANVGDSSFQSYARSANSAKTTFASYGKSFNEGNDTFKEYGKGSKGQTTID  374

Query  65   FKSYSENANVGDQNFTSYGK  6
            FK YS      D+NF  Y +
Sbjct  375  FKEYSV-----DRNFKDYAQ  389


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 64/136 (47%), Gaps = 6/136 (4%)
 Frame = -1

Query  392  NVNFTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FT+Y+       ++FT+Y   +  G  SF +Y    N     F  YS DS+  +  F
Sbjct  217  NLLFTTYDSDGNDHKRSFTSYNQDANTGGQSFTSYAKHGNSSPTHFATYSGDSNTISSTF  276

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S Y   GN  +++F +YG         F  Y+   N     FT+Y + A+     F+SY+
Sbjct  277  SGYGLLGNAGNETFTSYGGNANDPHNTFKGYSTGGNSATESFTSYRNKANVGDSSFQSYA  336

Query  50   ENANVGDQNFTSYGKN  3
             +AN     F SYGK+
Sbjct  337  RSANSAKTTFASYGKS  352


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 58/137 (42%), Gaps = 6/137 (4%)
 Frame = -1

Query  398  DDNVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTD  237
            D   +FTSY        Q+FT+Y  H  +    F  Y+ D N    TF  Y    +A  +
Sbjct  229  DHKRSFTSYNQDANTGGQSFTSYAKHGNSSPTHFATYSGDSNTISSTFSGYGLLGNAGNE  288

Query  236  RFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKS  57
             F++Y    N    +F  Y          F +Y    NV +  F +Y+  A+  K  F S
Sbjct  289  TFTSYGGNANDPHNTFKGYSTGGNSATESFTSYRNKANVGDSSFQSYARSANSAKTTFAS  348

Query  56   YSENANVGDQNFTSYGK  6
            Y ++ N G+  F  YGK
Sbjct  349  YGKSFNEGNDTFKEYGK  365



>gb|ACG28762.1| polygalacturonase-1 non-catalytic beta subunit precursor [Zea 
mays]
Length=642

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 116/215 (54%), Gaps = 8/215 (4%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F +   SPL AA  A F       R    A LP  C
Sbjct  38   PFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPDIR----ASLPALC  93

Query  455  SSADLLC----FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
            S A LLC      D +    S       F  Y   NF+NYG+   AG DSF+ Y+ D+N+
Sbjct  94   SKAALLCPGPATTDAASLVASGRRGGGPFKGYNNANFSNYGTGGVAGTDSFQKYSPDLNI  153

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
              D+FRRY RDSS   D F++Y   GNV   +F +Y     GG+G F  YA + NVP+  
Sbjct  154  AADSFRRYGRDSSGRADSFTSYEDDGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDST  213

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            FT Y   A+GR + F SYS+ AN G+  F+ YGKN
Sbjct  214  FTNYDAAANGRGRSFASYSQEANHGEYGFSGYGKN  248


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG +     ++FK+Y  + N+    F  Y + ++  TD F+ Y   GNV +  F +Y
Sbjct  242  FSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTGYGVEGNVPENRFRSY  301

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G     G   F NY  D NV + RFT+Y+  A+G   EF+SY  +AN G   F  YG+
Sbjct  302  GAGGNAGVDTFKNYRDDGNVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTIFKGYGE  359


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (47%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNY + +     SF +Y+ + N     F  Y ++ +   + F +Y    NV    F  Y
Sbjct  214  FTNYDAAANGRGRSFASYSQEANHGEYGFSGYGKNGNGVRETFKSYGNESNVLASGFANY  273

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +  G    F  Y  + NVP  RF +Y    +     FK+Y ++ NVGD  FTSY K
Sbjct  274  GQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSYAK  331


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 21/122 (17%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLP--------------VDTFRRYSRDSSAHTDRFSNY  222
            F NYG  +    D+F  Y V+ N+P              VDTF+ Y  D +   DRF++Y
Sbjct  270  FANYGQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSY  329

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN--LRFTAYSDDADGRKQEFKSYSE  48
            A G N     F +YG +   G+  F  Y +  N PN  + F  Y+    G    FK Y++
Sbjct  330  AKGANGGAAEFQSYGNSANPGSTIFKGYGEGTN-PNHHIGFKEYA----GENNTFKGYAK  384

Query  47   NA  42
            + 
Sbjct  385  SG  386



>ref|NP_001146063.1| uncharacterized protein LOC100279594 precursor [Zea mays]
 gb|ACL53138.1| unknown [Zea mays]
 gb|ACN33667.1| unknown [Zea mays]
 gb|AFW62083.1| polygalacturonase-1 non-catalytic beta subunit [Zea mays]
Length=643

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 116/214 (54%), Gaps = 7/214 (3%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F +   SPL AA  A F       R    A LP  C
Sbjct  38   PFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPDIR----ASLPALC  93

Query  455  SSADLLCFPDLS---PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            + A LLC    +    S  S       F  Y   NF+NYG+   AG DSF+ Y+ D+N+ 
Sbjct  94   TKAALLCPGPATTDAASLTSGRRGGGPFKGYNNANFSNYGTGGVAGTDSFQKYSPDLNIA  153

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D+FRRY RDSS   D F++Y   GNV   +F +Y     GG+G F  YA + NVP+  F
Sbjct  154  ADSFRRYGRDSSGRADSFTSYEADGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDSTF  213

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T Y   A+GR + F SYS+ AN G+  F+ YGKN
Sbjct  214  TNYDAAANGRGRSFASYSQEANHGENGFSGYGKN  247


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG +     ++FK+Y  + N+    F  Y + ++  TD F+ Y   GNV +  F +Y
Sbjct  241  FSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTGYGVEGNVPENRFRSY  300

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G     G   F NY  D NV + RFT+Y+  A+G   EF+SY  +AN G   F  YG+
Sbjct  301  GAGGNAGVDTFKNYRDDGNVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTIFKGYGE  358


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNY + +     SF +Y+ + N   + F  Y ++ +   + F +Y    NV    F  Y
Sbjct  213  FTNYDAAANGRGRSFASYSQEANHGENGFSGYGKNGNGVRETFKSYGNESNVLASGFANY  272

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +  G    F  Y  + NVP  RF +Y    +     FK+Y ++ NVGD  FTSY K
Sbjct  273  GQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSYAK  330


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 21/122 (17%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLP--------------VDTFRRYSRDSSAHTDRFSNY  222
            F NYG  +    D+F  Y V+ N+P              VDTF+ Y  D +   DRF++Y
Sbjct  269  FANYGQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSY  328

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN--LRFTAYSDDADGRKQEFKSYSE  48
            A G N     F +YG +   G+  F  Y +  N PN  + F  Y+    G    FK Y++
Sbjct  329  AKGANGGAAEFQSYGNSANPGSTIFKGYGEGTN-PNHHIGFKEYA----GENNTFKGYAK  383

Query  47   NA  42
            + 
Sbjct  384  SG  385



>gb|ACN34141.1| unknown [Zea mays]
Length=643

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 115/214 (54%), Gaps = 7/214 (3%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F +   SPL AA  A F       R    A LP  C
Sbjct  38   PFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPDIR----ASLPALC  93

Query  455  SSADLLCFPDLS---PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            + A LLC    +    S  S       F  Y   NF+NYG+   AG DSF+ Y+ D+N+ 
Sbjct  94   TKAALLCPGPATTDAASLTSGRRGGGPFKGYNNANFSNYGTGGVAGTDSFQKYSPDLNIA  153

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D+FRRY RDSS   D F++Y   GNV   +F  Y     GG+G F  YA + NVP+  F
Sbjct  154  ADSFRRYGRDSSGRADSFTSYEADGNVVTANFTPYAGGATGGSGSFAAYAAETNVPDSTF  213

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            T Y   A+GR + F SYS+ AN G+  F+ YGKN
Sbjct  214  TNYDAAANGRGRSFASYSQEANHGENGFSGYGKN  247


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG +     ++FK+Y  + N+    F  Y + ++  TD F+ Y   GNV +  F +Y
Sbjct  241  FSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTGYGVEGNVPENRFRSY  300

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G     G   F NY  D NV + RFT+Y+  A+G   EF+SY  +AN G   F  YG+
Sbjct  301  GAGGNAGVDTFKNYRDDGNVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTIFKGYGE  358


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNY + +     SF +Y+ + N   + F  Y ++ +   + F +Y    NV    F  Y
Sbjct  213  FTNYDAAANGRGRSFASYSQEANHGENGFSGYGKNGNGVRETFKSYGNESNVLASGFANY  272

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +  G    F  Y  + NVP  RF +Y    +     FK+Y ++ NVGD  FTSY K
Sbjct  273  GQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSYAK  330


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 21/122 (17%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLP--------------VDTFRRYSRDSSAHTDRFSNY  222
            F NYG  +    D+F  Y V+ N+P              VDTF+ Y  D +   DRF++Y
Sbjct  269  FANYGQSANGATDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDGNVGDDRFTSY  328

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN--LRFTAYSDDADGRKQEFKSYSE  48
            A G N     F +YG +   G+  F  Y +  N PN  + F  Y+    G    FK Y++
Sbjct  329  AKGANGGAAEFQSYGNSANPGSTIFKGYGEGTN-PNHHIGFKEYA----GENNTFKGYAK  383

Query  47   NA  42
            + 
Sbjct  384  SG  385



>ref|XP_006345047.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Solanum tuberosum]
Length=642

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 124/213 (58%), Gaps = 2/213 (1%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFT KA L+RYWN +ISN LP+P FL + ASPL+AA  A F+ +A   + SL+  +  
Sbjct  47   ENPFTVKASLVRYWNKQISNKLPKPDFLFSKASPLSAADAAFFTNLA--TQKSLSGHIST  104

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            FCSSA L CF + +P   +    + +F  Y  + F  YGS    G D FKNY+  +N   
Sbjct  105  FCSSAKLFCFSESNPYFDNTPSKDADFAVYNNKKFATYGSGRLGGGDGFKNYSDGINFAT  164

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
              F +YSR S+ H + F++YA  GNVA  +F +Y     GG G F +Y   VNVP+LRF 
Sbjct  165  GEFTKYSRSSTGHHEDFTSYAADGNVATGNFTSYAAGATGGGGTFQSYMPRVNVPDLRFA  224

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +Y  D +  K  F SY  + N G + F SY KN
Sbjct  225  SYDSDGNNHKLSFNSYVGDTNSGREFFISYAKN  257


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 54/120 (45%), Gaps = 1/120 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG  S     SF  Y    N   D+F+ YS +S+   + F NY +GGN    SF +Y
Sbjct  265  FTTYGDTSNVIGSSFNGYGESGNAANDSFKAYSSNSNNPNNNFKNYGSGGNSGIDSFESY  324

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY-SENANVGDQNFTSYGKN  3
              A   G+  F +YA+  N   + F  Y    +   + FK Y S+ A      F  YG N
Sbjct  325  RDAANAGSDTFTSYARGSNTGKVNFLNYGKSFNEGTEIFKGYGSQGAKFPSVGFKVYGVN  384



>ref|XP_003574428.1| PREDICTED: BURP domain-containing protein 12 [Brachypodium distachyon]
Length=623

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 122/211 (58%), Gaps = 5/211 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F ++  SPL AA  A F     A R    A+LP  C
Sbjct  27   PFTAKAAFIRYWNRKVPNNRPHPAFFLSKLSPLPAADAASFPSSPAAIR----ARLPTLC  82

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S A LLC P    +S+        F SY   NFTNYGS   AGAD F +Y+ DVN+  D+
Sbjct  83   SRAALLC-PSSDTASMGSRRAPGPFKSYNGANFTNYGSGGGAGADGFTSYSPDVNIAADS  141

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRYSR S+   D F++Y   GNV   +F +Y     GG+G F  YA+  NVP+ +FT Y
Sbjct  142  FRRYSRGSTGRADTFASYEANGNVVTANFTSYAGGATGGSGSFAAYAEGTNVPDSKFTNY  201

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               A+GR + F +YS+ AN G+ +F  YGK+
Sbjct  202  DAGANGRARGFTAYSQEANHGENSFAGYGKS  232


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FT+Y  +      +F  YG       ++F +Y  D N     F  Y   ++  TD F+ Y
Sbjct  212  FTAYSQEANHGENSFAGYGKSGNRLRETFTSYGNDTNTLSSGFANYGESANGATDTFAGY  271

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV + +F +YG     G   F  Y  D NV +  F +Y+  A+G   EF+SY  +A
Sbjct  272  GVEGNVPENTFRSYGAGGNAGVDSFKGYRDDSNVGDDSFASYAKGANGGAAEFRSYGGSA  331

Query  41   NVGDQNFTSYGK  6
            N G  +F  YG+
Sbjct  332  NPGSVSFKGYGE  343



>ref|XP_003601289.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES71540.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=628

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 119/213 (56%), Gaps = 4/213 (2%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFTPKA LIR+WN K SN LP P F ++ ASPLT   YA    + K  + S +      C
Sbjct  37   PFTPKASLIRHWNTKTSNKLPIPNFFLSKASPLTPQHYANLINLFK-QKPSSSNLHNTLC  95

Query  455  SSADLLC---FPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLP  285
            S+  L C    P+    S   +  + NF  Y  + F+NYGS    G DSFKNY+  +N  
Sbjct  96   STPYLFCSFDHPNTLYQSTKTNKSDSNFAVYSNKKFSNYGSARLGGVDSFKNYSNGLNTN  155

Query  284  VDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRF  105
             D+F++YS  S+     F++YA  GNVA+ +F  YG  ++ G G F +Y K VNVPNL F
Sbjct  156  SDSFKKYSSGSTRRGGEFNSYAENGNVANTNFTNYGSGSSSGTGNFKSYDKLVNVPNLGF  215

Query  104  TAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            T Y   A+  K  F SY  + N G Q+F SYGK
Sbjct  216  TTYDSGANNHKLSFSSYGNDTNSGSQSFNSYGK  248


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 53/104 (51%), Gaps = 2/104 (2%)
 Frame = -1

Query  359  FTNYGSHSAAGA-DSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            FT YG     GA DSFK Y+ + N P  +F+ Y   S + +D F +Y    NV D SF +
Sbjct  271  FTGYGELGTGGANDSFKAYSFNGNNPKSSFKAYGTGSVSGSDTFVSYRNRANVGDDSFQS  330

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSY  54
            YG  +  GA  F NY +  N  N  FT Y   A G+    FKSY
Sbjct  331  YGAKSKAGAASFTNYGQSFNEGNDTFTEYGKGATGKTAFGFKSY  374


 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 62/119 (52%), Gaps = 1/119 (1%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            NFTNYGS S++G  +FK+Y   VN+P   F  Y   ++ H   FS+Y    N   QSF++
Sbjct  186  NFTNYGSGSSSGTGNFKSYDKLVNVPNLGFTTYDSGANNHKLSFSSYGNDTNSGSQSFNS  245

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSD-DADGRKQEFKSYSENANVGDQNFTSYG  9
            YG     G  +F NYA   N+    FT Y +    G    FK+YS N N    +F +YG
Sbjct  246  YGKRVRSGNSDFINYAVSSNILQSTFTGYGELGTGGANDSFKAYSFNGNNPKSSFKAYG  304


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 54/121 (45%), Gaps = 1/121 (1%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSR-DSSAHTDRFSNYATGGNVADQSF  189
            Q+F +YG    +G   F NY V  N+   TF  Y    +    D F  Y+  GN    SF
Sbjct  241  QSFNSYGKRVRSGNSDFINYAVSSNILQSTFTGYGELGTGGANDSFKAYSFNGNNPKSSF  300

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
              YG  +  G+  F +Y    NV +  F +Y   +      F +Y ++ N G+  FT YG
Sbjct  301  KAYGTGSVSGSDTFVSYRNRANVGDDSFQSYGAKSKAGAASFTNYGQSFNEGNDTFTEYG  360

Query  8    K  6
            K
Sbjct  361  K  361



>ref|NP_001061692.1| Os08g0380100 [Oryza sativa Japonica Group]
 sp|Q6ZA27.1|BURPC_ORYSJ RecName: Full=BURP domain-containing protein 12; Short=OsBURP12; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05416.1| putative polygalacturonase isoenzyme 1 beta subunit homolog [Oryza 
sativa Japonica Group]
 dbj|BAF23606.1| Os08g0380100 [Oryza sativa Japonica Group]
 dbj|BAG95253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96203.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 118/217 (54%), Gaps = 14/217 (6%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN ++ N+ P P F +   SPL AA        A +   +L   LP  C
Sbjct  30   PFTAKAAFIRYWNRRVPNNRPHPAFFVAKLSPLQAAD-------AASFAAALPRLLPPLC  82

Query  455  SSADLLCFPDLSPS------SLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDV  294
            + A LLC P  S +      ++        F  Y   NFTNYGS    GAD F  Y+ D+
Sbjct  83   ARAALLC-PSASDTETAASLAVGGGGGGGPFKGYSNANFTNYGSGGVGGADGFSAYSPDL  141

Query  293  NLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN  114
            N+  D+FRRY RDS+   D F++Y   GNV   +F +Y  A  GG+G F  YA D NVP+
Sbjct  142  NVVGDSFRRYGRDSTRRVDTFASYEAEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPD  201

Query  113  LRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
              FT Y  +A+GR++EF SYS+ AN G   F  YGKN
Sbjct  202  STFTNYDAEANGRRREFTSYSQEANHGSNTFAGYGKN  238


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 69/148 (47%), Gaps = 11/148 (7%)
 Frame = -1

Query  416  SSLSKHDDNVNFTSYEFQNFT---NYGSHSAAG--------ADSFKNYTVDVNLPVDTFR  270
            S+ + +D   N    EF +++   N+GS++ AG         ++F  Y  D N+    F 
Sbjct  202  STFTNYDAEANGRRREFTSYSQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFT  261

Query  269  RYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSD  90
             Y    +  TD F+ Y   GNV D +F +YG     G   F  Y  + NV +  F +Y+ 
Sbjct  262  NYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASYAK  321

Query  89   DADGRKQEFKSYSENANVGDQNFTSYGK  6
             A+G   EF++Y  + N G   F  YG+
Sbjct  322  GANGNAAEFQNYGGSFNPGTVTFKGYGE  349


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 73/160 (46%), Gaps = 34/160 (21%)
 Frame = -1

Query  383  FTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTF----------RR----Y  264
            F SYE +      NFT+Y   +  G+ SF  Y  D N+P  TF          RR    Y
Sbjct  162  FASYEAEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNYDAEANGRRREFTSY  221

Query  263  SRDSSAHTDRFSNYATGGNVADQSFHTYGP---ATAGG---AGEFGN--------YAKDV  126
            S++++  ++ F+ Y   GN   ++F TYG      A G    GE GN        Y K+ 
Sbjct  222  SQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGATDTFTAYGKEG  281

Query  125  NVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            NVP+  F +Y    +     FK Y   +NVGD +F SY K
Sbjct  282  NVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASYAK  321


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 55/120 (46%), Gaps = 5/120 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG       D+F  Y  + N+P +TFR Y    +A  D F  Y +  NV D SF +Y
Sbjct  260  FTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASY  319

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYGKN  3
                 G A EF NY    N   + F  Y + ++      FK Y+ + N    +F  Y K+
Sbjct  320  AKGANGNAAEFQNYGGSFNPGTVTFKGYGEGSNPNHHIGFKEYAGSNN----SFKGYAKS  375



>ref|XP_004956601.1| PREDICTED: BURP domain-containing protein 14-like [Setaria italica]
Length=683

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 121/228 (53%), Gaps = 21/228 (9%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ ++ P P F     SPL+A   A FS +A A +  LA+++ +FC
Sbjct  69   PFTAKAAFIRYWNRKVRSNRPHPAFFFAKLSPLSAPDAAAFSTLASAGK--LASRIRDFC  126

Query  455  SSADLLCFPDLSPSSLSKHDDNVN------------------FTSYEFQNFTNYGSHSAA  330
            ++A LLC P    +S S    +V                   F +YE  NF++YG+    
Sbjct  127  AAASLLC-PSTPAASWSASSSSVEDGAAGTASSGGGAGSAAPFKNYENGNFSSYGNSGGG  185

Query  329  GADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGE  150
            GAD F  Y+   + PVD+F+RY + S    D F+NY  GGNV   SF +Y     GGAGE
Sbjct  186  GADQFAAYSSGKSGPVDSFKRYGKGSLGRNDSFTNYEAGGNVGTSSFSSYTTGATGGAGE  245

Query  149  FGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            F  YA   N     F  Y    +GR  EF +Y+++AN G + FTSYGK
Sbjct  246  FAGYAGQTNTVAATFATYDSGGNGRAHEFTAYAQDANSGVEGFTSYGK  293


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 71/148 (48%), Gaps = 11/148 (7%)
 Frame = -1

Query  416  SSLSKHDDNVNFTSYEF-----------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFR  270
            ++ + +D   N  ++EF           + FT+YG  + A A+SFK Y  + N     F 
Sbjct  258  ATFATYDSGGNGRAHEFTAYAQDANSGVEGFTSYGKAANAAAESFKTYGNNSNTVASGFI  317

Query  269  RYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSD  90
             Y   ++   D F++Y   GN  + +F +Y   +     +F  Y    N+ +  FT+Y+ 
Sbjct  318  NYGEKANGLNDTFASYGLDGNAPENTFRSYASGSNAAVDDFKGYRDAANIGDDSFTSYAS  377

Query  89   DADGRKQEFKSYSENANVGDQNFTSYGK  6
            +A+G +  F SY ++ N G  +F  YG+
Sbjct  378  NANGAEAGFDSYGKSTNPGSVSFKGYGQ  405


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 52/119 (44%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F  Y S     A  F  Y  D N  V+ F  Y + ++A  + F  Y    N     F  Y
Sbjct  260  FATYDSGGNGRAHEFTAYAQDANSGVEGFTSYGKAANAAAESFKTYGNNSNTVASGFINY  319

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  D N P   F +Y+  ++    +FK Y + AN+GD +FTSY  N
Sbjct  320  GEKANGLNDTFASYGLDGNAPENTFRSYASGSNAAVDDFKGYRDAANIGDDSFTSYASN  378


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 51/114 (45%), Gaps = 11/114 (10%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG  +    D+F +Y +D N P +TFR Y+  S+A  D F  Y    N+ D SF +Y
Sbjct  316  FINYGEKANGLNDTFASYGLDGNAPENTFRSYASGSNAAVDDFKGYRDAANIGDDSFTSY  375

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD-----------GRKQEFKSYS  51
                 G    F +Y K  N  ++ F  Y   ++           G    FK+YS
Sbjct  376  ASNANGAEAGFDSYGKSTNPGSVSFKGYGQGSNPNHRIGFTHYSGDNTTFKAYS  429



>ref|XP_002460065.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
 gb|EER96586.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
Length=691

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 121/233 (52%), Gaps = 25/233 (11%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+  + P P FL    SPL+A   A FS +A A +  LA+++ +FC
Sbjct  72   PFTAKAAFIRYWNRKVRGNRPHPAFLFAKLSPLSAPDAATFSTLASAGK--LASRIRDFC  129

Query  455  SSADLLC-----------------------FPDLSPSSLSKHDDNVNFTSYEFQNFTNYG  345
            ++A LLC                           S S       +  F +YE  NF++YG
Sbjct  130  AAASLLCPSTPAASWSAASSSSSVDGGAAGGVAASSSGGGGAASSAPFKNYENGNFSSYG  189

Query  344  SHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATA  165
            +    G+D F  Y+   + PVD+F+RY + S    D F+NY  GGNV   SF++Y     
Sbjct  190  NSGGGGSDQFAVYSSGKSGPVDSFKRYGKGSLGRNDSFTNYEEGGNVGTSSFNSYTTGAT  249

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            GGAGEF  YA   N   + F  Y +  +GR  EF +YS++AN G Q+FT YGK
Sbjct  250  GGAGEFAGYAGQTNTVAVTFATYDNTGNGRTHEFTAYSQDANSGVQSFTGYGK  302


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 71/172 (41%), Gaps = 39/172 (23%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDS  252
            SL ++D   +FT+YE        +F +Y + +  GA  F  Y    N    TF  Y    
Sbjct  220  SLGRND---SFTNYEEGGNVGTSSFNSYTTGATGGAGEFAGYAGQTNTVAVTFATYDNTG  276

Query  251  SAHTDRFSNYATGGNVADQSFHTYGPATAGGAGE--------------------------  150
            +  T  F+ Y+   N   QSF  YG  TA GAGE                          
Sbjct  277  NGRTHEFTAYSQDANSGVQSFTGYG-KTANGAGESFKTYGNNSNTVASGFINYGDRANGF  335

Query  149  ---FGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
               F +Y  D N P   F +Y+  ++    EFK+Y + ANVGD +F SY  N
Sbjct  336  NDTFASYGLDGNAPQNTFRSYASGSNAAVDEFKAYRDQANVGDDSFASYASN  387


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (45%), Gaps = 11/147 (7%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEF-----------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRR  267
            + + +D+  N  ++EF           Q+FT YG  +    +SFK Y  + N     F  
Sbjct  268  TFATYDNTGNGRTHEFTAYSQDANSGVQSFTGYGKTANGAGESFKTYGNNSNTVASGFIN  327

Query  266  YSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDD  87
            Y   ++   D F++Y   GN    +F +Y   +     EF  Y    NV +  F +Y+ +
Sbjct  328  YGDRANGFNDTFASYGLDGNAPQNTFRSYASGSNAAVDEFKAYRDQANVGDDSFASYASN  387

Query  86   ADGRKQEFKSYSENANVGDQNFTSYGK  6
            A+G   +F SY ++ N G   F  YG+
Sbjct  388  ANGAAADFDSYGKSTNPGSVAFKGYGQ  414


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 11/114 (10%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG  +    D+F +Y +D N P +TFR Y+  S+A  D F  Y    NV D SF +Y
Sbjct  325  FINYGDRANGFNDTFASYGLDGNAPQNTFRSYASGSNAAVDEFKAYRDQANVGDDSFASY  384

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD-----------GRKQEFKSYS  51
                 G A +F +Y K  N  ++ F  Y   ++           G    FK+YS
Sbjct  385  ASNANGAAADFDSYGKSTNPGSVAFKGYGQGSNPNHRIGFTHYSGENTTFKAYS  438



>ref|XP_008652571.1| PREDICTED: BURP domain-containing protein 14-like [Zea mays]
 tpg|DAA61067.1| TPA: hypothetical protein ZEAMMB73_635092 [Zea mays]
Length=679

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 123/229 (54%), Gaps = 22/229 (10%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+S++ P P FL    SPL+A   A FS +A A +  LA+++ +FC
Sbjct  67   PFTAKAAFIRYWNRKVSSNRPHPAFLFAKLSPLSAPDAATFSNLASAGK--LASRIHDFC  124

Query  455  SSADLLCFPDLSPSSLSKHDDNVN-------------------FTSYEFQNFTNYGSHSA  333
             +A LLC P    +S S    +++                   F  YE  NF++YG+   
Sbjct  125  DAASLLC-PSTPAASWSASSTSMDGAAGVASSGGGSGAASAAPFKDYENGNFSSYGNSGG  183

Query  332  AGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG  153
             G+D F  Y+   + PVD+F+RY + S    D F+NY  G NV   +F++Y     GGAG
Sbjct  184  GGSDQFAIYSSGKSGPVDSFKRYGKGSLGRNDSFANYEEGANVGTSTFNSYTTGATGGAG  243

Query  152  EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            EF  YA   N   + F  Y    +GR  EF +YS++AN G Q+FT YGK
Sbjct  244  EFAGYAGQTNTVAVAFATYDSVGNGRTHEFTAYSQDANSGVQSFTGYGK  292


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT YG  +    +SF+ Y  + N     F  Y   S+   D F++Y   GN  + +F 
Sbjct  285  QSFTGYGKTANGAGESFETYGNNSNTVASGFINYGEKSNGFNDTFTSYGLVGNAPENTFR  344

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +Y   +  G  +F  Y  + NV +  F +Y+++A+G   +F SY ++ N G   F  YG+
Sbjct  345  SYASGSNAGVDQFKAYRDEANVGDDSFMSYANNANGAAADFDSYGKSTNPGSVAFKGYGQ  404


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 11/114 (10%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NYG  S    D+F +Y +  N P +TFR Y+  S+A  D+F  Y    NV D SF +Y
Sbjct  315  FINYGEKSNGFNDTFTSYGLVGNAPENTFRSYASGSNAGVDQFKAYRDEANVGDDSFMSY  374

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD-----------GRKQEFKSYS  51
                 G A +F +Y K  N  ++ F  Y   ++           G    FK+YS
Sbjct  375  ANNANGAAADFDSYGKSTNPGSVAFKGYGQGSNPNHRIGFKHYAGENTTFKAYS  428


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 50/116 (43%), Gaps = 0/116 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F  Y S        F  Y+ D N  V +F  Y + ++   + F  Y    N     F  Y
Sbjct  259  FATYDSVGNGRTHEFTAYSQDANSGVQSFTGYGKTANGAGESFETYGNNSNTVASGFINY  318

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
            G  + G    F +Y    N P   F +Y+  ++    +FK+Y + ANVGD +F SY
Sbjct  319  GEKSNGFNDTFTSYGLVGNAPENTFRSYASGSNAGVDQFKAYRDEANVGDDSFMSY  374



>ref|XP_002525381.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
 gb|EEF37019.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
Length=531

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 128/213 (60%), Gaps = 14/213 (7%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            ++PFTPKA L+ +W+N+I+ + P   FL++ ASPL+A +    S +       L   L  
Sbjct  52   ENPFTPKASLMPHWSNQINTNSPISPFLLSRASPLSALK--TLSPLTSPPSPLL---LSA  106

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPV  282
            F S         +SPS + KH+ N NF +Y  QNFTNYG+    G  SF NY+   N   
Sbjct  107  FASR--------ISPSVV-KHEKNSNFAAYLNQNFTNYGTGQVGGVGSFNNYSPGDNFAR  157

Query  281  DTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFT  102
            D FRRYSR++    ++FS+YA   N+A  +F+TYG    GG GEF  Y + VN  N+RFT
Sbjct  158  DNFRRYSRNAQDRKEKFSSYAPDANLAMTTFNTYGTGATGGEGEFKKYNERVNFQNIRFT  217

Query  101  AYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            +Y+DD+ GR+  F SY E+ N+G + F+SYGKN
Sbjct  218  SYADDSKGREYTFSSYVESVNLGVEWFSSYGKN  250



>ref|XP_004973305.1| PREDICTED: BURP domain-containing protein 12-like [Setaria italica]
Length=647

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 122/221 (55%), Gaps = 14/221 (6%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+ N+ P P F +   SPL AA  A F       R    A+LP  C
Sbjct  37   PFTAKAAFIRYWNRKVPNNRPHPAFFVAKLSPLPAADSASFPSALPDIR----ARLPALC  92

Query  455  SSADLLCFPDLSPSSLSKHDDNVN----------FTSYEFQNFTNYGSHSAAGADSFKNY  306
            S A LLC    S +       ++           F  Y   NF+NYGS    GADSF++Y
Sbjct  93   SRAGLLCAGPASSAGADADAASLAAAAGTRGGGPFKGYSNANFSNYGSGGDGGADSFRSY  152

Query  305  TVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDV  126
            + D+N+  D+FRRY+RDSS   DRF +Y   GNV   +F +Y   + GG+G F +YA + 
Sbjct  153  SPDLNIAADSFRRYARDSSDRADRFESYEADGNVVTANFTSYAGGSTGGSGTFASYAAET  212

Query  125  NVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            NVP+  FT Y   A+GR + F SY++ AN G+  F+ YGKN
Sbjct  213  NVPDSTFTNYDAAANGRGRGFASYAQEANHGENGFSGYGKN  253


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+ YG +     ++F +Y  + N+    F  Y    +  TD FS+Y   GNV + +F +Y
Sbjct  247  FSGYGKNGNGVRETFTSYGNESNVMASAFANYGESGNGATDTFSSYGVEGNVPENTFRSY  306

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G     G   F  Y  D NV + RF++Y+  A+G   EF+SY  +AN G   F  YG+
Sbjct  307  GAGGNAGVDTFKKYRDDANVGDDRFSSYAKGANGGGAEFQSYGNSANPGSTTFKGYGE  364


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 56/118 (47%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNY + +      F +Y  + N   + F  Y ++ +   + F++Y    NV   +F  Y
Sbjct  219  FTNYDAAANGRGRGFASYAQEANHGENGFSGYGKNGNGVRETFTSYGNESNVMASAFANY  278

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +  G    F +Y  + NVP   F +Y    +     FK Y ++ANVGD  F+SY K
Sbjct  279  GESGNGATDTFSSYGVEGNVPENTFRSYGAGGNAGVDTFKKYRDDANVGDDRFSSYAK  336


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 27/134 (20%)
 Frame = -1

Query  383  FTSYEFQN------FTNYGSHSAAGADSFKNYTVDVNLP--------------VDTFRRY  264
            FTSY  ++      F NYG       D+F +Y V+ N+P              VDTF++Y
Sbjct  261  FTSYGNESNVMASAFANYGESGNGATDTFSSYGVEGNVPENTFRSYGAGGNAGVDTFKKY  320

Query  263  SRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPN--LRFTAYSD  90
              D++   DRFS+YA G N     F +YG +   G+  F  Y +  N PN  + F  Y+ 
Sbjct  321  RDDANVGDDRFSSYAKGANGGGAEFQSYGNSANPGSTTFKGYGEGTN-PNHHIGFKEYA-  378

Query  89   DADGRKQEFKSYSE  48
               G    FK Y++
Sbjct  379  ---GENNTFKGYAK  389



>ref|XP_003610588.1| BURP domain-containing protein [Medicago truncatula]
 gb|AES92785.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=394

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 112/188 (60%), Gaps = 20/188 (11%)
 Frame = -1

Query  560  LINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNF  381
            +I++   +T  +     K+A    N L+ +LPEFCS+A+LLC P+++  SL KH+ + NF
Sbjct  19   VISVGDVVTGDKNPFTPKLASG--NMLSTRLPEFCSAANLLCLPEVA-QSLEKHEGDENF  75

Query  380  TSYEFQNFTNYGSHSAAGADSFKNYTVD--VNLPVDTFRRYSRDSSAHTDRFSNYATGGN  207
             +Y  +NFTNYG+    G DSFKNY+     +  V+ F RYSR+S+ H + F+NY     
Sbjct  76   KAYSDKNFTNYGTSLPGGHDSFKNYSDGDYSDGEVNDFCRYSRNSAGHKETFTNYTPQTP  135

Query  206  VADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQ  27
             +D               EF     + NVPN  FT+YSD+A+GR Q F SY+EN N GDQ
Sbjct  136  TSD---------------EFKQCTTEANVPNEVFTSYSDNANGRTQSFNSYTENGNGGDQ  180

Query  26   NFTSYGKN  3
            +FTSYGKN
Sbjct  181  SFTSYGKN  188


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 64/132 (48%), Gaps = 20/132 (15%)
 Frame = -1

Query  383  FTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        + FTNYG+ S      F NY    N   D+F+ YS D +  T+ FSNY
Sbjct  182  FTSYGKNGNGHTEEFTNYGTSSNTVGSDFSNYAETSNSGNDSFKGYSVDMNNPTNTFSNY  241

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
            A GGN A Q+F T              Y +D NV    FT+Y+  A+  K  F +Y ++ 
Sbjct  242  ANGGNGAIQTFST--------------YREDANVGADSFTSYAKTANAAKIGFDNYGKSF  287

Query  41   NVGDQNFTSYGK  6
            N G   FTSY K
Sbjct  288  NGGTDTFTSYAK  299



>gb|ABR16440.1| unknown [Picea sitchensis]
Length=666

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 120/215 (56%), Gaps = 6/215 (3%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSK-IAKADRNSLAAQLP  465
            D PF  KA L+R+W   + N    P FL+  ASPL A   AVF+  IA    ++L   + 
Sbjct  64   DHPFAAKASLLRFWRRVLPN-ARLPAFLLEKASPLNATSVAVFAGYIAN---HTLPDHIA  119

Query  464  EFCSSADLLCFPDLSPSSLSKHD-DNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNL  288
             FC++ADLLC   ++ +   K    + +F SY  ++F +Y   +++G DSFKNY+   N 
Sbjct  120  SFCTAADLLCTRRIAVTGDEKAVVGDADFQSYHGKDFKHYKVGASSGTDSFKNYSDGDNE  179

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
              D F+RY RD +  +  F+NYA   N+ D+ F TY    +    +F NY  + NVP+  
Sbjct  180  AKDDFKRYGRDGNGRSQVFANYAPQTNIEDEGFATYSSGASAANSDFTNYGSNSNVPDHH  239

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            F  Y  D++   Q FKSY++N+NV   +F SYGK+
Sbjct  240  FKNYGTDSNAGIQNFKSYADNSNVVKNDFASYGKD  274


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
             +F NYG+ S AG  +FK+Y  + N+  + F  Y +D++     FS+YA   NV   +F 
Sbjct  238  HHFKNYGTDSNAGIQNFKSYADNSNVVKNDFASYGKDANGILSGFSSYAENSNVITNNFK  297

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             Y     G   +F +YA + NVP   F +Y  + +G  Q F SY++ ANV    F SYGK
Sbjct  298  GYSEGGNGPLDQFTSYADNGNVPRNEFESYGSNGNGALQSFTSYADGANVPQDVFKSYGK  357

Query  5    N  3
            +
Sbjct  358  D  358


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 65/122 (53%), Gaps = 0/122 (0%)
 Frame = -1

Query  368  FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSF  189
               F++Y  +S    ++FK Y+   N P+D F  Y+ + +   + F +Y + GN A QSF
Sbjct  279  LSGFSSYAENSNVITNNFKGYSEGGNGPLDQFTSYADNGNVPRNEFESYGSNGNGALQSF  338

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             +Y          F +Y KD N P + FT Y + ++ ++ EFK Y + +N  D  FTSYG
Sbjct  339  TSYADGANVPQDVFKSYGKDANTPLVTFTNYGNSSNSQQDEFKQYGKGSNSPDMTFTSYG  398

Query  8    KN  3
            +N
Sbjct  399  RN  400


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 7/93 (8%)
 Frame = -1

Query  368  FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSF  189
             Q+FT+Y   +    D FK+Y  D N P+ TF  Y   S++  D F  Y  G N  D +F
Sbjct  335  LQSFTSYADGANVPQDVFKSYGKDANTPLVTFTNYGNSSNSQQDEFKQYGKGSNSPDMTF  394

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSD  90
             +YG  T     +F  YAK  N   + F++Y++
Sbjct  395  TSYGRNT-----QFKEYAK--NGTGITFSSYTN  420



>ref|XP_003576424.1| PREDICTED: BURP domain-containing protein 14-like [Brachypodium 
distachyon]
Length=775

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 123/227 (54%), Gaps = 19/227 (8%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKI-SNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF  459
            PFT KA  IRYWN K+ S+ L  P F     SPL+A   A FS +A A +  LA++LP F
Sbjct  156  PFTAKAAFIRYWNRKVHSSRLLHPAFFFAKLSPLSAPDAATFSSLAAAGQ--LASRLPAF  213

Query  458  CSSADLLCFPD----LSPSSLSKHDDNVN------------FTSYEFQNFTNYGSHSAAG  327
            C++A +LC        S SS++  D + N            F +Y+  NF++YG++   G
Sbjct  214  CAAASILCPATSDAVWSGSSVAAGDASGNTSPASSGSGTAPFKNYDNGNFSSYGNNGGGG  273

Query  326  ADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEF  147
            AD+F  Y+     PVD+FRRY + S    D F+ Y   GNV   SF++Y     GGAG+F
Sbjct  274  ADAFAVYSRGQINPVDSFRRYGKGSLGRNDSFATYEALGNVGTASFNSYTTGATGGAGDF  333

Query  146  GNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
              Y  + N   + F  Y    +GR +EF  Y+ +AN G ++FT YGK
Sbjct  334  AAYDGETNTAAVTFANYDVTGNGRSREFTDYTRDANSGVESFTGYGK  380


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 64/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++FT YG  + +  +SFK+Y    N  +  F  Y   +++  D F++Y   GN  + +F 
Sbjct  373  ESFTGYGKTANSAGESFKDYGNHSNSIMSGFINYGEKANSANDTFASYGLNGNAPENTFR  432

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +Y   +  GA +F  Y  + NV +  F +Y+ DA+G   +F+SY ++ N G   F  YG+
Sbjct  433  SYASGSNAGADDFKGYRDNANVGDDSFMSYATDANGATADFESYGKSVNPGSVAFKGYGQ  492


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 54/120 (45%), Gaps = 11/120 (9%)
 Frame = -1

Query  368  FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSF  189
               F NYG  + +  D+F +Y ++ N P +TFR Y+  S+A  D F  Y    NV D SF
Sbjct  400  MSGFINYGEKANSANDTFASYGLNGNAPENTFRSYASGSNAGADDFKGYRDNANVGDDSF  459

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD-----------GRKQEFKSYSENA  42
             +Y     G   +F +Y K VN  ++ F  Y   ++           G    FK YS + 
Sbjct  460  MSYATDANGATADFESYGKSVNPGSVAFKGYGQGSNPNHHIGFTHYTGDNTTFKGYSNDG  519


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (47%), Gaps = 0/116 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F NY       +  F +YT D N  V++F  Y + +++  + F +Y    N     F  Y
Sbjct  347  FANYDVTGNGRSREFTDYTRDANSGVESFTGYGKTANSAGESFKDYGNHSNSIMSGFINY  406

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
            G         F +Y  + N P   F +Y+  ++    +FK Y +NANVGD +F SY
Sbjct  407  GEKANSANDTFASYGLNGNAPENTFRSYASGSNAGADDFKGYRDNANVGDDSFMSY  462


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = -1

Query  362  NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHT  183
            +F  Y   +   A +F NY V  N     F  Y+RD+++  + F+ Y    N A +SF  
Sbjct  332  DFAAYDGETNTAAVTFANYDVTGNGRSREFTDYTRDANSGVESFTGYGKTANSAGESFKD  391

Query  182  YGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            YG  +      F NY +  N  N  F +Y  + +  +  F+SY+  +N G  +F  Y  N
Sbjct  392  YGNHSNSIMSGFINYGEKANSANDTFASYGLNGNAPENTFRSYASGSNAGADDFKGYRDN  451



>gb|EEC83505.1| hypothetical protein OsI_29064 [Oryza sativa Indica Group]
Length=623

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 106/211 (50%), Gaps = 34/211 (16%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN ++ N+ P P F +   SPL AA        A +   +L   LP  C
Sbjct  31   PFTAKAAFIRYWNRRVPNNRPHPAFFVAKLSPLQAAD-------AASFAAALPRLLPPLC  83

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            + A LLC     P  L   D  +   +Y                      + D+N+  D+
Sbjct  84   ARAALLC-----PCRLRHRDGRLPAPAY----------------------SPDLNVVGDS  116

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            FRRY+RDS+   D F++Y   GNV   +F +Y  A  GG+G F  YA D NVP+  FT Y
Sbjct  117  FRRYARDSTRRVDTFASYEPEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNY  176

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
              +A+GR++EF SYS+ AN G   F  YGKN
Sbjct  177  DAEANGRRREFTSYSQEANHGSNTFAGYGKN  207


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 69/148 (47%), Gaps = 11/148 (7%)
 Frame = -1

Query  416  SSLSKHDDNVNFTSYEFQNFT---NYGSHSAAG--------ADSFKNYTVDVNLPVDTFR  270
            S+ + +D   N    EF +++   N+GS++ AG         ++F  Y  D N+    F 
Sbjct  171  STFTNYDAEANGRRREFTSYSQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFT  230

Query  269  RYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSD  90
             Y    +  TD F+ Y   GNV D +F +YG     G   F  Y  + NV +  F +Y+ 
Sbjct  231  NYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASYAK  290

Query  89   DADGRKQEFKSYSENANVGDQNFTSYGK  6
             A+G   EF++Y  + N G   F  YG+
Sbjct  291  GANGNAAEFQNYGGSFNPGTVTFKGYGE  318


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 55/120 (46%), Gaps = 5/120 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG       D+F  Y  + N+P +TFR Y    +A  D F  Y +  NV D SF +Y
Sbjct  229  FTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASY  288

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYGKN  3
                 G A EF NY    N   + F  Y + ++      FK Y+ + N    +F  Y K+
Sbjct  289  AKGANGNAAEFQNYGGSFNPGTVTFKGYGEGSNPNHHIGFKEYAGSNN----SFKGYAKS  344



>emb|CDP00166.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 117/255 (46%), Gaps = 46/255 (18%)
 Frame = -1

Query  641  DSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP-  465
            ++PFT KA LIR W  +++NDLP PWF +N  SPL A Q A FSK+   D+NS +  LP 
Sbjct  19   ENPFTAKASLIRRWRTQVTNDLPMPWFFLNKVSPLNAVQMATFSKLL-TDQNSFSTPLPP  77

Query  464  -----EFCSSADLL---CFPDLSPSSLSKHDDNVNFTSY-----EFQNFTNYGSHSAAGA  324
                  F  S D L    F   S SSL  HDD   F++Y       Q F  YG+    GA
Sbjct  78   RKTRQRFNYSHDFLPLDSFRRYSRSSLG-HDDK--FSTYIDGNLVDQTFDTYGNTVTGGA  134

Query  323  DSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGP----------  174
             +F NY   VN+P   F  YS D+S     F+NY   GN  ++ F +Y            
Sbjct  135  GTFTNYQNLVNVPNLNFTSYSDDASGRNQGFTNYINNGNSGEEDFKSYTKKGTESENKFT  194

Query  173  ----ATAGGAGEFGNYAKDVN--------------VPNLRFTAYSDDADGRKQEFKSYSE  48
                A  G    F NY K  N              VP   FT+Y D  +   + FK YS+
Sbjct  195  TTRMAQTGILSSFSNYGKSGNGIKDTFTSYRFGGNVPENTFTSYGDGGNAATEIFKCYSD  254

Query  47   NANVGDQNFTSYGKN  3
              NVG   F SY K+
Sbjct  255  ETNVGADFFKSYAKD  269


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 56/122 (46%), Gaps = 5/122 (4%)
 Frame = -1

Query  368  FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSF  189
              +F+NYG       D+F +Y    N+P +TF  Y    +A T+ F  Y+   NV    F
Sbjct  204  LSSFSNYGKSGNGIKDTFTSYRFGGNVPENTFTSYGDGGNAATEIFKCYSDETNVGADFF  263

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
             +Y   +      F +Y + VN   ++FT+Y + A     EFK Y +N      +F  Y 
Sbjct  264  KSYAKDSNAAKANFASYGRSVNKGPVQFTSYGEGAKNHHIEFKIYGDN-----YSFKKYA  318

Query  8    KN  3
            KN
Sbjct  319  KN  320



>dbj|BAJ97940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 114/224 (51%), Gaps = 17/224 (8%)
 Frame = -1

Query  635  PFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFC  456
            PFT KA  IRYWN K+      P F     SPL+A     FS +A A +  L ++LP FC
Sbjct  141  PFTAKAAFIRYWNRKVHGSRLHPAFFFAKLSPLSAPDAVAFSNLAAAGQ--LGSRLPAFC  198

Query  455  SSADLLCFPDLSP-----SSLSKHDD---------NVNFTSYEFQNFTNYGSHSAAGADS  318
            ++A ++C P  S      S  SK  D            F +Y   NF++YG+    GAD+
Sbjct  199  TAASIIC-PSTSGIIWSGSGPSKAGDASGSPASNSTAPFKNYANGNFSSYGNSGGGGADA  257

Query  317  FKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNY  138
            F  Y+     PVD+F RY + S    D F+ Y   GNV   SF++Y     GG GEF  Y
Sbjct  258  FAVYSRGQINPVDSFHRYGKGSLGRNDSFATYEALGNVGTASFNSYTAGATGGTGEFAEY  317

Query  137  AKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
              + N   + F  Y    +GR ++F +Y+++AN G ++FT YG+
Sbjct  318  DGETNTVAVTFANYDVAGNGRSRDFSTYTQDANSGVESFTGYGR  361


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 66/120 (55%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++FT YG  + +  +SFK Y    N  +  F  Y   +++ TD F +Y   GN  + SF 
Sbjct  354  ESFTGYGRAANSAGESFKAYGNHSNSIMSGFINYGDKANSATDTFDSYGLNGNTPENSFR  413

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +Y   + GGA +F  Y  + NV +  FT+Y++DA+G   +F+SY ++ N G   F  YG+
Sbjct  414  SYSSGSNGGADDFKGYRDNANVGDDSFTSYANDANGATADFQSYGKSVNPGSVAFKGYGQ  473


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 62/133 (47%), Gaps = 3/133 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
             +++D   N  +  F N+   G+  +     F  YT D N  V++F  Y R +++  + F
Sbjct  314  FAEYDGETNTVAVTFANYDVAGNGRS---RDFSTYTQDANSGVESFTGYGRAANSAGESF  370

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
              Y    N     F  YG         F +Y  + N P   F +YS  ++G   +FK Y 
Sbjct  371  KAYGNHSNSIMSGFINYGDKANSATDTFDSYGLNGNTPENSFRSYSSGSNGGADDFKGYR  430

Query  50   ENANVGDQNFTSY  12
            +NANVGD +FTSY
Sbjct  431  DNANVGDDSFTSY  443


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 53/117 (45%), Gaps = 11/117 (9%)
 Frame = -1

Query  368  FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSF  189
               F NYG  + +  D+F +Y ++ N P ++FR YS  S+   D F  Y    NV D SF
Sbjct  381  MSGFINYGDKANSATDTFDSYGLNGNTPENSFRSYSSGSNGGADDFKGYRDNANVGDDSF  440

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD-----------GRKQEFKSYS  51
             +Y     G   +F +Y K VN  ++ F  Y   ++           G    FK+YS
Sbjct  441  TSYANDANGATADFQSYGKSVNPGSVAFKGYGQGSNPNHRIGFTHYTGDNTTFKAYS  497



>emb|CAN81758.1| hypothetical protein VITISV_043391 [Vitis vinifera]
Length=574

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 78/122 (64%), Gaps = 0/122 (0%)
 Frame = -1

Query  368  FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSF  189
             + F NYG     G DSFKNY+  +N+P  +FRRYS DS+ H + F++YA  GNVA  SF
Sbjct  49   IRGFANYGDSRIGGVDSFKNYSDGLNMPSGSFRRYSGDSTDHHEEFTSYARDGNVATGSF  108

Query  188  HTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
              YG    GG+GEF NY   VNVP+L FT Y  + +  K  F +Y+++ N G ++FTSYG
Sbjct  109  AGYGSGATGGSGEFTNYDPLVNVPHLEFTTYDPNGNNHKLTFAAYTDDTNSGTESFTSYG  168

Query  8    KN  3
            KN
Sbjct  169  KN  170


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 56/125 (45%), Gaps = 3/125 (2%)
 Frame = -1

Query  419  PSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHT  240
            P+  + + DN N        FT YG  +    DSFK Y    N P + F+ YS   +A T
Sbjct  175  PAEFTSYGDNSNIIG---STFTAYGQLANXQNDSFKAYGHSSNNPHNNFKSYSLGGNAAT  231

Query  239  DRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFK  60
            D FSNY  G NV D SF +Y  ++      F NY +  NV N  F  Y   +      FK
Sbjct  232  DTFSNYRDGANVGDDSFQSYARSSNSAEVNFANYGRTFNVGNDTFKEYGKGSTDSSVGFK  291

Query  59   SYSEN  45
             Y  N
Sbjct  292  IYGLN  296


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 61/135 (45%), Gaps = 6/135 (4%)
 Frame = -1

Query  398  DDNVNFTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTD  237
            D +  FTSY         +F  YGS +  G+  F NY   VN+P   F  Y  + + H  
Sbjct  89   DHHEEFTSYARDGNVATGSFAGYGSGATGGSGEFTNYDPLVNVPHLEFTTYDPNGNNHKL  148

Query  236  RFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKS  57
             F+ Y    N   +SF +YG        EF +Y  + N+    FTAY   A+ +   FK+
Sbjct  149  TFAAYTDDTNSGTESFTSYGKNGKNVPAEFTSYGDNSNIIGSTFTAYGQLANXQNDSFKA  208

Query  56   YSENANVGDQNFTSY  12
            Y  ++N    NF SY
Sbjct  209  YGHSSNNPHNNFKSY  223



>dbj|BAD23622.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
 dbj|BAD29397.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
Length=690

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 119/244 (49%), Gaps = 37/244 (15%)
 Frame = -1

Query  638  SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF  459
            SPFT KA  +RYWN K+ ++ P P F     SPL+A   A FS +A A +  L +++  F
Sbjct  64   SPFTAKAAFVRYWNRKVHSNRPHPAFFFAKLSPLSAPDAAAFSTLAAAGQ--LGSRIRAF  121

Query  458  CSSADLLCFPDLSPSSLSKHDDNVN--------------------------FTSYEFQNF  357
            C++A LLC    +P S      +                            F +YE  NF
Sbjct  122  CAAASLLC--PTTPGSSWSKSSSDGDGAAAAAAPAGGGGGGGGGGDGGAAPFKNYENGNF  179

Query  356  TNYGSHSAAGADSFKNYT-------VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVAD  198
            ++YG+    GAD F  Y+             VD+FRRY + S    D F++Y  GGNV  
Sbjct  180  SSYGNSGGGGADQFAVYSSGQSNGGGGGGGGVDSFRRYGKGSQGRNDSFTSYEAGGNVGT  239

Query  197  QSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFT  18
             SF +Y     GGAG F +YA D N   + F  Y    +GR +EF  Y+++AN G+++F 
Sbjct  240  SSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHTGNGRSREFSEYTQDANTGEESFA  299

Query  17   SYGK  6
            +YGK
Sbjct  300  AYGK  303


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 55/133 (41%), Gaps = 6/133 (5%)
 Frame = -1

Query  392  NVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N +FTSYE        +FT+Y   +  GA  F +Y  D N    +F  Y    +  +  F
Sbjct  225  NDSFTSYEAGGNVGTSSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHTGNGRSREF  284

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S Y    N  ++SF  YG    G A  F  Y    N     F  Y D A+G    F SY 
Sbjct  285  SEYTQDANTGEESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYG  344

Query  50   ENANVGDQNFTSY  12
             + N  +  F SY
Sbjct  345  ASGNTPENTFKSY  357


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F  YG  +   A+SF+ Y    N     F  Y   ++   D FS+Y   GN  + +F 
Sbjct  296  ESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFK  355

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +Y   +  G  +F  Y  D NV N  FT+Y+ +A+G    F+SY ++ N G   F  YG
Sbjct  356  SYASGSNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYG  414



>ref|NP_001062896.2| Os09g0329000 [Oryza sativa Japonica Group]
 sp|Q6K2M1.2|BURPE_ORYSJ RecName: Full=BURP domain-containing protein 14; Short=OsBURP14; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF24810.2| Os09g0329000 [Oryza sativa Japonica Group]
Length=690

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 119/244 (49%), Gaps = 37/244 (15%)
 Frame = -1

Query  638  SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF  459
            SPFT KA  +RYWN K+ ++ P P F     SPL+A   A FS +A A +  L +++  F
Sbjct  64   SPFTAKAAFVRYWNRKVHSNRPHPAFFFAKLSPLSAPDAAAFSTLAAAGQ--LGSRIRAF  121

Query  458  CSSADLLCFPDLSPSSLSKHDDNVN--------------------------FTSYEFQNF  357
            C++A LLC    +P S      +                            F +YE  NF
Sbjct  122  CAAASLLC--PTTPGSSWSKSSSDGDGAAAAAAPAGGGGGGGGGGDGGAAPFKNYENGNF  179

Query  356  TNYGSHSAAGADSFKNYT-------VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVAD  198
            ++YG+    GAD F  Y+             VD+FRRY + S    D F++Y  GGNV  
Sbjct  180  SSYGNSGGGGADQFAVYSSGQSNGGGGGGGGVDSFRRYGKGSQGRNDSFTSYEAGGNVGT  239

Query  197  QSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFT  18
             SF +Y     GGAG F +YA D N   + F  Y    +GR +EF  Y+++AN G+++F 
Sbjct  240  SSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHTGNGRSREFSEYTQDANTGEESFA  299

Query  17   SYGK  6
            +YGK
Sbjct  300  AYGK  303


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 55/133 (41%), Gaps = 6/133 (5%)
 Frame = -1

Query  392  NVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N +FTSYE        +FT+Y   +  GA  F +Y  D N    +F  Y    +  +  F
Sbjct  225  NDSFTSYEAGGNVGTSSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHTGNGRSREF  284

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S Y    N  ++SF  YG    G A  F  Y    N     F  Y D A+G    F SY 
Sbjct  285  SEYTQDANTGEESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYG  344

Query  50   ENANVGDQNFTSY  12
             + N  +  F SY
Sbjct  345  ASGNTPENTFKSY  357


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F  YG  +   A+SF+ Y    N     F  Y   ++   D FS+Y   GN  + +F 
Sbjct  296  ESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFK  355

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +Y   +  G  +F  Y  D NV N  FT+Y+ +A+G    F+SY ++ N G   F  YG
Sbjct  356  SYASGSNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYG  414



>gb|EEE68602.1| hypothetical protein OsJ_27135 [Oryza sativa Japonica Group]
Length=703

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = -1

Query  383  FTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNV  204
            F  Y   NFTNYGS    GAD F  Y+ D+N+  D+FRRY RDS+   D F++Y   GNV
Sbjct  88   FKGYSNANFTNYGSGGVGGADGFSAYSPDLNVVGDSFRRYGRDSTRRVDTFASYEAEGNV  147

Query  203  ADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQN  24
               +F +Y  A  GG+G F  YA D NVP+  FT Y  +A+GR++EF SYS+ AN G   
Sbjct  148  VTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNYDAEANGRRREFTSYSQEANHGSNT  207

Query  23   FTSYGKN  3
            F  YGKN
Sbjct  208  FAGYGKN  214


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 59/131 (45%), Gaps = 6/131 (5%)
 Frame = -1

Query  383  FTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            F SYE +      NFT+Y   +  G+ SF  Y  D N+P  TF  Y  +++     F++Y
Sbjct  138  FASYEAEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNYDAEANGRRREFTSY  197

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
            +   N    +F  YG    G    F  Y  D NV    FT Y +  +G    F +Y +  
Sbjct  198  SQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGATDTFTAYGKEG  257

Query  41   NVGDQNFTSYG  9
            NV D  F SYG
Sbjct  258  NVPDNTFRSYG  268


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 69/148 (47%), Gaps = 11/148 (7%)
 Frame = -1

Query  416  SSLSKHDDNVNFTSYEFQNFT---NYGSHSAAG--------ADSFKNYTVDVNLPVDTFR  270
            S+ + +D   N    EF +++   N+GS++ AG         ++F  Y  D N+    F 
Sbjct  178  STFTNYDAEANGRRREFTSYSQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFT  237

Query  269  RYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSD  90
             Y    +  TD F+ Y   GNV D +F +YG     G   F  Y  + NV +  F +Y+ 
Sbjct  238  NYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASYAK  297

Query  89   DADGRKQEFKSYSENANVGDQNFTSYGK  6
             A+G   EF++Y  + N G   F  YG+
Sbjct  298  GANGNAAEFQNYGGSFNPGTVTFKGYGE  325


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 55/120 (46%), Gaps = 5/120 (4%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG       D+F  Y  + N+P +TFR Y    +A  D F  Y +  NV D SF +Y
Sbjct  236  FTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDSFASY  295

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQ-EFKSYSENANVGDQNFTSYGKN  3
                 G A EF NY    N   + F  Y + ++      FK Y+ + N    +F  Y K+
Sbjct  296  AKGANGNAAEFQNYGGSFNPGTVTFKGYGEGSNPNHHIGFKEYAGSNN----SFKGYAKS  351



>ref|XP_006661124.1| PREDICTED: LOW QUALITY PROTEIN: BURP domain-containing protein 
14-like [Oryza brachyantha]
Length=505

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 105/234 (45%), Gaps = 24/234 (10%)
 Frame = -1

Query  638  SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF  459
            SPFT KA  +RYWN K+ ++ P P FL    SPL+A   A FS +A A +  L +++  F
Sbjct  72   SPFTAKAAFVRYWNRKVHSNRPHPAFLFAKLSPLSAPDAAAFSALAAAGQ--LGSRIRAF  129

Query  458  CSSADLLC-----FPDLSPSSLSKHDD-----------NVNFTSYE------FQNFTNYG  345
            C++A LLC     F   S    S  D            N +FTSYE        NFT+Y 
Sbjct  130  CAAASLLCGGADQFAVYSGGETSPVDSFRRYGKGSQGRNDSFTSYEAGGNVGTANFTSYN  189

Query  344  SHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATA  165
            S +  GA  F  Y  + N    +F  Y  D +  +  F+ Y    N  ++SF  YG    
Sbjct  190  SGATGGAGGFSTYAGETNTASVSFANYDHDGNGRSREFAAYTQDANTGEESFAAYGKTAN  249

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G A  F  Y    N     F  Y D A+G    F SY  N N  +  F SYG +
Sbjct  250  GAAESFKTYGNHSNSIASGFLNYGDRANGAADTFSSYGVNGNTPENTFKSYGTD  303


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 68/146 (47%), Gaps = 11/146 (8%)
 Frame = -1

Query  413  SLSKHDDNVNFTSYEF-----------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRR  267
            S + +D + N  S EF           ++F  YG  +   A+SFK Y    N     F  
Sbjct  212  SFANYDHDGNGRSREFAAYTQDANTGEESFAAYGKTANGAAESFKTYGNHSNSIASGFLN  271

Query  266  YSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDD  87
            Y   ++   D FS+Y   GN  + +F +YG  +  G  +F  Y  D NV N  FT+Y+ +
Sbjct  272  YGDRANGAADTFSSYGVNGNTPENTFKSYGTDSNAGVDDFKGYRDDANVGNDSFTSYASN  331

Query  86   ADGRKQEFKSYSENANVGDQNFTSYG  9
            A+G    F+SY ++ N G   F  YG
Sbjct  332  ANGAAAGFESYGKSVNPGSVTFKGYG  357



>emb|CBI28512.3| unnamed protein product [Vitis vinifera]
Length=125

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = -1

Query  644  GDSPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLP  465
            G++PFTP+A L+RYWN +I + LP+  FL++ ASPL+A + A F+K+A   +N+L+  LP
Sbjct  39   GENPFTPRASLLRYWNKQIGSGLPKSTFLLSKASPLSAVESATFTKLAA--QNALSDNLP  96

Query  464  EFCSSADLLCFPDLSPSSLSKHDDNVNF  381
             FC SA+LLCFPDL   SL KHD + NF
Sbjct  97   AFCKSANLLCFPDLG-QSLEKHDASSNF  123



>gb|EEC84370.1| hypothetical protein OsI_30914 [Oryza sativa Indica Group]
Length=658

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 98/219 (45%), Gaps = 19/219 (9%)
 Frame = -1

Query  638  SPFTPKAYLIRYWNNKISNDLPR-PWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPE  462
            SPFT KA  +RYWN K     PR  W       P +A      S +      S  ++   
Sbjct  64   SPFTAKAAFVRYWNRK-----PRGSW------DPGSARSAPRRSLLCPTTPGSSWSKSSS  112

Query  461  FCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYT-------  303
                A     P               F +YE  NF++YG+    GAD F  Y+       
Sbjct  113  DGDGAAAAAAPAGGGGGGGGGGGAAPFKNYENGNFSSYGNSGGGGADQFAVYSSGQSNGG  172

Query  302  VDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVN  123
                  VD+FRRY + S    D F++Y  GGNV   SF +Y     GGAG F +YA D N
Sbjct  173  GGGGGGVDSFRRYGKGSQGRNDSFTSYEAGGNVGTSSFTSYNGDATGGAGGFSSYAGDAN  232

Query  122  VPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               + F  Y    +GR +EF  Y+++AN G+++F +YGK
Sbjct  233  TVAVSFGNYDHTGNGRSREFSEYTQDANTGEESFVAYGK  271


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 55/133 (41%), Gaps = 6/133 (5%)
 Frame = -1

Query  392  NVNFTSYE------FQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N +FTSYE        +FT+Y   +  GA  F +Y  D N    +F  Y    +  +  F
Sbjct  193  NDSFTSYEAGGNVGTSSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHTGNGRSREF  252

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            S Y    N  ++SF  YG    G A  F  Y    N     F  Y D A+G    F SY 
Sbjct  253  SEYTQDANTGEESFVAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYG  312

Query  50   ENANVGDQNFTSY  12
             + N  +  F SY
Sbjct  313  ASGNTPENTFKSY  325


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F  YG  +   A+SF+ Y    N     F  Y   ++   D FS+Y   GN  + +F 
Sbjct  264  ESFVAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFK  323

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +Y   +  G  +F  Y  D NV N  FT+Y+ +A+G    F+SY ++ N G   F  YG
Sbjct  324  SYASGSNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYG  382



>ref|XP_006659367.1| PREDICTED: BURP domain-containing protein 12-like, partial [Oryza 
brachyantha]
Length=495

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = -1

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            Y+ D+N+  D+FRRY RDS+   D F++Y   GNV   +F +Y     GG G F +YA D
Sbjct  3    YSPDLNVVGDSFRRYGRDSTRRADTFASYEAEGNVVTANFTSYAGGATGGTGAFASYAAD  62

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
             N P+  FT Y  +A+GR++EF SYS+ AN G+  F  YGKN
Sbjct  63   RNGPDPPFTTYDGEANGRRREFTSYSQEANHGENTFAGYGKN  104


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY  +       F  YG +     ++F  Y  + N+    F  Y   ++  TD F+ Y
Sbjct  84   FTSYSQEANHGENTFAGYGKNGNGLRETFTTYGNESNVIASGFANYGESANGATDTFTGY  143

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV D +F +YG     G   F  Y  + NV +  F +Y+  A+G   EF++Y  + 
Sbjct  144  GAEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDTFASYAKGANGNAAEFQNYGGSF  203

Query  41   NVGDQNFTSYGK  6
            N G   F  YG+
Sbjct  204  NPGSVTFKGYGE  215


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 51/118 (43%), Gaps = 0/118 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT Y   +      F +Y+ + N   +TF  Y ++ +   + F+ Y    NV    F  Y
Sbjct  70   FTTYDGEANGRRREFTSYSQEANHGENTFAGYGKNGNGLRETFTTYGNESNVIASGFANY  129

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            G +  G    F  Y  + NVP+  F +Y    +     FK Y   +NVGD  F SY K
Sbjct  130  GESANGATDTFTGYGAEGNVPDNTFRSYGAGGNAGVDTFKGYRSESNVGDDTFASYAK  187



>gb|KHN00353.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=437

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  ATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            ++ GGAGEF  YA + NVPNL FT+YSD+A+GR Q F SYSEN N G+Q FTSYGKN
Sbjct  47   SSTGGAGEFKRYADETNVPNLGFTSYSDNANGRTQSFSSYSENGNAGEQTFTSYGKN  103


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q  T     S  GA  FK Y  + N+P   F  YS +++  T  FS+Y+  GN  +Q+F 
Sbjct  39   QRVTEATVSSTGGAGEFKRYADETNVPNLGFTSYSDNANGRTQSFSSYSENGNAGEQTFT  98

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG    G    F +Y  + NV    F+ Y++ A+     FK Y   AN  D  F++YGK
Sbjct  99   SYGKNGNGPTNVFASYGTESNVVGSGFSNYAETANAANDTFKGYGIAANAADIGFSNYGK  158

Query  5    N  3
            +
Sbjct  159  S  159


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 58/123 (47%), Gaps = 7/123 (6%)
 Frame = -1

Query  392  NVNFTSY------EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
            N+ FTSY        Q+F++Y  +  AG  +F +Y  + N P + F  Y  +S+     F
Sbjct  66   NLGFTSYSDNANGRTQSFSSYSENGNAGEQTFTSYGKNGNGPTNVFASYGTESNVVGSGF  125

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGR-KQEFKSY  54
            SNYA   N A+ +F  YG A       F NY K  N     FT Y+  +DG  K  F SY
Sbjct  126  SNYAETANAANDTFKGYGIAANAADIGFSNYGKSFNEGTDTFTTYAKSSDGETKVGFTSY  185

Query  53   SEN  45
              N
Sbjct  186  GVN  188



>gb|KEH20005.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=374

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 73/141 (52%), Gaps = 24/141 (17%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
            FTPKAY IRYW+  I N+LP+P F+++ ASPL+A   A  +    A  N+L+ +LPEFCS
Sbjct  18   FTPKAYAIRYWDRVIKNNLPKPSFILSKASPLSATDAA--AFEKHAAANTLSTKLPEFCS  75

Query  452  SADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTF  273
            +A L CFP+++P    K                        G + FK Y   V+L     
Sbjct  76   AAHLFCFPNINPQLCRK------------------PVLRGLGTNIFKGYGKGVDLD----  113

Query  272  RRYSRDSSAHTDRFSNYATGG  210
             ++S D+   T+ F +YA  G
Sbjct  114  NKFSFDNYGFTNPFKDYAKRG  134



>gb|EMS64687.1| hypothetical protein TRIUR3_01269 [Triticum urartu]
Length=487

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = -1

Query  329  GADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGE  150
            GA +F  Y+     PVD+F RY + S    D F+ Y   GNV   SF++Y     GGAG+
Sbjct  103  GAGAFAVYSRGQVNPVDSFHRYGKGSLGRNDSFATYQALGNVGTASFNSYTAGATGGAGK  162

Query  149  FGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            F  Y  + N   + F  Y    +GR ++F +Y+++AN G ++FT YG+
Sbjct  163  FAEYDGETNTVAVTFANYDVAGNGRSRDFSAYTQDANSGVESFTGYGR  210


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++FT YG  + +  +SF +Y    N  +  F  Y   +++ TD F +Y   GN    +F 
Sbjct  203  ESFTGYGRTANSVGESFNSYGNHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFR  262

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +Y   + GGA +F  Y  + NV +  FTAY++DA+G   +F+SY ++ N G   F  YG+
Sbjct  263  SYSSGSNGGADDFKGYRDNANVGDDSFTAYANDANGATADFQSYGKSVNPGSVGFKGYGQ  322


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (49%), Gaps = 3/133 (2%)
 Frame = -1

Query  410  LSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRF  231
             +++D   N  +  F N+   G+  +     F  YT D N  V++F  Y R +++  + F
Sbjct  163  FAEYDGETNTVAVTFANYDVAGNGRS---RDFSAYTQDANSGVESFTGYGRTANSVGESF  219

Query  230  SNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYS  51
            ++Y    N    +F  YG         F +Y  + N P   F +YS  ++G   +FK Y 
Sbjct  220  NSYGNHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSGSNGGADDFKGYR  279

Query  50   ENANVGDQNFTSY  12
            +NANVGD +FT+Y
Sbjct  280  DNANVGDDSFTAY  292


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 55/123 (45%), Gaps = 11/123 (9%)
 Frame = -1

Query  386  NFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGN  207
            N T+     F NYG  + +  D+F +Y ++ N P +TFR YS  S+   D F  Y    N
Sbjct  224  NHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSGSNGGADDFKGYRDNAN  283

Query  206  VADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD-----------GRKQEFK  60
            V D SF  Y     G   +F +Y K VN  ++ F  Y   A+           G    FK
Sbjct  284  VGDDSFTAYANDANGATADFQSYGKSVNPGSVGFKGYGQGANPNHRIGFTRYTGDNTTFK  343

Query  59   SYS  51
            +YS
Sbjct  344  AYS  346



>ref|XP_010044626.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
 gb|KCW86719.1| hypothetical protein EUGRSUZ_B03326 [Eucalyptus grandis]
Length=364

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = -1

Query  626  PKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCSSA  447
            PK YL+ YWN +I+N L  P  LI+  SPLT A+ A+F++    D  +L+  L  FC +A
Sbjct  47   PKEYLVHYWNEQITNTLAVPPLLISKVSPLTTAETALFAQFVAKD--ALSDHLLSFCKAA  104

Query  446  DLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGAD  321
             LLCFPDLS   + K D  V      F +F N  +  A G +
Sbjct  105  QLLCFPDLSSHQVGK-DGRV------FYDFINGATTLAGGMN  139



>dbj|BAH57581.1| BURP domain-containing protein [Arabidopsis lyrata]
Length=196

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +S A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +Y
Sbjct  39   FSNYGENSNAANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANVGDDSFASY  98

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +     +F NY K +N  +  FT Y   A+G K  FK+Y++N+   D
Sbjct  99   AKNSNFEKVDFVNYGKSINPGSESFTGYGKGAEGNKIGFKTYTQNSTFKD  148


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  +S+A  D F  Y   GNV   +F 
Sbjct  9    QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENSNAANDTFKGYGGDGNVPRNNFK  68

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY    NV +  F +Y+ +++  K +F +Y ++ N G ++FT YGK
Sbjct  69   SYGASGNAAVDTFLNYRDKANVGDDSFASYAKNSNFEKVDFVNYGKSINPGSESFTGYGK  128


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 43/95 (45%), Gaps = 0/95 (0%)
 Frame = -1

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P  +F  Y ++ +   + FS+Y    NV    F  YG  +      F  Y  D NVP   
Sbjct  7    PGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENSNAANDTFKGYGGDGNVPRNN  66

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            F +Y    +     F +Y + ANVGD +F SY KN
Sbjct  67   FKSYGASGNAAVDTFLNYRDKANVGDDSFASYAKN  101



>dbj|BAH57586.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57587.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57588.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57590.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57591.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57592.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57593.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57594.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57595.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57599.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57601.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57602.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57603.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57604.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57605.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57606.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57607.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +Y
Sbjct  39   FSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSSY  98

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  99   AKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  148


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  9    QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  68

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  69   SYGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  128


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 44/95 (46%), Gaps = 0/95 (0%)
 Frame = -1

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P  +F  Y ++ +   + FS+Y    NV    F  YG         F  Y  D NVP   
Sbjct  7    PGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNN  66

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            F +Y    +     F +Y +NANVGD +F+SY KN
Sbjct  67   FKSYGASGNAAVDTFLNYRDNANVGDDSFSSYAKN  101



>dbj|BAH57597.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +Y
Sbjct  39   FSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSSY  98

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  99   AKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  148


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  9    QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  68

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  69   SYGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  128


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 44/95 (46%), Gaps = 0/95 (0%)
 Frame = -1

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P  +F  Y ++ +   + FS+Y    NV    F  YG         F  Y  D NVP   
Sbjct  7    PGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNN  66

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            F +Y    +     F +Y +NANVGD +F+SY KN
Sbjct  67   FKSYGASGNAAVDTFLNYRDNANVGDDSFSSYAKN  101



>dbj|BAH57589.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +Y
Sbjct  39   FSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSSY  98

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  99   AKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  148


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  9    QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  68

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  69   SYGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  128


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 44/95 (46%), Gaps = 0/95 (0%)
 Frame = -1

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P  +F  Y ++ +   + FS+Y    NV    F  YG         F  Y  D NVP   
Sbjct  7    PGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNN  66

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            F +Y    +     F +Y +NANVGD +F+SY KN
Sbjct  67   FKSYGASGNAAVDTFLNYRDNANVGDDSFSSYAKN  101



>dbj|BAH57598.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57600.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +Y
Sbjct  39   FSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSSY  98

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  99   AKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  148


 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  9    QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  68

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  69   SYGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  128


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 44/95 (46%), Gaps = 0/95 (0%)
 Frame = -1

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P  +F  Y ++ +   + FS+Y    NV    F  YG         F  Y  D NVP   
Sbjct  7    PGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNN  66

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            F +Y    +     F +Y +NANVGD +F+SY KN
Sbjct  67   FKSYGASGNAAVDTFLNYRDNANVGDDSFSSYAKN  101



>dbj|BAH57596.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F+NYG +  A  D+FK Y  D N+P + F+ Y    +A  D F NY    NV D SF +Y
Sbjct  39   FSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGASGNAAVDTFLNYRDNANVGDDSFSSY  98

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               +     +F NY K +N  +  F+ Y   A+G K +FK+Y++N+   D
Sbjct  99   AKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGNKIDFKTYTQNSTFKD  148


 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q+FT+YG +     + F +Y V  N+    F  Y  + +A  D F  Y   GNV   +F 
Sbjct  9    QSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFK  68

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +YG +       F NY  + NV +  F++Y+ +++  K +F +Y ++ N G ++F+ YGK
Sbjct  69   SYGASGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGK  128


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 44/95 (46%), Gaps = 0/95 (0%)
 Frame = -1

Query  287  PVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLR  108
            P  +F  Y ++ +   + FS+Y    NV    F  YG         F  Y  D NVP   
Sbjct  7    PGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNN  66

Query  107  FTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            F +Y    +     F +Y +NANVGD +F+SY KN
Sbjct  67   FKSYGASGNAAVDTFLNYRDNANVGDDSFSSYAKN  101



>ref|XP_010100466.1| hypothetical protein L484_027778 [Morus notabilis]
 gb|EXB82600.1| hypothetical protein L484_027778 [Morus notabilis]
Length=184

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 74/161 (46%), Gaps = 32/161 (20%)
 Frame = -1

Query  482  LAAQLPEFCSSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADS-----  318
            L+ +L  FCSSA+LLC  +L  S L KHD + +F+SY  +NFTNYGS    GADS     
Sbjct  4    LSTRLLGFCSSANLLCSSELGQS-LEKHDKDSSFSSYASKNFTNYGSDRLGGADSAGTGA  62

Query  317  ---------------------FKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVA  201
                                 FK+Y  +     D+F+ Y++DS      F+NY       
Sbjct  63   KTRSVPHSSTTETAPTAGVEEFKSYRENPAQGEDSFQSYAKDSKNEVVTFANYGESFRFG  122

Query  200  DQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADG  78
            + +F +YG    G +  F     D+N    +F  Y+ D  G
Sbjct  123  EDNFTSYGKGATGQSIGF-KVCSDLN----QFKEYTKDKKG  158



>ref|XP_010046641.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=364

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 2/77 (3%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
              PK YL+ YWN +I+N L  P  LI+  SPLT A+ A+F+++   D  +L+     FC 
Sbjct  45   ILPKEYLVHYWNEQITNTLAVPPLLISKVSPLTTAETALFAQLVAKD--ALSDHPLSFCK  102

Query  452  SADLLCFPDLSPSSLSK  402
            +A LLCFPDLS   + K
Sbjct  103  AAQLLCFPDLSSHQVGK  119



>gb|EEE69479.1| hypothetical protein OsJ_28904 [Oryza sativa Japonica Group]
Length=837

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 73/254 (29%), Positives = 100/254 (39%), Gaps = 49/254 (19%)
 Frame = -1

Query  638  SPFTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF  459
            SPFT KA  +RYWN K+ ++ P P F     SPL+A   A FS +A A +  L +++  F
Sbjct  64   SPFTAKAAFVRYWNRKVHSNRPHPAFFFAKLSPLSAPDAAAFSTLAAAGQ--LGSRIRAF  121

Query  458  CSSADLLCFPDLSPSSLSKHDDNVN--------------------------FTSYEFQNF  357
            C++A LLC    +P S      +                            F +YE  NF
Sbjct  122  CAAASLLC--PTTPGSSWSKSSSDGDGAAAAAAPAGGGGGGGGGGDGGAAPFKNYENGNF  179

Query  356  TNYGSHSAAGADSF-------------------KNYTVDVNLPVDTFRRYSRDSSAHTDR  234
            ++YG+    GAD F                    +Y  D N    +F  Y    +  +  
Sbjct  180  SSYGNSGGGGADQFAVYSSGQSNGGGGAAPGAFSSYAGDANTVAVSFGNYDHTGNGRSRE  239

Query  233  FSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY  54
            FS Y    N  ++SF  YG    G A  F  Y    N     F  Y D A+G    F SY
Sbjct  240  FSEYTQDANTGEESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSY  299

Query  53   SENANVGDQNFTSY  12
              + N  +  F SY
Sbjct  300  GASGNTPENTFKSY  313


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++F  YG  +   A+SF+ Y    N     F  Y   ++   D FS+Y   GN  + +F 
Sbjct  252  ESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFK  311

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +Y   +  G  +F  Y  D NV N  FT+Y+ +A+G    F+SY ++ N G   F  YG
Sbjct  312  SYASGSNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYG  370



>gb|EMT26618.1| hypothetical protein F775_18544 [Aegilops tauschii]
Length=560

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            ++FT YG  + +  +SFK+Y    N  +  F  Y   +++ TD F +Y   GN    +F 
Sbjct  38   ESFTGYGKTANSVGESFKSYGNHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFR  97

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            +Y   + GGA +F  Y  + NV +  FT+Y++DA+G   +F+SY ++ N G   F  YG+
Sbjct  98   SYSSGSNGGADDFKGYRDNANVGDDSFTSYANDANGATADFQSYGKSVNPGSVGFKGYGQ  157


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = -1

Query  386  NFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGN  207
            N T+     F NYG  + +  D+F +Y ++ N P +TFR YS  S+   D F  Y    N
Sbjct  59   NHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSGSNGGADDFKGYRDNAN  118

Query  206  VADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDAD  81
            V D SF +Y     G   +F +Y K VN  ++ F  Y   A+
Sbjct  119  VGDDSFTSYANDANGATADFQSYGKSVNPGSVGFKGYGQGAN  160


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (51%), Gaps = 0/99 (0%)
 Frame = -1

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            Y  D N  V++F  Y + +++  + F +Y    N    +F  YG         F +Y  +
Sbjct  29   YIADANSGVESFTGYGKTANSVGESFKSYGNHTNSIMSAFINYGDKANSATDTFDSYGLN  88

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
             N P   F +YS  ++G   +FK Y +NANVGD +FTSY
Sbjct  89   GNTPQNTFRSYSSGSNGGADDFKGYRDNANVGDDSFTSY  127


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 50/101 (50%), Gaps = 0/101 (0%)
 Frame = -1

Query  308  YTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKD  129
            +    + P +   +   +S      F +Y   GN    +F +Y   + GGA +F  Y  +
Sbjct  232  FAAGADFPSEKKHKTLAESDTIITTFDSYGLNGNTPQNNFRSYSSGSNGGADDFKGYRDN  291

Query  128  VNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
             NV +  FT+Y++DA+G   +F+SY ++ N G   F  YG+
Sbjct  292  ANVGDDSFTSYANDANGTAADFQSYGKSVNPGSVAFKGYGQ  332



>ref|XP_010044627.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010044628.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X2 [Eucalyptus grandis]
Length=372

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
             +PKAYL+ YWN +I+N+LP+P  L   ASPLTAA   +F+++    + +++  L  FC 
Sbjct  47   ISPKAYLVHYWNKQITNNLPKPPILFTKASPLTAASATIFAELVA--KGAISDHLLSFCE  104

Query  452  SADLLCFPDLSPSSLSKHDDNVNFTSY  372
             A LLCF + S   ++K  D   +  Y
Sbjct  105  EAQLLCFMNSSSYGVAKTIDAQLYKVY  131



>ref|XP_010046648.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=383

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
             +PKAYL+ YWN +I+N+LP+P  L + ASPLTAA   +F+++    + +++  L  FC 
Sbjct  47   ISPKAYLVHYWNKQITNNLPKPPILFSKASPLTAASATIFAELVA--KGAISDHLLSFCE  104

Query  452  SADLLCF  432
             A LLCF
Sbjct  105  EAQLLCF  111



>ref|XP_010936822.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=615

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 119/210 (57%), Gaps = 9/210 (4%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEF-C  456
            FT KA  +RYW+ K  +  P P FL++  SPL+       S    +  +S    LP F C
Sbjct  30   FTAKAAALRYWHRKNPHHRPLPPFLLSKLSPLSPLS----SAALSSALSSATTPLPSFLC  85

Query  455  SSADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTNYGSHSAAGADSFKNYTVDVNLPVDT  276
            S+A LLC    S S  +      +F++Y   NF++YG   + G D+FK Y+ D N   D+
Sbjct  86   SAAHLLC----SSSHSTSPPSPSDFSNYNHANFSSYGDSLSGGRDAFKIYSSDANTAADS  141

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            F RYS  SS+  D FS+Y++  N+A  SF +Y  A++G +G F +YA   NVP+LRF++Y
Sbjct  142  FHRYSLRSSSRPDSFSSYSSDANIAGASFSSYAAASSGASGSFSSYAASANVPDLRFSSY  201

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
               A  R + F SYS  +N G Q F+SYG+
Sbjct  202  DPAAVHRPRTFSSYSSESNSGGQRFSSYGQ  231


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = -1

Query  365  QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFH  186
            Q F++YG  + A   +F  Y  D N+    F  YS  ++A  D FS+Y +  N    +F 
Sbjct  224  QRFSSYGQRATASPATFTTYATDANVLGTGFAAYSEAATAANDTFSSYGSLTNRPSNTFR  283

Query  185  TYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            TYG   +GG   F  Y +  N  +  F +Y+      + +F +Y  + N G  +F  YG+
Sbjct  284  TYGDGASGGVESFATYRERANTGDDTFRSYAKHGTAARADFLNYGASFNPGSDSFNGYGE  343



>ref|XP_010046642.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=367

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 9/94 (10%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
             +PKAYL+ YWN +I+N+LP+P  L + ASPLT A   +F+++    + +++  L  FC 
Sbjct  40   ISPKAYLVHYWNKQITNNLPKPPILFSKASPLTTASATIFAELVA--KGAISDHLLSFCE  97

Query  452  SADLLCFPDLSPSSLSKHDDNVNFTSYEFQNFTN  351
             A LLCF       ++   D V  T+ +  ++TN
Sbjct  98   EAQLLCF-------MNSSSDGVARTNAQVYSYTN  124



>ref|XP_010046646.1| PREDICTED: BURP domain-containing protein 16-like [Eucalyptus 
grandis]
Length=538

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -1

Query  632  FTPKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCS  453
             +PKAYL+ YWN +I+N+LP+P  L + ASPLTAA   +F+++    + +++  L  FC 
Sbjct  40   ISPKAYLVHYWNKQITNNLPKPPILFSKASPLTAASATIFAELVA--KGAISDHLLSFCE  97

Query  452  SADLLCF  432
             A LLCF
Sbjct  98   EAQLLCF  104


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -1

Query  626  PKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCSSA  447
            PK YL+RYW  +I+++   P  L +  SPL AA+  +F+++    +++++ +L  FC +A
Sbjct  396  PKEYLVRYWTEQITSNPAIPPLLTSKVSPLIAAETTLFAQLVA--KSAISDRLSSFCRAA  453

Query  446  DLLCFP  429
             LLCFP
Sbjct  454  QLLCFP  459



>gb|EMS58973.1| hypothetical protein TRIUR3_16136 [Triticum urartu]
Length=514

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 6/134 (4%)
 Frame = -1

Query  386  NFTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSN  225
             FTSY  +      +F  YG  + +  ++F +Y  D N     F  Y   ++  TD F+ 
Sbjct  107  GFTSYSQEANHGESSFAGYGKSANSLRETFTSYGGDTNTLSSGFANYGESANGATDTFTG  166

Query  224  YATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            Y   GNV + +F +YG     G   F  Y  D NV +  F +Y+  A+G   EF+SY  +
Sbjct  167  YGVEGNVPENTFRSYGAGGNAGVDTFKGYRGDANVGDDSFASYAKGANGGAAEFQSYGGS  226

Query  44   ANVGDQNFTSYGKN  3
            AN G   F  YG+ 
Sbjct  227  ANQGSVAFKGYGEG  240


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (46%), Gaps = 0/123 (0%)
 Frame = -1

Query  371  EFQNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQS  192
            E + FTNY + +      F +Y+ + N    +F  Y + +++  + F++Y    N     
Sbjct  90   ETRQFTNYDAGANGRTRGFTSYSQEANHGESSFAGYGKSANSLRETFTSYGGDTNTLSSG  149

Query  191  FHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSY  12
            F  YG +  G    F  Y  + NVP   F +Y    +     FK Y  +ANVGD +F SY
Sbjct  150  FANYGESANGATDTFTGYGVEGNVPENTFRSYGAGGNAGVDTFKGYRGDANVGDDSFASY  209

Query  11   GKN  3
             K 
Sbjct  210  AKG  212



>gb|KHN27019.1| Putative polygalacturonase non-catalytic subunit [Glycine soja]
Length=253

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 0/92 (0%)
 Frame = -1

Query  278  TFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTA  99
            TF+ Y ++     + F+ Y T  NVA   F  YG   A     F NY  ++NVP + F +
Sbjct  43   TFQSYRKNFVGSGNEFTGYGTNSNVATLGFTNYGKGDASPNNTFTNYDMEMNVPEVMFKS  102

Query  98   YSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            Y+D   G  + F +Y + ANVGD +F SY KN
Sbjct  103  YTDGTHGGTKSFVNYRDQANVGDDSFQSYAKN  134


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 3/121 (2%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FTNYG   A+  ++F NY +++N+P   F+ Y+  +   T  F NY    NV D SF +Y
Sbjct  72   FTNYGKGDASPNNTFTNYDMEMNVPEVMFKSYTDGTHGGTKSFVNYRDQANVGDDSFQSY  131

Query  179  GPATAGGAG-EFGNYAKDVNVPNLRFTAYS--DDADGRKQEFKSYSENANVGDQNFTSYG  9
               T  G   +F NY    N  +  F  Y+  ++ D + +     S+N+++      S G
Sbjct  132  AKNTKEGTQVDFKNYGNSFNPGSNTFKGYAKGEEWDHKLKHVLHVSDNSSMDKIIMDSLG  191

Query  8    K  6
            +
Sbjct  192  E  192


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 1/119 (1%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            F +Y  +     + F  Y  + N+    F  Y +  ++  + F+NY    NV +  F +Y
Sbjct  44   FQSYRKNFVGSGNEFTGYGTNSNVATLGFTNYGKGDASPNNTFTNYDMEMNVPEVMFKSY  103

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDA-DGRKQEFKSYSENANVGDQNFTSYGK  6
               T GG   F NY    NV +  F +Y+ +  +G + +FK+Y  + N G   F  Y K
Sbjct  104  TDGTHGGTKSFVNYRDQANVGDDSFQSYAKNTKEGTQVDFKNYGNSFNPGSNTFKGYAK  162



>gb|EMT30231.1| hypothetical protein F775_20363 [Aegilops tauschii]
Length=444

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 6/134 (4%)
 Frame = -1

Query  386  NFTSYEFQ------NFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSN  225
             FTSY  +      +F  YG  + +  ++F +Y  D N     F  Y   ++  TD F+ 
Sbjct  58   GFTSYSQEANHGESSFAGYGKSANSLRETFTSYGGDTNTLSSGFANYGESANGATDTFTG  117

Query  224  YATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSEN  45
            Y   GNV + +F +YG     G   F  Y  D NV +  F +Y+  A+G   EF+SY  +
Sbjct  118  YGVEGNVPENTFRSYGAGGNAGVDTFKGYRDDANVGDDSFASYAKGANGGAAEFQSYGGS  177

Query  44   ANVGDQNFTSYGKN  3
             N G   F  YG+ 
Sbjct  178  GNQGSVAFKGYGEG  191


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  212  GNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVG  33
            GNV   +F +Y     GG+G F  YA D NVP  +FT Y   A+GR + F SYS+ AN G
Sbjct  10   GNVVTANFPSYAGGATGGSGSFTAYAADTNVPESKFTNYDAGANGRTRGFTSYSQEANHG  69

Query  32   DQNFTSYGKN  3
            + +F  YGK+
Sbjct  70   ESSFAGYGKS  79



>gb|AEN81140.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81141.1| AT1G60390-like protein, partial [Capsella rubella]
Length=171

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            GG+GEF +Y  + N PN  FT+YSD A+GR Q F SYS N N G+Q FTSY KN
Sbjct  1    GGSGEFASYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKN  54


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F +Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  20   FTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKY  79

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  80   GENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  138


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = -1

Query  332  AGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG  153
             G+  F +Y  + N P   F  YS  ++  +  F++Y+  GN  +Q+F +Y     G   
Sbjct  1    GGSGEFASYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPN  60

Query  152  EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +F  Y    NV    FT Y ++ +G    F SY  N NV   +F  YG
Sbjct  61   DFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYG  108


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 61/132 (46%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y
Sbjct  34   FTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSY  93

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV    F  YG    G    F NY    N+    F++Y+ +++  K  F +YS++ 
Sbjct  94   GGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFINYSKSF  153

Query  41   NVGDQNFTSYGK  6
            N+G  NFT YG+
Sbjct  154  NLGSDNFTGYGQ  165



>gb|AEN81138.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            GG+GEF +Y  + N PN  FT+YSD A+GR Q F SYS N N G+Q FTSY KN
Sbjct  1    GGSGEFASYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKN  54


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F +Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  20   FTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKY  79

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y    +G    FK+Y + +N+G  +F+SY KN
Sbjct  80   GENGNGANDSFTSYGGNXNVPVNDFKGYGXGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  138


 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = -1

Query  332  AGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG  153
             G+  F +Y  + N P   F  YS  ++  +  F++Y+  GN  +Q+F +Y     G   
Sbjct  1    GGSGEFASYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPN  60

Query  152  EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +F  Y    NV    FT Y ++ +G    F SY  N NV   +F  YG
Sbjct  61   DFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNXNVPVNDFKGYG  108


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 59/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y
Sbjct  34   FTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSY  93

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
                NV    F  YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ 
Sbjct  94   GGNXNVPVNDFKGYGXGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSF  153

Query  41   NVGDQNFTSYGK  6
            N+G  NFT YG+
Sbjct  154  NLGSDNFTGYGQ  165



>gb|AEN81134.1| AT1G60390-like protein, partial [Capsella grandiflora]
 gb|AEN81135.1| AT1G60390-like protein, partial [Capsella grandiflora]
 gb|AEN81142.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81143.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81144.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81145.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81146.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81147.1| AT1G60390-like protein, partial [Capsella rubella]
Length=171

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            GG+GEF +Y  + N PN  FT+YSD A+GR Q F SYS N N G+Q FTSY KN
Sbjct  1    GGSGEFASYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKN  54


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F +Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  20   FTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKY  79

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  80   GENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  138


 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = -1

Query  332  AGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG  153
             G+  F +Y  + N P   F  YS  ++  +  F++Y+  GN  +Q+F +Y     G   
Sbjct  1    GGSGEFASYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPN  60

Query  152  EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +F  Y    NV    FT Y ++ +G    F SY  N NV   +F  YG
Sbjct  61   DFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYG  108


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 60/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y
Sbjct  34   FTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSY  93

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV    F  YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ 
Sbjct  94   GGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSF  153

Query  41   NVGDQNFTSYGK  6
            N+G  NFT YG+
Sbjct  154  NLGSDNFTGYGQ  165



>gb|AEN81137.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            GG+GEF +Y  + N PN  FT+YSD A+GR Q F SYS N N G+Q FTSY KN
Sbjct  1    GGSGEFTSYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKN  54


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F +Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  20   FTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKY  79

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y    +G    FK+Y + +N+G  +F+SY KN
Sbjct  80   GENGNGANDSFTSYGGNXNVPVNDFKGYGXGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  138


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = -1

Query  332  AGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG  153
             G+  F +Y  + N P   F  YS  ++  +  F++Y+  GN  +Q+F +Y     G   
Sbjct  1    GGSGEFTSYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPN  60

Query  152  EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +F  Y    NV    FT Y ++ +G    F SY  N NV   +F  YG
Sbjct  61   DFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNXNVPVNDFKGYG  108


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 59/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y
Sbjct  34   FTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSY  93

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
                NV    F  YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ 
Sbjct  94   GGNXNVPVNDFKGYGXGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSF  153

Query  41   NVGDQNFTSYGK  6
            N+G  NFT YG+
Sbjct  154  NLGSDNFTGYGQ  165



>gb|AEN81136.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            GG+GEF +Y  + N PN  FT+YSD A+GR Q F SYS N N G+Q FTSY KN
Sbjct  1    GGSGEFTSYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKN  54


 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F +Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  20   FTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKY  79

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  80   GENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  138


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = -1

Query  332  AGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG  153
             G+  F +Y  + N P   F  YS  ++  +  F++Y+  GN  +Q+F +Y     G   
Sbjct  1    GGSGEFTSYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPN  60

Query  152  EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +F  Y    NV    FT Y ++ +G    F SY  N NV   +F  YG
Sbjct  61   DFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYG  108


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 60/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y
Sbjct  34   FTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSY  93

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV    F  YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ 
Sbjct  94   GGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSF  153

Query  41   NVGDQNFTSYGK  6
            N+G  NFT YG+
Sbjct  154  NLGSDNFTGYGQ  165



>gb|AEN81139.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT+Y   +   + +F +Y+ + N    TF  YS++ +   + FS Y TG NV    F  Y
Sbjct  20   FTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKY  79

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            G    G    F +Y  + NVP   F  Y D  +G    FK+Y + +N+G  +F+SY KN
Sbjct  80   GENGNGANDSFTSYGGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKN  138


 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  GGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYGKN  3
            GG+G F +Y  + N PN  FT+YSD A+GR Q F SYS N N G+Q FTSY KN
Sbjct  1    GGSGXFXSYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKN  54


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = -1

Query  332  AGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAG  153
             G+  F +Y  + N P   F  YS  ++  +  F++Y+  GN  +Q+F +Y     G   
Sbjct  1    GGSGXFXSYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGAPN  60

Query  152  EFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +F  Y    NV    FT Y ++ +G    F SY  N NV   +F  YG
Sbjct  61   DFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYG  108


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 60/132 (45%), Gaps = 6/132 (5%)
 Frame = -1

Query  383  FTSYEF------QNFTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNY  222
            FTSY        Q FT+Y  +     + F  Y    N+    F +Y  + +   D F++Y
Sbjct  34   FTSYSGNGNTGEQTFTSYSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSY  93

Query  221  ATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENA  42
               GNV    F  YG    G    F NY    N+    F++Y+ +++  K  F +Y ++ 
Sbjct  94   GGNGNVPVNDFKGYGDGGNGAVYGFKNYRDQSNIGVDSFSSYAKNSNXEKVNFVNYGKSF  153

Query  41   NVGDQNFTSYGK  6
            N+G  NFT YG+
Sbjct  154  NLGSDNFTGYGQ  165



>ref|XP_008348846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=154

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = -1

Query  359  FTNYGSHSAAGADSFKNYTVDVNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTY  180
            FT YG       D F NY  D N   + F+ Y    +A  + F++Y    NV D SF +Y
Sbjct  7    FTGYGQSGNEANDKFSNYGNDQNNSANNFQSYGDGGNAGVETFTSYRESANVGDDSFQSY  66

Query  179  GPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSYSENANVGD  30
               + G   +F +Y K  N+ +  FT Y   A G+  EFK Y  N    D
Sbjct  67   AKNSNGEKMDFTSYGKSFNIGSDTFTGYRKGAKGQDIEFKIYGMNTTFKD  116


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = -1

Query  275  FRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAY  96
            F  Y +  +   D+FSNY    N +  +F +YG     G   F +Y +  NV +  F +Y
Sbjct  7    FTGYGQSGNEANDKFSNYGNDQNNSANNFQSYGDGGNAGVETFTSYRESANVGDDSFQSY  66

Query  95   SDDADGRKQEFKSYSENANVGDQNFTSYGK  6
            + +++G K +F SY ++ N+G   FT Y K
Sbjct  67   AKNSNGEKMDFTSYGKSFNIGSDTFTGYRK  96



>ref|XP_010100467.1| hypothetical protein L484_027779 [Morus notabilis]
 gb|EXB82601.1| hypothetical protein L484_027779 [Morus notabilis]
Length=217

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 16/82 (20%)
 Frame = -1

Query  203  ADQSFHTYGPATAGGAGEFGNYAKDVNVPNLRFTAYSDDADGRKQEFKSY----------  54
             ++ F TYG  +  G G+F  Y    NVP L FT+YS  + GRKQ FKSY          
Sbjct  8    VNKGFSTYGTGSTKGTGDFKKYTDSANVPELHFTSYSARSGGRKQNFKSYSGRSILLTPK  67

Query  53   ------SENANVGDQNFTSYGK  6
                  SE+ + G+ NFTS+GK
Sbjct  68   PRIQRTSESFSFGEDNFTSFGK  89



>ref|XP_010044635.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Eucalyptus grandis]
Length=358

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -1

Query  626  PKAYLIRYWNNKISNDLPRPWFLINMASPLTAAQYAVFSKIAKADRNSLAAQLPEFCSSA  447
            PK Y +RYW  +I+++   P  LI+  SPLTAA+  +F+++    + +++ +L  FC +A
Sbjct  47   PKEYFVRYWTEQITSNPAIPPLLISKVSPLTAAETTLFAQLVA--KGAISDRLSSFCRAA  104

Query  446  DLLCFP  429
             LLCFP
Sbjct  105  QLLCFP  110



>gb|KHN27021.1| Putative polygalacturonase non-catalytic subunit [Glycine soja]
Length=340

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (48%), Gaps = 0/96 (0%)
 Frame = -1

Query  296  VNLPVDTFRRYSRDSSAHTDRFSNYATGGNVADQSFHTYGPATAGGAGEFGNYAKDVNVP  117
            +N P +TF+ Y+  +   T  FSNY    NV   SF +Y   T G   +F NY    N  
Sbjct  1    MNNPTETFQSYADGTVGGTQSFSNYRDQANVGADSFQSYAKNTLGSEADFKNYGNSFNPG  60

Query  116  NLRFTAYSDDADGRKQEFKSYSENANVGDQNFTSYG  9
            +  F  Y+  A+  K  F +YS N N   +++  +G
Sbjct  61   SDTFKGYAKGAEDNKVGFTTYSANTNATFKDYAKHG  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1321621760038