BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11584_g1_i1 len=1922 path=[1:0-871 873:872-1921]

Length=1922
                                                                      Score     E

ref|XP_009605826.1|  PREDICTED: uncharacterized protein LOC104100317    620   0.0      
ref|XP_009773950.1|  PREDICTED: uncharacterized protein LOC104224082    617   0.0      
ref|XP_006344017.1|  PREDICTED: uncharacterized protein LOC102582487    566   0.0      
ref|XP_010325669.1|  PREDICTED: uncharacterized protein LOC101257885    553   0.0      
ref|XP_002272534.1|  PREDICTED: uncharacterized protein LOC100257079    499   4e-166   Vitis vinifera
emb|CBI34404.3|  unnamed protein product                                499   7e-166   
ref|XP_004168760.1|  PREDICTED: uncharacterized protein LOC101223816    484   1e-160   
ref|XP_008467257.1|  PREDICTED: uncharacterized protein LOC103504654    479   1e-158   
ref|XP_002272386.2|  PREDICTED: uncharacterized protein LOC100250178    476   2e-157   Vitis vinifera
ref|XP_010053198.1|  PREDICTED: uncharacterized protein LOC104441706    475   5e-157   
ref|XP_002272422.2|  PREDICTED: uncharacterized protein LOC100245045    472   6e-156   Vitis vinifera
gb|KGN50395.1|  hypothetical protein Csa_5G171770                       472   9e-156   
ref|XP_008810943.1|  PREDICTED: uncharacterized protein LOC103722247    469   1e-154   
ref|XP_007159232.1|  hypothetical protein PHAVU_002G220300g             468   2e-154   
gb|KGN50394.1|  hypothetical protein Csa_5G171760                       467   6e-154   
ref|XP_002509879.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    466   2e-153   Ricinus communis
ref|XP_006439449.1|  hypothetical protein CICLE_v10023534mg             462   3e-152   
ref|XP_011080894.1|  PREDICTED: uncharacterized protein LOC105164044    457   4e-152   
gb|EYU23409.1|  hypothetical protein MIMGU_mgv1a004243mg                460   3e-151   
gb|KHN45741.1|  Endoglucanase                                           459   4e-151   
gb|EYU23411.1|  hypothetical protein MIMGU_mgv1a004205mg                459   8e-151   
ref|XP_003608279.1|  Endoglucanase                                      458   1e-150   
gb|EYU23408.1|  hypothetical protein MIMGU_mgv1a020519mg                458   1e-150   
ref|XP_008459280.1|  PREDICTED: uncharacterized protein LOC103498458    463   6e-150   
ref|XP_004170746.1|  PREDICTED: endoglucanase E1-like                   454   6e-149   
gb|KGN45940.1|  hypothetical protein Csa_6G028440                       454   1e-148   
ref|XP_002272454.2|  PREDICTED: uncharacterized protein LOC100267...    449   2e-146   Vitis vinifera
ref|XP_011080895.1|  PREDICTED: uncharacterized protein LOC105164045    445   2e-145   
ref|XP_004510834.1|  PREDICTED: uncharacterized protein LOC101496378    445   2e-145   
ref|XP_010916958.1|  PREDICTED: uncharacterized protein LOC105041671    442   5e-145   
emb|CBI34407.3|  unnamed protein product                                440   3e-144   
ref|XP_004143723.1|  PREDICTED: uncharacterized protein LOC101213113    442   4e-144   
gb|EYU23410.1|  hypothetical protein MIMGU_mgv1a004297mg                441   8e-144   
emb|CDP12092.1|  unnamed protein product                                451   1e-142   
ref|XP_002272491.1|  PREDICTED: uncharacterized protein LOC100262188    437   3e-142   Vitis vinifera
ref|XP_008467306.1|  PREDICTED: uncharacterized protein LOC103504686    435   2e-141   
gb|KEH18775.1|  hydrolyzing O-glycosyl compounds hydrolase              433   7e-141   
ref|XP_002509877.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    433   1e-140   Ricinus communis
gb|KDP25366.1|  hypothetical protein JCGZ_20522                         431   6e-140   
gb|KDP25365.1|  hypothetical protein JCGZ_20521                         443   1e-139   
gb|KDP26669.1|  hypothetical protein JCGZ_17827                         430   4e-139   
emb|CBI34405.3|  unnamed protein product                                437   2e-137   
gb|AES77604.2|  hydrolyzing O-glycosyl compounds hydrolase              424   2e-137   
gb|ABR17494.1|  unknown                                                 421   9e-136   Picea sitchensis
ref|XP_004245178.1|  PREDICTED: uncharacterized protein LOC101258288    421   1e-135   
ref|XP_008221942.1|  PREDICTED: uncharacterized protein LOC103321869    421   2e-135   
ref|XP_007223308.1|  hypothetical protein PRUPE_ppa003807mg             419   3e-135   
ref|XP_003621369.1|  Endoglucanase E1                                   418   4e-135   
gb|KGN57438.1|  hypothetical protein Csa_3G185670                       414   1e-134   
ref|XP_006367511.1|  PREDICTED: uncharacterized protein LOC102589547    418   1e-134   
gb|AES77610.2|  hydrolyzing O-glycosyl compounds hydrolase              416   2e-134   
emb|CDP16213.1|  unnamed protein product                                414   2e-134   
ref|XP_003621392.1|  Endoglucanase E1                                   416   3e-134   
ref|XP_011034023.1|  PREDICTED: uncharacterized protein LOC105132312    416   2e-133   
emb|CDP13254.1|  unnamed protein product                                414   3e-133   
gb|KHG05074.1|  Endoglucanase                                           414   4e-133   
ref|XP_007044872.1|  Cellulase protein                                  413   1e-132   
ref|XP_008236799.1|  PREDICTED: uncharacterized protein LOC103335561    412   1e-132   
ref|XP_011042367.1|  PREDICTED: uncharacterized protein LOC105138074    413   1e-132   
ref|XP_002515055.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    412   4e-132   Ricinus communis
ref|XP_009765489.1|  PREDICTED: uncharacterized protein LOC104217035    411   8e-132   
ref|XP_010904543.1|  PREDICTED: uncharacterized protein LOC105031942    410   2e-131   
ref|XP_010100346.1|  hypothetical protein L484_027655                   410   2e-131   
ref|XP_011042368.1|  PREDICTED: uncharacterized protein LOC105138075    409   3e-131   
ref|XP_002312657.2|  hypothetical protein POPTR_0008s18380g             409   3e-131   Populus trichocarpa [western balsam poplar]
gb|KDO82151.1|  hypothetical protein CISIN_1g008330mg                   407   2e-130   
ref|XP_008793719.1|  PREDICTED: uncharacterized protein LOC103709945    406   2e-130   
ref|XP_006438205.1|  hypothetical protein CICLE_v10031098mg             407   3e-130   
ref|XP_006483983.1|  PREDICTED: uncharacterized protein LOC102624331    407   3e-130   
ref|XP_009359244.1|  PREDICTED: uncharacterized protein LOC103949843    405   1e-129   
gb|EEE61202.1|  hypothetical protein OsJ_15212                          404   5e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682344.1|  PREDICTED: uncharacterized protein LOC104897211    403   6e-129   
ref|XP_010248702.1|  PREDICTED: uncharacterized protein LOC104591536    402   1e-128   
ref|XP_009385963.1|  PREDICTED: uncharacterized protein LOC103973...    402   2e-128   
ref|XP_004309996.1|  PREDICTED: endoglucanase-like                      402   2e-128   
ref|XP_009385956.1|  PREDICTED: uncharacterized protein LOC103973...    402   3e-128   
gb|EEC77495.1|  hypothetical protein OsI_16343                          402   3e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_003524249.1|  PREDICTED: uncharacterized protein LOC100789885    402   3e-128   
ref|XP_004239150.1|  PREDICTED: uncharacterized protein LOC101248575    401   7e-128   
ref|XP_003539156.1|  PREDICTED: uncharacterized protein LOC100816102    400   8e-128   
gb|EPS62091.1|  hypothetical protein M569_12701                         399   1e-127   
ref|XP_010250986.1|  PREDICTED: uncharacterized protein LOC104593039    400   2e-127   
ref|XP_004135502.1|  PREDICTED: uncharacterized protein LOC101217177    399   2e-127   
gb|KGN51727.1|  hypothetical protein Csa_5G593400                       399   3e-127   
ref|XP_008446127.1|  PREDICTED: uncharacterized protein LOC103488945    398   7e-127   
gb|KEH20742.1|  cellulase (glycosyl hydrolase family 5)                 398   7e-127   
ref|XP_004504142.1|  PREDICTED: uncharacterized protein LOC101503968    397   1e-126   
gb|KEH28356.1|  hydrolyzing O-glycosyl compounds hydrolase              395   2e-126   
gb|KHN29014.1|  Endoglucanase                                           395   4e-126   
ref|XP_008389746.1|  PREDICTED: uncharacterized protein LOC103452050    394   1e-125   
ref|XP_010044528.1|  PREDICTED: uncharacterized protein LOC104433472    395   1e-125   
emb|CAD41090.2|  OSJNBb0011N17.7                                        394   2e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975985.1|  PREDICTED: uncharacterized protein LOC101760765    394   2e-125   
ref|XP_003532808.1|  PREDICTED: uncharacterized protein LOC100818309    395   2e-125   
emb|CAH67677.1|  H0510A06.2                                             393   7e-125   Oryza sativa [red rice]
ref|XP_002876948.1|  glycosyl hydrolase family 5 protein                391   7e-125   
ref|XP_010691763.1|  PREDICTED: uncharacterized protein LOC104905020    392   9e-125   
ref|XP_004504189.1|  PREDICTED: uncharacterized protein LOC101490831    390   3e-124   
ref|XP_011086688.1|  PREDICTED: uncharacterized protein LOC105168334    392   3e-124   
ref|XP_007159685.1|  hypothetical protein PHAVU_002G258500g             390   7e-124   
gb|KDP25367.1|  hypothetical protein JCGZ_20523                         387   1e-123   
ref|XP_008445780.1|  PREDICTED: uncharacterized protein LOC103488703    385   2e-123   
ref|XP_010249431.1|  PREDICTED: uncharacterized protein LOC104591975    388   3e-123   
ref|XP_002285424.1|  PREDICTED: uncharacterized protein LOC100244027    388   4e-123   Vitis vinifera
gb|KHN06534.1|  Endoglucanase                                           389   4e-123   
gb|EYU30606.1|  hypothetical protein MIMGU_mgv1a018920mg                385   1e-122   
gb|KGN50047.1|  hypothetical protein Csa_5G151630                       386   1e-122   
ref|XP_010026595.1|  PREDICTED: uncharacterized protein LOC104416964    386   2e-122   
ref|XP_010425288.1|  PREDICTED: uncharacterized protein LOC104710406    385   4e-122   
gb|KCW59699.1|  hypothetical protein EUGRSUZ_H02457                     384   6e-122   
ref|XP_007135020.1|  hypothetical protein PHAVU_010G095100g             383   1e-121   
ref|XP_010502524.1|  PREDICTED: uncharacterized protein LOC104779826    384   1e-121   
ref|XP_006292902.1|  hypothetical protein CARUB_v10019167mg             383   1e-121   
emb|CDX83590.1|  BnaC07g23300D                                          384   2e-121   
ref|XP_010556350.1|  PREDICTED: uncharacterized protein LOC104825676    383   4e-121   
ref|XP_010556349.1|  PREDICTED: uncharacterized protein LOC104825675    383   5e-121   
ref|XP_006395581.1|  hypothetical protein EUTSA_v10003934mg             382   8e-121   
ref|XP_010240029.1|  PREDICTED: uncharacterized protein LOC100839976    382   9e-121   
ref|XP_004143963.1|  PREDICTED: uncharacterized protein LOC101211910    381   1e-120   
ref|XP_010250979.1|  PREDICTED: uncharacterized protein LOC104593...    381   1e-120   
ref|XP_008389747.1|  PREDICTED: uncharacterized protein LOC103452051    381   2e-120   
gb|AAD31066.1|AC007357_15  F3F19.15                                     380   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249430.1|  PREDICTED: uncharacterized protein LOC104591974    380   4e-120   
ref|XP_008437728.1|  PREDICTED: uncharacterized protein LOC103483074    378   5e-120   
ref|XP_009152075.1|  PREDICTED: uncharacterized protein LOC103875317    380   5e-120   
ref|XP_004955049.1|  PREDICTED: uncharacterized protein LOC101776534    380   7e-120   
ref|XP_007132485.1|  hypothetical protein PHAVU_011G098000g             379   7e-120   
ref|NP_172772.2|  Cellulase (glycosyl hydrolase family 5) protein       379   8e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189245.1|  Cellulase (glycosyl hydrolase family 5) protein       377   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395580.1|  hypothetical protein EUTSA_v10003968mg             378   2e-119   
ref|XP_002446674.1|  hypothetical protein SORBIDRAFT_06g020260          378   3e-119   Sorghum bicolor [broomcorn]
emb|CDY13613.1|  BnaA06g33100D                                          378   3e-119   
ref|XP_002298005.2|  hypothetical protein POPTR_0001s10020g             377   3e-119   Populus trichocarpa [western balsam poplar]
dbj|BAK05121.1|  predicted protein                                      378   3e-119   
ref|XP_008437726.1|  PREDICTED: uncharacterized protein LOC103483073    376   6e-119   
ref|XP_010502521.1|  PREDICTED: uncharacterized protein LOC104779823    377   1e-118   
ref|XP_006652422.1|  PREDICTED: uncharacterized protein LOC102702088    375   1e-118   
ref|XP_009152076.1|  PREDICTED: uncharacterized protein LOC103875318    376   2e-118   
gb|EAY86525.1|  hypothetical protein OsI_07905                          377   2e-118   Oryza sativa Indica Group [Indian rice]
ref|NP_189244.1|  Cellulase (glycosyl hydrolase family 5) protein       375   3e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AIZ06017.1|  hypothetical protein                                    375   3e-118   
ref|XP_002876947.1|  predicted protein                                  375   3e-118   
ref|XP_007159684.1|  hypothetical protein PHAVU_002G258400g             376   4e-118   
ref|XP_006307168.1|  hypothetical protein CARUB_v10008758mg             375   5e-118   
ref|XP_006290844.1|  hypothetical protein CARUB_v10016955mg             375   6e-118   
ref|XP_011026965.1|  PREDICTED: uncharacterized protein LOC105127394    374   6e-118   
ref|XP_006417151.1|  hypothetical protein EUTSA_v10007253mg             375   7e-118   
dbj|BAB02432.1|  unnamed protein product                                374   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793758.1|  PREDICTED: uncharacterized protein LOC103709981    374   1e-117   
ref|XP_010495004.1|  PREDICTED: uncharacterized protein LOC104772051    373   2e-117   
ref|NP_001132121.1|  hypothetical protein precursor                     374   2e-117   Zea mays [maize]
ref|XP_002889989.1|  glycosyl hydrolase family 5 protein                372   4e-117   
ref|XP_009148543.1|  PREDICTED: uncharacterized protein LOC103871957    373   5e-117   
ref|XP_010458755.1|  PREDICTED: uncharacterized protein LOC104739...    372   6e-117   
ref|XP_010250982.1|  PREDICTED: uncharacterized protein LOC104593...    371   6e-117   
ref|XP_010904544.1|  PREDICTED: uncharacterized protein LOC105031943    372   7e-117   
gb|AES72136.2|  cellulase (glycosyl hydrolase family 5)                 373   1e-116   
emb|CDY19395.1|  BnaC05g09040D                                          370   2e-116   
ref|XP_003617143.1|  Oligoribonuclease                                  391   3e-116   
ref|XP_010514260.1|  PREDICTED: uncharacterized protein LOC104790246    368   6e-116   
ref|XP_003601885.1|  Endoglucanase                                      373   6e-116   
ref|XP_010476303.1|  PREDICTED: uncharacterized protein LOC104755594    369   1e-115   
ref|XP_010026596.1|  PREDICTED: uncharacterized protein LOC104416965    367   1e-115   
ref|XP_010514258.1|  PREDICTED: uncharacterized protein LOC104790245    369   2e-115   
ref|XP_002446675.1|  hypothetical protein SORBIDRAFT_06g020270          369   2e-115   Sorghum bicolor [broomcorn]
ref|XP_010026600.1|  PREDICTED: uncharacterized protein LOC104416972    371   2e-115   
ref|XP_009381699.1|  PREDICTED: uncharacterized protein LOC103969775    365   3e-115   
dbj|BAK00694.1|  predicted protein                                      367   4e-115   
ref|XP_002509878.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    365   9e-115   Ricinus communis
ref|XP_010026597.1|  PREDICTED: uncharacterized protein LOC104416968    365   1e-114   
gb|ACF79301.1|  unknown                                                 367   1e-114   Zea mays [maize]
ref|NP_001130915.1|  hydrolase, hydrolyzing O-glycosyl compound p...    367   1e-114   Zea mays [maize]
emb|CDX98009.1|  BnaA06g07600D                                          366   1e-114   
ref|XP_006378253.1|  hypothetical protein POPTR_0010s059502g            360   1e-114   
emb|CDY16066.1|  BnaC08g40570D                                          366   1e-114   
ref|XP_003552802.1|  PREDICTED: uncharacterized protein LOC100805196    364   3e-114   
ref|XP_010528075.1|  PREDICTED: uncharacterized protein LOC104805267    365   4e-114   
ref|XP_002315653.2|  hypothetical protein POPTR_0010s05960g             358   8e-114   Populus trichocarpa [western balsam poplar]
ref|XP_004975980.1|  PREDICTED: uncharacterized protein LOC101758857    364   9e-114   
ref|XP_004158142.1|  PREDICTED: uncharacterized LOC101213113            358   2e-113   
ref|XP_003579979.1|  PREDICTED: uncharacterized protein LOC100845861    362   3e-113   
gb|EAY94563.1|  hypothetical protein OsI_16341                          361   1e-112   Oryza sativa Indica Group [Indian rice]
emb|CAH67676.1|  H0510A06.1                                             359   5e-112   Oryza sativa [red rice]
gb|EAZ23667.1|  hypothetical protein OsJ_07369                          360   8e-112   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41089.2|  OSJNBb0011N17.6                                        358   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010658499.1|  PREDICTED: uncharacterized protein LOC100267...    356   2e-111   
ref|XP_010261410.1|  PREDICTED: uncharacterized protein LOC104600255    353   2e-111   
gb|EPS64690.1|  hypothetical protein M569_10090                         352   2e-111   
gb|KHN06535.1|  Endoglucanase                                           354   4e-111   
ref|XP_004975262.1|  PREDICTED: uncharacterized protein LOC101779133    358   5e-111   
gb|KFK33555.1|  hypothetical protein AALP_AA5G028800                    356   9e-111   
ref|XP_004143962.1|  PREDICTED: uncharacterized protein LOC101211675    353   1e-110   
gb|EMT27118.1|  hypothetical protein F775_19072                         355   3e-110   
ref|XP_003621368.1|  Endoglucanase                                      351   5e-110   
ref|XP_003621386.1|  Endoglucanase E1                                   348   1e-109   
gb|KHN19917.1|  hypothetical protein glysoja_032397                     350   1e-109   
ref|XP_006395579.1|  hypothetical protein EUTSA_v10003968mg             350   7e-109   
ref|XP_002452393.1|  hypothetical protein SORBIDRAFT_04g024910          350   4e-108   Sorghum bicolor [broomcorn]
gb|KDO82155.1|  hypothetical protein CISIN_1g008330mg                   343   3e-107   
ref|XP_010458756.1|  PREDICTED: uncharacterized protein LOC104739...    345   3e-107   
ref|NP_001053105.1|  Os04g0480900                                       346   6e-107   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66880.1|  OSIGBa0158F13.11                                       344   2e-106   Oryza sativa [red rice]
gb|EEC77494.1|  hypothetical protein OsI_16340                          343   5e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_006400290.1|  hypothetical protein EUTSA_v10015581mg             342   7e-106   
ref|XP_008678767.1|  PREDICTED: uncharacterized protein LOC100501...    343   1e-105   
ref|XP_010549752.1|  PREDICTED: uncharacterized protein LOC104820833    340   5e-105   
gb|KHN43979.1|  Endoglucanase E1                                        337   3e-104   
gb|KCW59703.1|  hypothetical protein EUGRSUZ_H02464                     336   4e-104   
ref|XP_010026599.1|  PREDICTED: uncharacterized protein LOC104416971    333   8e-104   
ref|XP_010492706.1|  PREDICTED: uncharacterized protein LOC104770057    337   1e-103   
ref|XP_008678768.1|  PREDICTED: uncharacterized protein LOC100501...    335   9e-103   
ref|XP_010420476.1|  PREDICTED: uncharacterized protein LOC104706046    333   2e-102   
ref|XP_002871770.1|  glycosyl hydrolase family 5 protein                333   3e-102   
ref|XP_009107523.1|  PREDICTED: uncharacterized protein LOC103833179    333   3e-102   
gb|KFK25904.1|  hypothetical protein AALP_AA8G177600                    332   6e-102   
ref|XP_009387346.1|  PREDICTED: uncharacterized protein LOC103974285    330   7e-102   
ref|NP_197252.1|  Glycosyl hydrolase superfamily protein                332   8e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289374.1|  hypothetical protein CARUB_v10002868mg             332   9e-102   
emb|CDY13614.1|  BnaA06g33090D                                          330   9e-102   
ref|XP_004168759.1|  PREDICTED: uncharacterized protein LOC101223591    332   1e-101   
emb|CDX83591.1|  BnaC07g23310D                                          327   7e-101   
gb|KDO76363.1|  hypothetical protein CISIN_1g039248mg                   324   1e-100   
gb|KFK43579.1|  hypothetical protein AALP_AA1G144700                    331   3e-100   
emb|CDY38435.1|  BnaA10g17230D                                          327   4e-100   
ref|XP_010492588.1|  PREDICTED: uncharacterized protein LOC104769...    327   7e-100   
emb|CDY16914.1|  BnaC09g40410D                                          326   1e-99    
ref|XP_010437042.1|  PREDICTED: uncharacterized protein LOC104720...    325   3e-99    
emb|CDX69429.1|  BnaA10g17780D                                          323   2e-98    
ref|XP_006341815.1|  PREDICTED: uncharacterized protein LOC102587665    318   7e-98    
gb|KHG22500.1|  Endoglucanase E1                                        320   1e-97    
ref|XP_009121460.1|  PREDICTED: uncharacterized protein LOC103846306    319   7e-97    
gb|KHN04647.1|  Endoglucanase                                           316   1e-96    
gb|AFW62836.1|  hypothetical protein ZEAMMB73_750687                    314   1e-96    
emb|CDY38091.1|  BnaC02g06820D                                          318   1e-96    
emb|CDX89335.1|  BnaA01g15580D                                          317   2e-96    
ref|XP_004170960.1|  PREDICTED: uncharacterized LOC101217177            313   5e-96    
gb|KCW59700.1|  hypothetical protein EUGRSUZ_H02458                     315   2e-95    
gb|ACF85134.1|  unknown                                                 314   2e-95    Zea mays [maize]
ref|XP_010535458.1|  PREDICTED: uncharacterized protein LOC104810759    308   2e-94    
gb|KDO82152.1|  hypothetical protein CISIN_1g008330mg                   308   2e-94    
ref|NP_001047320.1|  Os02g0596200                                       309   6e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EPS61076.1|  hypothetical protein M569_13724                         307   6e-94    
gb|AFW62835.1|  hypothetical protein ZEAMMB73_750687                    306   8e-94    
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       316   8e-93    
emb|CDY40992.1|  BnaA02g27820D                                          302   7e-92    
ref|XP_006400209.1|  hypothetical protein EUTSA_v10015466mg             293   2e-87    
ref|XP_006584934.1|  PREDICTED: uncharacterized protein LOC100811735    287   3e-87    
ref|XP_010248706.1|  PREDICTED: uncharacterized protein LOC104591...    293   6e-87    
ref|XP_010453833.1|  PREDICTED: uncharacterized protein LOC104735704    291   6e-87    
ref|XP_002284895.1|  PREDICTED: uncharacterized protein LOC100253729    292   6e-87    Vitis vinifera
gb|KFK38059.1|  hypothetical protein AALP_AA3G064700                    290   9e-87    
ref|XP_010248705.1|  PREDICTED: uncharacterized protein LOC104591...    292   2e-86    
ref|XP_010437048.1|  PREDICTED: uncharacterized protein LOC104720...    290   3e-86    
ref|NP_197172.1|  glycosyl hydrolase family protein                     289   5e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121461.1|  PREDICTED: uncharacterized protein LOC103846308    285   2e-84    
ref|XP_002284888.2|  PREDICTED: uncharacterized protein LOC100258876    286   2e-84    Vitis vinifera
ref|XP_010492589.1|  PREDICTED: uncharacterized protein LOC104769...    284   4e-84    
ref|XP_002871731.1|  glycosyl hydrolase family 5 protein                284   6e-84    
ref|XP_009142293.1|  PREDICTED: uncharacterized protein LOC103866164    283   7e-84    
ref|XP_004151386.1|  PREDICTED: uncharacterized protein LOC101207450    278   2e-83    
ref|XP_009142284.1|  PREDICTED: uncharacterized protein LOC103866155    282   2e-83    
ref|XP_001767510.1|  predicted protein                                  278   3e-83    
ref|XP_009126137.1|  PREDICTED: uncharacterized protein LOC103851062    281   6e-83    
ref|XP_001769398.1|  predicted protein                                  276   2e-82    
emb|CDY16991.1|  BnaC09g41180D                                          278   1e-81    
emb|CBI16819.3|  unnamed protein product                                270   8e-81    
ref|XP_004151560.1|  PREDICTED: uncharacterized protein LOC101211788    270   1e-80    
ref|XP_010420372.1|  PREDICTED: uncharacterized protein LOC104705962    275   2e-80    
gb|KGN50360.1|  hypothetical protein Csa_5G168960                       268   5e-80    
ref|XP_002284881.1|  PREDICTED: uncharacterized protein LOC100264047    274   6e-80    Vitis vinifera
ref|XP_010494994.1|  PREDICTED: uncharacterized protein LOC104772040    253   5e-74    
gb|KCW77463.1|  hypothetical protein EUGRSUZ_D01801                     253   8e-74    
gb|EMT10461.1|  Endoglucanase E1                                        253   2e-72    
emb|CDY38093.1|  BnaC02g06800D                                          251   2e-72    
emb|CDY34588.1|  BnaC03g56880D                                          247   9e-72    
ref|XP_006653527.1|  PREDICTED: uncharacterized protein LOC102709173    244   6e-71    
ref|XP_010497223.1|  PREDICTED: uncharacterized protein LOC104774279    238   2e-68    
emb|CDX94333.1|  BnaC01g18510D                                          236   6e-68    
ref|XP_001836746.2|  glycosyl hydrolase family 5 protein/cellulase      239   1e-67    Coprinopsis cinerea okayama7#130
ref|XP_004170742.1|  PREDICTED: uncharacterized protein LOC101225189    234   5e-67    
emb|CDX85491.1|  BnaA02g03220D                                          234   1e-66    
ref|XP_002145195.1|  cellulase family protein                           230   7e-65    
gb|EKG14335.1|  Glycoside hydrolase family 5                            230   8e-65    
ref|XP_002340189.1|  cellulase family protein                           229   2e-64    
dbj|GAM34669.1|  hypothetical protein TCE0_015f02391                    229   3e-64    
ref|XP_006648806.1|  PREDICTED: uncharacterized protein LOC102721430    226   5e-64    
ref|XP_007585086.1|  putative cellulase family protein                  224   2e-62    
ref|XP_006671920.1|  cellulase family protein                           226   2e-62    
ref|XP_002893942.1|  predicted protein                                  224   3e-62    
ref|XP_007910862.1|  putative cellulase family protein                  223   6e-62    
ref|XP_007357340.1|  glycosyl hydrolase family 5 protein/cellulase      221   3e-61    
gb|EFQ33294.1|  cellulase                                               219   1e-60    
gb|KFA63501.1|  hypothetical protein S40285_00384                       219   1e-60    
gb|ACN33507.1|  unknown                                                 218   2e-60    
gb|KEY64284.1|  hypothetical protein S7711_06330                        218   3e-60    
gb|KDN66432.1|  putative cellulase                                      218   4e-60    
gb|KFA75266.1|  hypothetical protein S40288_00156                       218   4e-60    
ref|XP_003662646.1|  glycoside hydrolase family 5 protein               218   6e-60    
ref|XP_001908470.1|  hypothetical protein                               217   1e-59    
gb|ERS96619.1|  hypothetical protein HMPREF1624_06828                   216   2e-59    
emb|CCF32701.1|  cellulase                                              216   2e-59    
ref|XP_008597845.1|  cellulase-like protein                             216   2e-59    
ref|XP_007594136.1|  cellulase                                          215   3e-59    
gb|EQK97843.1|  cellulase family protein                                216   6e-59    
dbj|GAD95395.1|  cellulase family protein                               214   6e-59    
ref|XP_001221670.1|  hypothetical protein CHGG_05575                    214   1e-58    
gb|ENH81172.1|  cellulase family protein                                213   2e-58    
gb|KGQ09067.1|  hypothetical protein BBAD15_g5599                       213   2e-58    
ref|XP_007819785.1|  cellulase family protein                           213   3e-58    
gb|KID89157.1|  cellulase family protein                                213   4e-58    
gb|KIH89233.1|  glycosyl hydrolase family 5 protein/cellulase           212   5e-58    
gb|KFG83308.1|  cellulase family protein                                212   7e-58    
gb|EQB46738.1|  cellulase                                               211   9e-58    
gb|KDO82153.1|  hypothetical protein CISIN_1g008330mg                   208   2e-57    
gb|KIE00366.1|  cellulase family protein                                210   2e-57    
ref|XP_007273044.1|  cellulase family protein                           210   3e-57    
emb|CDY26627.1|  BnaA09g46500D                                          207   6e-57    
ref|XP_003717168.1|  cellulase                                          209   8e-57    
ref|XP_009224314.1|  hypothetical protein GGTG_08211                    208   1e-56    
gb|KHO00841.1|  cellulase family protein                                208   2e-56    
ref|XP_007834259.1|  hypothetical protein PFICI_07487                   207   4e-56    
gb|EMS46776.1|  hypothetical protein TRIUR3_23304                       202   5e-56    
ref|XP_007814668.1|  cellulase family protein                           206   6e-56    
ref|XP_003655929.1|  glycoside hydrolase family 5 protein               206   7e-56    
gb|KID73106.1|  cellulase family protein                                205   2e-55    
emb|CBI20318.3|  unnamed protein product                                201   1e-54    
gb|KFH44162.1|  Endoglucanase-like protein                              202   2e-54    
gb|EPE03278.1|  cellulase family protein                                200   1e-53    
emb|CEJ81391.1|  hypothetical protein VHEMI01518                        199   3e-53    
ref|XP_009126336.1|  PREDICTED: uncharacterized protein LOC103851244    189   2e-51    
gb|EFW98553.1|  cellulase family protein                                189   5e-50    
ref|XP_007792420.1|  putative cellulase family protein                  189   1e-49    
gb|KGN57439.1|  hypothetical protein Csa_3G186170                       182   2e-49    
gb|EMT72253.1|  Endoglucanase                                           187   9e-49    
gb|EQB54091.1|  beta-1,6-galactanase                                    186   2e-48    
gb|EXM17989.1|  hypothetical protein FOTG_13958                         186   2e-48    
gb|EXK27375.1|  hypothetical protein FOMG_16183                         185   4e-48    
gb|EWZ81068.1|  hypothetical protein FOWG_15056                         185   4e-48    
gb|EWZ43433.1|  hypothetical protein FOZG_04542                         185   4e-48    
gb|EWY97310.1|  hypothetical protein FOYG_02170                         184   5e-48    
gb|EXL60764.1|  hypothetical protein FOCG_00055                         184   5e-48    
emb|CCF37606.1|  beta-1,6-galactanase                                   184   6e-48    
ref|XP_007590702.1|  beta-1,6-galactanase                               183   1e-47    
gb|ENH76760.1|  beta-galactanase                                        182   2e-47    
ref|XP_007797018.1|  putative beta- -galactanase protein                190   2e-47    
gb|AFK48266.1|  unknown                                                 176   2e-47    
ref|XP_003663765.1|  glycoside hydrolase family 5 protein               182   2e-47    
ref|XP_007286355.1|  beta-1,6-galactanase                               182   3e-47    
gb|ENH72329.1|  Endoglucanase                                           182   3e-47    
gb|EXK80342.1|  hypothetical protein FOQG_15124                         181   9e-47    
gb|EXA33415.1|  hypothetical protein FOVG_15480                         181   1e-46    
ref|XP_006577386.1|  PREDICTED: uncharacterized protein LOC102665018    175   2e-46    
ref|XP_009218474.1|  cellulase                                          181   2e-46    
ref|XP_001228860.1|  hypothetical protein CHGG_02344                    180   3e-46    
gb|KFH46053.1|  hypothetical protein ACRE_031990                        179   3e-46    
ref|XP_004140825.1|  PREDICTED: uncharacterized protein LOC101208873    176   4e-46    
gb|EPE02619.1|  beta- -galactanase                                      179   6e-46    
gb|ESZ94649.1|  hypothetical protein SBOR_4958                          177   2e-45    
gb|EFQ30340.1|  beta-1,6-galactanase                                    177   2e-45    
gb|KDN63966.1|  putative beta-1,6-galactanase                           176   4e-45    
ref|XP_009853760.1|  hypothetical protein NEUTE1DRAFT_148368            176   7e-45    
gb|ACU18247.1|  unknown                                                 169   7e-45    
gb|KHE83132.1|  glycoside hydrolase family 5 protein                    175   1e-44    
ref|XP_001558669.1|  hypothetical protein BC1G_02740                    174   2e-44    
ref|XP_959873.1|  hypothetical protein NCU05882                         174   3e-44    
gb|KGN57440.1|  hypothetical protein Csa_3G186670                       172   3e-44    
ref|XP_003346057.1|  hypothetical protein SMAC_08559                    173   5e-44    
ref|XP_003654775.1|  glycoside hydrolase family 5 protein               173   6e-44    
gb|KGN50048.1|  hypothetical protein Csa_5G152130                       165   8e-44    
ref|XP_007916764.1|  putative beta- -galactanase protein                171   2e-43    
ref|XP_003719440.1|  cellulase                                          171   5e-43    
ref|XP_009221743.1|  beta-1,6-galactanase                               170   5e-43    
ref|XP_007788083.1|  putative beta- -galactanase protein                170   6e-43    
ref|XP_001589233.1|  hypothetical protein SS1G_09866                    170   7e-43    
gb|KHM98801.1|  Chaperone protein ClpB3, chloroplastic                  175   2e-42    
gb|ERS98824.1|  hypothetical protein HMPREF1624_04014                   168   2e-42    
gb|KIH93867.1|  cellulase family protein                                168   3e-42    
ref|XP_007828900.1|  hypothetical protein PFICI_02128                   168   6e-42    
gb|ELQ40532.1|  cellulase family protein                                168   6e-42    
gb|KEZ38898.1|  hypothetical protein SAPIO_CDS10213                     166   2e-41    
gb|KEQ65714.1|  glycosyl hydrolase family 5 protein-like protein/...    164   4e-41    
ref|XP_003852017.1|  hypothetical protein MYCGRDRAFT_71681              164   6e-41    
gb|EYB22881.1|  hypothetical protein FG05_11184                         163   1e-40    
gb|ESU17537.1|  hypothetical protein FGSG_11184                         163   1e-40    
gb|KIN05076.1|  glycoside hydrolase family 5 protein                    162   2e-40    
ref|XP_009254229.1|  hypothetical protein FPSE_02835                    162   2e-40    
ref|XP_391360.1|  hypothetical protein FG11184.1                        162   3e-40    
gb|EEC73517.1|  hypothetical protein OsI_07900                          157   7e-40    
ref|XP_008437725.1|  PREDICTED: uncharacterized protein LOC103483072    155   8e-40    
ref|XP_001218590.1|  conserved hypothetical protein                     163   1e-39    
ref|XP_009652661.1|  beta-1,6-galactanase                               160   2e-39    
ref|XP_001727126.2|  cellulase family protein                           159   2e-39    
gb|KDN70454.1|  putative endo-beta-1                                    160   3e-39    
ref|XP_002375352.1|  cellulase family protein                           159   3e-39    
ref|XP_009221446.1|  hypothetical protein GGTG_05380                    159   5e-39    
gb|EXL52466.1|  hypothetical protein FOCG_08258                         158   5e-39    
dbj|BAF42338.1|  beta-1,6-galactanase                                   158   6e-39    
gb|EGU84192.1|  hypothetical protein FOXB_05301                         158   6e-39    
gb|EWZ31143.1|  hypothetical protein FOZG_15552                         158   7e-39    
ref|XP_003716571.1|  beta-1,6-galactanase                               158   7e-39    
gb|EWY82241.1|  hypothetical protein FOYG_14356                         158   7e-39    
gb|ENH63669.1|  Endoglucanase E1                                        158   7e-39    
gb|EXM21364.1|  hypothetical protein FOTG_10887                         158   7e-39    
gb|EWG53981.1|  hypothetical protein FVEG_12299                         158   8e-39    
gb|EMT67612.1|  Endoglucanase E1                                        158   8e-39    
gb|EHL01724.1|  putative endoglucanase E1                               157   2e-38    
ref|XP_682435.1|  hypothetical protein AN9166.2                         156   2e-38    
ref|XP_008079151.1|  (Trans)glycosidase                                 157   2e-38    
ref|XP_753201.1|  cellulase family protein                              155   3e-38    
gb|EMF10750.1|  glycoside hydrolase family 5 protein                    156   3e-38    
ref|XP_007829998.1|  hypothetical protein PFICI_03226                   156   3e-38    
gb|EYF06416.1|  Hypothetical protein CAP_1946                           156   4e-38    
gb|KFY97953.1|  hypothetical protein V498_01781                         155   6e-38    
ref|XP_001796881.1|  hypothetical protein SNOG_06513                    155   6e-38    
gb|KFY54743.1|  hypothetical protein V496_07185                         155   7e-38    
gb|KEQ97289.1|  glycoside hydrolase family 5 protein                    155   8e-38    
gb|KIL93951.1|  hypothetical protein FAVG1_02513                        161   9e-38    
gb|KEQ69124.1|  glycosyl hydrolase family 5 protein-like protein/...    154   1e-37    
ref|XP_003000334.1|  beta-1,6-galactanase                               154   1e-37    
ref|XP_007290132.1|  putative glycosyl hydrolase family 5 protein...    154   1e-37    
ref|XP_001259223.1|  cellulase, putative                                154   1e-37    
gb|KFY18769.1|  hypothetical protein V493_08357                         154   2e-37    
gb|EMD93538.1|  glycoside hydrolase family 5 protein                    154   2e-37    
ref|XP_007714643.1|  glycoside hydrolase family 5 protein               153   3e-37    
ref|XP_010536239.1|  PREDICTED: uncharacterized protein LOC104811274    147   3e-37    
gb|EUN23705.1|  glycoside hydrolase family 5 protein                    153   4e-37    
ref|XP_003049455.1|  hypothetical protein NECHADRAFT_45063              153   4e-37    
ref|XP_007695874.1|  glycoside hydrolase family 5 protein               153   4e-37    
ref|XP_007673934.1|  glycoside hydrolase family 5 protein               153   5e-37    
gb|KCW59701.1|  hypothetical protein EUGRSUZ_H02460                     148   7e-37    
gb|KEQ88759.1|  putative endoglucanase E1                               151   1e-36    
ref|XP_003834169.1|  similar to glycosyl hydrolase family 5 prote...    150   3e-36    
gb|KHN27305.1|  hypothetical protein glysoja_034658                     144   4e-36    
gb|EIT75924.1|  hypothetical protein Ao3042_07759                       150   6e-36    
dbj|BAE60287.1|  unnamed protein product                                149   6e-36    
gb|KGN50359.1|  hypothetical protein Csa_5G168955                       142   7e-36    
dbj|GAA92545.1|  cellulase family protein                               149   9e-36    
ref|XP_008020410.1|  glycoside hydrolase family 5 protein               148   2e-35    
ref|XP_001390007.2|  cellulase family protein                           147   2e-35    
ref|XP_007602986.1|  endo-beta-1                                        149   4e-35    
emb|CAK38078.1|  unnamed protein product                                147   5e-35    
gb|EQB45939.1|  endo-beta-1                                             146   9e-35    
gb|EFQ25644.1|  endo-beta-1                                             145   1e-34    
gb|KFY05071.1|  hypothetical protein O988_00287                         146   1e-34    
ref|XP_007283182.1|  cellulase family protein                           145   3e-34    
gb|KHN26287.1|  hypothetical protein glysoja_050239                     138   3e-34    
gb|KIM98514.1|  glycoside hydrolase family 5 protein                    144   2e-33    
gb|KFZ08766.1|  hypothetical protein V501_05827                         142   2e-33    
gb|KFZ18118.1|  hypothetical protein V502_04277                         142   2e-33    
ref|XP_007688994.1|  glycoside hydrolase family 5 protein               142   3e-33    
gb|KFY79089.1|  hypothetical protein V499_01878                         139   4e-32    
gb|KFX85816.1|  hypothetical protein V490_09391                         140   2e-31    
gb|EAY94564.1|  hypothetical protein OsI_16342                          135   2e-31    
gb|KFY38525.1|  hypothetical protein V495_06511                         139   4e-31    
gb|KDN53057.1|  glycoside hydrolase family 5 protein                    136   6e-31    
ref|XP_007880014.1|  hypothetical protein PFL1_04296                    135   8e-31    
ref|XP_007788248.1|  putative beta- -galactanase protein                133   5e-30    
ref|XP_001802868.1|  hypothetical protein SNOG_12647                    128   2e-29    
ref|XP_003710230.1|  beta-1,6-galactanase                               130   5e-29    
gb|KDN62736.1|  putative beta-1,6-galactanase                           129   7e-29    
gb|AEW08277.1|  hypothetical protein 2_5099_01                          122   1e-28    
gb|AFG69336.1|  hypothetical protein 2_5099_01                          121   2e-28    
ref|XP_008031104.1|  glycoside hydrolase family 5 protein               128   2e-28    
dbj|GAC98490.1|  glycoside hydrolase                                    127   5e-28    
gb|EGU83355.1|  hypothetical protein FOXB_06135                         125   6e-28    
ref|WP_020706673.1|  hypothetical protein                               125   9e-28    
gb|EXV02884.1|  cellulase (glycoside hydrolase family 5) protein        126   9e-28    
emb|CDX69431.1|  BnaA10g17800D                                          125   1e-27    
gb|KID90126.1|  cellulase                                               126   1e-27    
gb|KIE03229.1|  cellulase                                               126   1e-27    
gb|KID77044.1|  cellulase                                               126   2e-27    
ref|XP_007820373.1|  cellulase                                          125   2e-27    
ref|XP_010501449.1|  PREDICTED: uncharacterized protein LOC104778702    122   2e-27    
emb|CBI20317.3|  unnamed protein product                                118   3e-27    
gb|ETS60461.1|  hypothetical protein PaG_05301                          125   3e-27    
gb|KFG87644.1|  cellulase                                               125   3e-27    
gb|EMD89616.1|  glycoside hydrolase family 5 protein                    125   3e-27    
ref|XP_001937210.1|  beta-1,6-galactanase                               125   3e-27    
dbj|GAK66794.1|  beta- -galactanase protein                             125   3e-27    
ref|XP_007698919.1|  glycoside hydrolase family 5 protein               125   3e-27    
ref|XP_761031.1|  hypothetical protein UM04884.1                        126   3e-27    
ref|XP_007715431.1|  glycoside hydrolase family 5 protein               124   4e-27    
ref|NP_001053106.2|  Os04g0481000                                       116   4e-27    
dbj|GAC77343.1|  hypothetical protein PANT_26c00006                     124   5e-27    
ref|XP_003299126.1|  hypothetical protein PTT_10061                     124   5e-27    
emb|CBQ69840.1|  related to cellulase                                   124   6e-27    
emb|CBI20315.3|  unnamed protein product                                117   6e-27    
gb|ENH86025.1|  beta-galactanase                                        123   1e-26    
gb|KEQ91282.1|  glycoside hydrolase family 5 protein                    121   3e-26    
ref|XP_003841187.1|  hypothetical protein LEMA_P091170.1                122   4e-26    
ref|XP_007690633.1|  glycoside hydrolase family 5 protein               120   7e-26    
gb|EST08742.1|  glycoside hydrolase                                     120   7e-26    
ref|XP_007601021.1|  beta-1,6-galactanase                               120   8e-26    
emb|CCF49355.1|  related to cellulase                                   120   1e-25    
ref|WP_002615846.1|  glycosyl hydrolase family 5                        121   3e-25    
gb|KEH20763.1|  glycoside hydrolase family 5 protein                    111   4e-25    
emb|CDI55906.1|  related to cellulase                                   117   8e-25    
ref|XP_009655318.1|  endoglucanase                                      116   1e-24    
gb|EQB45951.1|  beta-1,6-galactanase                                    117   1e-24    
gb|KEQ69326.1|  Exo-beta-1,3-glucanase                                  116   2e-24    



>ref|XP_009605826.1| PREDICTED: uncharacterized protein LOC104100317 [Nicotiana tomentosiformis]
Length=526

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/504 (59%), Positives = 381/504 (76%), Gaps = 6/504 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+++G+RVKL C +WA HL+ MLPEGLD++P+SQIA H+S MGFNCVRLTWATYMF
Sbjct  28    RWIVDEETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSQIARHISLMGFNCVRLTWATYMF  87

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR++N+TV QSF + GL  A+SGL  NNP LL L +V+A+KAV+EE+GRHG+M VLDN V
Sbjct  88    TRHSNLTVAQSFINNGLNNAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGVMSVLDNQV  147

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
              +PMWCC  +DGN F+G  YF+P EWL+GL IVAN +KD PMV+G+SLRNELRGPLQN  
Sbjct  148   GEPMWCCGSNDGNGFWGDKYFEPKEWLKGLDIVANRYKDIPMVIGISLRNELRGPLQNQS  207

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             VWY+YVEKGAK I+ ANPNLL+IISGL YDLDF FLKE+P     M+ K+V+ETHRY+FT
Sbjct  208   VWYEYVEKGAKTIHRANPNLLLIISGLDYDLDFTFLKEKP-LNLNMRNKIVFETHRYSFT  266

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
             EGQ+  ++  PLNKVC  I  E+  K GFL++G N  PLFVSEFGI+Q G ++ADN  L 
Sbjct  267   EGQANWFLTQPLNKVCDTIKEEIMNKSGFLIKGKNAAPLFVSEFGIDQRGTNQADNLFLG  326

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C LS LA+LDLDW+VWALQG+YY REG+ G +E YGMF + W +LR+P + +KL+ +QQK
Sbjct  327   CFLSLLAELDLDWAVWALQGNYYTREGQQGMEEMYGMFNSTWNSLRSPEYHAKLQLIQQK  386

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGDQI-HMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             LQDP S +P Y LL+HP SG+C     + + + SDC GASR   + D  PI + G+  CL
Sbjct  387   LQDPKSKQPMYHLLFHPQSGKCLHAAANNVLYASDCIGASRWSYDGDDTPIRLTGTSLCL  446

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
                 E LP+TLST C++   +TW   SN  +QL+N  +NG  LCLDFD+ YS S +L RK
Sbjct  447   TTSREGLPVTLSTDCSE--QSTWKFVSN--YQLSNHDENGTELCLDFDTYYSSSKVLVRK  502

Query  1669  CVGLEEGDMRNPQTQWFKLIASNT  1740
             C+GL+E    NPQTQWFK +++N 
Sbjct  503   CIGLDEKSNDNPQTQWFKFVSANV  526



>ref|XP_009773950.1| PREDICTED: uncharacterized protein LOC104224082 [Nicotiana sylvestris]
Length=526

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/504 (59%), Positives = 378/504 (75%), Gaps = 6/504 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD++G+RVKL C +WA HL+ MLPEGLD++P+S IA H+S MGFNCVRLTWATYMF
Sbjct  28    RWIIDDETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSHIARHISLMGFNCVRLTWATYMF  87

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR++N+TV QSF + GL +A+SGL  NNP LL L +V+A+KAV+EE+GRHG+M VLDN V
Sbjct  88    TRHSNLTVAQSFINNGLNDAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGVMSVLDNQV  147

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
              +PMWCC   DGN F+G  YF+P EWL+GL IVA  +KD P+V+G+SLRNELRGPLQN  
Sbjct  148   GEPMWCCGSDDGNGFWGDKYFEPKEWLKGLDIVARTYKDIPLVIGISLRNELRGPLQNQS  207

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             VWY+YV+KGAK I+ ANPNLL+IISGL YDLDF FLKE+P     M+ K+V+ETHRY+FT
Sbjct  208   VWYEYVQKGAKTIHRANPNLLLIISGLDYDLDFTFLKEKP-LNLNMRNKIVFETHRYSFT  266

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
             EGQS  ++  PLNKVC  I  E+  K GFL++G N  PLFVSEFGI+Q G ++ADN  L 
Sbjct  267   EGQSNWYLTQPLNKVCDTIKEEIMNKSGFLIKGKNAAPLFVSEFGIDQRGTNQADNLFLG  326

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C LS+LA+LDLDW+VWALQG+YY REG+ G +E YGMF + W  LRNP + +KL+ +QQ 
Sbjct  327   CFLSFLAELDLDWAVWALQGNYYTREGQQGMEEMYGMFNSTWKTLRNPEYHAKLQLIQQT  386

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             LQDP S +P Y LL+HP SG+C     +  ++ SDC GASR   + D  PI + G+  CL
Sbjct  387   LQDPKSKQPMYHLLFHPQSGKCLHAADNNVVYASDCIGASRWSYDGDDTPIRLTGTSLCL  446

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
                 E LP+ LST C+  + +TW  ASN  +QL+N  +NG  LCLDFD+ YS S +L RK
Sbjct  447   TTSREGLPVALSTDCS--EQSTWKFASN--YQLSNHDENGSELCLDFDTYYSSSKVLVRK  502

Query  1669  CVGLEEGDMRNPQTQWFKLIASNT  1740
             C+GL+E  + NPQ QWFK +++N 
Sbjct  503   CIGLDEKSIDNPQNQWFKFVSANV  526



>ref|XP_006344017.1| PREDICTED: uncharacterized protein LOC102582487 [Solanum tuberosum]
Length=478

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/478 (58%), Positives = 354/478 (74%), Gaps = 3/478 (1%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRYANMTVVQSFGDLGLTEAISGLA  486
             MLPEGLD++P++ I  H+S MGFNCVRLTWATYMFTRY+N+TV QSF + GL +A+SG+A
Sbjct  1     MLPEGLDQQPINNIVNHISLMGFNCVRLTWATYMFTRYSNLTVAQSFVNNGLHDALSGIA  60

Query  487   snnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDE  666
               NP LL L +  A++AV+EE+GRHGIM VLDNH+SKPMWCC +HDGN F+G   F P E
Sbjct  61    QKNPQLLGLTVFKAQRAVIEEMGRHGIMSVLDNHLSKPMWCCGNHDGNGFWGDEDFQPKE  120

Query  667   WLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIIS  846
             WL+GL IVA  +KD PMV+G+SLRNELRGPLQN  VWYK V+KGAK I+ ANPNLL+IIS
Sbjct  121   WLKGLDIVAKKYKDLPMVIGISLRNELRGPLQNQSVWYKNVKKGAKTIHKANPNLLIIIS  180

Query  847   GLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEE  1026
             GL+YD+DF FLK +PL L  M+ K+VYE HRYAFTEGQ+  ++  PLNKVC  I +E+  
Sbjct  181   GLNYDIDFTFLKRKPLNLLNMRNKIVYEIHRYAFTEGQANWFLTQPLNKVCDTIKKEIMN  240

Query  1027  KEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLR  1206
             K GFL++G N  PLFVSEFG +Q G + + N  + C+L++L DLDLDW+VWALQG+YY R
Sbjct  241   KSGFLLKGKNAAPLFVSEFGADQKGMNPSGNLFMGCLLTFLVDLDLDWAVWALQGNYYTR  300

Query  1207  EGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRCARV  1386
             +GK G DE +GM    W +LR+P + +KL+ +QQK QDP S +P Y LL+HP SG+C  V
Sbjct  301   QGKPGMDEPFGMLNNTWNSLRSPQYRAKLQLIQQKPQDPKSKKPKYYLLFHPQSGKCLNV  360

Query  1387  VGDQ-IHMSDCSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSL  1563
               +  +  S C GASR I   DG PI + G+  CL    E +PLTLS  CN+ + + W L
Sbjct  361   ATNNVVQASSCIGASRWIYHGDGTPIRLRGTSSCLTTSREGMPLTLSKDCNNNEKSRWKL  420

Query  1564  ASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             ASN  +QL+N  +N   LCLDFD++ S + +L RKCVGL+   + NPQ+QWFKL+++N
Sbjct  421   ASN--YQLSNIDENEKELCLDFDTNSSSNKVLVRKCVGLDGKSIDNPQSQWFKLVSTN  476



>ref|XP_010325669.1| PREDICTED: uncharacterized protein LOC101257885 [Solanum lycopersicum]
Length=503

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/504 (53%), Positives = 355/504 (70%), Gaps = 36/504 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD++G+RVKLAC +WA HL+ M+PEGLD++P+S+I  H+S MGFNCVRLTWATYMF
Sbjct  34    RWIIDDKNGQRVKLACVNWAAHLQTMIPEGLDQQPISKIVKHISLMGFNCVRLTWATYMF  93

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+N+TV QSF + GL +A++ +A  NP LL L++ +A++AVVEE+GRHGIM +LDNH+
Sbjct  94    TRYSNLTVAQSFANNGLHDALTRIAQKNPQLLGLSVFEAQRAVVEEMGRHGIMSILDNHL  153

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+PMWCC +HDGN F+G   F P EWL+GL IVA  +KD+PMV+G+SLRNELRGPLQN  
Sbjct  154   SRPMWCCGNHDGNGFWGDEDFQPKEWLKGLDIVAKKYKDSPMVMGISLRNELRGPLQNQS  213

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             VWYK V+KGAKAI+ ANPN+L+IISGL+YD+DF FLK + L L  ++ K+VYE HRYAFT
Sbjct  214   VWYKNVKKGAKAIHKANPNILIIISGLNYDIDFTFLKRKHLNLLNIRNKIVYEIHRYAFT  273

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
             EGQ+  ++  PLNKVC  I +E+ +K GFL++G N  PLFVSEFG +Q G + + N  + 
Sbjct  274   EGQANWFLTQPLNKVCDTIKKEIMDKSGFLLKGKNAAPLFVSEFGADQKGMNPSGNLFMG  333

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C+L++L DLDLDW+VWALQG+YY R+GK G DE +GMF   W +LR+P + +KL+ +QQK
Sbjct  334   CLLTFLVDLDLDWAVWALQGNYYTRQGKPGMDEPFGMFNNIWNSLRSPQYHAKLQLIQQK  393

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             LQDP S +P Y  L+HP SG+C  V  +  +  S C G SR I   DG  I + G+  CL
Sbjct  394   LQDPKSKKPKYYWLFHPQSGKCLNVATNNVVEASSCIGGSRWIYHGDGTSIRLTGTSSCL  453

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
                 E +PLTLS  C + +                                    +L RK
Sbjct  454   TTSKEGMPLTLSKDCTNNEK-----------------------------------VLVRK  478

Query  1669  CVGLEEGDMRNPQTQWFKLIASNT  1740
             CVGL+   + NPQ+QWFKL+++N 
Sbjct  479   CVGLDGKSIDNPQSQWFKLVSTNV  502



>ref|XP_002272534.1| PREDICTED: uncharacterized protein LOC100257079 [Vitis vinifera]
Length=545

 Score =   499 bits (1284),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 264/515 (51%), Positives = 342/515 (66%), Gaps = 16/515 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++DD SG+RVKLAC +W  HL+ M+ EGL +RPL +IA  ++ MGFNCVRLTWATYMF
Sbjct  32    RWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLTWATYMF  91

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N +V +S G+LGL+EA  G+A NNP LL+L+LV+A +AVV+E+GRHG+M+VLDN
Sbjct  92    TRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGVMVVLDN  151

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCCA+ DGN FFG  YF P EWLQGL  VA+ FKD   VV +S+RNELRGP Q 
Sbjct  152   HVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAMSMRNELRGPNQT  211

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
               +WYK + KG + I++ NPNLLVI+SGL +D D  FLK++      +  KVV+E H Y+
Sbjct  212   EHIWYKQIRKGGRTIHSINPNLLVIVSGLEFDTDLSFLKQK-PLKLKLPNKVVFEAHWYS  270

Query  946   FTEGQSKA-WMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             F+       W + PLN++CH+ T   E    F+  G NP P F+SEFGI+  G +  DNR
Sbjct  271   FSSITGGVEWTEQPLNQICHNRTEWFESGAAFVGTGSNPAPFFLSEFGIDLRGVNPRDNR  330

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
                C L+++A  DLDW++W LQGSYY R+G  G +ETYG+   NW   RNP FL ++  L
Sbjct  331   FFGCFLAFVAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLDYNWDKPRNPKFLKRIRIL  390

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVG---DQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQDP S+ P Y L++HP SGRC  V G   DQIH  +C   SR   + +G  I ++G
Sbjct  391   QDILQDPNSNVPKYHLIFHPRSGRCVSVKGEGQDQIHGRNCKKGSRWSHDGNGGAIRLMG  450

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
             S  CL  VG+ LP  LST C+  Q+  W L S S   +A   + G  LCLD  +S S S+
Sbjct  451   SGLCLKAVGDGLPAKLSTDCSSPQAR-WKLISKSKLHIAAMDEQGKPLCLDGKNSNS-SS  508

Query  1654  ILTRKCV-GLEEGD------MRNPQTQWFKLIASN  1737
             ILTR C+  L++GD      + NPQ QWFK + SN
Sbjct  509   ILTRTCICALQDGDGSDLDCLTNPQRQWFKFVPSN  543



>emb|CBI34404.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   499 bits (1284),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 264/515 (51%), Positives = 342/515 (66%), Gaps = 16/515 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++DD SG+RVKLAC +W  HL+ M+ EGL +RPL +IA  ++ MGFNCVRLTWATYMF
Sbjct  48    RWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLTWATYMF  107

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N +V +S G+LGL+EA  G+A NNP LL+L+LV+A +AVV+E+GRHG+M+VLDN
Sbjct  108   TRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGVMVVLDN  167

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCCA+ DGN FFG  YF P EWLQGL  VA+ FKD   VV +S+RNELRGP Q 
Sbjct  168   HVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAMSMRNELRGPNQT  227

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
               +WYK + KG + I++ NPNLLVI+SGL +D D  FLK++      +  KVV+E H Y+
Sbjct  228   EHIWYKQIRKGGRTIHSINPNLLVIVSGLEFDTDLSFLKQK-PLKLKLPNKVVFEAHWYS  286

Query  946   FTEGQSKA-WMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             F+       W + PLN++CH+ T   E    F+  G NP P F+SEFGI+  G +  DNR
Sbjct  287   FSSITGGVEWTEQPLNQICHNRTEWFESGAAFVGTGSNPAPFFLSEFGIDLRGVNPRDNR  346

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
                C L+++A  DLDW++W LQGSYY R+G  G +ETYG+   NW   RNP FL ++  L
Sbjct  347   FFGCFLAFVAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLDYNWDKPRNPKFLKRIRIL  406

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVG---DQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQDP S+ P Y L++HP SGRC  V G   DQIH  +C   SR   + +G  I ++G
Sbjct  407   QDILQDPNSNVPKYHLIFHPRSGRCVSVKGEGQDQIHGRNCKKGSRWSHDGNGGAIRLMG  466

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
             S  CL  VG+ LP  LST C+  Q+  W L S S   +A   + G  LCLD  +S S S+
Sbjct  467   SGLCLKAVGDGLPAKLSTDCSSPQAR-WKLISKSKLHIAAMDEQGKPLCLDGKNSNS-SS  524

Query  1654  ILTRKCV-GLEEGD------MRNPQTQWFKLIASN  1737
             ILTR C+  L++GD      + NPQ QWFK + SN
Sbjct  525   ILTRTCICALQDGDGSDLDCLTNPQRQWFKFVPSN  559



>ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus]
Length=535

 Score =   484 bits (1247),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 244/505 (48%), Positives = 332/505 (66%), Gaps = 6/505 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++  +G+RVKL C +W GH++ M+ EGL  +PL  IA  V  + FNCVRLT++ +MF
Sbjct  32    RWIVEATTGQRVKLICVNWPGHMQAMVAEGLHLKPLDDIAAMVVKLRFNCVRLTYSIHMF  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN+TV QSF +  L EAI G+A NNP +L++ +V+A +AVV+ +G HG+M+V DNH+
Sbjct  92    TRYANLTVKQSFENFDLKEAIVGIAQNNPTILNMKVVEAYEAVVDSLGAHGVMVVSDNHI  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC++ DGN FFG  YF+  EWLQGL++     K  P VV +SLRNE RGP QNV+
Sbjct  152   SQPRWCCSNDDGNGFFGDRYFNSQEWLQGLSLATQSLKTKPQVVAMSLRNEPRGPNQNVE  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             +W++Y+ +GAK ++  NPN LV++SGLSYD    FLK R      +  K+V+E H Y+FT
Sbjct  212   MWFQYMSQGAKLVHQINPNALVVVSGLSYDTYLSFLKNR-SMGFNLDNKLVFEAHLYSFT  270

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   W   PLN  C ++ +  E++ GFLVRG NP PLFVSEFGINQMG +E  NR L 
Sbjct  271   NNMGDYWTSKPLNTFCANVNQGFEDRAGFLVRGQNPIPLFVSEFGINQMGVNEGQNRFLS  330

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C  +YL   D DW +WALQGSYY REG    +ET+G+  + +T ++NP FL K + +Q K
Sbjct  331   CFFTYLTKNDFDWGLWALQGSYYYREGVKNDEETFGVLDSKFTNVKNPKFLQKFQLMQTK  390

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             LQDP S+  T  ++YHPLSG C R+    Q+ +S C  ++R   E D  PI + GS+ CL
Sbjct  391   LQDPSSNLTTSFIMYHPLSGECVRMNKKYQLGVSSCKTSNRWSHEQDDTPIKLAGSILCL  450

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
               VG+ LP  LS  C+  QS  W  ASN+  QLA   + G  LCL   +S+S   ILT K
Sbjct  451   QAVGDGLPPILSKDCSSQQS-AWKYASNAKLQLATVDEEGQALCLQ-RASHS-HQILTNK  507

Query  1669  CVGLEEGDMR-NPQTQWFKLIASNT  1740
             C+   + + + +PQ+QWF L+ SN 
Sbjct  508   CMCPNDSECQGDPQSQWFTLVPSNV  532



>ref|XP_008467257.1| PREDICTED: uncharacterized protein LOC103504654 [Cucumis melo]
Length=539

 Score =   479 bits (1233),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 247/505 (49%), Positives = 332/505 (66%), Gaps = 7/505 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKL C +WAGH++ ML EGL RRPL  IA  V+ + FNCVRLT++ +MF
Sbjct  34    RWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRFNCVRLTYSIHMF  93

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+AN+TV QSF +  + +A++G+A NNP++L+L LV+A  AVV+ +  HGIM+V DNH+
Sbjct  94    TRHANLTVKQSFENFDMKDAMAGIAQNNPSILNLTLVEAYGAVVDSLVAHGIMVVSDNHI  153

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC ++DGN FFG  YFDP EWLQG+++ A   K    VV +SLRNELRGP QNV+
Sbjct  154   SQPRWCCDNNDGNGFFGDRYFDPQEWLQGISLAAQSLKSKAQVVAMSLRNELRGPNQNVE  213

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W++Y+ +GAK I+  NPN LV++SGLSYD D  FLK R      +  K+V+E H Y+FT
Sbjct  214   KWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFLKNRS-MGFNLDNKLVFEAHLYSFT  272

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   WM  PLN  C  I +  E++ GFLVRG NP PLFVSEFGI+Q G +E  NR L 
Sbjct  273   NNMRDFWMSKPLNTFCASINQGFEDRAGFLVRGQNPIPLFVSEFGIDQTGTNEGQNRFLS  332

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPN-FLSKLEFLQQ  1308
             C  SYL + D DW +WALQGSYY + G    +E +G+  +N+T  +N   FL + + +Q 
Sbjct  333   CFFSYLTENDFDWGLWALQGSYYYKVGVKNAEENFGVLDSNFTKAKNSKLFLQRFQLMQT  392

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             KLQDP S+  T  ++YHPLSG C R+    Q+ +S C  ++R   E DG PI + GS+ C
Sbjct  393   KLQDPSSNFTTTFIMYHPLSGGCVRMNKKYQLGISSCKTSNRWSHEQDGAPIKLAGSILC  452

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L  +G  LP  LS  C+  QS  W  ASN+  QLA   + G  LCL   +S+S   I+T 
Sbjct  453   LKAIGVGLPPILSQDCSSQQS-IWRYASNAKLQLATVDEQGQALCLQ-RASHS-HQIVTN  509

Query  1666  KCV-GLEEGDMRNPQTQWFKLIASN  1737
             KC+  ++     +PQ+QWF L+ SN
Sbjct  510   KCLCTIDSQCQEDPQSQWFTLVPSN  534



>ref|XP_002272386.2| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera]
Length=536

 Score =   476 bits (1225),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 247/505 (49%), Positives = 331/505 (66%), Gaps = 8/505 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKL C +WA H++ M+ EGL  +P+  I   V+ MGFNC+RLT+AT+M+
Sbjct  35    RWIVDSETGSRVKLTCLNWAAHIDTMVTEGLHTQPIKDIVAKVTLMGFNCIRLTYATFMW  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N TV QS   + LT+A  G+A NNP LL+L+L DA +AVV+ IG +G+M+VLDN
Sbjct  95    TRPDYGNKTVAQSLDSMNLTQAREGIARNNPQLLNLSLQDAYEAVVDAIGANGLMLVLDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKPMWCCA  DGN FFG ++FDP EW++GL  VA+ FK  P VV +S+RNELRGP QN
Sbjct  155   HVSKPMWCCASEDGNGFFGDMFFDPKEWIEGLTQVASRFKGKPQVVAMSMRNELRGPRQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             +  WY  + +GAKAI++ NP++LV++SGL++DLD  FL   P     +  KVVYE H Y+
Sbjct  215   LPDWYTNMTEGAKAIHSTNPDVLVLVSGLNFDLDLSFLNTTP-FGLTLDNKVVYEAHWYS  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F   Q   W   PLN+VC     E + +  FL+ G N  PL +SEFG++  G ++ DNR+
Sbjct  274   FDFTQQ--WQTQPLNRVCGQCADEFQREAAFLITGDNAAPLILSEFGVDVRGVNQDDNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+L  +AD DLDW++W LQGSYY REGK GP+E Y +   NW   R+P +L +L  LQ
Sbjct  332   FNCLLPTVADKDLDWALWTLQGSYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQ  391

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVG-DQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             Q +QDP S   +Y +L HP SG C  V G D +H S C   S+     DG PI ++GS  
Sbjct  392   QTIQDPNSIALSYYVLVHPESGFCVNVEGQDNVHGSSCRERSKWSHSGDGSPIQLVGSEL  451

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             CL  VG+ +P+ LST C    + TW L S+SM  +A   + G  LCL+  SS + S+ILT
Sbjct  452   CLKAVGDGVPVALSTDCKSPWA-TWKLVSDSMLHIAAMDEQGNSLCLESTSS-NYSSILT  509

Query  1663  RKCVGLEEGDMRNPQTQWFKLIASN  1737
             R C  L      +PQ+QWF+L+ SN
Sbjct  510   RSCACLNNETNCDPQSQWFRLVPSN  534



>ref|XP_010053198.1| PREDICTED: uncharacterized protein LOC104441706 [Eucalyptus grandis]
 gb|KCW77462.1| hypothetical protein EUGRSUZ_D01800 [Eucalyptus grandis]
Length=538

 Score =   475 bits (1222),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 244/508 (48%), Positives = 334/508 (66%), Gaps = 9/508 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G R+KLAC +WA HLEPML EGLD++PL  I   +  + FNCVRLTWATYMF
Sbjct  35    RWIVDSATGRRMKLACVNWASHLEPMLAEGLDKKPLGVIVAEIRRLRFNCVRLTWATYMF  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T+  + +  V ++   LGL EA  G+A NNP +L++  V+A  AVV+E+G+ G+M+VLDN
Sbjct  95    TQPGHGDQPVEETLDSLGLAEAKGGVARNNPLVLNMTHVEAYAAVVDELGKQGVMVVLDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCCA  DGN FFG  YFDP+EWL+GL  VA  F     VVG+S+RNELRGP QN
Sbjct  155   HVSKPKWCCAYDDGNGFFGDEYFDPEEWLRGLVAVAEHFNGKSQVVGMSVRNELRGPRQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WY+Y+   A  ++ ANPN+LVI+SGL++  D  FL++RP     + +K+VYE H Y+
Sbjct  215   DYDWYQYIRTAATKVHQANPNVLVILSGLNWASDLSFLRKRP-VGLSLGRKLVYEAHWYS  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+ G  K W   P+++VC +  + ME++ GFL  G    PLF+ EFG +Q G S+AD+R 
Sbjct  274   FS-GDRKIWEVQPVDRVCANAVQRMEDQAGFLSSGPGAVPLFLGEFGFDQTGKSQADDRF  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C + Y A  DLDW++WALQGSYY R+G  GP+ET+G+   NW  LRNP F  + + +Q
Sbjct  333   LSCFMGYAAGKDLDWALWALQGSYYYRQGVVGPEETFGVLDFNWDGLRNPKFKERFQLVQ  392

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
               +QDP S+ P   ++YHP SG C R   + +I  ++C   SR I   DG PI ++G+  
Sbjct  393   TMVQDPSSNSPMSYIMYHPQSGLCIRANNNHEIGTAECQHWSRWIHYRDGSPIRLMGTPL  452

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             CL  +G+ LP  LS  C++ +S  W   SNS   +A   ++G  LCL+  S+ S S ILT
Sbjct  453   CLKALGDGLPPVLSNDCSNRRS-AWRSISNSKLHVAATDEHGNRLCLEKKSNES-SVILT  510

Query  1663  RKCVGLEE--GDMRNPQTQWFKLIASNT  1740
             RKC+ +++  G   NPQ QWFK + +NT
Sbjct  511   RKCICVDDDSGCTENPQGQWFKFVPTNT  538



>ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera]
Length=530

 Score =   472 bits (1215),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 244/505 (48%), Positives = 334/505 (66%), Gaps = 8/505 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKL C +W  H E M+ EGL  +P+  IA  V++MGFNC+RLT+AT+M+
Sbjct  29    RWIVDSETGHRVKLTCLNWVAHTETMVTEGLHTQPIKDIAAKVTSMGFNCIRLTYATFMW  88

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y+N TV QS     LT+A  G+A NNP LL+L+L +A +AVV+E+G +G+M+VLDN
Sbjct  89    TRSDYSNKTVAQSLDSFNLTQAREGIARNNPQLLNLSLQEAYEAVVDELGANGLMLVLDN  148

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKPMWCCA  DGN FFG ++FDP EW++GL  VA  FK  P VV +S+RNE+RGP QN
Sbjct  149   HVSKPMWCCAREDGNGFFGDMFFDPKEWIEGLTQVAKRFKGKPQVVAMSMRNEIRGPRQN  208

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             +  WYK + +GAKAI++ NP++LV++SGL++D D  FL   P     + KKVVYE H Y+
Sbjct  209   LPDWYKNMREGAKAIHSTNPDVLVLVSGLNFDKDLSFLSTTP-FGLTLDKKVVYEAHWYS  267

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F   Q   W   PLN+VC     E + +  FL+ G N  PL +SEFG++  G ++ADNR+
Sbjct  268   FDFTQQ--WQTQPLNRVCRQRADEFQREAAFLITGDNAAPLIISEFGVDLRGVNQADNRY  325

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+L  +A+ DLDW++W LQ SYY REGK GP+E Y +   NW   R+P +L +L  LQ
Sbjct  326   FNCLLPTVAEKDLDWALWTLQASYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQ  385

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVG-DQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             Q +QDP S+  +Y L+ H  SG C  V G D +H S C   S+     DG PI ++G   
Sbjct  386   QTIQDPNSTTLSYYLIVHTESGFCVNVEGEDNVHGSSCRERSKWSHGGDGWPIRLVGGEL  445

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             CL  VG+ +P+TLST C   ++ TW L S+S   +A   + G  LCL+  SS + S+ILT
Sbjct  446   CLKAVGDGVPVTLSTDCKSPRA-TWKLVSDSRLHVAAMDEQGNSLCLEATSS-NYSSILT  503

Query  1663  RKCVGLEEGDMRNPQTQWFKLIASN  1737
             R+C  ++     +PQ+QWFKL+ SN
Sbjct  504   RRCACVKNEANCDPQSQWFKLVPSN  528



>gb|KGN50395.1| hypothetical protein Csa_5G171770 [Cucumis sativus]
Length=538

 Score =   472 bits (1214),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 239/505 (47%), Positives = 329/505 (65%), Gaps = 6/505 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G+RVKL C +W GH++ ML EGL RRPL  I + V+ + FNCVRLT++ +MF
Sbjct  33    RWIVDATTGQRVKLMCVNWPGHMQGMLAEGLHRRPLDDIISLVAKLRFNCVRLTYSIHMF  92

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+AN+TV QSF +  + +A++G+A NNP+L++L LV+A  AVV+ +  HG+M+V DNH+
Sbjct  93    TRHANLTVQQSFENFDMKDAMAGIAQNNPSLVNLTLVEAYGAVVDSLAAHGVMVVSDNHI  152

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC + DGN FFG  YFDP+EWLQG+++ A   K    VV +S+RNE RGP QNV+
Sbjct  153   SQPRWCCNNDDGNGFFGDRYFDPEEWLQGISLAAQSLKSKAEVVAMSMRNEPRGPNQNVE  212

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W++Y+ +GAK I+  NPN LV++SGLSYD D  FLK R      +  K+V+E H Y+FT
Sbjct  213   KWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFLKNR-SMGFNLDNKLVFEAHLYSFT  271

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   WM  PLN  C  + +  E++ GFLVRG NP PLFVSEFGI+Q G +E  NR L 
Sbjct  272   NNMGDFWMSKPLNTFCASVNQGFEDRAGFLVRGQNPMPLFVSEFGIDQRGVNEGQNRFLS  331

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPN-FLSKLEFLQQ  1308
             C  SYL + D DW +WALQGSYY REG    +E +G+  + +   +N   FL + + +Q 
Sbjct  332   CFFSYLTENDFDWGLWALQGSYYYREGVKNAEENFGVLDSTFAKAKNSKLFLQRFQLMQT  391

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             KLQDP S+  T  ++YHPLSG C R+    Q+ +S C  ++R I E D  PI + GS+ C
Sbjct  392   KLQDPSSNFTTSLIMYHPLSGGCVRMNKKYQLGISSCKTSNRWIHEQDSSPIKLAGSVLC  451

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L  +G  LP  LS  C+  QS  W   S++  QLA   + G  LCL   +S+S   I+T 
Sbjct  452   LKAIGVGLPPILSQDCSSQQS-IWKYGSSAKLQLATVDEQGQALCLQRAASHS-HQIVTN  509

Query  1666  KCVGLEEGDMR-NPQTQWFKLIASN  1737
             KC+   +   + +PQ+QWF L+ SN
Sbjct  510   KCLCSNDSQCQEDPQSQWFTLVPSN  534



>ref|XP_008810943.1| PREDICTED: uncharacterized protein LOC103722247 [Phoenix dactylifera]
Length=554

 Score =   469 bits (1207),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/520 (47%), Positives = 331/520 (64%), Gaps = 20/520 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D  SG+RVKL C +WA H+  +L EGLDR+PL  IA  ++ +GFNCVRLTWAT++F
Sbjct  37    RWVVDSASGQRVKLHCVNWAAHMPAVLAEGLDRQPLDGIAAGIAGLGFNCVRLTWATHLF  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T+  Y N+TV +S   LGL +A  G+  NN  ++ + + +A  AVV+ IG  G+M+VLDN
Sbjct  97    TKESYENLTVSESLSSLGLGDAFDGVRRNNGWMVGITVREAFDAVVKAIGEAGLMVVLDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFK-DTPMVVGVSLRNELRGPLQ  762
             HVS+P WCC D DGN FFG  YFDP+EWL+GL  VA  ++ D P VVG+S+RNELRGP Q
Sbjct  157   HVSRPQWCCGDDDGNGFFGDTYFDPEEWLRGLEFVATRYRSDNPQVVGMSMRNELRGPNQ  216

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             +   WY+ + +GA+ I+  NP++L+I SGLSYD D  FL++RPL      K V  E H Y
Sbjct  217   SEPAWYRNIARGAQKIHGTNPDVLIIASGLSYDTDLSFLRKRPLGSDFDSKLV-LEAHWY  275

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRG--GNPGPLFVSEFGINQMGDSEAD  1116
             AF+ GQ   W   P N+VC ++ R  +E+ GF++R   G   PLFVSEFG++Q G + AD
Sbjct  276   AFSGGQRLVWADQPPNRVCSEMVRRFDEQAGFVIRNENGTSLPLFVSEFGVDQRGTNRAD  335

Query  1117  NRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLE  1296
             NR L C L Y A+ DLDW++WALQGSYYLR G  G +ETYG+   NW   +NP F  K  
Sbjct  336   NRFLSCFLGYAAERDLDWALWALQGSYYLRNGIPGFNETYGVLDANWDRPKNPRFREKFR  395

Query  1297  FLQQKLQ----------DPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQE  1443
              +Q  LQ          DP  S   YQ++YHP SG+C  V     + +SDC    R    
Sbjct  396   LIQDTLQDKYPTKYSNPDPRLSVAAYQIIYHPHSGQCVSVDDSSNVVLSDCKKRKRWSYN  455

Query  1444  ADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCL  1623
              +   + ++GS +CL V GE LP+ LS  C+D +S  W   S+S FQ++     G  LCL
Sbjct  456   GNRTAVWLMGSAQCLRVEGEGLPVLLSAECDDNRS-VWGPVSSSWFQISGMDAQGRHLCL  514

Query  1624  DFDSSYSPSTILTRKCVGLEE-GDMRNPQTQWFKLIASNT  1740
             + +SS S ++I T+KC+ L+  G  +NPQTQWF  I SN 
Sbjct  515   ERNSSNS-NSIFTKKCLCLDNLGCSKNPQTQWFHFIPSNV  553



>ref|XP_007159232.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
 gb|ESW31226.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
Length=529

 Score =   468 bits (1204),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 237/506 (47%), Positives = 329/506 (65%), Gaps = 8/506 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +GERVKL C  W  H +PML EGLD+ PL+ IA +V+  GFNCVRL++ATYMF
Sbjct  29    RWIIDDATGERVKLHCTHWVVHAQPMLAEGLDKSPLNVIAANVAKAGFNCVRLSYATYMF  88

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+AN TV  +F    + E ++ +  +NP++L++  + A +AVV+ +G HG+M+++DNH+
Sbjct  89    TRHANNTVRDTFHSYDVPEMVTAIQKHNPSVLNMTHLQAYEAVVDALGAHGVMVLIDNHL  148

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S P WCCA+ D N FFG  +F+  EW+QGLAIVA+ FK  P V  + LRNELRG  QN +
Sbjct  149   SLPDWCCANDDQNGFFGDRHFNTSEWIQGLAIVAHHFKGKPNVFAMDLRNELRGSRQNWN  208

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             VWYKYV +GAK I+  NP+LL+IISGLS+D D  +LK RP     +  K+VYE+H Y+F+
Sbjct  209   VWYKYVSEGAKTIHEINPDLLIIISGLSFDNDLSYLKTRP-LHLNIPNKIVYESHIYSFS  267

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              G +  W   P N VC+   +    + GFL+ G NP PLFVSEFG N  G + AD+ + P
Sbjct  268   -GDTGRWHVQPANWVCNATIQTFNRQSGFLLSGKNPAPLFVSEFGYNMDGGNFADDSYWP  326

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C++++   +DL+WS+WA QGSYYLR+G  GP E+YG+    W   R+PNF  K + LQ+ 
Sbjct  327   CVVAHFTSVDLEWSLWAFQGSYYLRQGNVGPGESYGVMDFEWENYRDPNFTQKFQLLQRI  386

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSLKCLA  1491
             +QDP S      +++HP +G CA V   ++ M DC   S    E DG PI ++ S  CL 
Sbjct  387   IQDPNSKASKSHIIFHPSTGYCAHVNDKELVMGDCKSNSLWSFEGDGSPIRLMNSAMCLK  446

Query  1492  VVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKC  1671
              VGE LP TLS  C   QS +W   S S   LA+   NG +LCL+ DS  + + ++TRKC
Sbjct  447   AVGEGLPPTLSEDCLSAQS-SWKAVSMSGLHLASFDKNGDLLCLEKDS--NSTKLVTRKC  503

Query  1672  VGLEEGD---MRNPQTQWFKLIASNT  1740
             + +E  D   + +P  QWF+L+ +N 
Sbjct  504   ICIENDDSSCLDSPLNQWFRLVPTNV  529



>gb|KGN50394.1| hypothetical protein Csa_5G171760 [Cucumis sativus]
Length=538

 Score =   467 bits (1202),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 237/505 (47%), Positives = 324/505 (64%), Gaps = 6/505 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKL C +WAGH++ ML EGL  RPL  IA  V    FNCVRLT++ +MF
Sbjct  33    RWIVDATTGNRVKLMCVNWAGHMQGMLAEGLHLRPLDDIAALVVKSRFNCVRLTYSIHMF  92

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+AN+TV QSF +  + +A++G+A NNP++L++ +V A  AV++ +  H +M+V DNH+
Sbjct  93    TRHANLTVQQSFENFDMKDALAGIAQNNPSILNMTVVQAYGAVIDSLAAHRVMVVSDNHI  152

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC + DGN FFG  YFDP EWLQG+++ A   K    VV +SLRNE RGP QNV+
Sbjct  153   SQPRWCCNNDDGNGFFGDRYFDPQEWLQGISLAAQNLKSKSQVVAMSLRNEPRGPNQNVE  212

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             +W++Y+ +GAK I+  NPN LV++SGLSYD D  FLK R      +  K+V+E H Y+FT
Sbjct  213   MWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFLKNRS-MGFNLDNKLVFEAHLYSFT  271

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   WM  PLN  C  + +  E++ GFLVRG NP PLFVSEFGI+Q G +E  NR L 
Sbjct  272   NNMGDFWMSKPLNTFCASVNQGFEDRAGFLVRGQNPIPLFVSEFGIDQRGVNEGQNRFLS  331

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPN-FLSKLEFLQQ  1308
             C  SYL + D DW +WALQGSYY REG    +E +G+  + +   +N   FL + + +Q 
Sbjct  332   CFFSYLTENDFDWGLWALQGSYYYREGVKNAEENFGVLDSTFAKAKNSKLFLQRFQLMQT  391

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             KLQDP S+  T  ++YHPLSG C R+    Q+ +S C  ++R I E D  PI + GS+ C
Sbjct  392   KLQDPSSNFTTSLIMYHPLSGGCVRMNKKYQLGISSCKTSNRWIHEQDSSPIKLAGSVLC  451

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L  +G  LP  LS  C+  QS  W   SN+  QLA   + G  LCL   +S+S   ++T 
Sbjct  452   LKAIGVGLPPILSQDCSSQQS-IWKYGSNAKLQLATIDEQGQALCLQRAASHS-HQLVTN  509

Query  1666  KCVGLEEGDMR-NPQTQWFKLIASN  1737
             KC+   +   + +PQ+QWF L+ SN
Sbjct  510   KCLCSSDSQCQEDPQSQWFTLVPSN  534



>ref|XP_002509879.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51266.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=542

 Score =   466 bits (1199),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 244/506 (48%), Positives = 335/506 (66%), Gaps = 7/506 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SGERVKLAC +WA HL+PML EGLD++PLS +A+ ++   FNCVR T AT+MF
Sbjct  32    RWIIDAKSGERVKLACVNWASHLQPMLAEGLDKKPLSYLASKLARYHFNCVRFTCATHMF  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY  +TV QSF  L LT+A +G+A +N  LL+L +V A +AVV E+G HG+M++LDNHV
Sbjct  92    TRYGKLTVAQSFDSLNLTKAKAGIARHNSFLLNLTVVQAYEAVVNELGAHGLMVLLDNHV  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC   D N FFG ++F P EWL+GLAIVA IF+    VV +S+RNELRGP QN  
Sbjct  152   SQPKWCCPQDDENGFFGDIHFHPKEWLRGLAIVAKIFQGKSQVVAMSMRNELRGPYQNEH  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlkl-kmmkkkvvYETHRYAF  948
              WYKY+++GA+ ++  NP +LV++SGL +  D  FLK++PL L   +  K+VYE H Y+F
Sbjct  212   DWYKYIQEGARMVHKLNPEVLVLVSGLVWGTDLSFLKKKPLHLGLNLDNKLVYEAHWYSF  271

Query  949   TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
             + G  K W   PLN++C   T+   +  GF++ G NP PLF+ E GI+Q G + ADNR  
Sbjct  272   S-GDPKVWEVQPLNRICDLKTQIQVDLSGFVITGENPVPLFLGEVGIDQRGVNRADNRFF  330

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
              C L+Y+A+ DLDW +WA QGSYY +EG  GPDE YG+   +W  LR+P F  ++  +++
Sbjct  331   TCFLAYVAENDLDWGLWAFQGSYYFKEGIAGPDENYGLMNFDWNYLRSPEFDDRIWLIKR  390

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVV-GDQIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
              +QDP S   T  L+YHPLSG C      ++I+ S     SR   + DG PI ++GS  C
Sbjct  391   MIQDPDSILSTSYLMYHPLSGNCVHASEKNEIYASRFQQHSRWSHDGDGAPIRLMGSALC  450

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L  +G+ L   LS  C   QS+   L S+S   L  K ++G  LCL+   S++ S + TR
Sbjct  451   LKAIGDGLEPVLSNDCFSQQSSW-KLLSSSKLHLGVKDEHGEYLCLE-KESFNSSKVFTR  508

Query  1666  KCVGLEEGD--MRNPQTQWFKLIASN  1737
             KC+ +E+      NPQ+QWFKLI +N
Sbjct  509   KCICIEDDSDCQENPQSQWFKLIKTN  534



>ref|XP_006439449.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
 gb|ESR52689.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
Length=538

 Score =   462 bits (1190),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 332/510 (65%), Gaps = 10/510 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++  +G+RVKLAC +W  HL+PML EGLD++PL +I   V  M FNCVRLTW+T+MF
Sbjct  28    RWIINASTGQRVKLACVNWPAHLQPMLAEGLDKKPLGEIVAAVVKMHFNCVRLTWSTFMF  87

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y +++V Q+   L L EA  G++ NNP +L++  + A +AVV E+G  GIM++LDN
Sbjct  88    TRPNYGHISVSQTLDSLDLKEAKQGISKNNPFILNMTHIQAYEAVVGELGAQGIMVLLDN  147

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDP+EW++GL+ VA+ FK+   VV +SLRNELRGP QN
Sbjct  148   HISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQN  207

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+ +GA+ ++  NP++LV +SGL++DLD RFL++ P     +  K+VYE H Y+
Sbjct  208   EPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSP-LALDLDNKLVYEIHWYS  266

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++ Q+  W   P N VC+ +T+    +  FL    NP PL +SEFG +Q   + ADN +
Sbjct  267   FSQDQN-MWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLY  325

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C+++Y A+ DLDW++WALQGSYYLR G  G +ET+G   + W   RNPNFL +L FLQ
Sbjct  326   MTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQRPRNPNFLERLRFLQ  385

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
              K   P +S   T  +++HPLSG C      ++++ S+    SR     DG PI ++   
Sbjct  386   TKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPIRLMDRS  445

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDN--GLVLCLDFDSSYSPST  1653
              CL VVG+ LP  LS  C   QS  WSL S+S   LA K D   G +LCL    + S   
Sbjct  446   LCLKVVGDGLPPMLSNDCQSNQS-AWSLVSSSKLHLATKDDEHGGELLCLQVSPTNSSQV  504

Query  1654  ILTR-KCVGLEEGDMRNPQTQWFKLIASNT  1740
             + T+  CVG +   ++NPQ+QWFKL+ +N 
Sbjct  505   VTTKCICVGDDSSCLQNPQSQWFKLVLTNV  534



>ref|XP_011080894.1| PREDICTED: uncharacterized protein LOC105164044 [Sesamum indicum]
Length=409

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 272/363 (75%), Gaps = 1/363 (0%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+ +G RVKL C +WA HLEPML EGL+++P  +IA  V+ MGFNCVRLTWATYMF
Sbjct  27    RWIIDEATGARVKLICINWAAHLEPMLAEGLNKQPAGRIARLVAEMGFNCVRLTWATYMF  86

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+AN+TV QS   LGL +A+ G+A NNP  L++ +VDA++AVVE + R G+M+VLDNHV
Sbjct  87    TRFANLTVAQSLTRLGLVDAMEGIAVNNPGFLNVTVVDAQRAVVEALVRQGVMVVLDNHV  146

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+PMWCC +HDGN FFG  YFD  EWLQGL+IVA ++KDT MVVG+S+RNELRGPLQN  
Sbjct  147   SQPMWCCGEHDGNGFFGDKYFDAKEWLQGLSIVAKLYKDTSMVVGISMRNELRGPLQNAS  206

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             VW+ Y+E GA  I  ANP LLVII GL YDL F +LKE P      K K+VYE HRYAFT
Sbjct  207   VWHGYMESGAMRIQKANPRLLVIIPGLHYDLSFTYLKENP-LQLNFKNKLVYEIHRYAFT  265

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              GQ+K W+     + C+ + + ++ + GFL  G N  PLFVSEFG+ Q+G   A+N  L 
Sbjct  266   AGQTKMWLNNIFAETCNSVRQGIQRQAGFLSEGQNAAPLFVSEFGVKQVGVVRAENLFLR  325

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C L YLA++DLDW VWALQGSYY++ G HGPDETYGM   NW+++RNP FL +L  +QQ+
Sbjct  326   CFLGYLAEMDLDWGVWALQGSYYVKHGVHGPDETYGMLDFNWSSVRNPEFLQRLHLIQQQ  385

Query  1312  LQD  1320
             ++D
Sbjct  386   IRD  388



>gb|EYU23409.1| hypothetical protein MIMGU_mgv1a004243mg [Erythranthe guttata]
Length=538

 Score =   460 bits (1184),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 238/512 (46%), Positives = 333/512 (65%), Gaps = 17/512 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++  +G RVKL CA+WAGHL+ M+PEGL+++P+S IA+ ++ +GFNCVRLTWAT+MF
Sbjct  35    RWIVNQGTGNRVKLTCANWAGHLQAMVPEGLEKKPVSYIASQIAKLGFNCVRLTWATFMF  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y+N+ V  +     L  A SG+  NNP  L ++++D +KAVV E+G++ +M+VLDN
Sbjct  95    TRPEYSNLKVSAALDKYNLAAAKSGIGKNNPQFLEMSVIDVQKAVVGELGKNNLMVVLDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS P WCC D DGN FFG   FD +EWLQGL  VA  +K  P VV +SLRNELRG  QN
Sbjct  155   HVSLPGWCCGDDDGNGFFGDANFDTNEWLQGLTAVARSYKGNPAVVAMSLRNELRGNRQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + WYK +  GA+ ++  NP++L+I+SGLSYD D  FLK++      +  K+VYE H YA
Sbjct  215   TNDWYKNMAAGAQTVHTQNPDVLIIVSGLSYDSDLSFLKQQD-LQSGINNKIVYEAHWYA  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F  G  K W     N++C D T+   +K  FL    NP PLF+SEFGI+Q G +EADNR+
Sbjct  274   FGTGPDK-W-DARTNQLCADFTKNARDKYFFLTTKENPYPLFLSEFGIDQRGTNEADNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C+L+ +A++D+DWS+WA+QGSY LREG    +ETYG+   NW   +NP F+ +L+ L+
Sbjct  332   ITCLLAAVAEIDIDWSLWAIQGSYILREGNADVEETYGVMNFNWDGPKNPAFVDRLQILK  391

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             Q  Q   S  P Y ++ HP SG+C ++   + + ++DC  ASR  Q  DG P+ + GS  
Sbjct  392   QVNQGANSKNPGYYIMLHPQSGKCVQIGNNNSVRLADCKTASRWDQHQDGGPLKLSGSSL  451

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             CLAV G+    ++S  C    ++ W   S+S  QLA +   G   CL+ + S   ST++T
Sbjct  452   CLAVAGDGGATSVSDNC----TSKWKYVSSSGLQLAAQDGMGKYFCLEMNGS-DHSTVIT  506

Query  1663  RK--CVGLEEGDMR----NPQTQWFKLIASNT  1740
             +K  CVG + GD      NPQ QWFKL+ +N 
Sbjct  507   KKCLCVGDDLGDFSTCADNPQVQWFKLVPANV  538



>gb|KHN45741.1| Endoglucanase [Glycine soja]
Length=531

 Score =   459 bits (1182),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 233/507 (46%), Positives = 326/507 (64%), Gaps = 9/507 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +G+RVKL CA W  H  PML EGLD+ P++ IA +++  GFNCVRL++ATYMF
Sbjct  30    RWIIDDATGKRVKLHCAHWVAHATPMLAEGLDKSPMNDIAANIAKAGFNCVRLSYATYMF  89

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN TV   F    +   +S +   NP +L++  + A +AVV+ +G HG+M+++DNHV
Sbjct  90    TRYANNTVRDIFHTHDIPGIVSAIEKYNPRVLNMTHLQAYEAVVDALGDHGVMVLIDNHV  149

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S   WCCA+ D N FFG  +F+  EWLQGLA +A+ FK  P V  + LRNELRG  QN  
Sbjct  150   SLAKWCCANDDQNGFFGDRHFNTSEWLQGLAFIAHHFKGKPNVFAMDLRNELRGSRQNHH  209

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              WYKY+ +GA  I++ NP+ +VIISGL++D D  FLK++P        K+VYE+H Y+ +
Sbjct  210   DWYKYMTQGANTIHDINPDFIVIISGLAFDNDLSFLKKKP-LDLNFPHKIVYESHIYSVS  268

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              G +  W   P+N +C+   + + ++  FL+ G NP PL VSEFG +  G S ADN +LP
Sbjct  269   -GDTHRWRVQPVNWICNATIQLLHQQSSFLLSGKNPAPLLVSEFGYDMTGGSFADNMYLP  327

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C++SY A +DLDWS+WA QGSYY R+GK G  E+Y +   +W + R+PNF  K E LQ+ 
Sbjct  328   CIVSYFASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMDDDWKSYRDPNFTQKFELLQRM  387

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             +QDP S+     +++HPL+G CA V    ++ M DC   S    E DG PI ++ S KCL
Sbjct  388   VQDPTSNVSKSNIIFHPLTGYCAHVNNSKELVMGDCKSNSLWSYEGDGSPIRLMNSAKCL  447

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
               VGE LP +LS  C   QS +W   S +   LA    +G +LCL+ DS  + S I+T K
Sbjct  448   KAVGERLPPSLSEDCLSPQS-SWKTVSMTGLHLATFDKDGDLLCLEKDS--NSSKIVTSK  504

Query  1669  CVGLEEGD---MRNPQTQWFKLIASNT  1740
             C+ + + D   + NPQ+QWFKL+++N 
Sbjct  505   CICISDDDSSCLDNPQSQWFKLVSTNV  531



>gb|EYU23411.1| hypothetical protein MIMGU_mgv1a004205mg [Erythranthe guttata]
Length=539

 Score =   459 bits (1181),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 245/516 (47%), Positives = 336/516 (65%), Gaps = 22/516 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL CA+W  HL+PM+ EGL+++PLS IA  V   GFNCVR TW T+MF
Sbjct  32    RWIIDQETGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKVPETGFNCVRFTWPTFMF  91

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N+TV +S     LT A SG+A NNP  LS+ + +   AVV E+G++ +M+VLDN
Sbjct  92    TRPDYYNLTVSESLDKYNLTAAKSGIAENNPGFLSMKVAEVHMAVVNELGKNKVMVVLDN  151

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS+P WCC D+DGN FFG   FDP EWLQGL  VA  +K    VVG+S+RNELRGP QN
Sbjct  152   HVSQPGWCCGDNDGNGFFGDANFDPAEWLQGLTAVARAYKGNSAVVGMSMRNELRGPRQN  211

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPl-klkmmkkkvvYETHRY  942
              D WYKY+++GAKAI+  NP+ LVI+SGL YD +  FLKE+PL   K +  K+VYE H Y
Sbjct  212   TDDWYKYMQQGAKAIHKENPDFLVIVSGLYYDTNLGFLKEKPLPLQKNLDNKLVYEAHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
              F  G  K W     N +C  +T+   +   FL  G NP PLF+SEFGI+Q G +EA+NR
Sbjct  272   TFGTGADK-W-DAQTNNLCAAVTKIARDNYIFLTTGENPFPLFLSEFGIDQRGTNEAENR  329

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L+ +A++D+DW++W  QGSY LREG    +E YG+   NW   RNP +L +L+ L
Sbjct  330   YISCLLAVVAEIDIDWALWTFQGSYILREGTLNLEEVYGVMDLNWDGPRNPQYLDRLQIL  389

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARV--VGDQIHMSDCSGASRCIQEADGKPIHMI-G  1473
             +QK Q+  S  P Y +++HP SG+CA +   GD I ++ C  A+R  Q  DG PI +  G
Sbjct  390   RQKNQELESKNPNYYIMFHPQSGKCAHIYKYGDII-LATCETATRWEQHQDGGPIKLAGG  448

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
             S +CL V G+    ++S  C    S+ W + S+S   LA +   G  LCL+ +++    T
Sbjct  449   SSRCLTVAGDGGAASVSGDC----SSKWKIVSSSGLHLAAQDGKGKYLCLEMNAT-DNFT  503

Query  1654  ILTRKCVGLEEGDMR-------NPQTQWFKLIASNT  1740
             I+T+KC+ + + D+R       NPQ QWFKL+ +N 
Sbjct  504   IVTKKCLCVGD-DLRDFPTCSDNPQGQWFKLVPANV  538



>ref|XP_003608279.1| Endoglucanase [Medicago truncatula]
 gb|ABD32354.1| Glycoside hydrolase, family 5; Ricin B-related lectin [Medicago 
truncatula]
 gb|AES90476.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=536

 Score =   458 bits (1179),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/508 (45%), Positives = 323/508 (64%), Gaps = 11/508 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +GER+KL CA W GH  PML EGLD+ P+  IA  ++  GFNCVRL++ATYMF
Sbjct  32    RWIIDDATGERMKLTCAHWVGHATPMLVEGLDKLPIQDIANQIAKSGFNCVRLSYATYMF  91

Query  412   TRYANMTVVQSFGDLGL-TEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNH  588
             TR+AN T+  +   L +  + +S +  +NP +L++  V A +A ++ +G  G+M+++DNH
Sbjct  92    TRHANDTIRDTLYSLDIPKDVVSAIEKHNPLMLNMTHVQAYEAAIDALGEKGVMVLIDNH  151

Query  589   VSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNV  768
             VS   WCC ++D N FFG  +F PDEWLQGLA +A  F+  P V+ + LRNELRG  QN+
Sbjct  152   VSMAEWCCDNNDQNGFFGDRHFHPDEWLQGLAFIAKHFRGKPNVIAMDLRNELRGGRQNL  211

Query  769   DVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF  948
               WYKYV +GA  I+  NP+LL++ISGL++D D  FLK++         K+VYE H Y+F
Sbjct  212   PDWYKYVSQGASTIHKHNPDLLIVISGLNFDNDLSFLKKK-TLDLNFTNKLVYEAHIYSF  270

Query  949   TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
             +  Q + W   P+N VC  +   + ++ GFL+ G NP PLF+SEFG +  G +  DN+ +
Sbjct  271   SGNQDR-WNLQPMNWVCSSVIENLNDQAGFLISGNNPVPLFISEFGYDMTGGNAVDNKFM  329

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
             PC +SY A +DLDWS+W+  GSYY REG  G  ETY +   +W   R+P F  K + LQ+
Sbjct  330   PCFVSYAASVDLDWSLWSFGGSYYFREGSVGAGETYAVMDYDWKNYRDPKFPQKFQLLQK  389

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             K+QDP S+     +++HPL+G+CA   G  +++ + DC   S    E DG PI ++ S  
Sbjct  390   KIQDPTSNLSKSHIMFHPLTGKCAHANGSNNELVLGDCKSHSEWSFEGDGSPIRLMDSAM  449

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             CL   GE LP TLS  C   QS +W   S +   LA    NG + CL+ +S    S I+T
Sbjct  450   CLKAEGEGLPATLSEHCLSPQS-SWKSVSKTGLHLATSHGNGPLFCLEMES--DSSKIVT  506

Query  1663  RKCVGLEEGD---MRNPQTQWFKLIASN  1737
             RKC+ ++E D   + NPQ+QWF+LI++N
Sbjct  507   RKCICIDENDSSCLDNPQSQWFQLISTN  534



>gb|EYU23408.1| hypothetical protein MIMGU_mgv1a020519mg [Erythranthe guttata]
Length=538

 Score =   458 bits (1179),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 241/512 (47%), Positives = 333/512 (65%), Gaps = 16/512 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G+RVKL CA+W  HL+PM+ EGL+++PLS IA  +S  GFNCVR TW T+MF
Sbjct  34    RWIVDQATGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKISETGFNCVRFTWPTFMF  93

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N+TV +S     LT A SG+A NNP  L++ + +  KAVV E+G++ +M+VLDN
Sbjct  94    TRPDYYNLTVSESLDKFKLTAAKSGIAKNNPGFLNMKVAEVHKAVVNELGKNKVMVVLDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S+P WCCAD+DGN FFG   FDP EWL+GL  VA  +K    V+G+S+RNELRG  QN
Sbjct  154   HISQPGWCCADNDGNGFFGDALFDPTEWLKGLTAVATAYKGNSAVIGMSMRNELRGGRQN  213

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY++ GA+AI+  NP+ LVI+SGL  D    FL   PL++  +K K+VYE H Y 
Sbjct  214   VNDWYKYMQAGAEAIHKENPDFLVIVSGLYTDTSLNFLNGHPLQVNNLKNKLVYEAHWYT  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F     + W   P N++C  +T+  ++   FL    NP PLF+SEFGI+Q G ++A+NR+
Sbjct  274   FGV-PPETWATQP-NQLCATMTKRAQDNYLFLTTSQNPTPLFLSEFGIDQRGGNDAENRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C+L+ +AD D+DW++W  QGSY LREGK   +E YG+   NW   RNP FL KL+ ++
Sbjct  332   ITCLLATVADRDIDWALWTFQGSYILREGKVNSEEAYGVMDLNWDRPRNPAFLDKLQLIR  391

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             Q  Q+  S +PT  +++HP SG+C +V   + I +S+C  ASR  Q  DG PI + GS +
Sbjct  392   QMNQELESKKPTNYIMFHPQSGQCVQVGKNNNIILSNCKTASRWDQHQDGGPIKLAGSPQ  451

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             C+ V G+     +S  C    S+ W +AS S   LA +   G  LCL+ ++S   STI+T
Sbjct  452   CIGVAGDGGAARVSGDC----SSKWKIASTSGLHLAAQDGKGKYLCLEMNAS-DHSTIVT  506

Query  1663  RK--CVGLEEGDM----RNPQTQWFKLIASNT  1740
             +K  CVG +  D      NPQ QWFKL+A N 
Sbjct  507   KKCLCVGDDLVDFPTCSDNPQVQWFKLVAVNV  538



>ref|XP_008459280.1| PREDICTED: uncharacterized protein LOC103498458 [Cucumis melo]
Length=719

 Score =   463 bits (1191),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 243/514 (47%), Positives = 325/514 (63%), Gaps = 16/514 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKL C +WAGH++ ML EGL RRPL  IA  V+ + FNCVRLT++ +MF
Sbjct  205   RWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRFNCVRLTYSIHMF  264

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+AN+TV QSF +  + +A+ G+A NNP++L+L LV+A  AVV+ +  HGIM+V DNH+
Sbjct  265   TRHANVTVKQSFENFDMKDALVGIAQNNPSILNLTLVEAYGAVVDSLAAHGIMVVSDNHI  324

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC + DGN FFG  YFDP EW QG+++ A   K    VV +SLRNE RGP QNV+
Sbjct  325   SQPRWCCDNDDGNGFFGDRYFDPQEWFQGISLAAQSLKSKAQVVAMSLRNEPRGPNQNVE  384

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W++Y+ +GAK I+  NPN LV++SGLSYD D  FL+ R      +  K+V+E H Y+FT
Sbjct  385   KWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFLRNR-SMGFNLDNKLVFEAHLYSFT  443

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   WM  PLN  C  I +  E++ GFLVRG NP PLFVSEFGI+Q G +E  NR L 
Sbjct  444   NNMRDFWMSKPLNTFCASINQGFEDRAGFLVRGQNPIPLFVSEFGIDQTGTNEGQNRFLS  503

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPN-FLSKLEFLQQ  1308
             C  SYL + D DW +WALQGSYY + G     E +G+  +N+T  +N   FL + + +Q 
Sbjct  504   CFFSYLTENDFDWGLWALQGSYYYKVGVKNAGENFGVLDSNFTKAKNSKLFLQRFQLMQT  563

Query  1309  KLQ---------DPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKP  1458
             KLQ         DP S+  T  ++YHPLSG C R+    Q+ +S C  ++R   E DG P
Sbjct  564   KLQESQRLLFYTDPSSNFTTSFIMYHPLSGGCMRMNKKYQLGISSCKTSNRWSHEQDGAP  623

Query  1459  IHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
             I + GS+ CL  +G  LP  LS  C+  QS  W   SN+  QLA   + G  LCL   +S
Sbjct  624   IKLAGSILCLKAIGVGLPPILSQDCSSQQS-IWKYGSNAKLQLATVDEQGQALCLQ-RAS  681

Query  1639  YSPSTILTRKCVGLEEGD-MRNPQTQWFKLIASN  1737
             +S   I+T KC+   +     +PQ+QWF L+ SN
Sbjct  682   HS-HQIVTNKCLCSNDSQCQEDPQSQWFTLVPSN  714



>ref|XP_004170746.1| PREDICTED: endoglucanase E1-like [Cucumis sativus]
Length=539

 Score =   454 bits (1168),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 226/507 (45%), Positives = 324/507 (64%), Gaps = 5/507 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D QSG+RVKL C +W  H + ML EGL+ RPL ++A     + FNCVRLT+AT+MF
Sbjct  32    RWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLTYATHMF  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN TV ++F  L L +A +GLA  N  +L+  + +A +AVV+ +G  G+M++ DNH+
Sbjct  92    TRYANRTVEENFDLLDLEQAKAGLAQYNAFVLNKTIAEAYEAVVDVLGASGLMVIADNHM  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC+  DGN FFG+ YFDP EWLQGL++VA  F +   VVG+SLRNELRG ++N +
Sbjct  152   SQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGMSLRNELRGMMENAN  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W  YV +G   I+  NP +LVI+SGL+YD D R LK++PL +  +  K+ +E H Y+F+
Sbjct  212   DWNNYVTQGVTTIHKINPAVLVIVSGLNYDNDLRCLKDKPLNVSTLDNKLAFEVHLYSFS  271

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   +++ PLN +C  I  E  +   F++ G NP PLFVSE+G +Q    +A+NR + 
Sbjct  272   GDSESKFVQQPLNNICAKIMHEFIDHAEFVIEGPNPFPLFVSEYGYDQREVDDAENRFMS  331

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C  ++LA  DLDW++W  QGSYY REG+    ET+G+  +NWT ++NPNF+ K + LQ  
Sbjct  332   CFTAHLAQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTM  391

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGD--QIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             LQDP S+     ++YH  SG+C  V  D  +I +++CS +SR   + D  PI M  +  C
Sbjct  392   LQDPNSNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLC  451

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L   GE L  +LST C  G+ + WS  SNS   L    ++G  LCL    S + S I+T 
Sbjct  452   LKASGEGLEASLSTDC-VGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTN  510

Query  1666  KCVGLEEGD--MRNPQTQWFKLIASNT  1740
              C+        +++ Q+QWF+L+A+NT
Sbjct  511   SCICTANDPTCLQDTQSQWFELVATNT  537



>gb|KGN45940.1| hypothetical protein Csa_6G028440 [Cucumis sativus]
Length=539

 Score =   454 bits (1167),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 227/507 (45%), Positives = 325/507 (64%), Gaps = 5/507 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D QSG+RVKL C +W  H + ML EGL+ RPL ++A     + FNCVRLT+AT+MF
Sbjct  32    RWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLTYATHMF  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN TV ++F  L L +A +GLA  NP +L+  + +A +AVV+ +G  G+M++ DNH+
Sbjct  92    TRYANRTVEENFDLLDLEQAKAGLAQYNPFVLNKTIAEAYEAVVDVLGASGLMVIADNHM  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC+  DGN FFG+ YFDP EWLQGL++VA  F +   VVG+SLRNELRG ++N +
Sbjct  152   SQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGMSLRNELRGMMENAN  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W  YV +G   I+  NP +LVI+SGL+YD D R LK++PL +  +  K+ +E H Y+F+
Sbjct  212   DWNNYVTQGVTTIHKINPAVLVIVSGLNYDNDLRCLKDKPLNVSTLDNKLAFEVHLYSFS  271

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   +++ PLN +C  I  E  +   F++ G NP PLFVSE+G +Q    +A+NR + 
Sbjct  272   GDSESKFVQQPLNNICAKIMHEFIDHAEFVIEGPNPFPLFVSEYGYDQREVDDAENRFMS  331

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C  ++LA  DLDW++W  QGSYY REG+    ET+G+  +NWT ++NPNF+ K + LQ  
Sbjct  332   CFTAHLAQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTM  391

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGD--QIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             LQDP S+     ++YH  SG+C  V  D  +I +++CS +SR   + D  PI M  +  C
Sbjct  392   LQDPYSNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLC  451

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L   GE L  +LST C  G+ + WS  SNS   L    ++G  LCL    S + S I+T 
Sbjct  452   LKASGEGLEASLSTDC-IGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTN  510

Query  1666  KCVGLEEGD--MRNPQTQWFKLIASNT  1740
              C+        +++ Q+QWF+L+A+NT
Sbjct  511   SCICTTNDPTCLQDTQSQWFELVATNT  537



>ref|XP_002272454.2| PREDICTED: uncharacterized protein LOC100267356 isoform X1 [Vitis 
vinifera]
Length=575

 Score =   449 bits (1155),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 238/508 (47%), Positives = 317/508 (62%), Gaps = 10/508 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+ +G RVK+AC +W  HLEP++ EG+  +P+ +IA  V  MGFNC+RLT+AT+M+
Sbjct  70    RWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLTYATFMW  129

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N TV QS     LT+A  G+A NNP LL+L ++DA +AVV E+G HG+M+VLDN
Sbjct  130   TRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGLMLVLDN  189

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP+WCCA  DGN FFG +YFDP EW++GL  V+  FK+ P VV +S+RNE+RG   N
Sbjct  190   HVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEMRGARSN  249

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y+ KGAKAI+ ANP +LVI+SGL++D D  FL  R      +  KVV+E H Y 
Sbjct  250   VPDWYRYMRKGAKAIHKANPKVLVIVSGLNFDKDLSFLG-RKSFGFTLNNKVVFEAHWYT  308

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F   Q   W + P N+ C     E +    FL  G    PLF+SE+GIN    S+ D+R+
Sbjct  309   FDFTQQ--WQQLPPNRACRQRADEFQRDAAFLTTGDKAAPLFISEYGINLQETSQVDSRY  366

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L  +A+ DLDW++W LQ SY+ R+G  G  E+Y +   +W+  R P FL ++  LQ
Sbjct  367   FTCFLPTVAEKDLDWALWTLQASYHYRQGHAGGGESYSVLDYSWSKPRYPQFLERMVILQ  426

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVV-GDQIHMSDC---SGASRCIQEADGKPIHMIG  1473
               LQDP S+   Y LL H  SG C  V   D + +S C   S  SR   E D  PI  +G
Sbjct  427   NLLQDPNSNVSPYYLLVHAQSGFCVNVKHNDVVSVSSCRKNSRNSRWNHEGDRSPIKKLG  486

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
                CL  VG+ +PLTLS  C+  ++ TW L S+SM Q+A   + G  LCLD   S + + 
Sbjct  487   RKHCLKAVGDGVPLTLSDDCSSPRA-TWQLVSDSMLQIAAMDEQGNPLCLDATPSSNSTP  545

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             ILTR C  L      +P +QWFKL+ SN
Sbjct  546   ILTRACACLNNEAGCDPLSQWFKLVPSN  573



>ref|XP_011080895.1| PREDICTED: uncharacterized protein LOC105164045 [Sesamum indicum]
Length=535

 Score =   445 bits (1144),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 233/511 (46%), Positives = 327/511 (64%), Gaps = 14/511 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  SG+RVKLAC +W  HL+PM+ EGL+++P+S IA  +   GFNCVR TWAT+MF
Sbjct  31    RWIVDQASGKRVKLACVNWVSHLQPMIVEGLEKKPVSCIARQIVATGFNCVRFTWATFMF  90

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y+ +TV +S    GL +A +G+  NNP  L++N+V+  KAVV E+G++ +M+VLDN
Sbjct  91    TRTDYSKLTVSESLDKYGLKDAKAGIMKNNPQFLNMNVVEVHKAVVNELGKNKVMVVLDN  150

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS+P WCC+  DGN FFG   FDP EWLQGLA VA  +K   +V+G+SLRNELRG  QN
Sbjct  151   HVSQPKWCCSGADGNGFFGDAEFDPTEWLQGLAAVAGTYKGNSVVIGMSLRNELRGDRQN  210

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+++GAK ++  NP+ LVI+SGLSYD +  FLK +P     +K K+VYE H Y+
Sbjct  211   EADWYKYMQEGAKTVHQENPDCLVIVSGLSYDTNLGFLKAKP-LGVNLKNKLVYEAHWYS  269

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F     K W     N +C    +   +   FL  G NP PLF+SEFGI+Q G +EADNR+
Sbjct  270   FGTPADK-WA-AETNHLCGAAAKTARDNYVFLTTGDNPFPLFLSEFGIDQRGANEADNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C+L+ +A+ D+DW++W  QGSY LREG    +E YG+   NW   RNP FL +L+ ++
Sbjct  328   ISCLLAVVAETDIDWALWTFQGSYMLREGTVNLEEVYGVNDLNWDRPRNPAFLDRLQLIR  387

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             Q  Q+P ++ PTY +++HP SG+C R+    I +++C  AS   Q  DG  I + GS +C
Sbjct  388   QLNQEPKTNRPTYYIMFHPQSGQCVRIGKTNIVLANCKTASHWDQHQDGGTIKVAGSPQC  447

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L V G+     +S  C+   S  W   S+S   L  +   G  LCL  + S S ST++T+
Sbjct  448   LGVAGDGKVAGVSDDCSSNGSK-WKHVSSSGLHLGAQDGEGKYLCL--ERSASNSTLVTK  504

Query  1666  KCVGLEEGDM------RNPQTQWFKLIASNT  1740
             KC+ + +  +       NP+ QWFKL+ +N 
Sbjct  505   KCLCVGDNLVDFPTCDDNPEVQWFKLVPANV  535



>ref|XP_004510834.1| PREDICTED: uncharacterized protein LOC101496378 [Cicer arietinum]
Length=540

 Score =   445 bits (1145),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 230/511 (45%), Positives = 322/511 (63%), Gaps = 13/511 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD + ERVKL C +WAGHL+PM+PEGLDRRPL ++   +    FNCVRLT+A YM+
Sbjct  35    RWIIDDSTSERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVQKKFNCVRLTYAIYMW  94

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+ +  V ++F DL   EA+ G+A  NP +L +  ++A  AVV E+    + ++LDNHV
Sbjct  95    TRHGHDIVNETFSDLDAPEAVDGIAKYNPFVLKMTHIEAFDAVVNELAAQNVKVLLDNHV  154

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC D DGN FF   +FDP EW+ GL + A  F     VV +SLRNEL GP QN+ 
Sbjct  155   SEPKWCCNDDDGNGFFYDRHFDPQEWIHGLTLAAKHFNGHHHVVAMSLRNELHGPRQNLK  214

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF-  948
              WYKY+ + A +I+ ANPN+LV+ISGL YD + +FL+ +P     + KK+VYETH Y+F 
Sbjct  215   DWYKYMSQAALSIHKANPNVLVVISGLIYDTELQFLRNKP-LNIDIGKKMVYETHLYSFS  273

Query  949   ---TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
                T      W K PLN++C +  R ++++ GFL  G N  PL +SEFG +Q G S  DN
Sbjct  274   GIGTLKLRDIWTKQPLNRICANTVRGLDQRAGFLTIGENAVPLIISEFGFDQTGSSVEDN  333

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L C+ +YL   DLDW +WA  GSYY+RE K   DE++G+    W  LR PNF  K + 
Sbjct  334   RFLTCLQTYLVGRDLDWGLWAFHGSYYVREDKVQLDESFGVLDATWHNLRYPNFTDKFQL  393

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             LQ+  QDP S  P   ++YHPL+G+CA+V   +++ +  C G ++     DG  I   G+
Sbjct  394   LQRMNQDPTSKLPKAYIMYHPLTGKCAQVNEKNELEIGSC-GENKNRWIYDGSQILWNGT  452

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGD-NGLVLCLDFDSSYSPST  1653
              KCL   GEDLP+++S  C   ++++W   S S   LA   D NG  LCL  DS  + S 
Sbjct  453   KKCLTASGEDLPVSVSDDCK-SKNSSWKPVSLSRLHLATSHDQNGKQLCLHKDS--NSSV  509

Query  1654  ILTRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             ++T KC+ + +    + +PQ+QWF+L+A+N 
Sbjct  510   VVTSKCICINDDSLCLDDPQSQWFQLVATNV  540



>ref|XP_010916958.1| PREDICTED: uncharacterized protein LOC105041671 [Elaeis guineensis]
Length=485

 Score =   442 bits (1137),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 229/487 (47%), Positives = 317/487 (65%), Gaps = 9/487 (2%)
 Frame = +1

Query  298   LEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTR--YANMTVVQSFGDLGLTEA  471
             +  +L EGLD++P+  IA  ++ +GFNCVRLTWATY+FT   Y N+TV  S   LGL +A
Sbjct  1     MPAVLAEGLDKQPVDGIAARIAGLGFNCVRLTWATYLFTNESYENLTVSDSLSSLGLGDA  60

Query  472   ISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVY  651
             ++G+  NN  ++ + + +A  AVV+ IG  G+M+VLDNHVS+P WCC + DGN FFG +Y
Sbjct  61    LAGVRRNNGRMVGMTVREAYDAVVKAIGEAGLMVVLDNHVSRPQWCCGNADGNGFFGDLY  120

Query  652   FDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNL  831
             FDP+EWL+GL +VA  ++D   VVG+S+RNELRGP Q+   WY+ + +GA+ I++ NP++
Sbjct  121   FDPEEWLRGLELVARRYRDIHQVVGMSMRNELRGPNQSEPAWYRNIGRGAQTIHDTNPDV  180

Query  832   LVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDIT  1011
             L+I SGL+YD D  FLK+RP        K+V E H YAF++G+S  W   P N+VC ++ 
Sbjct  181   LIIASGLNYDTDLSFLKKRP-LESNFDNKLVLEAHWYAFSDGRSLDWADQPPNRVCSELV  239

Query  1012  REMEEKEGFLVRGGNPG--PLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWAL  1185
             R  +E+ GF+V   N    PLFVSEFG++Q G + ADNR L C L Y A+ DLDW++WAL
Sbjct  240   RRFDEQAGFVVHNQNGSVLPLFVSEFGVDQRGTNRADNRFLSCFLGYAAERDLDWALWAL  299

Query  1186  QGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPL  1365
             QGSYY+R+G  G  ETYG+  +NW   +NP F  K   +Q+ LQ+P SS  T Q++YHP 
Sbjct  300   QGSYYMRDGIPGSKETYGVLDSNWDQAKNPRFQEKFRLIQEMLQEPRSSTATNQIIYHPH  359

Query  1366  SGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDG  1542
             SG+C  V  D  + +SDC        + +   I + GS  CL V GE L + LS  CND 
Sbjct  360   SGQCVSVDDDNNVVLSDCKNRKWWSYDGNRTAIWLAGSTHCLRVEGEGLSVLLSAECNDN  419

Query  1543  QSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKCVGLEE-GDMRNPQTQWF  1719
             QS  W   S+S FQ++     G  LCL+ +SS S S I T++C+  +  G  +NPQTQWF
Sbjct  420   QS-FWGPVSSSWFQISGMDAQGRNLCLERNSSNSDS-IWTKECLCSDNLGCSKNPQTQWF  477

Query  1720  KLIASNT  1740
             + I SN 
Sbjct  478   RFIPSNV  484



>emb|CBI34407.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   440 bits (1132),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 231/480 (48%), Positives = 317/480 (66%), Gaps = 8/480 (2%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTR--YANMTVVQSFGDLGLTEAISG  480
             M+ EGL  +P+  IA  V++MGFNC+RLT+AT+M+TR  Y+N TV QS     LT+A  G
Sbjct  1     MVTEGLHTQPIKDIAAKVTSMGFNCIRLTYATFMWTRSDYSNKTVAQSLDSFNLTQAREG  60

Query  481   LAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDP  660
             +A NNP LL+L+L +A +AVV+E+G +G+M+VLDNHVSKPMWCCA  DGN FFG ++FDP
Sbjct  61    IARNNPQLLNLSLQEAYEAVVDELGANGLMLVLDNHVSKPMWCCAREDGNGFFGDMFFDP  120

Query  661   DEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVI  840
              EW++GL  VA  FK  P VV +S+RNE+RGP QN+  WYK + +GAKAI++ NP++LV+
Sbjct  121   KEWIEGLTQVAKRFKGKPQVVAMSMRNEIRGPRQNLPDWYKNMREGAKAIHSTNPDVLVL  180

Query  841   ISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREM  1020
             +SGL++D D  FL   P     + KKVVYE H Y+F   Q   W   PLN+VC     E 
Sbjct  181   VSGLNFDKDLSFLSTTP-FGLTLDKKVVYEAHWYSFDFTQQ--WQTQPLNRVCRQRADEF  237

Query  1021  EEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYY  1200
             + +  FL+ G N  PL +SEFG++  G ++ADNR+  C+L  +A+ DLDW++W LQ SYY
Sbjct  238   QREAAFLITGDNAAPLIISEFGVDLRGVNQADNRYFNCLLPTVAEKDLDWALWTLQASYY  297

Query  1201  LREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRCA  1380
              REGK GP+E Y +   NW   R+P +L +L  LQQ +QDP S+  +Y L+ H  SG C 
Sbjct  298   YREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQQTIQDPNSTTLSYYLIVHTESGFCV  357

Query  1381  RVVG-DQIHMSDCSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTW  1557
              V G D +H S C   S+     DG PI ++G   CL  VG+ +P+TLST C   ++ TW
Sbjct  358   NVEGEDNVHGSSCRERSKWSHGGDGWPIRLVGGELCLKAVGDGVPVTLSTDCKSPRA-TW  416

Query  1558  SLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
              L S+S   +A   + G  LCL+  SS + S+ILTR+C  ++     +PQ+QWFKL+ SN
Sbjct  417   KLVSDSRLHVAAMDEQGNSLCLEATSS-NYSSILTRRCACVKNEANCDPQSQWFKLVPSN  475



>ref|XP_004143723.1| PREDICTED: uncharacterized protein LOC101213113 [Cucumis sativus]
Length=539

 Score =   442 bits (1136),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 237/513 (46%), Positives = 333/513 (65%), Gaps = 16/513 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKL C +W  H + ML EGLDRRPL  +A  V  + FNCVRLT+AT+MF
Sbjct  32    RWIVDSATGRRVKLVCVNWPSHTQSMLIEGLDRRPLKDLANEVVRLRFNCVRLTYATHMF  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN TV ++F  L L  A  GLA +NP +L++ + +A +AVV+ +G  G+M++ DNH+
Sbjct  92    TRYANRTVEENFDLLDLRAAKVGLAFHNPFVLNMTIFEAYEAVVDVLGTSGLMVIADNHI  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC+  DGN FFG  YFD +EWL+GL +VA  F +   VV +SLRNELRG      
Sbjct  152   SQPRWCCSLEDGNGFFGDRYFDTEEWLEGLRLVARRFYNKSAVVAMSLRNELRGASSKSK  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W KY+ +GA  I+N NP +LVIISGL++D D R  ++ PL+L  +  K+V+E H Y+F+
Sbjct  212   DWNKYITQGATTIHNINPKILVIISGLNFDNDLRCQRQYPLQLNNLHNKLVFEVHLYSFS  271

Query  952   -EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
              E QSK ++  PLNK+C  +     E+  F++ G    PLFVSEFG++Q G +EAD+R L
Sbjct  272   GESQSK-FIHNPLNKICSKVINGFVERAEFVMEGAEAVPLFVSEFGLDQRGVNEADDRFL  330

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
              C  ++L + DLDW++W  QGSYY R+GK GP+E +G+   NW+ +RNP+F    + LQ 
Sbjct  331   SCFSAHLVEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLNYNWSDVRNPHFSQMFQLLQT  390

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVVGD----QIHMSDCSGASRCIQEADGKPIHMIGS  1476
              LQDP S+     ++YHP SG+C  +V D    QI+++DCS AS    E DG PI +  +
Sbjct  391   MLQDPNSNSSNTYVMYHPQSGQCV-LVQDMKHMQIYLNDCSNASHWSYEGDGTPIMLAST  449

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLAN---KGDNGLVLCLDFDSSYSP  1647
               CL   G+ LP +LS  C  G+ + W+  S+S   LA    +G+NG  +CL+ +SS S 
Sbjct  450   NFCLKASGDGLPPSLSRDC-FGEQSVWTAISDSKLHLATLTKQGNNG--MCLEKESSNS-  505

Query  1648  STILTRK--CVGLEEGDMRNPQTQWFKLIASNT  1740
             S IL R   CVG +   +++ Q QWF+L+ +NT
Sbjct  506   SRILMRSCVCVGNDSNCLQDTQAQWFQLVVTNT  538



>gb|EYU23410.1| hypothetical protein MIMGU_mgv1a004297mg [Erythranthe guttata]
Length=534

 Score =   441 bits (1134),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 228/512 (45%), Positives = 327/512 (64%), Gaps = 19/512 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G+RVKL CA+WA H+EPMLPEGL+++P+S IA+ ++ +GFNCVRLTWATYMF
Sbjct  30    RWIIDQGTGKRVKLTCANWAAHMEPMLPEGLEKKPVSYIASQIAKLGFNCVRLTWATYMF  89

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N+ V +S     L  A +G+  NN   L ++++D +KAVV E+G++ +M+VLDN
Sbjct  90    TRPEYVNLKVSESLDRYSLAAAKAGIGKNNAQFLEMSVIDVQKAVVGELGKNNLMVVLDN  149

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              VS P WCC+D DGN F+G  YF  DEWLQGL  VA  +K  P VV +SLRNELRG  QN
Sbjct  150   TVSMPTWCCSDDDGNGFWGDKYFAVDEWLQGLTAVARAYKGNPAVVAMSLRNELRGKGQN  209

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             +  WY+Y++ GA+ ++  NP+ L+++SG SYD D  FLK        +  K+V+E H Y 
Sbjct  210   LLDWYRYMKAGAQTVHTENPDFLIVVSGTSYDSDLSFLK-LTDFEIGINNKIVFEAHWYT  268

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F  G  K W +   N +C D T+  +    FL    +  PLF+SEFGI+Q G +EADNR+
Sbjct  269   FGTGADK-W-EAQTNNLCADFTKTAQRNYLFLTSQYHAYPLFLSEFGIDQRGTNEADNRY  326

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C+L+ +A++D+DW++WA QGSY  REGK   DE YG+   NW A RNP F+ +L+ L+
Sbjct  327   ISCLLAAVAEIDIDWALWAFQGSYIFREGKPDVDEAYGVMNFNWDAPRNPGFVDRLQILR  386

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVG-DQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             Q  Q   S  P+Y ++ HP SG+C ++   + + +++C  ASR  Q  DG  + + GS  
Sbjct  387   QTNQVADSKNPSYYIMLHPQSGQCVQIGNTNNVLLANCKTASRWDQHEDGGLMKLSGSSL  446

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             CLAV G+    ++S  C     + W   S+S  QLA +   G   CL+ + S   ST++T
Sbjct  447   CLAVAGDGGAASVSGNCR----SKWKYVSSSGLQLAAQDGMGKYFCLEMNGS-DHSTVIT  501

Query  1663  RKCVGLEEGDMR-------NPQTQWFKLIASN  1737
             +KC+ + + D+R       NP+ QWFKL+ +N
Sbjct  502   KKCLCVGD-DLRDFSTCADNPEVQWFKLVPAN  532



>emb|CDP12092.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   451 bits (1159),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 241/515 (47%), Positives = 336/515 (65%), Gaps = 22/515 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD++G RVKL C +W GHLEP++ EGL ++PL  I  +V+ MGFNCVRLTWAT+MF
Sbjct  413   RWILDDKTGSRVKLTCVNWVGHLEPLVVEGLQKKPLPYIVDNVALMGFNCVRLTWATFMF  472

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N+TV +S   L L  +++G+A NNP LL   +V+ +KAVV E+GR  IM++LDN
Sbjct  473   TRENYGNLTVRESLNQLSLDGSVAGIAMNNPQLLDATVVEVQKAVVYELGRKNIMVILDN  532

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC   DGN FFG  +FDP EWLQGLA VAN++KD P VV +S+RNELRGP QN
Sbjct  533   HVSKPQWCCGGDDGNGFFGDEFFDPKEWLQGLAAVANLYKDAPNVVAMSMRNELRGPRQN  592

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + WY+Y+ +GA AI+  NP+LL+I+SGL Y+ D  F+KE+P  +     K+VYE H YA
Sbjct  593   TNDWYEYIPQGAAAIHGENPSLLIIVSGLGYETDISFVKEKP-LVLNFTNKLVYEAHWYA  651

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F +   + W+    N++C   ++   +   F+V    P PLF+SEFG +Q G +EADNR+
Sbjct  652   F-DTPWQIWL-SQTNQICAQRSQRFADHSAFVVSSSKPVPLFLSEFGADQRGGNEADNRY  709

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C+L+++A+ DLDW++W LQGSY LR+G    +E YGMF  NW  +RN     +L+ ++
Sbjct  710   LSCLLAFVAEHDLDWALWTLQGSYILRQGVVELEEVYGMFDVNWDHIRNSTLSRRLQLVK  769

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHM----I  1470
             Q + DP S+  T+  LYHP SG CA++  +  +  SDC    R  Q+  G  I +     
Sbjct  770   QIIWDPKSNNTTHSKLYHPQSGLCAQIGNNGSVRGSDCQSPGRWKQQEAGSSIQLEAEAE  829

Query  1471  GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
             G+  CL  VG+  P T+S+ C + Q+  W L S+S   +A +G     LCL+ +S  S S
Sbjct  830   GTFGCLRAVGDGQPATVSSDCGN-QTTLWKLVSSSQLHIAAQGG---YLCLEMNS--SDS  883

Query  1651  TILTRKCVGLEEGD------MRNPQTQWFKLIASN  1737
              ++TRKC+ L+E          NP+ QWFKL+ +N
Sbjct  884   VVVTRKCLCLDENSNDVPNCAENPEGQWFKLVPTN  918


 Score =   405 bits (1042),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/414 (50%), Positives = 287/414 (69%), Gaps = 9/414 (2%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRYANMTVVQSFGDLGLTEAISGLA  486
             MLPEGL + PL  I+ H+S +GFNC+RLTWA YM+TR+A++TV Q   DL LT+A++G+ 
Sbjct  1     MLPEGLSKSPLDDISRHISLLGFNCIRLTWAVYMYTRHAHVTVAQHLQDLNLTDALAGIQ  60

Query  487   snnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDE  666
              +NP+L SL LVDA+KAV+E +  HG+M++LD  VSKPMWCC D+DGN F+G  YFDP E
Sbjct  61    RHNPHLASLTLVDAQKAVIESVASHGVMVLLDCQVSKPMWCCNDNDGNGFWGDAYFDPHE  120

Query  667   WLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIIS  846
             WL+ L+ VA  +KD  MV+ +SLRNELRGP QN  +WY +VE+GAK I+ ANPN+LV++S
Sbjct  121   WLRALSTVAKRYKDMHMVMAMSLRNELRGPRQNETLWYHWVEEGAKTIHRANPNVLVLVS  180

Query  847   GLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEE  1026
             GL+YDLDFRFLK +P     + KK+VYE H+YAF++GQ   W+   +N +C ++ +++E+
Sbjct  181   GLNYDLDFRFLKTKP-LKLGIGKKMVYEAHQYAFSDGQDGLWLTKSVNWMCKNMIQDVED  239

Query  1027  KEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLR  1206
             + GFL RG +P PLF++EFG +Q+GD+ ADN  L C +S+LA+ DLDW++WALQGSYYLR
Sbjct  240   RVGFLFRGRHPAPLFITEFGGDQIGDNTADNYFLTCYISWLAENDLDWALWALQGSYYLR  299

Query  1207  EGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRCARV  1386
             +GKH P+ETYG+F ++W  LRNP F +KL+ +Q+ L       P   L    L+G+ A  
Sbjct  300   DGKHDPEETYGLFNSSWGPLRNPQFHTKLQLIQRTLIATGDGLPV-ALTRECLTGQSAWE  358

Query  1387  VGD--QIHMSDCSGASRCIQEADGKPIHMIGSLK-----CLAVVGEDLPLTLST  1527
             +    Q H S     S  I+ A     H    L        A + + LPL+ S+
Sbjct  359   LAQNSQFHRSSSLVHSASIKMAKKNSSHFHTFLLWILLFSFAKLSKSLPLSTSS  412



>ref|XP_002272491.1| PREDICTED: uncharacterized protein LOC100262188 [Vitis vinifera]
Length=541

 Score =   437 bits (1124),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 316/510 (62%), Gaps = 14/510 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +G RVKL C +W  H E M+ EGL  +P+  IA  +S MGFNCVRLT+ T+++
Sbjct  36    RWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLTYPTFLW  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N TV +S   L  TEA + +A  NP  LSL L ++ + VV E+GR G+M++LDN
Sbjct  96    TRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGLMLILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKPMWCC   DGN FFG  +FDP+EW++GL+ VAN FKD   V+G+S+RNELRG   N
Sbjct  156   HVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGMSMRNELRGQRSN  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+ +GAKAI++ NPNLLV++SGL++D D  FLK++P     +  KVV+E H Y+
Sbjct  216   QKDWYKYMREGAKAIHSINPNLLVVVSGLNFDNDLSFLKKKP-FRLTLNNKVVFEAHWYS  274

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F    ++ W   P  + C D  RE     GFL  G NP PLF+SEFG++    +  DNR+
Sbjct  275   F--DATEQWNDKPPEQECKDRAREFYRDAGFLTEGDNPAPLFISEFGMDLRMGNVVDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L  +A  DLDW++W LQ SYY R+G    +E Y +   NW   RNP FL KL  LQ
Sbjct  333   FNCYLPTVAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLDFNWEKPRNPQFLEKLTILQ  392

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             + LQDP S    Y ++ H  SG C  V G+ ++H S C   ++     DG PI ++GS  
Sbjct  393   EMLQDPNSEASPYYVIVHAKSGLCVNVDGEKKVHGSGCRHRTKWTHSGDGWPIELMGSNL  452

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLA--NKGDNGLVLCLDFDSSYSPSTI  1656
             CL  VG+  P+ +ST C   QS  W   S     LA  ++ D+   LCLD  SS  PS+I
Sbjct  453   CLKAVGDGRPVKVSTDCRSQQSR-WRRVSKEKLHLAVRDEHDHTESLCLDASSS-DPSSI  510

Query  1657  LTRKCVGLEEGDM---RNPQTQWFKLIASN  1737
             +TRKC   +EGD+      Q+ WF+L+ SN
Sbjct  511   VTRKC-ACKEGDLNCHHEEQSNWFQLVPSN  539



>ref|XP_008467306.1| PREDICTED: uncharacterized protein LOC103504686 [Cucumis melo]
Length=539

 Score =   435 bits (1118),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/512 (46%), Positives = 328/512 (64%), Gaps = 14/512 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKL C +W  H + ML EGLDRRPL  +A  V  + FNCVRLT+AT+MF
Sbjct  32    RWIVDSATGHRVKLVCVNWPSHTQSMLIEGLDRRPLKDLANEVMRLKFNCVRLTYATHMF  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN TV ++F  L L  +  GLA +NP +L++ + +A +AVV+ +G  G+M++ DNH+
Sbjct  92    TRYANRTVEENFDLLDLRASKVGLALHNPFVLNMTIFEAYEAVVDVLGTSGLMVIADNHI  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC+  DGN FFG  YFD +EWL+GL +VA  F +   VV +SLRNELRG      
Sbjct  152   SQPRWCCSLEDGNGFFGDRYFDSEEWLEGLRLVARRFYNKSAVVAMSLRNELRGASSKSK  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W KYV +GA  I+N NPN+LVIISGL++D D R  ++ PL+L  +  K+V+E H Y+F+
Sbjct  212   DWNKYVTQGATTIHNINPNILVIISGLNFDNDLRCQRQYPLQLNNLHNKLVFEVHLYSFS  271

Query  952   -EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
              E QSK ++  PLNK+C  I     ++  F++ G    PLFVSEFG++Q G +EAD+R L
Sbjct  272   GESQSK-FIHNPLNKICSKIINGFVQRAEFVMEGAEAVPLFVSEFGLDQTGVNEADDRFL  330

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
              C  ++L + DLDW++W  QGSYY R+GK   +E +G+   NW+ +RNP F    + LQ 
Sbjct  331   SCFSAHLVEKDLDWALWGWQGSYYYRQGKVELEEVFGVLNYNWSDVRNPRFSQMFQLLQT  390

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARV---VGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
              LQDP S+     L+YHP SG+C +V      +I +++CS AS    E DG PI +  + 
Sbjct  391   MLQDPNSNSSNTYLMYHPQSGQCVQVHDMKQKEIFLNNCSNASHWSYEGDGTPIMLASTN  450

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLAN---KGDNGLVLCLDFDSSYSPS  1650
              CL   G  LP +LS  C  G+ + W+  S+S   LA    +G+NG  +CL+ +SS S S
Sbjct  451   FCLKANGNGLPPSLSRDC-FGEQSVWTAISDSKLHLATLTKQGNNG--MCLEKESSNS-S  506

Query  1651  TILTRK--CVGLEEGDMRNPQTQWFKLIASNT  1740
              IL R   CVG +   +++ Q QWF+L+ +NT
Sbjct  507   RILMRSCVCVGSDSNCLQDTQAQWFQLVVTNT  538



>gb|KEH18775.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=538

 Score =   433 bits (1114),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 223/511 (44%), Positives = 323/511 (63%), Gaps = 14/511 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +GERVKL C +WAGHL+PM+PEGLDRRPL ++   +    FNCVRLT+A YM+
Sbjct  34    RWIIDDTTGERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVKNNFNCVRLTYAIYMW  93

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY N  V  +F DL + E + G+A+NNP++L +  ++A  AVV+E+G   + ++LDNHV
Sbjct  94    TRYQNGIVNDTFNDLDVPEIVEGIANNNPSVLKMTHIEAFDAVVKELGDQNVRVLLDNHV  153

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC D D N FF   +FDP EW+ GL + A  F+    VV +SLRNEL GP QN+ 
Sbjct  154   SEPKWCCHDDDENGFFHDRHFDPQEWIHGLTLAAKHFEGHHPVVAMSLRNELHGPRQNLK  213

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF-  948
              WYKY+ +GA AI+ +NPN+LV+ISGL+YD + +FL+ +P     + KK+V+ETH Y++ 
Sbjct  214   DWYKYMSQGAFAIHKSNPNVLVLISGLNYDTELQFLRNKP-MDIDLGKKMVFETHLYSWS  272

Query  949   ---TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
                T    + W K PLN++C +    ++++ GFL  G    PL  +EFG +Q G +  DN
Sbjct  273   GIGTLKLKEIWSKQPLNRICAESIIGLDQRAGFLTMGQKAVPLIFTEFGFDQTGSTVEDN  332

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L C+ +YL   DLDW +WA  G YY+RE K   DET+G+    W  LR PNF  K + 
Sbjct  333   RFLTCLQTYLVGRDLDWGLWAFHGGYYVREDKVQLDETFGVVDATWHKLRYPNFTDKFQL  392

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             LQ+K QDP S      ++YHPL+G+C +V   +++ +  C    R   +  G  I +  S
Sbjct  393   LQRKNQDPTSKRSKAYIMYHPLTGKCVQVNENNKLEIGSCENQKRWTYK--GSQIFLKES  450

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNG-LVLCLDFDSSYSPST  1653
              KCL   GE LP+++S  C + ++++W  AS S   LA    +G   LCL  D+  + S 
Sbjct  451   QKCLTASGEGLPVSVSDDC-ESKNSSWKTASPSKLHLATVNQDGKQQLCLQKDT--NSSA  507

Query  1654  ILTRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             ++T KC+ + +    + +PQ+QWF+L+A+N 
Sbjct  508   VVTSKCICIHDDSLCLDDPQSQWFQLVATNV  538



>ref|XP_002509877.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51264.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=547

 Score =   433 bits (1114),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 223/521 (43%), Positives = 313/521 (60%), Gaps = 22/521 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL CA+W  H+E ML EGLD++PL  I   +S   FNCVR T+AT+M+
Sbjct  28    RWIVDAKTGQRVKLTCANWPSHVESMLAEGLDKKPLDYIIHQLSRNHFNCVRFTYATHMY  87

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN TV ++F  L LT+A +G+A  NP+ LS+  V A  AVV++ G  G+++VLDN V
Sbjct  88    TRYANRTVSETFDSLNLTDAKAGIAKYNPSFLSMTHVQAFDAVVDQFGAQGVLVVLDNQV  147

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC   DGN FFG   FD +EWLQ LA VA+ FK    V+G+S RNELRGP  N D
Sbjct  148   SRPTWCCGYDDGNGFFGDKDFDAEEWLQALATVADRFKGKSQVIGISTRNELRGPSSNED  207

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              WYKY+ +G   I+ ANP++L+ +SG+ Y  D  +L+ +         K+VYE H Y F+
Sbjct  208   DWYKYMHEGGSTIHRANPDVLIFVSGIGYASDLTYLQNK-SLDTNFDNKLVYEAHWYPFS  266

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              G  K W    +N  C+D T+      GF++ G  P P+F+ EFGI+Q G S  D   + 
Sbjct  267   WGVGKTWDLEDVNGACYDNTQYFVNHTGFVINGEKPFPMFLGEFGIDQRGLSRGDEHFMA  326

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C ++Y AD D+DW  WA QGSYY RE + G +ET+G+   NW  +RNP F ++++ + +K
Sbjct  327   CFMAYAADTDVDWGFWAWQGSYYYRENQTGTEETFGVMNFNWNRVRNPEFQNRMQLITKK  386

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASR------------CIQEADG  1452
             LQDP S+  T  +++H LSG C    G+ +I+ + C    R             + + DG
Sbjct  387   LQDPSSNSSTSYIMFHALSGSCIHTDGNKEIYATSCKAPRRWSDPAGDVIPMKWLHDGDG  446

Query  1453  KPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFD  1632
              PI + G+  CL  +GE L   LS  C+  QS +W   S +   LA   +NG  LCL  +
Sbjct  447   APIRLKGTKLCLKALGEGLAPILSEDCSSPQS-SWKFLSKTKLHLAATDENGEYLCLQKE  505

Query  1633  SSYSPSTILTRKCVGLEE------GDMRNPQTQWFKLIASN  1737
             S Y+ S ILT  C+ + E         ++P TQWFKL+ +N
Sbjct  506   SPYT-SKILTNACIFMNEEPECGKDPQKDPVTQWFKLVKTN  545



>gb|KDP25366.1| hypothetical protein JCGZ_20522 [Jatropha curcas]
Length=554

 Score =   431 bits (1109),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 221/512 (43%), Positives = 313/512 (61%), Gaps = 12/512 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             +WI+D ++GERVKLAC +W  HLEPML EGL  +PL QI   +    +NCVR TWAT+MF
Sbjct  29    KWIVDSKTGERVKLACVNWPSHLEPMLAEGLADKPLKQIVFQIVRGNYNCVRFTWATFMF  88

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN+TV +SF  L LTE ++ +   N  +L   L  A + V++E+GR G+M++LD  V
Sbjct  89    TRYANLTVRESFNTLNLTETVAEIRRQNGFILEKTLPQAFETVIDELGRQGVMVILDCQV  148

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             SKP WCC + DGN+FFG  YFD +EWLQGL   A + K  P V+G+S RNELRGPL NVD
Sbjct  149   SKPTWCCGEKDGNAFFGDEYFDVEEWLQGLTTAAELAKGKPNVIGISTRNELRGPLSNVD  208

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              WYKY+ +GA+AI+ ANP+ +++ SGLSY  D  FLK +         K+VYE H Y ++
Sbjct  209   NWYKYITQGAEAIHKANPDAIILASGLSYANDLTFLKNQ-SLRSNYDNKLVYEAHWYPWS  267

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                +  W    +N++C +  +   ++ GF+    NP PLF+ EFG+N  G   + +  L 
Sbjct  268   WAPTDTWDDKNINQICQNKLQHFIDQTGFVNTLKNPVPLFLGEFGLNLRGLLRSQDHFLS  327

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C L+Y +D+DLDW++W LQG+YY R  K G DET+G+   +W  +RNP+F ++L+ ++QK
Sbjct  328   CFLAYASDIDLDWAIWGLQGNYYFRSNKIGMDETFGVLDYHWNRIRNPHFENRLKLIKQK  387

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVG-DQIHMSDCS-GASRCIQEADGKPIHMIGSLKC  1485
             LQ+P S    Y +++HP SG C       +++   CS   S+     DG PI + G+  C
Sbjct  388   LQEPSSDYYNYYIMFHPQSGSCVLSSSRREVYTESCSNNPSQWFYAGDGHPIRLKGTDLC  447

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCLDFDSSYSPSTILT  1662
             +  VG+ +   LS  C+  QS +W L S +   +      +G  LCL  DS Y+ STI+T
Sbjct  448   IEAVGDGVRPILSENCHGPQS-SWKLLSETKLHVGVFDQSSGQYLCLQKDSPYT-STIIT  505

Query  1663  RKC------VGLEEGDMRNPQTQWFKLIASNT  1740
              KC          E    +P TQWFKL+ +N 
Sbjct  506   TKCHFTLQDTNCLEDPQDDPTTQWFKLVTTNV  537



>gb|KDP25365.1| hypothetical protein JCGZ_20521 [Jatropha curcas]
Length=935

 Score =   443 bits (1139),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 231/509 (45%), Positives = 313/509 (61%), Gaps = 10/509 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             +WI+D ++G+RVKLAC +W  HLEPM+ EG   + L +I   +    +NCVRLTWAT+MF
Sbjct  33    KWIVDSKTGQRVKLACVNWPAHLEPMVAEGFREQSLKRIVEQIVKQKYNCVRLTWATFMF  92

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN+TV QSF  L LTE   G+  +N  L S+ LV A +AV++E+G  G+M VLD  V
Sbjct  93    TRYANITVKQSFQTLKLTETTGGIKKHNLFLYSMTLVQAFEAVIDELGNQGVMAVLDCQV  152

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             SKP WCC + DGN+FFG   FD  EW+QGL  VA + K  P VVG+S RNELRGPL NVD
Sbjct  153   SKPSWCCGERDGNAFFGDTSFDVQEWIQGLTKVAELVKSKPHVVGISTRNELRGPLSNVD  212

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              WYKY+ +GA AI+ ANP++L+ +SGL Y  D  FLK R         K+VYE H YAF+
Sbjct  213   DWYKYINEGASAIHKANPDVLIFVSGLGYATDLTFLK-RQSLGTNYDNKLVYEAHWYAFS  271

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              GQ   W    +N+VC D       K GF+    NP PLF+ EFG +Q G   +++  L 
Sbjct  272   WGQKSDWDVKDINQVCKDKLDSFISKTGFITTLENPFPLFLGEFGFSQRGLDLSEDHFLS  331

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C L+Y +D+DLDW++W LQGSYY+R  K   DE +G+  + W  +R+P   ++L F++QK
Sbjct  332   CFLAYASDIDLDWAIWGLQGSYYIRNNKEYADEHFGVLDSYWNRVRSPFMENRLNFVKQK  391

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             LQDP S      +++HP SG C       +I+   C   ++     DG PI +  +  C+
Sbjct  392   LQDPTSDFYQSYVIFHPQSGACISTNERGEIYADSCDNPNQWEHAEDGHPIRLHSTNLCI  451

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
               +G+ L   LS  C+ GQ ++W L S +   +A   ++G  LCL  DS Y+ STILT K
Sbjct  452   EAIGDGLSPVLSENCS-GQKSSWKLLSATKLHVAVIDESGQSLCLHKDSPYT-STILTIK  509

Query  1669  CVGLEEGD--MRNPQ----TQWFKLIASN  1737
             C    E D  M++PQ    TQWFKL+ +N
Sbjct  510   CSLTFEDDPCMKDPQKDSTTQWFKLVQTN  538


 Score =   145 bits (366),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/279 (30%), Positives = 125/279 (45%), Gaps = 60/279 (22%)
 Frame = +1

Query  718   VVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlk  897
             V+G+S RNE+RGP  N + WYKY+E+G + I  ANP +L+  SGL Y +           
Sbjct  703   VIGISTRNEIRGPRSNEEDWYKYMEQGIETIQKANPPVLIFASGLGYAV-----------  751

Query  898   lkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVS  1077
                                G    W    +N VC++ T+ +  + GF++    P P+F+ 
Sbjct  752   -------------------GHGGYWNMEDVNGVCYNETQRIFNQTGFVMNAEKPFPMFMG  792

Query  1078  EFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNW  1257
             EFG++Q   S  D R L C L+Y A+ DL+W +WA Q                       
Sbjct  793   EFGLDQRAFSRGDERFLACFLAYAAEFDLEWVLWAWQ-----------------------  829

Query  1258  TALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRCARVVG-DQIHMSDCSGASRC  1434
                    +  ++E ++ KLQDP        +++HP SG C    G ++I   DC   S  
Sbjct  830   ------EYQRRMELIKLKLQDPSLKSQVSHIMFHPQSGTCINADGTERISAGDCKAPSHW  883

Query  1435  IQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSN  1551
             +   DG PI + G   C+ VV +     LS  C+  QS+
Sbjct  884   VHTRDGDPIRLKGKRLCIKVVSDGWEPMLSEDCSSEQSS  922



>gb|KDP26669.1| hypothetical protein JCGZ_17827 [Jatropha curcas]
Length=563

 Score =   430 bits (1105),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 231/506 (46%), Positives = 326/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HLE ++ EGL R P+  IA  + +MGFNCVRLTW  Y+ 
Sbjct  38    RWIVDEK-GQRVKLACVNWVSHLEAVVAEGLSREPMDLIAKKIVSMGFNCVRLTWPLYLV  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   YA++TV QSF +LGL E+ISG+ +NNP ++ L L+ A +AVV  +G + ++++LDN
Sbjct  97    TNETYASLTVKQSFQNLGLLESISGIQANNPAIIDLPLIKAYQAVVSSLGDNNVLVILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W+ GL  +A IF   P VVG+SLRNELRG  QN
Sbjct  157   HISKPGWCCSNFDGNGFFGDSYFNPDLWINGLTQMATIFNGVPNVVGLSLRNELRGQKQN  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+EKGA+A+++ANP++LVI+SGL+YD D  FL+ RP        K+V+E H Y 
Sbjct  217   VNDWYRYMEKGAEAVHSANPDVLVILSGLNYDKDLSFLRNRP-VNLTFTGKLVFEVHWYG  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +T  M    G+L+  G   PLFVSEFGI+Q G +  DNR+
Sbjct  276   FSDGQ--AWKNGNPNQVCGRVTSNMMRMSGYLLDQG--WPLFVSEFGIDQRGTNVNDNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L + A+LDLDW++W L GSYYLREG  G +E YG+   NW  +RN +FL ++  LQ
Sbjct  332   LGCFLGWAAELDLDWALWTLVGSYYLREGVLGLNEYYGVLNWNWCDIRNSSFLQQISALQ  391

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  SE   +++++HPL+G C   + + + + +  C+  S   +    K + + G+
Sbjct  392   SPFQGPGVSESNLHKVIFHPLTGLCVQRKSMLEPLKLGPCTD-SEAWRYTPQKILSLKGT  450

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S  W + S+S   L++K  NG  +CLD DS+   +TI
Sbjct  451   YFCLQADELGKPAKLGVICTDSDSK-WDVISDSNMHLSSKISNGTTICLDVDSN---NTI  506

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +   C  L   +  +P +QWFKL+ S
Sbjct  507   VINTCKCLSRDNTCDPGSQWFKLVNS  532



>emb|CBI34405.3| unnamed protein product [Vitis vinifera]
Length=970

 Score =   437 bits (1125),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 316/510 (62%), Gaps = 14/510 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +G RVKL C +W  H E M+ EGL  +P+  IA  +S MGFNCVRLT+ T+++
Sbjct  465   RWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLTYPTFLW  524

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N TV +S   L  TEA + +A  NP  LSL L ++ + VV E+GR G+M++LDN
Sbjct  525   TRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGLMLILDN  584

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKPMWCC   DGN FFG  +FDP+EW++GL+ VAN FKD   V+G+S+RNELRG   N
Sbjct  585   HVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGMSMRNELRGQRSN  644

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+ +GAKAI++ NPNLLV++SGL++D D  FLK++P     +  KVV+E H Y+
Sbjct  645   QKDWYKYMREGAKAIHSINPNLLVVVSGLNFDNDLSFLKKKP-FRLTLNNKVVFEAHWYS  703

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F    ++ W   P  + C D  RE     GFL  G NP PLF+SEFG++    +  DNR+
Sbjct  704   F--DATEQWNDKPPEQECKDRAREFYRDAGFLTEGDNPAPLFISEFGMDLRMGNVVDNRY  761

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L  +A  DLDW++W LQ SYY R+G    +E Y +   NW   RNP FL KL  LQ
Sbjct  762   FNCYLPTVAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLDFNWEKPRNPQFLEKLTILQ  821

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             + LQDP S    Y ++ H  SG C  V G+ ++H S C   ++     DG PI ++GS  
Sbjct  822   EMLQDPNSEASPYYVIVHAKSGLCVNVDGEKKVHGSGCRHRTKWTHSGDGWPIELMGSNL  881

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLA--NKGDNGLVLCLDFDSSYSPSTI  1656
             CL  VG+  P+ +ST C   QS  W   S     LA  ++ D+   LCLD  SS  PS+I
Sbjct  882   CLKAVGDGRPVKVSTDCRSQQSR-WRRVSKEKLHLAVRDEHDHTESLCLDASSS-DPSSI  939

Query  1657  LTRKCVGLEEGDM---RNPQTQWFKLIASN  1737
             +TRKC   +EGD+      Q+ WF+L+ SN
Sbjct  940   VTRKC-ACKEGDLNCHHEEQSNWFQLVPSN  968


 Score =   357 bits (915),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/365 (49%), Positives = 241/365 (66%), Gaps = 5/365 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+ +G RVK+AC +W  HLEP++ EG+  +P+ +IA  V  MGFNC+RLT+AT+M+
Sbjct  32    RWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLTYATFMW  91

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N TV QS     LT+A  G+A NNP LL+L ++DA +AVV E+G HG+M+VLDN
Sbjct  92    TRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGLMLVLDN  151

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP+WCCA  DGN FFG +YFDP EW++GL  V+  FK+ P VV +S+RNE+RG   N
Sbjct  152   HVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEMRGARSN  211

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y+ KGAKAI+ ANP +LVI+SGL++D D  FL  R      +  KVV+E H Y 
Sbjct  212   VPDWYRYMRKGAKAIHKANPKVLVIVSGLNFDKDLSFLG-RKSFGFTLNNKVVFEAHWYT  270

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F   Q   W + P N+ C     E +    FL  G    PLF+SE+GIN    S+ D+R+
Sbjct  271   FDFTQQ--WQQLPPNRACRQRADEFQRDAAFLTTGDKAAPLFISEYGINLQETSQVDSRY  328

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L  +A+ DLDW++W LQ SY+ R+G  G  E+Y +   +W+  R P FL ++  LQ
Sbjct  329   FTCFLPTVAEKDLDWALWTLQASYHYRQGHAGGGESYSVLDYSWSKPRYPQFLERMVILQ  388

Query  1306  QKLQD  1320
               LQ+
Sbjct  389   NLLQE  393



>gb|AES77604.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   424 bits (1090),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/506 (42%), Positives = 321/506 (63%), Gaps = 9/506 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL C +W+ HL  M+ EGL+ +PL  +   +  +GF+CVR TWAT+MF
Sbjct  31    RWIID-ETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTWATHMF  89

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+N  V ++   L LT +  G+ + NP+L ++ +V+A   V++E G+ G+M+++DNHV
Sbjct  90    TRYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMMVLVDNHV  149

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S P WCC + DGN FFG  Y DP EWLQGL+ VAN  K    VV V LRNELRGP QN+D
Sbjct  150   SDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAVGLRNELRGPGQNID  209

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W KY+ +GA  ++  NPN+LV +SG +YD D  FLK  P     +  K+VYE H YA++
Sbjct  210   NWQKYMSQGATTVHKENPNVLVFVSGFNYDTDLSFLKTNP-LNTSIGDKLVYEVHSYAWS  268

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              G  K W+  PLN+ C ++   + ++ GFL+ G NP PL +SEFG++     + + R L 
Sbjct  269   TGSPKDWIVKPLNQKCANVMNGLNDRAGFLMSGSNPNPLVMSEFGLDMTDMDDKNQRFLS  328

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             CML+YLA +DLDW++W  QGSYY+RE +    E YG++  ++ +LR P+F  + + +Q+K
Sbjct  329   CMLAYLAGVDLDWALWTAQGSYYIREKESNVSEHYGLWNIDFKSLRYPDFPQRFQLVQKK  388

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             L +P S+     ++YHPLSG+C +V   +++ + DC  AS+  QE  G+ I ++G+   +
Sbjct  389   LLEPSSNSSKSYVIYHPLSGQCVKVNTNNELELGDCEWASKWNQE--GQQIKLVGNGTYI  446

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
               V +   + +S  C   QS  W   S +   L    + G  LCL  +S+ SP  I+T+K
Sbjct  447   EAVSDGSQVKVSNDCKSKQS-FWKTLSATNLHLGTLDEQGQNLCLQRESTTSPK-IVTKK  504

Query  1669  CVGLEEGD--MRNPQTQWFKLIASNT  1740
             C+ +++    + +PQ+QWF+L+ +N 
Sbjct  505   CICIDDNPACLDDPQSQWFQLVTTNV  530



>gb|ABR17494.1| unknown [Picea sitchensis]
Length=543

 Score =   421 bits (1081),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 228/514 (44%), Positives = 317/514 (62%), Gaps = 19/514 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+  G RVKLAC +W  HL+PM+ EGL R+PL  I + + + GFNCVRLTWAT+M 
Sbjct  31    RWIVDETGGTRVKLACVNWVSHLQPMVTEGLSRQPLKYITSTIVSQGFNCVRLTWATFMV  90

Query  412   TRYAN--MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  AN  +TV  S   L L++A + +A +NP  L L L+D+ K VV  +G  G+M++LDN
Sbjct  91    TNPANRNLTVQDSLNSLNLSDAAAAMAVSNPEFLDLTLMDSYKRVVAGLGEAGLMVILDN  150

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S+P WCC  +DGN FFG   FDP  W+QGL+ +A  FK T  VVG+SLRNELRG   N
Sbjct  151   HISRPQWCCGYNDGNGFFGDADFDPGVWIQGLSAMATAFKGTAAVVGMSLRNELRGSRAN  210

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+++GA+A+++ANP++LVI+SGL+Y  D +FL  +P        K+VYE H Y+
Sbjct  211   AADWYKYMQQGAQAVHDANPDVLVIMSGLNYAADLKFLASKP-VSLEFTNKIVYEMHWYS  269

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRG-GNPGPLFVSEFGINQMGDSEADNR  1122
             FT+G  KAW   P NK+C  +T  + +   F+ +    P PLF+SEFGI++ G +  DNR
Sbjct  270   FTDG--KAWENMPANKLCGTVTARVNDHTAFVAKTLSPPAPLFISEFGIDERGSNVGDNR  327

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
              + C L++ A+ D DW++W LQGSYYLR G+ G +ETYG+F   W  LR+P F+S+L+ L
Sbjct  328   FINCFLAFAAEGDFDWALWTLQGSYYLRNGQPGFEETYGIFNGRWDDLRDPPFVSRLKSL  387

Query  1303  QQKLQDPM-SSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRC-IQEADGKPIHMIG  1473
             Q+  Q+   SSEP Y+ LYHP +G C    G+  + +  C   +    +   G       
Sbjct  388   QKPFQESFSSSEPLYKTLYHPATGLCLATSGEGGLKLDSCDSPTLFEYKSPQGAFTLSDE  447

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLA---NKGDNGLVLCLDFDSSYS  1644
             S  C+A  G  L   LST C    S  W   S+S  Q++   +      +LCLD  SS  
Sbjct  448   SSTCIAAKGPGLAAELSTQCAASNSK-WQRVSSSNLQVSVTLSVNGTSQMLCLDGKSS--  504

Query  1645  PSTILTRKCVGLEEGDMR---NPQTQWFKLIASN  1737
                +LT  C+ L++ D R   NP+ QWFKLI +N
Sbjct  505   -PQVLTNDCICLKDSDCRKDENPEMQWFKLITTN  537



>ref|XP_004245178.1| PREDICTED: uncharacterized protein LOC101258288 [Solanum lycopersicum]
Length=561

 Score =   421 bits (1081),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 222/506 (44%), Positives = 324/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ + G+RVKL+C +W  HLE M+ EGL ++P+  I+  ++ MGFNCVRLTW  ++F
Sbjct  39    RWIVN-EGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFNCVRLTWPLFLF  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    ++++V QSF +LGL E+I+GL  NNP++L L+L+ A +AVV  +G + +M++LDN
Sbjct  98    TNDSLSSLSVRQSFNNLGLVESIAGLQVNNPSILDLSLLQAYQAVVSGLGNNNVMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W+QGL  VA  F +   VVG+SLRNELRGP QN
Sbjct  158   HISKPGWCCSNFDGNGFFGDQYFNPDLWVQGLTKVATTFINVTNVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A++ ANP++LVI+SGL++D D  FL++RP        K+V+E HRY+
Sbjct  218   VNDWYRYMQKGAEAVHAANPDVLVILSGLNFDKDLSFLRQRP-INLTFSGKLVFEIHRYS  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G  K+W  G  N+VC  +  +M  + GFL+  G   PLFVSEFG +Q G +  DNR+
Sbjct  277   FTDG--KSWETGNANQVCGQVLNDMMSRGGFLLDQGY--PLFVSEFGADQRGTNVNDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L   A+LD DW++W L GSYYLREG  G +E YG+   NW  +RN +FL+++  +Q
Sbjct  333   FNCFLGLAAELDFDWALWTLVGSYYLREGVVGLNEVYGVMDWNWCDIRNSSFLNRISAVQ  392

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  +E  +++L++HP++G C R +     + +  CS  S        K + + G+
Sbjct  393   SPFQGPGYNESRSHKLIFHPMTGLCVRRISFLQPLELGPCS-ESDAWDYTTTKSLTLTGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  +C +  S  W   S+S   L++K  +G  LCLD DS    + I
Sbjct  452   YFCLQADKSGQPAKLGIMCTNSNSK-WQAISDSKMHLSSKLQDGTSLCLDVDSK---NAI  507

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              T  C  L +     P++QWFK+I S
Sbjct  508   FTNPCKCLSKDKTCEPESQWFKIIDS  533



>ref|XP_008221942.1| PREDICTED: uncharacterized protein LOC103321869 [Prunus mume]
Length=584

 Score =   421 bits (1082),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 240/561 (43%), Positives = 354/561 (63%), Gaps = 32/561 (6%)
 Frame = +1

Query  61    LISKSTKFLISSLYMLKTIHL*QAGLATPAMTPFLTIlfllsfasslsnslplsassRWI  240
             +++ S+  +ISS   L  I    A L T A+ P            +  +++PLS SSRWI
Sbjct  38    MVAHSSTPIISSFSFLAII----ASLLTVAVLP------------ATVSAVPLSTSSRWI  81

Query  241   MDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTR-  417
             +D +SG+RVKLAC +W  HLEP++ EGL ++P+  I+  ++++GFNCVRLTW T++ T  
Sbjct  82    VD-ESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGFNCVRLTWPTFLATND  140

Query  418   -YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVS  594
               A++TV QSF  LGL+E+I+GL SNNP+++ L L+ A +AVV  +G++ +M++LDN VS
Sbjct  141   TLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSSLGKNNVMVILDNQVS  200

Query  595   KPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDV  774
             KP WCC+  DGN FFG  YF+PD W++GL  +A +FK    VVG+SLRNELRGP QNVD 
Sbjct  201   KPGWCCSSSDGNGFFGDQYFNPDIWIKGLTRMATLFKGVANVVGMSLRNELRGPKQNVDD  260

Query  775   WYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTE  954
             WYKY+++GA+A+++ANP++LVI+SGLSYD D  FL +RP        K VYE H Y F++
Sbjct  261   WYKYMQRGAEAVHSANPDVLVILSGLSYDKDLSFLADRP-VSLTFSGKTVYEVHWYGFSD  319

Query  955   GQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPC  1134
             GQ  AW  G  N+VC  +   M+ + GFL+  G   PLFVSEFG++Q G +  DNR+L C
Sbjct  320   GQ--AWKSGNPNQVCGSVVNNMKRQSGFLLEKGF--PLFVSEFGVDQRGTNVNDNRYLNC  375

Query  1135  MLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKL  1314
              ++  A+LD+D+++W L GSYYL++G  G +E YG+   +W+ +RN +   +L  LQ   
Sbjct  376   FMATAAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLNWDWSDVRNSSLSQRLSVLQSPF  435

Query  1315  QDP-MSSEPTYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             Q P +S    +++++HP +G C   VG    + +  CS  S     +  K + + G+  C
Sbjct  436   QGPGLSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCS-QSGAWSYSSKKILTLKGTYFC  494

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             + V   + P  +  IC    S  W   S+S   L++K  +G  +CLD DSS   +TI+T 
Sbjct  495   IQVDELEKPAQVGIICTTPNSQ-WDTISDSGLHLSSKTLDGTDVCLDVDSS---NTIVTS  550

Query  1666  KCVGLEEGDMRNPQTQWFKLI  1728
              C  L      +P++QWFKL+
Sbjct  551   SCKCLGRDSSCDPESQWFKLV  571



>ref|XP_007223308.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
 gb|EMJ24507.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
Length=547

 Score =   419 bits (1077),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 239/561 (43%), Positives = 351/561 (63%), Gaps = 32/561 (6%)
 Frame = +1

Query  61    LISKSTKFLISSLYMLKTIHL*QAGLATPAMTPFLTIlfllsfasslsnslplsassRWI  240
             +++ S+  +ISS   L  I    A L T A+ P            +  +++PLS SSRWI
Sbjct  1     MVAHSSTPIISSFSFLAII----ASLLTVAVLP------------ATVSAVPLSTSSRWI  44

Query  241   MDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTR-  417
             +D +SG+RVKLAC +W  HLEP++ EGL ++P+  I+  ++++GFNCVRLTW T++ T  
Sbjct  45    VD-ESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGFNCVRLTWPTFLATND  103

Query  418   -YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVS  594
               A++TV QSF  LGL+E+I+GL SNNP+++ L L+ A +AVV  +G++ +M++LDN VS
Sbjct  104   TLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSSLGKNNVMVILDNQVS  163

Query  595   KPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDV  774
             KP WCC+  DGN FFG  YF PD W++GL  +A +FK    VVG+SLRNELRGP QNVD 
Sbjct  164   KPGWCCSSFDGNGFFGDQYFSPDIWIKGLTRMATLFKGVANVVGMSLRNELRGPKQNVDD  223

Query  775   WYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTE  954
             WYKY+++GA+A+++ANP++LVI+SGLSYD D  FL +RP        K VYE H Y F++
Sbjct  224   WYKYMQRGAEAVHSANPDVLVILSGLSYDKDLSFLADRP-VSLTFSGKTVYEVHWYGFSD  282

Query  955   GQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPC  1134
             GQ  AW  G  N+VC  +   M+ + GFL+  G   PLFVSEFG++Q G +  DNR+L C
Sbjct  283   GQ--AWKSGNPNQVCGSVVNNMKRQAGFLLEKGF--PLFVSEFGVDQRGTNVNDNRYLNC  338

Query  1135  MLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKL  1314
              ++  A+LD+D+++W L GSYYL++G  G +E YG+   +W+ +RN +   +L  LQ   
Sbjct  339   FMATAAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLNWDWSDIRNSSLSQRLSVLQSPF  398

Query  1315  QDP-MSSEPTYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             Q P +S    +++++HP +G C   VG    + +  CS  S     +  K + + G+  C
Sbjct  399   QGPGLSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCS-QSGAWSYSSKKILSLKGTYFC  457

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             +     + P  +  IC    S  W   S+S   L++K  NG  +CLD DSS   +TI+  
Sbjct  458   IQADELEKPAQVGIICTTPNSQ-WDTISDSGLHLSSKTLNGTDVCLDVDSS---NTIVAS  513

Query  1666  KCVGLEEGDMRNPQTQWFKLI  1728
              C  L      +P++QWFKL+
Sbjct  514   SCKCLGRDSSCDPESQWFKLV  534



>ref|XP_003621369.1| Endoglucanase E1 [Medicago truncatula]
 gb|AES77587.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   418 bits (1075),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 209/506 (41%), Positives = 318/506 (63%), Gaps = 9/506 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D +SG+RVKL C +W+ H+  M+ EGLD  PL      +  +GFNCVR TWAT+MF
Sbjct  31    RWVVD-ESGKRVKLHCINWSSHMNAMVAEGLDTIPLKDCIAQLKGLGFNCVRYTWATHMF  89

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+   V +    L LT    G+ + NP++ ++ +V+A   V++E G+ G+M++ DNHV
Sbjct  90    TRYSTNKVGEKLDKLNLTGPRLGIGNFNPSMENITVVEAFDFVIDEFGKQGMMVLADNHV  149

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S P WCC ++DGN FFG  YF+P+EWLQGL+ VAN  K  P VV + LRNELRGP QN +
Sbjct  150   SDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVANRVKGKPQVVAIGLRNELRGPKQNEN  209

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W+KY+ +GA  ++ ANP++LV +SGL+YD D  FLK +P     +  K+VYE H YA++
Sbjct  210   NWHKYMSQGATTVHKANPDVLVFVSGLNYDTDLSFLKTKP-LNVNIGNKLVYEVHSYAWS  268

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              G+   W K PLNK C ++   + +K GFL+ G NP PL +SEFGIN    ++ + + L 
Sbjct  269   SGERSDWDKQPLNKKCANVMNNLNDKAGFLMSGSNPKPLVMSEFGINMENKTDMNEKFLS  328

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             CML+YL  +DLDW++WA QG+YY+R+ +    ET+G+++ ++  LR   F  + + + +K
Sbjct  329   CMLAYLVGVDLDWALWAAQGAYYIRKNEIIVSETFGIWSYDFRTLRYIEFPQRFQLMHKK  388

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVG-DQIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             L +P S+     ++YHPLSG+C +V   +++ + DC G S+  Q   G+ I ++G+  C+
Sbjct  389   LLEPSSNSSKSYIIYHPLSGQCVKVNKRNKLVLGDCDGKSKWNQV--GQQIKLVGNDACI  446

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
               + +   + LS  C   QS  W   S +   L      G  LCL   S  SP  I+T+K
Sbjct  447   EAIKDGSQVKLSNDCRSKQS-FWKTLSATNLHLGTLDSQGQNLCLQRKSPTSPK-IVTKK  504

Query  1669  CVGLEEGD--MRNPQTQWFKLIASNT  1740
             C+ +++    + +PQ+QWF+L+ +N 
Sbjct  505   CICIDDNPACLEDPQSQWFQLVTTNV  530



>gb|KGN57438.1| hypothetical protein Csa_3G185670 [Cucumis sativus]
Length=427

 Score =   414 bits (1063),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 210/430 (49%), Positives = 282/430 (66%), Gaps = 5/430 (1%)
 Frame = +1

Query  406   MFTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             MFTRYAN+TV QSF +  + EAI+G+A NNP +L++ +V+A +AVV+ +G HG+M+V DN
Sbjct  1     MFTRYANLTVKQSFENFDMKEAIAGIAQNNPTILNMKVVEAYEAVVDSLGAHGVMVVSDN  60

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S+P WCC++ DGN FFG  YF+  EWLQGL++     K  P VV +SLRNE RGP QN
Sbjct  61    HISQPRWCCSNDDGNGFFGDRYFNSQEWLQGLSLATQSLKTKPQVVAMSLRNEPRGPNQN  120

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V++W++Y+ +GAK ++  NPN LV++SGLSYD D  FLK R      +  K+V+E H Y+
Sbjct  121   VEMWFQYMSQGAKLVHQINPNALVVVSGLSYDTDLSFLKNR-SMGFNLDNKLVFEAHLYS  179

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT   S  W   PLN  C ++ +  E++ GFLVRG NP PLFVSEFGINQMG +E  NR 
Sbjct  180   FTNNMSDYWTSKPLNTFCANVNQGFEDRAGFLVRGQNPIPLFVSEFGINQMGANEGQNRF  239

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C  +YL   D DW +WALQGSYY REG    +ET+G+  + +T ++NP FL K + +Q
Sbjct  240   LSCFFTYLTKNDFDWGLWALQGSYYYREGVKNDEETFGVLDSKFTNVKNPKFLQKFQLMQ  299

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
              KLQDP S+  T  ++YHPLSG C R+    Q+ +S C  ++R   E D  PI + GS+ 
Sbjct  300   TKLQDPSSNLTTSFIMYHPLSGECVRMNKKYQLGVSSCKTSNRWSHEQDDTPIKLAGSIL  359

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             CL  VG+ LP  LS  C+  QS  W  ASN+  QLA   + G  LCL   +S+S   ILT
Sbjct  360   CLQAVGDGLPPILSKDCSSQQS-AWKYASNAKLQLATVDEQGQALCLQ-RASHS-HQILT  416

Query  1663  RKCVGLEEGD  1692
              KC+   + D
Sbjct  417   NKCICPNDSD  426



>ref|XP_006367511.1| PREDICTED: uncharacterized protein LOC102589547 [Solanum tuberosum]
Length=560

 Score =   418 bits (1075),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 221/506 (44%), Positives = 323/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ + G+RVKL+C +W  HLE M+ EGL ++P+  I+  ++ MGFNCVRLTW  ++F
Sbjct  38    RWIVN-EGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFNCVRLTWPLFLF  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++TV QSF +LGL E+I+GL  NNP++L L+L+ A +AVV  +G + +M++LDN
Sbjct  97    TNDSLSSLTVRQSFSNLGLVESIAGLQVNNPSILDLSLLHAYQAVVSGLGNNNVMVILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W+QGL  VA  F +   VVG+SLRNELRGP QN
Sbjct  157   HISKPGWCCSNFDGNGFFGDQYFNPDLWIQGLTNVATTFINVTNVVGMSLRNELRGPKQN  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A++ ANP++LVI+SGL++D D  FL++RP        K+V+E HRY+
Sbjct  217   VNDWYRYMQKGAEAVHAANPDVLVILSGLNFDKDLSFLRQRP-INLTFSGKLVFEIHRYS  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G  K+W  G  N+VC  +  ++  + GFL+  G   PLFVSEFG +Q G +  DNR+
Sbjct  276   FTDG--KSWETGNPNQVCGQVVNDIMSRGGFLLDQGY--PLFVSEFGADQRGTNVNDNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L   A+LD DW++W L GSYYLREG  G +E YG+   NW  +RN +FL ++  +Q
Sbjct  332   FNCFLGLAAELDFDWALWTLVGSYYLREGVVGLNEVYGVMDWNWCDIRNSSFLKRISTVQ  391

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  +E  +++L++HP++G C R +     + +  CS  S        K + + G+
Sbjct  392   SPFQGPGYNESRSHKLIFHPMTGLCVRRISFFQPLELGPCS-ESDAWDYTPTKTLTLTGT  450

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  +C +  S  W   S+S   L++K  +G  LCLD DS    + +
Sbjct  451   YFCLQADKSGQPAKLGIMCTNSNSK-WQAISDSKMHLSSKLQDGTNLCLDVDSK---NVV  506

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              T  C  L +    +P +QWFK+I S
Sbjct  507   FTNTCKCLSKDKTCDPASQWFKIIDS  532



>gb|AES77610.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=535

 Score =   416 bits (1070),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/510 (41%), Positives = 316/510 (62%), Gaps = 13/510 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL C +W+ H+  M+ EGL+  PL  I T +  +GF+CVR TWAT MF
Sbjct  32    RWIVD-ETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTWATKMF  90

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+N  V ++   L LT +  G+   NP+  ++ +V+A   V++E GR G+M++ DNHV
Sbjct  91    TRYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMMVLADNHV  150

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S P WCC ++DGN FFG  YF+P+EWLQGL+ V+N  K    VV + LRNELRGP QN+ 
Sbjct  151   SDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAIGLRNELRGPSQNIS  210

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W KY+ +GA  ++  NPN+LV +SG +YD+D  FLK  P     +  K+VYE H YA++
Sbjct  211   SWQKYMSQGATTVHKENPNVLVFVSGFNYDIDLSFLKTNP-LNTSIGDKLVYEVHSYAWS  269

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMG----DSEADN  1119
              G    W K PLNK C ++   + +K GFL+ G NP PL +SEFG +       +   + 
Sbjct  270   TGDRSDWDKQPLNKKCANVMNNLNDKAGFLMSGSNPNPLVMSEFGADLTAIDDKNQTFNQ  329

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L CML+YLA +DLDW++W  QGSYY+R+ +    E +G++  ++ +LR P+F  + + 
Sbjct  330   RFLSCMLAYLAGVDLDWALWTAQGSYYIRDKESNASEPFGIWNIDFKSLRYPDFSQRFQL  389

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             +Q+KL DP  +     ++YHPLSG+C +V   +++ + DC  AS+  QE  G+ I ++G+
Sbjct  390   VQKKLLDPSLNSSKSYIIYHPLSGQCVKVNTNNELELGDCEWASKWNQE--GQQIKLVGN  447

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
                +  V +   + +S  C   QS  W   S +   L    + G  LCL  +S  SP  I
Sbjct  448   GTYIEAVSDGSQVKVSNDCKSKQS-FWKTLSATNLHLGTLDEQGQKLCLQRESPTSPK-I  505

Query  1657  LTRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             +T++C+ +++    + +PQ+QWF+L+ +N 
Sbjct  506   VTKRCICIDDNPACLEDPQSQWFQLVTTNV  535



>emb|CDP16213.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   414 bits (1065),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 222/480 (46%), Positives = 309/480 (64%), Gaps = 35/480 (7%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRYANMTVVQSFGDLGLTEAISGLA  486
             M+P+ L +R L ++A HVS MGFNC+RLT+AT+MFT YAN+TV Q   +L LT AI+G+ 
Sbjct  1     MVPQRLHKRSLHELALHVSLMGFNCIRLTYATHMFTCYANLTVAQRLQNLNLTNAIAGIK  60

Query  487   snnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDE  666
              NNP+LL+  +VDA+KAV+EE+G +G+M++LDN +SKPMWCC D DGN FFG  YFDP+E
Sbjct  61    ENNPDLLNATVVDAQKAVIEELGLNGVMVLLDNQISKPMWCCNDDDGNGFFGDKYFDPNE  120

Query  667   WLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIIS  846
             WLQ L++V+  +KDT  V+ +S RNELRGPLQ+  VWY+YVEKGA+ I++ NPN+LV+IS
Sbjct  121   WLQCLSLVSTRYKDTQTVIAMSFRNELRGPLQSERVWYQYVEKGAQTIHSGNPNVLVLIS  180

Query  847   GLSYDLDFRFLKERPlkl----------------------kmmkkkvvYETH----RYAF  948
              L+YDLDF+ L+ R                          +  +   +  TH     + F
Sbjct  181   SLNYDLDFQGLRNRSFFFFFWQSPKLGTYGKIWNSKHIPDQSNEIIHMRVTHICSRSHLF  240

Query  949   TEGQSKAWMKGPLNKVCHDITREMEEKE-GFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
              E  ++ + K    +        M+  E GFL +G NP PLFV+EFG++QMG++ +DN+ 
Sbjct  241   IEIMNQQFRKLEPYRSNGQFFVNMKRYEVGFLTKGKNPAPLFVTEFGVDQMGENPSDNKL  300

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             LPC ++YLA   LDW++WALQ SYYLR+G    DETYGMF +NW  L++  F SKL  + 
Sbjct  301   LPCFMAYLARHGLDWALWALQASYYLRDGHQDHDETYGMFNSNWRHLKSLEFHSKLHTIT  360

Query  1306  ------QKLQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIH  1464
                     L  P S   +Y++LYH LSG+CAR    + IH+S+C   S+   + +G P  
Sbjct  361   LLTNFGNGLIYPKSDGRSYKILYHLLSGKCARANKSNDIHVSECWEMSKWDHQGEGTPTI  420

Query  1465  MIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYS  1644
             + G+  CL  +G+ L + L+  C   QS  W+LASNS FQLA+K +NG  LCLD+D  +S
Sbjct  421   LQGTRSCLKAIGDGLLVALTIDCKSNQSK-WTLASNSQFQLASKHENGTELCLDWDPYHS  479



>ref|XP_003621392.1| Endoglucanase E1 [Medicago truncatula]
Length=534

 Score =   416 bits (1070),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 208/510 (41%), Positives = 316/510 (62%), Gaps = 13/510 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL C +W+ H+  M+ EGL+  PL  I T +  +GF+CVR TWAT MF
Sbjct  31    RWIVD-ETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTWATKMF  89

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+N  V ++   L LT +  G+   NP+  ++ +V+A   V++E GR G+M++ DNHV
Sbjct  90    TRYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMMVLADNHV  149

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S P WCC ++DGN FFG  YF+P+EWLQGL+ V+N  K    VV + LRNELRGP QN+ 
Sbjct  150   SDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAIGLRNELRGPSQNIS  209

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W KY+ +GA  ++  NPN+LV +SG +YD+D  FLK  P     +  K+VYE H YA++
Sbjct  210   SWQKYMSQGATTVHKENPNVLVFVSGFNYDIDLSFLKTNP-LNTSIGDKLVYEVHSYAWS  268

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMG----DSEADN  1119
              G    W K PLNK C ++   + +K GFL+ G NP PL +SEFG +       +   + 
Sbjct  269   TGDRSDWDKQPLNKKCANVMNNLNDKAGFLMSGSNPNPLVMSEFGADLTAIDDKNQTFNQ  328

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L CML+YLA +DLDW++W  QGSYY+R+ +    E +G++  ++ +LR P+F  + + 
Sbjct  329   RFLSCMLAYLAGVDLDWALWTAQGSYYIRDKESNASEPFGIWNIDFKSLRYPDFSQRFQL  388

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             +Q+KL DP  +     ++YHPLSG+C +V   +++ + DC  AS+  QE  G+ I ++G+
Sbjct  389   VQKKLLDPSLNSSKSYIIYHPLSGQCVKVNTNNELELGDCEWASKWNQE--GQQIKLVGN  446

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
                +  V +   + +S  C   QS  W   S +   L    + G  LCL  +S  SP  I
Sbjct  447   GTYIEAVSDGSQVKVSNDCKSKQS-FWKTLSATNLHLGTLDEQGQKLCLQRESPTSPK-I  504

Query  1657  LTRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             +T++C+ +++    + +PQ+QWF+L+ +N 
Sbjct  505   VTKRCICIDDNPACLEDPQSQWFQLVTTNV  534



>ref|XP_011034023.1| PREDICTED: uncharacterized protein LOC105132312 [Populus euphratica]
Length=566

 Score =   416 bits (1068),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 223/508 (44%), Positives = 323/508 (64%), Gaps = 16/508 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLE M+ EGL  +P+  IA  + +MGFNCVRLTW  ++ 
Sbjct  39    RWIVD-ENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCVRLTWPVFLV  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     ++TV QS   LGL E+ISG+ +NNP+++ L L+D  +AVV  +G + +M++LDN
Sbjct  98    TNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLDVYQAVVSNLGDNNVMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W+ GL  +A++F   P VVG+SLRNELRGP QN
Sbjct  158   HISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP+++VI+SGL+YD D  FL+ RP       +K+V+E H Y 
Sbjct  218   VNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFLRNRP-VNLTFSRKIVFEVHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW  G  N+VC  +   M    GFL+  G   PLF+SEFG++Q G +  DNR+
Sbjct  277   FTDGQ--AWKNGNPNQVCGRVVDNMMRISGFLLDQG--WPLFMSEFGVDQRGTNVNDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L   A+LDLDW++W L GSYYLR+G  G +E YG+  +NW   RN  FL ++  LQ
Sbjct  333   LGCFLGVAAELDLDWALWTLVGSYYLRQGVIGMNEYYGVLNSNWRETRNSTFLQQISALQ  392

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P  SE   +++++HP +G C   + + + + +  C+  S        K + + G+
Sbjct  393   SPFRGPGVSEVHLHKVIFHPSTGLCVLRKSMLEPLRLGPCT-KSEAWNYTPQKILSVKGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  +C D  S  W   S+S   L++K  NG  +CLD  S+   +TI
Sbjct  452   YFCLQTDELAKPAKLGIMCTDSNSK-WETISDSKMHLSSKAPNGTPVCLDIGSN---NTI  507

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIASNT  1740
             +T  C  L + +  +P++QWFKL+ S T
Sbjct  508   VTNTCKCLSKDNTCDPESQWFKLVNSTT  535



>emb|CDP13254.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   414 bits (1064),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 227/511 (44%), Positives = 329/511 (64%), Gaps = 24/511 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++  SG+RVKLAC +WA HLE ++ EGL ++P+  I+  +  MGFNCVRLTW  ++F
Sbjct  10    RWIVNG-SGQRVKLACVNWATHLEVVVAEGLSKQPVDVISRSIVDMGFNCVRLTWPLFLF  68

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A+++V QSF  LGLTE+I+G  +NNP+++ L+L++A +AVV  +  + +M++LDN
Sbjct  69    TNDTLASLSVRQSFQKLGLTESIAGFQANNPSIVDLSLINAYQAVVASLASNNVMIILDN  128

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  VA +F     VVG+SLRNELRGP QN
Sbjct  129   HISKPGWCCSNFDGNGFFGDRYFNPDLWIRGLTEVAAMFCGINNVVGISLRNELRGPKQN  188

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WY+Y++KGA+A++ ANP++L+I+SGL+YD DF FL ++P        K+VYE H Y 
Sbjct  189   VDDWYRYMQKGAEAVHAANPDVLIILSGLNYDKDFSFLLQKP-VNLTFSGKLVYEVHWYG  247

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G  KAW  G  N+VC  +  +M  K GFL+  G   PLFVSEFG++  G +  DNR 
Sbjct  248   FSDG--KAWETGNPNEVCGRLVNDMMRKSGFLLDQGY--PLFVSEFGVDLRGTNVNDNRF  303

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L + A+LDLDW++W L GSYYLREG  G DE+YG++  NW   RN +F+ ++  LQ
Sbjct  304   LNCFLGWAAELDLDWALWTLVGSYYLREGVAGKDESYGIYNWNWCETRNSSFIQRISALQ  363

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADG----KPIH  1464
                + P  SE   +++++HP +G C   + +   + +  CS A     EA G    K + 
Sbjct  364   SPFRGPGVSESRPHKIIFHPATGLCVQRKSLLKPLELGPCSEA-----EAWGYSPQKTLT  418

Query  1465  MIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYS  1644
             + G+  CL       P  L  IC D +S+ W   S+S   L++K  +G  +CLD DS+  
Sbjct  419   IKGTYYCLQADALGQPAKLGIICTD-KSSKWEAISDSKMHLSSKLCDGSEVCLDVDSN--  475

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
              + ++T  C  L      +P +QWFKL+ S+
Sbjct  476   -NVVVTNNCKCLSRDSSCDPGSQWFKLVDSS  505



>gb|KHG05074.1| Endoglucanase [Gossypium arboreum]
Length=563

 Score =   414 bits (1065),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 218/506 (43%), Positives = 325/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G RVKLAC +W  HLEP++ EGL ++P+  I+  + TMGFNCVR TW  ++ 
Sbjct  36    RWIVDEE-GRRVKLACVNWVSHLEPVVAEGLSKQPMDMISKRIVTMGFNCVRFTWPLFLI  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL E+I+G+ SNNP+++ ++L+ A +AVV  +G++ +M++LDN
Sbjct  95    TNDSLASLTVRQSFQRLGLLESIAGIQSNNPSIIDVSLIKAYQAVVSSLGKNDVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC+D DGN FFG  YF+PD W+ GL  +A +F     VVG+SLRNELRG  QN
Sbjct  155   HLSKPGWCCSDFDGNGFFGDQYFNPDLWITGLTRMATLFNGVTNVVGMSLRNELRGHKQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP++LVI+SGLSYD D  F++ RP        K+V+E H Y 
Sbjct  215   VNDWYRYMQKGAEAVHSANPDVLVILSGLSYDSDLSFIQNRP-AQLSFSGKLVFEVHWYG  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+ GQ+  W+ G  N+VC  + ++M  + GFLV  G   PLFVSE+G++Q G +  DNR+
Sbjct  274   FSNGQT--WVTGNPNQVCGRVAKDMMRRSGFLVDQGY--PLFVSEYGVDQRGTNVNDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L   A+LDLDW++W L GSYYLREG  G +E YG+   NW   RN +F+ ++  LQ
Sbjct  330   LNCFLGVAAELDLDWALWTLVGSYYLREGVIGLNEYYGVLNYNWCETRNSSFIKRISALQ  389

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P +S    +++++HP +G C   +   D + +  C+ +      +D K + + G+
Sbjct  390   SPFRGPGLSETKLHKVIFHPSTGLCVIRKSFLDPLLLGPCANSESWSYSSD-KTLVVKGT  448

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL          L   C+D  S  W + ++S   L++K  NG  +CLD DSS   + I
Sbjct  449   YFCLQADESGTLAKLGIFCSDSNSK-WEMIADSKMHLSSKLRNGKSICLDVDSS---NAI  504

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  + + +  +P +QWFKL+ S
Sbjct  505   VTNSCKCISKDNTCDPASQWFKLVDS  530



>ref|XP_007044872.1| Cellulase protein [Theobroma cacao]
 gb|EOY00704.1| Cellulase protein [Theobroma cacao]
Length=563

 Score =   413 bits (1062),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 220/506 (43%), Positives = 325/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HLEPM+ EGL + P+  IA  + + GFNCVRLTW  ++ 
Sbjct  36    RWIVDEK-GQRVKLACVNWVSHLEPMVAEGLSKLPMDVIAKRIVSTGFNCVRLTWPLFLV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL E+I+G+ +NNP+++ ++L+ A +AVV  +G + +M++LDN
Sbjct  95    TNDSLASLTVRQSFQRLGLLESIAGIQTNNPSIIDVSLLKAYQAVVCSLGENNVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W+ GL  +A +      VVG+SLRNELRGP Q 
Sbjct  155   HISKPGWCCSNFDGNGFFGDQYFNPDIWITGLTRMATLVNAVTNVVGMSLRNELRGPKQT  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP++LVI+SGL+YD D  F++ RP        K+V+E H Y 
Sbjct  215   VNDWYRYMQKGAEAVHSANPDVLVILSGLNYDKDLSFIRNRP-ANLTFTGKLVFEVHWYG  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ+  W+ G  N+VC  +  +M    GFLV  G   PLFVSEFG++Q G +  DNR+
Sbjct  274   FTDGQT--WVTGNPNQVCGRVANDMMRTSGFLVDQGY--PLFVSEFGVDQRGTNVNDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L   A+LDLDW++W L GSYYLREG  G +E YG+   NW  +RN +FL ++  LQ
Sbjct  330   LNCFLGVAAELDLDWALWTLVGSYYLREGVVGLNEYYGILNWNWCEIRNSSFLERISALQ  389

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P +S    +++++HP +G C   + + D + +  C+  S     +    + + G+
Sbjct  390   SPFRGPGLSETKLHKVIFHPSTGLCVLRKSLLDPLRLGPCTD-SEAWSYSPQNTLVVKGT  448

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL          L  IC++  S  W + S+S   L++K  NG  +CLD DS+   +TI
Sbjct  449   YFCLQADESGTLARLGIICSESNSK-WEMISDSKMHLSSKLRNGTSICLDVDST---NTI  504

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L   +M +P++QWFKL+ S
Sbjct  505   VTNSCKCLSNDNMCDPESQWFKLVDS  530



>ref|XP_008236799.1| PREDICTED: uncharacterized protein LOC103335561 [Prunus mume]
Length=544

 Score =   412 bits (1060),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 225/507 (44%), Positives = 325/507 (64%), Gaps = 16/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G+RVKLAC +W  HLE ++ EGL ++P+  I+  ++++GFNCV+LTW T++ 
Sbjct  40    RWIVDYK-GQRVKLACVNWVSHLEAVIAEGLSKQPVDTISKRIASLGFNCVKLTWPTFLA  98

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  L L+E+I+GL SNNP++++L L+ A +AVV  +G++ +M++LDN
Sbjct  99    TNDTLASVTVQQSFQSLNLSESIAGLQSNNPSIINLTLLQAYQAVVNSLGKNNVMVILDN  158

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC+  DGN FFG  YF+PD W++GL  +A +F     VVG+SLRNELRGP QN
Sbjct  159   HVSKPGWCCSSSDGNGFFGDQYFNPDVWIKGLTRMATLFNGVGFVVGMSLRNELRGPKQN  218

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WYK +++GA+A+++ANP++LVI+SGLS D D  FL  RP        K V+E H Y 
Sbjct  219   VDDWYKDMQRGAEAVHSANPDVLVILSGLSDDKDLSFLANRP-LGLTFSGKTVFEVHWYG  277

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N VC  +T  M+ + GFL+  G   PL VSEFG++Q G +  DNR+
Sbjct  278   FSDGQ--AWKSGNPNHVCGSVTNNMKRQSGFLLEKG--FPLLVSEFGVDQRGTNVNDNRY  333

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++  A+LDLD+++W L GSYYLR+G  G +E YG+  ++W+ +RN +   +L  LQ
Sbjct  334   LSCFMAAAAELDLDFALWTLVGSYYLRDGVLGMNEYYGVLNSDWSDIRNSSLSQRLSVLQ  393

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGD--QIHMSDCSGASRCIQEADG-KPIHMIG  1473
                Q P +S    +++++HP +G C   VG    + +  CS +   I  +   K + + G
Sbjct  394   SPFQGPDISQSSWHKIIFHPATGLCLVQVGQLAPLKLGPCSQSGPWIYSSQTQKFLTLQG  453

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
             S  CL V   + P  L  IC    S  W   S+S   L++K  NG  +CLD DSS   +T
Sbjct  454   SYLCLQVDELEKPAKLGVICRPPNSQ-WDTISDSGLHLSSKTLNGTNVCLDVDSS---NT  509

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             I+T  C  L      NP++QWFKL+ S
Sbjct  510   IVTNSCKCLSRDSSCNPESQWFKLVDS  536



>ref|XP_011042367.1| PREDICTED: uncharacterized protein LOC105138074 [Populus euphratica]
Length=561

 Score =   413 bits (1061),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 220/506 (43%), Positives = 320/506 (63%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLE M+ EGL ++P+  IA  + +MGFNCVRLTW  ++ 
Sbjct  39    RWIVD-ENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCVRLTWPVFLV  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     ++TV QS    GL E+ISG+ +NNP+++ L+L+D  +AVV  +G + +M++LDN
Sbjct  98    TNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGNNNVMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W+ GL  +A++F   P VVG+SLRNELRGP QN
Sbjct  158   HISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP++++I+SGL+YD D  +L+ RP        K+V+E H Y 
Sbjct  218   VNDWYRYMQKGAEAVHSANPDVVIILSGLNYDKDLSYLRNRP-LNLTFSGKIVFEVHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G+  AW  G  N+VC  +   M    GFL+  G   PLFVSEFG++Q G +  DNR+
Sbjct  277   FTDGE--AWKNGNSNQVCGRVVDNMMRVSGFLLDQG--WPLFVSEFGVDQRGTNVNDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A+LDLDW++W L GSYYLR+G  G +E YG+   NW   RN  FL ++  LQ
Sbjct  333   LGCFLSVAAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLNWNWCEARNSTFLQQISALQ  392

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P  SE   +++++HP +G C   + + + + +  C+  S        K + + G+
Sbjct  393   SPFRGPGLSEANPHKVIFHPSTGLCVLRKSMFEPLRLGRCT-ESEAWTYTSQKILSVKGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S  W   S+S    ++   NG  +CLD DS    +TI
Sbjct  452   YFCLQTDDLAKPAKLGIICTDSNSK-WQTISDSKMHFSSTASNGTTVCLDVDSD---NTI  507

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L + +  +P++QWFKL+ S
Sbjct  508   VTNTCKCLSKDNACDPESQWFKLVNS  533



>ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=566

 Score =   412 bits (1058),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 220/506 (43%), Positives = 323/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLE ++ EGL ++P+  IA  + +MGFNCVRLTW  Y+ 
Sbjct  39    RWIVD-ENGQRVKLACVNWVSHLEAVVAEGLSKQPMDMIAKKIVSMGFNCVRLTWPLYLV  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A+++V QSF  LGL E+ISG+ +NNP+++ L L+ A +AVV  +G + +M++LDN
Sbjct  98    TNDTLASLSVRQSFQGLGLLESISGIQANNPSIIDLPLIKAYQAVVSSLGDNNVMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A +F     V+G+SLRNELRG  QN
Sbjct  158   HISKPGWCCSNFDGNGFFGDTYFNPDLWIKGLTQMATLFNGVTNVIGMSLRNELRGQKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+EKGA+A+++ANP++LVI+SGL+YD DF FL+ RP        KVV+E H Y 
Sbjct  218   VNDWYRYMEKGAEAVHSANPDVLVILSGLNYDKDFSFLRNRP-VNLSFTGKVVFEVHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   +    GFL+  G   P+FVSEFG++Q G +  DNR+
Sbjct  277   FSDGQ--AWRSGNPNQVCGRVVDNLMRISGFLLEQG--WPMFVSEFGVDQRGTNVNDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C +   A+LD DW++W L GSYYLR+G  G +E YG+   NW  +RN +FL ++  LQ
Sbjct  333   LGCFIGVAAELDWDWALWTLVGSYYLRQGVIGLNEYYGVLNWNWCDVRNSSFLQQISALQ  392

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  SE   +++++HP +G C   + + + + +  C+  S   +      + + G+
Sbjct  393   SPFQGPGLSETNPHKVIFHPSTGLCVQRKSMLEPLRLGSCTD-SEAWRYTSENTLTLRGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S  W + S+S   L++K  NG  +CLD DS+   +TI
Sbjct  452   YFCLQADELGKPAKLGIICTDSTSK-WDVISDSKMHLSSKITNGTAVCLDVDSN---NTI  507

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +   C  L   +  +P++QWFKL+ S
Sbjct  508   VISTCKCLSRDNTCDPESQWFKLVNS  533



>ref|XP_009765489.1| PREDICTED: uncharacterized protein LOC104217035 [Nicotiana sylvestris]
Length=562

 Score =   411 bits (1056),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 222/507 (44%), Positives = 321/507 (63%), Gaps = 17/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++  +G+RVKLAC +W  H+E M+ EGL+++P+  I+  +  MGFNCVRLTW  ++F
Sbjct  38    RWIVN-STGQRVKLACVNWVSHMEVMVAEGLNQQPVDAISRAIINMGFNCVRLTWPLFLF  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     ++TV QSF +LGL  +I GL +NNP+++ L+++DA +AVV  + ++ +M++LDN
Sbjct  97    TNDSLGSITVRQSFKNLGLFASIVGLQANNPSIVDLSVLDAYQAVVASLAKNNVMIILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC+  DGN FFG  YFDPD WLQGL  VA IFK T  VVG+SLRNELRGPLQN
Sbjct  157   HISKPGWCCSRFDGNGFFGDKYFDPDLWLQGLTKVATIFKGTNNVVGMSLRNELRGPLQN  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WY+Y++KGA+A++ ANPN+L+I+SGLS+D D  FL +RP        K+VYE HRY 
Sbjct  217   AHDWYRYMQKGAEAVHAANPNVLIILSGLSFDKDLSFLHQRP-VNLTFSGKLVYEIHRYG  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G +  W     N+ C  +  +M  K  F+++ G   PLFVSEFG++Q G +  DNR+
Sbjct  276   FTDGDT--WSGDSANQACGVVLNDMVSKGTFVLQQGY--PLFVSEFGVDQRGTNVNDNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L   A LD DW++W L GSYYLR+G  G +E YG+   NW  +RN +FL ++  ++
Sbjct  332   FNCFLGLAAQLDFDWALWTLVGSYYLRDGVVGLNEYYGVLDCNWRDIRNSSFLERISAIR  391

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  +E   +++++HP +G C R       + +  CS A+   + A  K + +IG+
Sbjct  392   SPFQGPGYTETRLHKVIFHPKTGLCVRRTSFLQPLELGSCSEAA-AWRYAPQKTLTVIGT  450

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L   C+D  S+ W   S+S   L++K  +   +CLD DS+   + I
Sbjct  451   YFCLQADKLGEPAKLGITCSD-DSSKWETISDSKMHLSSKLQDATSVCLDVDSN---NVI  506

Query  1657  LTRKCVGLEEGDMR-NPQTQWFKLIAS  1734
             +T+ C  L   D   +P +QWFK+I S
Sbjct  507   VTQTCKCLSTNDTTCDPGSQWFKIIDS  533



>ref|XP_010904543.1| PREDICTED: uncharacterized protein LOC105031942 [Elaeis guineensis]
Length=563

 Score =   410 bits (1053),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 222/507 (44%), Positives = 322/507 (64%), Gaps = 16/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG+RVKLAC +W  HL+ +L EG+ ++PL  I+  +++MGFNCVRLTW  ++ 
Sbjct  35    RWIVD-ESGQRVKLACVNWPSHLDTVLAEGMGKQPLDTISKKIASMGFNCVRLTWPLFLA  93

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    AN+TV QSF  LGL E+ + +  NNP L+ L L+ A +AVV  +G + IM++LDN
Sbjct  94    TNDSLANLTVRQSFQSLGLAESFAAIQVNNPALVDLPLIQAFQAVVTNLGENNIMVILDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W++GL  +A +F  T  VVG+SLRNELRG  QN
Sbjct  154   HISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATMFNGTTNVVGMSLRNELRGARQN  213

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WY+Y+++GA+A+++ANPN+LVI+SGLS+D D  FL ++         K+V+E H Y+
Sbjct  214   ATDWYRYMQRGAEAVHSANPNVLVILSGLSFDTDLSFLSKK-QVEVTFTGKLVFELHWYS  272

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW  G  N+VC  I   +  + GFL+  G   PLF+SEFG++Q G +  DNR+
Sbjct  273   FSDG--SAWANGNPNQVCGRIAANVMRRAGFLLDQG--WPLFLSEFGVDQRGTNVNDNRY  328

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L CML   A+LDLDW++WALQGSYY+REG  G DE YG+   +W   RN + L +++ +Q
Sbjct  329   LGCMLGVAAELDLDWALWALQGSYYIREGIRGLDEVYGVLAWDWCKTRNSSMLQRIQAIQ  388

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P +S    Y +++HP +G C   + + + + +  C+ +      A+ + I +  +
Sbjct  389   APFQGPGLSDIQPYTIIFHPSTGLCVLKKSLFEPLELGPCNESEAWTFSAE-QTIALKDT  447

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLA-NKGDNGLVLCLDFDSSYSPST  1653
             L CL   G   P  L  IC+D QS  W L S+S   ++ N   N   LCLD DS     +
Sbjct  448   LLCLKADGAGKPAKLGIICSDTQSK-WELISDSKMHVSTNISSNASSLCLDVDS--DGKS  504

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             I+T  C  L +    +P++QWFK++ S
Sbjct  505   IVTNPCKCLSKDQSCDPESQWFKMVDS  531



>ref|XP_010100346.1| hypothetical protein L484_027655 [Morus notabilis]
 gb|EXB82480.1| hypothetical protein L484_027655 [Morus notabilis]
Length=559

 Score =   410 bits (1053),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 220/510 (43%), Positives = 320/510 (63%), Gaps = 28/510 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +W  HLEP++ EGL ++PL  IA  +S +GFNCVRLTW  Y+ 
Sbjct  43    RWIVD-EGGRRVKLACVNWVSHLEPVVAEGLSKQPLDVIAAQISALGFNCVRLTWPIYLA  101

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV  SF  LGL E+I+GL + NP+++ L+L+ A +AVV  +G   +M+VLDN
Sbjct  102   TNDSLASLTVRDSFQRLGLEESIAGLQTYNPSIVDLSLIQAYQAVVSSLGSKNVMVVLDN  161

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV+KP WCC++ DGN FFG  YFDPD W++GL  +A +FK    V+G+SLRNELRGP QN
Sbjct  162   HVTKPGWCCSNFDGNGFFGDQYFDPDLWIKGLTHMATLFKGVQNVIGMSLRNELRGPKQN  221

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ W+KY+++GA+A+++ANP++LVI+SGLSYD D  FL  R         K+V+E H Y 
Sbjct  222   VNDWFKYMQRGAEAVHSANPDVLVILSGLSYDTDLSFLSNRA-VDLTFSGKLVFELHWYG  280

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW+ G  N+VC  +   ++ K GFL+  G   PLFVSEFG++Q G +  DNR+
Sbjct  281   FSDGS--AWVSGNPNQVCSMVANNVKRKAGFLLDKG--WPLFVSEFGVDQRGTNVNDNRY  336

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A+LDLDW++W L GSYY R+G  G +E YG+   +W  +RN + L K+  +Q
Sbjct  337   LNCFLAVAAELDLDWALWTLVGSYYFRQGVVGMNEYYGVLNWDWNEIRNASVLQKISAIQ  396

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADG------KP  1458
                Q P ++    +++++HP +G C   +   D + +  CS       ++DG      K 
Sbjct  397   YPFQGPGLAETRKHKIIFHPSTGLCVVRKSFTDALTLGPCS-------KSDGWYYTPQKI  449

Query  1459  IHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
             + + G+  CL V     P  L  IC +  S  W + S+S   LA K  +G  +CLD DS+
Sbjct  450   LEIKGTYFCLQVDDVGKPARLGIICMESDSK-WEIISDSKLHLAAKTSSGTTVCLDVDSN  508

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
                + ++T  C  L      +P +QWF+L+
Sbjct  509   ---NVVVTNLCKCLSRDSSCDPGSQWFQLV  535



>ref|XP_011042368.1| PREDICTED: uncharacterized protein LOC105138075 [Populus euphratica]
Length=542

 Score =   409 bits (1050),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 219/506 (43%), Positives = 319/506 (63%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLE M+ EGL ++P+  IA  + +MGFNCVRLTW  ++ 
Sbjct  39    RWIVD-ENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCVRLTWPVFLV  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     ++TV QS    GL E+ISG+ +NNP+++ L+L+D  +AVV  +G + +M++LDN
Sbjct  98    TNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGNNNVMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W+ GL  +A++F   P VVG+SLRNELRGP QN
Sbjct  158   HISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP+++VI+SGL+YD D  FL+ RP        K+V+E H Y 
Sbjct  218   VNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFLRNRP-VNLTFSGKIVFEVHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G    W  G  N+VC  +   M    GFL+  G   PLFVSEFG++Q G +  DNR+
Sbjct  277   FTDG--GGWKNGNSNQVCGRVVDNMMRVSGFLLDQG--WPLFVSEFGVDQRGTNVNDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A+LDLDW++W L GSYYLR+G  G +E YG+   +W  +RN  FL  +  +Q
Sbjct  333   LGCFLSVAAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLNLDWREVRNSTFLQLISAIQ  392

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P  SE   +++++HP +G C   + +   + +  C+  S        K + + G+
Sbjct  393   SPFRGPGLSEANPHKVIFHPSTGLCVLRKSMLAPLRLGRCA-ESEAWSYTPQKILSVKGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S  W   S+S   L++   +G  +CLD DS+   +TI
Sbjct  452   YFCLQTDDVAKPAKLGIICTDSNSK-WETISDSKMHLSSNASSGTTVCLDIDSN---NTI  507

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L + +  +P++QWFKL+ S
Sbjct  508   VTNTCKCLSKDNACDPESQWFKLVNS  533



>ref|XP_002312657.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
 gb|EEE90024.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
Length=566

 Score =   409 bits (1052),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 219/506 (43%), Positives = 319/506 (63%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLE M+ EGL  +P+  IA  + +MGFNCVRLTW  ++ 
Sbjct  39    RWIVD-ENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCVRLTWPVFLV  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     ++TV QS   LGL E+ISG+ +NNP+++ L L++  +AVV  +G + +M++LDN
Sbjct  98    TNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLNVYQAVVSSLGDNNVMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W+ GL  +A++F   P VVG+SLRNELRGP QN
Sbjct  158   HISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP+++VI+SGL+YD D  FL+ RP       +K+V+E H Y 
Sbjct  218   VNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFLRNRP-VNLTFSRKIVFEVHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW  G  N+VC  +   M    GFL+  G   PLF+SEFG++Q G +  DNR+
Sbjct  277   FTDGQ--AWKNGNPNQVCGRVVDNMMRISGFLLDQG--WPLFMSEFGVDQRGTNVNDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L   A+LD DW++W L GSYY R+G  G +E YG+  +NW   RN  FL ++  LQ
Sbjct  333   LGCFLGVAAELDFDWALWTLVGSYYFRQGVIGMNEYYGVLNSNWRETRNSTFLQQISALQ  392

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P  SE   +++++HP +G C   + + + + +  C+  S        K + + G+
Sbjct  393   SPFRGPGVSEVHLHKVIFHPSTGLCVLRKSMFEPLRLGPCT-QSEAWNYTPQKILSVKGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S  W   S+S   L++K  NG  +CLD   +   +TI
Sbjct  452   YFCLQTDELAKPAKLGIICTDSNSK-WEAISDSKMHLSSKAPNGTAVCLDIGYN---NTI  507

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L + +  +P++QWFKL+ S
Sbjct  508   VTSTCKCLSKDNTCDPESQWFKLVNS  533



>gb|KDO82151.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=570

 Score =   407 bits (1047),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 225/504 (45%), Positives = 314/504 (62%), Gaps = 16/504 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKLAC +W  HLEP++ EGL ++P+  ++  V  MGFNCVRLTW  Y+ 
Sbjct  44    RWIVD-ENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLA  102

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL EAI G+ SNNP+++ L L+ A +AVV  +G + +M++LDN
Sbjct  103   TNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDN  162

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A IF     VVG+SLRNELRGP QN
Sbjct  163   HISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQN  222

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y++ GA+A++ ANP +LVI+SGL++D D  F++ +         K+V+E H Y 
Sbjct  223   VKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQ-AVNLTFTGKLVFEAHWYG  281

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW+ G  N+VC  +   +    GFL+  G   PLFVSEFG +  G++  DNR+
Sbjct  282   FTDGQ--AWVDGNPNQVCGRVVDNVMRLSGFLLEQG--WPLFVSEFGADLRGNNVNDNRY  337

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     A+LD DW++W L GSYYLREG  G +E YG+F  NW  +RN +FL ++  LQ
Sbjct  338   LNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQ  397

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E   ++++YHP +G C   +   D + +  C+  S        K I + G+
Sbjct  398   SPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT-ESEAWSYTPHKTISLKGA  456

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S TW + S+S   L++K DNG  +CLD DSS   +TI
Sbjct  457   YFCLQAKHVGKPAKLGIICTDCGS-TWEIISDSKMHLSSKADNGTTVCLDVDSS---NTI  512

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLI  1728
             +T  C  L      +P +QWFKL+
Sbjct  513   VTNTCKCLSRDKTCDPASQWFKLV  536



>ref|XP_008793719.1| PREDICTED: uncharacterized protein LOC103709945 [Phoenix dactylifera]
Length=530

 Score =   406 bits (1043),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 222/507 (44%), Positives = 323/507 (64%), Gaps = 16/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG+RVKLAC +W  HLE +L EG+ ++PL  I+  +++MGFNCVRLTW  ++ 
Sbjct  11    RWIVD-ESGQRVKLACVNWPSHLETVLAEGMGKQPLDTISKEIASMGFNCVRLTWPLFLA  69

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    AN+TV QSF  LGL E+++ +  NN  L+ L L+ A KAVV  +G + IM++LDN
Sbjct  70    TNDSLANLTVQQSFQALGLAESLAAIRVNNQALVDLPLIQAFKAVVTNLGDNNIMVILDN  129

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W++GL  +A  F  T  VVG+SLRNELRG  QN
Sbjct  130   HISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATTFNGTTNVVGMSLRNELRGARQN  189

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+++GA+A+++ANP++LVI+SGLS+D D  +L ++         K+V+E H YA
Sbjct  190   VNDWYRYMQRGAEAVHSANPDILVILSGLSFDNDLSYLSKK-QVEVTFAGKLVFEVHWYA  248

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW  G  N+VC  +   +  + GFL+  G   PLF+SEFG++Q G +  DNR+
Sbjct  249   FSDGM--AWANGNPNQVCGRVAANVMRRAGFLLDQG--WPLFLSEFGVDQRGTNVNDNRY  304

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L CML   A+LDLDW++WALQG+YY+REG  G DE YG+   +W  +RN + L +++ +Q
Sbjct  305   LGCMLGVAAELDLDWALWALQGNYYVREGNLGLDEVYGVLAWDWCKIRNSSMLQRIQSIQ  364

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P +SS   Y +++HP +G C   + + + + +  C+ +      AD + I +  +
Sbjct  365   APFQGPGLSSMQPYTIIFHPSTGLCVLKKSLFEPLGLGPCNESEAWTFTAD-QTIALKDT  423

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNS-MFQLANKGDNGLVLCLDFDSSYSPST  1653
             L CL   GE  P  L  IC+D +S  W L S+S M        N   LCLD  S     +
Sbjct  424   LICLKADGESKPAKLGIICSDTRSK-WELISDSKMHVSTKSSSNSSSLCLDVGS--DGRS  480

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             I+T  C  L +    +P++QWFK++ S
Sbjct  481   IVTNPCRCLSKDQSCDPESQWFKMVNS  507



>ref|XP_006438205.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
 gb|ESR51445.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
Length=570

 Score =   407 bits (1046),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 224/504 (44%), Positives = 314/504 (62%), Gaps = 16/504 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKLAC +W  HLEP++ EGL ++P+  ++  +  MGFNCVRLTW  Y+ 
Sbjct  44    RWIVD-ENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRIVDMGFNCVRLTWPLYLA  102

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL EAI G+ SNNP+++ L L+ A +AVV  +G + +M++LDN
Sbjct  103   TNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDN  162

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A IF     VVG+SLRNELRGP QN
Sbjct  163   HISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQN  222

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y++ GA+A++ ANP +LVI+SGL++D D  F++ +         K+V+E H Y 
Sbjct  223   VKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQ-AVNLTFTGKLVFEAHWYG  281

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW+ G  N+VC  +   +    GFL+  G   PLFVSEFG +  G++  DNR+
Sbjct  282   FTDGQ--AWVDGNPNQVCGRVVDNVMRLSGFLLEQG--WPLFVSEFGADLRGNNVNDNRY  337

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     A+LD DW++W L GSYYLREG  G +E YG+F  NW  +RN +FL ++  LQ
Sbjct  338   LNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQ  397

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E   ++++YHP +G C   +   D + +  C+  S        K I + G+
Sbjct  398   SPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT-ESEAWSYTPHKTISLKGA  456

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S TW + S+S   L++K DNG  +CLD DSS   +TI
Sbjct  457   YFCLQAKHVGKPAKLGIICTDCGS-TWEIISDSKMHLSSKADNGTTVCLDVDSS---NTI  512

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLI  1728
             +T  C  L      +P +QWFKL+
Sbjct  513   VTNTCKCLSRDKTCDPASQWFKLV  536



>ref|XP_006483983.1| PREDICTED: uncharacterized protein LOC102624331 [Citrus sinensis]
Length=588

 Score =   407 bits (1047),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 225/504 (45%), Positives = 314/504 (62%), Gaps = 16/504 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKLAC +W  HLEP++ EGL ++P+  ++  V  MGFNCVRLTW  Y+ 
Sbjct  62    RWIVD-ENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLA  120

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL EAI G+ SNNP+++ L L+ A +AVV  +G + +M++LDN
Sbjct  121   TNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDN  180

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A IF     VVG+SLRNELRGP QN
Sbjct  181   HISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQN  240

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y++ GA+A++ ANP +LVI+SGL++D D  F++ +         K+V+E H Y 
Sbjct  241   VKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQ-AVNLTFTGKLVFEAHWYG  299

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW+ G  N+VC  +   +    GFL+  G   PLFVSEFG +  G++  DNR+
Sbjct  300   FTDGQ--AWVDGNPNQVCGRVVDNVMRLSGFLLEQG--WPLFVSEFGADLRGNNVNDNRY  355

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     A+LD DW++W L GSYYLREG  G +E YG+F  NW  +RN +FL ++  LQ
Sbjct  356   LNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQ  415

Query  1306  QKLQDPMSSEP-TYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E   ++++YHP +G C   +   D + +  C+  S        K I + G+
Sbjct  416   SPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT-ESEAWSYTPHKTISLKGA  474

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL       P  L  IC D  S TW + S+S   L++K DNG  +CLD DSS   +TI
Sbjct  475   YFCLQAKHVGKPAKLGIICTDCGS-TWEIISDSKMHLSSKADNGTTVCLDVDSS---NTI  530

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLI  1728
             +T  C  L      +P +QWFKL+
Sbjct  531   VTNTCKCLSRDKTCDPASQWFKLV  554



>ref|XP_009359244.1| PREDICTED: uncharacterized protein LOC103949843 [Pyrus x bretschneideri]
Length=552

 Score =   405 bits (1040),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 219/506 (43%), Positives = 321/506 (63%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG+RVKLAC +W  HL+ ++ EGL ++P+  IA  ++++GFNCVRLTW  ++ 
Sbjct  34    RWIVD-ESGQRVKLACVNWVSHLDTVVAEGLSKQPVDAIAKRITSLGFNCVRLTWPLFLA  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV QSF  LGL ++ISG+ SNNP L+ L L+ A +AVV  +G + +M++LDN
Sbjct  93    TNETLAAVTVRQSFQSLGLLDSISGIQSNNPALVDLPLLKAYQAVVSSLGSNNVMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W+ GL  +A +FK    VVG+SLRNELRGP QN
Sbjct  153   HLSKPGWCCSNTDGNGFFGDQYFNPDLWITGLTRMATLFKGVSNVVGMSLRNELRGPKQN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+++GA+A+++AN ++LVI+SGLS+D D  FL +RP        K V+E H Y 
Sbjct  213   VNDWYKYMQRGAEAVHSANADVLVILSGLSFDTDLSFLAKRP-VNLTFAGKTVFEVHWYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   ++ K GFL+  G   PLFVSEFG +Q G +  DNR+
Sbjct  272   FSDGQ--AWQSGNPNQVCGQVYNNVKRKSGFLLEEG--FPLFVSEFGADQRGTNVNDNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++  A+LD+D+S+W L GSYY REG  G +E YG+   +W+ +RN +   +L  LQ
Sbjct  328   LNCFMAAAAELDVDFSLWTLVGSYYFREGVVGTEEYYGILNWDWSDIRNSSLTQRLSVLQ  387

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
               LQ P +S    +++++HP +G C   VG    + +  CS  S     +  K + + G+
Sbjct  388   SPLQGPGLSQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCS-QSGAWTYSSRKVLTLKGT  446

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+     + P  +  +C    S  W + S+S   L +K  +G  +CLD DSS   +T+
Sbjct  447   YFCIQADELNKPAAVGILCTTTNSQ-WDIISDSKLHLQSKTTDGTEVCLDVDSS---NTV  502

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L   +  +P +QWFKL+ S
Sbjct  503   VTSSCKCLSRDNSCDPASQWFKLVDS  528



>gb|EEE61202.1| hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
Length=571

 Score =   404 bits (1038),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 226/519 (44%), Positives = 311/519 (60%), Gaps = 27/519 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +W  HLEPML EGL ++P+  IA  V  MGFNCVRLTWAT+M 
Sbjct  36    RWIVD-EGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+++TV QSF  L LTE+++ +  NNP+L+ L L+DA KAVV  +G +G+M++LDN
Sbjct  95    TNASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSSLGENGVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC ++DGN FFG  YFDPD W+ GL  +A +F   P VV +SLRNELRGP QN
Sbjct  155   HVSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+++GA+A++ ANP ++VI+SG+S+D D  FL  R         KV +E H Y 
Sbjct  215   SADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFLNSR-QVNVSFAGKVAFEVHWYG  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   +  +  +L+  G   P+F+SEFG++  G +  DNR+
Sbjct  274   FSDGQ--AWRAGNANQVCARVAASVSRRALYLLDQG--WPVFLSEFGVDNRGGNVNDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+ +  ADLDLDW++W LQGSYYLREG  G DE YG+    W   RN   L++L  LQ
Sbjct  330   YGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQ  389

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRC-----ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
             +  + P ++    Y +++HP +GRC     + VV   + +  C  A      A  + +  
Sbjct  390   RPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSP  449

Query  1468  IGS-LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKG---------DNGLVL  1617
               S L CL   G   P  L   C D +   WSL S+S   LA             NG +L
Sbjct  450   RDSPLLCLRAEGAGRPARLGLSCGD-ELARWSLTSDSKLHLAVNASSSSSSPETSNGGML  508

Query  1618  CLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             CLD        +++T  C  L   +  +P++QWFKL+ S
Sbjct  509   CLDVGD--DGRSLVTNPCRCLSADNSCDPESQWFKLVTS  545



>ref|XP_010682344.1| PREDICTED: uncharacterized protein LOC104897211 [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   403 bits (1036),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 214/505 (42%), Positives = 325/505 (64%), Gaps = 17/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G RVKLAC +WA HLE ++ EGL ++P+  I+  +  +GFNCVRLTW  Y+ 
Sbjct  38    RWIVDEE-GHRVKLACVNWASHLELVVAEGLGQQPVDVISKKIKDLGFNCVRLTWPLYLA  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV +SF + GL+++ISGL +NNP+++ L+L++A +AVV  +  + +M++LDN
Sbjct  97    TNESLACLTVRESFVNAGLSDSISGLQANNPSIVDLSLINAFQAVVASLTNNKVMVILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S P WCC+ +DGN FFG  YF+PD W+ GL  +A +FKD P V+G+SLRNELRGP QN
Sbjct  157   HISTPGWCCSKYDGNGFFGDQYFNPDLWINGLTKMATLFKDNPFVIGMSLRNELRGPKQN  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+ +++GA+A++ ANPN+LVI+SGLSYD DF FL+++P        K+V+E H YA
Sbjct  217   VNDWYRCMQRGAEAVHGANPNVLVILSGLSYDKDFSFLRKQP-ISLSFTGKLVFEAHWYA  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G+  AW  G  N+VC  +   +    GFL+  G   PLFVSE+G++  G +  DNR+
Sbjct  276   FSDGE--AWKNGNSNQVCGKLVNNIMGMSGFLLDQG--FPLFVSEWGVDLRGTNTNDNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+++A+ DLDW++W L G+YYLREG  G  E YG+  ++WT +RN +FL ++  +Q
Sbjct  332   LNCFLAWIAEHDLDWALWTLAGNYYLREGVVGMVEYYGLLNSDWTQVRNTSFLERISVIQ  391

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCAR---VVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
               LQ P MS    + ++YHP +G C     +    + + +C+ ++R       + + + G
Sbjct  392   APLQGPGMSQRTEHNIIYHPSTGLCVVKKPMTPMGVQLGNCAESNRWTYTPS-QTLTIKG  450

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
             S  CL   G +LP  LS  C  G    W+  S+S   L+      + +CLD DS    + 
Sbjct  451   SYLCLHAQGMNLPARLSLYC-PGVGTRWTPISDSKLHLSASLSRRVTVCLDVDSD---NN  506

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLI  1728
             ++T  C  L   +  +P +QWFK++
Sbjct  507   LITTTCKCLSNDNKCDPGSQWFKIV  531



>ref|XP_010248702.1| PREDICTED: uncharacterized protein LOC104591536 [Nelumbo nucifera]
Length=555

 Score =   402 bits (1034),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 218/506 (43%), Positives = 316/506 (62%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +WA HLE M+ EGL ++PL  I+  + +MGFNCVRLTW  ++ 
Sbjct  38    RWIVD-ETGQRVKLACVNWASHLESMVAEGLSKQPLDVISKQIVSMGFNCVRLTWPLFLV  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL E I+G+  NNP+L+ L L+ A + VV  +  + +M++LDN
Sbjct  97    TNSSLASITVRQSFKSLGLIETIAGIEVNNPSLVDLPLIRAYQVVVANLADNNLMVILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SK  WCC+  DGN FFG  YFDP  W+ GL  +A +F+ T  VVG+SLRNELRG  Q+
Sbjct  157   HISKSGWCCSSVDGNGFFGDKYFDPSLWINGLTRMATMFRGTANVVGMSLRNELRGARQS  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A++ ANPN+LVI SGL+YD DF FL  +P        K+V+E H Y 
Sbjct  217   VNDWYRYMQKGAEAVHLANPNVLVIFSGLNYDKDFTFLVNQP-VNLTFTGKLVFELHWYG  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G  KAW  G  N+VC  +      K GF++  G   PLF+SEFG++Q G +  DNR 
Sbjct  276   FSDG--KAWETGNPNQVCATVVDNFMRKGGFVLDQG--WPLFLSEFGVDQRGTNINDNRF  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     A+LD DW++W L GSYYLREGK G DETYG+ + NW   RN +F+ ++  LQ
Sbjct  332   LNCFFGVAAELDFDWALWTLAGSYYLREGKIGMDETYGVLSWNWCKTRNSSFMERISVLQ  391

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P +S    Y++++HP +G C   + + + + +  C+  S        K + + G+
Sbjct  392   SPFQGPGLSDVRPYKVIFHPSTGLCVLRKSLFEPLKLGPCT-ESEAWSYTPPKNLLLKGT  450

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+       P+ L   C+D  S+ W + S+S   L++   +G  +CLD DS+   +TI
Sbjct  451   YFCIQADELGKPVKLGIFCSD-PSSKWDMISDSKMHLSSTLSDGSTVCLDVDST---NTI  506

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  +   D  +P +QWFK++ S
Sbjct  507   ITTPCKCVSRDDKCDPASQWFKIVTS  532



>ref|XP_009385963.1| PREDICTED: uncharacterized protein LOC103973176 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=556

 Score =   402 bits (1033),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 223/508 (44%), Positives = 315/508 (62%), Gaps = 17/508 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D + G RVKLAC +WA HLEP + EGL ++PL  I+  V+ MGFNCVRLTW  Y+ 
Sbjct  39    RWVVDGE-GRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMGFNCVRLTWPLYLL  97

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   + ++TV QS   LGL E+ +G+  NNP LL L LV A +AVV  +  + +M++LDN
Sbjct  98    TDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVSNLASNSLMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              +SKP WCC+ +D N FFG  YFDPDEWL+GL ++A +F  +  VVG+SLRNELRGP QN
Sbjct  158   QISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             + +WY+Y+++GA+ +++ANP++LVI+SGL YD D  FL E+        KK+V+E H Y 
Sbjct  218   ISLWYRYMQRGAEIVHSANPDILVILSGLDYDKDLSFLSEK-QVNLSFTKKLVFEYHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G    W     N+VC  +   +  K GFL+  G   PLF+SEFGI+Q G +EADN  
Sbjct  277   FSDGGD--WGSQNPNEVCAMVIGNITRKGGFLLEQG--WPLFLSEFGIDQRGVNEADNHF  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS+ A+ D+DW++WALQGSYY+REG+ G DETYG  + +W   RN +F+ +L  +Q
Sbjct  333   LSCFLSFAAEKDIDWALWALQGSYYIREGQLGLDETYGALSWDWCKARNSSFIQRLSAIQ  392

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGD--QIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P +S    Y +++HP +G C        Q+ +  C+  S   +    K + + G+
Sbjct  393   SPFQGPGLSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCA-ESTAWRYTRQKKLMLKGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCLDFDSSYSPST  1653
               CL   G   P  L   C    S  W L S+S   + +N  +NG  +CLD D +    T
Sbjct  452   KYCLQPEGVSKPAKLGFGCKV-SSAKWHLISSSKMHISSNLTNNGNNVCLDIDDN---GT  507

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             I+T +C  L      NP +QWFK+I S+
Sbjct  508   IMTNQCKCLSLDGTCNPGSQWFKIIRSS  535



>ref|XP_004309996.1| PREDICTED: endoglucanase-like [Fragaria vesca subsp. vesca]
Length=550

 Score =   402 bits (1032),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 223/506 (44%), Positives = 320/506 (63%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HL+P++ EGL ++PL  I+  ++++GFNCVRLTW  Y+ 
Sbjct  31    RWIVD-ENGQRVKLACVNWVSHLDPVVAEGLSKQPLDSISKRITSLGFNCVRLTWPLYLA  89

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV QSF  LGL E+I+G+ SNNP+L+ L L+ A + VV  +G + +M++LDN
Sbjct  90    TNDSLAAVTVRQSFQSLGLQESIAGVQSNNPSLIDLPLLKAFQEVVTNLGNNNVMVILDN  149

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC+++D N FFG  YF+PD W++GL  +A +FK    VVG+SLRNELRGP QN
Sbjct  150   HVSKPGWCCSNNDDNGFFGDKYFNPDLWIKGLTQMATLFKGVSNVVGMSLRNELRGPKQN  209

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+ +GA+A+++ANP++LVI+SGL +D D  F+  RP        K+VYE H Y 
Sbjct  210   VEDWYKYMPRGAEAVHSANPDVLVILSGLYFDTDLSFVNNRP-VKLTFPGKLVYELHWYG  268

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  ++ E++ K G+L+  G   PLFVSEFGI+Q G +  DNR+
Sbjct  269   FSDGQ--AWADGNPNQVCGRVSSEVKRKAGYLLDKG--FPLFVSEFGIDQRGTNVNDNRY  324

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A LD+++++W L GSYYLR G  G +E YG+   NW  +RN + L +L  LQ
Sbjct  325   LNCFLAAAAQLDVEYALWTLVGSYYLRSGVLGMNEYYGLLNWNWGEIRNSSLLQRLSVLQ  384

Query  1306  QKLQDPMSSE-PTYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  SE   ++++ HP +G C   VG    + +  CS  S     +  K + + G+
Sbjct  385   SPFQGPGLSEVRKHKIILHPSTGLCLLKVGFMGPLKLGPCS-QSGAWSYSSRKVLALKGT  443

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+       P  +  IC D  S  W   S+S   L +K  +G  +CLD DSS   +TI
Sbjct  444   YFCIQADQLGKPAAVGIICTDTNSQ-WDTISDSKLHLQSKTPDGTEVCLDVDSS---NTI  499

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L +    +P +QWF L+ S
Sbjct  500   VTNSCKCLSKDKSCDPGSQWFSLVDS  525



>ref|XP_009385956.1| PREDICTED: uncharacterized protein LOC103973176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   402 bits (1033),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 223/508 (44%), Positives = 315/508 (62%), Gaps = 17/508 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D + G RVKLAC +WA HLEP + EGL ++PL  I+  V+ MGFNCVRLTW  Y+ 
Sbjct  39    RWVVDGE-GRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMGFNCVRLTWPLYLL  97

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   + ++TV QS   LGL E+ +G+  NNP LL L LV A +AVV  +  + +M++LDN
Sbjct  98    TDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVSNLASNSLMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              +SKP WCC+ +D N FFG  YFDPDEWL+GL ++A +F  +  VVG+SLRNELRGP QN
Sbjct  158   QISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             + +WY+Y+++GA+ +++ANP++LVI+SGL YD D  FL E+        KK+V+E H Y 
Sbjct  218   ISLWYRYMQRGAEIVHSANPDILVILSGLDYDKDLSFLSEK-QVNLSFTKKLVFEYHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G    W     N+VC  +   +  K GFL+  G   PLF+SEFGI+Q G +EADN  
Sbjct  277   FSDGGD--WGSQNPNEVCAMVIGNITRKGGFLLEQG--WPLFLSEFGIDQRGVNEADNHF  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS+ A+ D+DW++WALQGSYY+REG+ G DETYG  + +W   RN +F+ +L  +Q
Sbjct  333   LSCFLSFAAEKDIDWALWALQGSYYIREGQLGLDETYGALSWDWCKARNSSFIQRLSAIQ  392

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGD--QIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P +S    Y +++HP +G C        Q+ +  C+  S   +    K + + G+
Sbjct  393   SPFQGPGLSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCA-ESTAWRYTRQKKLMLKGT  451

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCLDFDSSYSPST  1653
               CL   G   P  L   C    S  W L S+S   + +N  +NG  +CLD D +    T
Sbjct  452   KYCLQPEGVSKPAKLGFGCKV-SSAKWHLISSSKMHISSNLTNNGNNVCLDIDDN---GT  507

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             I+T +C  L      NP +QWFK+I S+
Sbjct  508   IMTNQCKCLSLDGTCNPGSQWFKIIRSS  535



>gb|EEC77495.1| hypothetical protein OsI_16343 [Oryza sativa Indica Group]
Length=571

 Score =   402 bits (1033),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 225/519 (43%), Positives = 311/519 (60%), Gaps = 27/519 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +W  HLEPML EGL ++P+  IA  V  MGFNCVRLTWAT+M 
Sbjct  36    RWIVD-EGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+++TV QSF  L LTE+++ +  NNP+L+ L L+DA KAVV  +G +G+M++LD+
Sbjct  95    TNASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSTLGENGVMVILDD  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC ++DGN FFG  YFDPD W+ GL  +A +F   P VV +SLRNELRGP QN
Sbjct  155   HVSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+++GA+A++ ANP ++VI+SG+S+D D  FL  R         KV +E H Y 
Sbjct  215   SADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFLNSR-QVNVSFAGKVAFEVHWYG  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   +  +  +L+  G   P+F+SEFG++  G +  DNR+
Sbjct  274   FSDGQ--AWRAGNANQVCARVAASVSRRALYLLDQG--WPVFLSEFGVDNRGGNVNDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+ +  ADLDLDW++W LQGSYYLREG  G DE YG+    W   RN   L++L  LQ
Sbjct  330   YGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQ  389

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRC-----ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
             +  + P ++    Y +++HP +GRC     + VV   + +  C  A      A  + +  
Sbjct  390   RPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSP  449

Query  1468  IGS-LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKG---------DNGLVL  1617
               S L CL   G   P  L   C D +   WSL S+S   LA             NG +L
Sbjct  450   RDSPLLCLRAEGAGRPARLGLSCGD-ELARWSLTSDSKLHLAVNASSSSSSPETSNGGML  508

Query  1618  CLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             CLD        +++T  C  L   +  +P++QWFKL+ S
Sbjct  509   CLDVGD--DGRSLVTNPCRCLSADNSCDPESQWFKLVTS  545



>ref|XP_003524249.1| PREDICTED: uncharacterized protein LOC100789885 [Glycine max]
Length=571

 Score =   402 bits (1032),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 223/506 (44%), Positives = 326/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D Q G RVKLAC +W  HLE ++ EGL ++P+  I+  + +MGFNCVRLTW T + 
Sbjct  50    RWILD-QDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWPTLLV  108

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV +SF  LGL E+I+G+ +NNP+++ L+L+ A +AVV+ +G + +M++LDN
Sbjct  109   TNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMVILDN  168

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV++P WCC + DGN FFG  +FDP++W+ GL  +A +FK    VVG+SLRNELRG  QN
Sbjct  169   HVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGISLRNELRGSRQN  228

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+ KGA+A + ANP++LVI+SGL++D D  FL++RP      K K+V+E HRY 
Sbjct  229   VNDWYKYMVKGAEAAHAANPDVLVILSGLNFDTDLSFLRDRP-VSLTFKGKLVFEVHRYG  287

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G   AW  G  N+VC  +T  +++  GFLV  G   PLFVSEFG +  G +  DNR+
Sbjct  288   FTDG--GAWADGNPNQVCGKVTANIKKTSGFLVDQG--WPLFVSEFGGDLRGTNVNDNRY  343

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+ +A+LDLDW+ W L GSYY REG  G +E YG+ T +W  +R+ +FL+++  LQ
Sbjct  344   LNCFLALVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWNQVRSTSFLNRISALQ  403

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRC--ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E   ++L++HPL+G C  ++     + ++ CS +S        K + +  +
Sbjct  404   IPFRGPGIIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACS-SSDAWTYTPQKTLLVNNT  462

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+    E  P TLS  C+D  S  W + S+S   L++K  +G  LCLD D +   + I
Sbjct  463   DFCIHAEEERKPATLSMTCSDPNSK-WEMISDSNMHLSSKLSDGSNLCLDVDDN---NII  518

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L +    +P +QWFKLI S
Sbjct  519   VTNACKCLSKDKTCDPGSQWFKLIDS  544



>ref|XP_004239150.1| PREDICTED: uncharacterized protein LOC101248575 [Solanum lycopersicum]
Length=572

 Score =   401 bits (1030),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 216/510 (42%), Positives = 324/510 (64%), Gaps = 22/510 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ + G+RVKL C +W  H++ ML EGL+ +P+  I+  +  MGFNCVRLTW  Y+F
Sbjct  47    RWIVNSK-GQRVKLTCVNWVSHMDVMLAEGLNHQPIDAISKSIINMGFNCVRLTWPLYLF  105

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    ++++V QSF +LGL  +I GL +NNP+++ L+++DA KAVV  + ++ +M++LDN
Sbjct  106   TNDSLSSISVRQSFKNLGLFSSILGLQANNPSIVDLSVLDAYKAVVASLAKNNVMIILDN  165

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC+  DGN FFG  YFDP  W+QGL  VA  FK T  VVG+SLRNELRGPLQN
Sbjct  166   HISKPGWCCSRFDGNGFFGDEYFDPHLWIQGLTKVATTFKATTNVVGMSLRNELRGPLQN  225

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WY+Y++KGA+A++ AN ++L+I+SGLS+D D  FLK+RP        K+V+E HRY+
Sbjct  226   VDDWYRYMQKGAEAVHAANSDVLIILSGLSFDKDLSFLKQRP-VNLTFSGKLVFEIHRYS  284

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G +  W     N+ C ++  +M  +  F++  G   PLFVSEFG++Q G +  DN +
Sbjct  285   FTDGDT--WSADNANQACGEVLNDMVSRGAFVLEQGY--PLFVSEFGVDQRGTNVNDNMY  340

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L   A+LD DW++W L GSYYLR+G  G +E YG+   NW  +RN +FL ++  ++
Sbjct  341   FNCFLGLAAELDFDWALWTLVGSYYLRDGIVGLNEYYGILDWNWFDIRNSSFLQRISVIR  400

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  +E   +++++HP++G C +       + +  CS A      A  K + ++G+
Sbjct  401   TPFQGPGYAETRPHKVIFHPMTGLCVQRTSLLQPLELGPCSEA-EAWSYAPAKALIVLGT  459

Query  1477  LKCLAV---VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP  1647
               CL     +G+  P  L  IC+D  S+ W + S+S   L++K  +   +CLD D +   
Sbjct  460   YFCLQADDKLGQ--PAKLGMICSD-DSSKWDIISDSKMHLSSKLQDATSVCLDVDPN---  513

Query  1648  STILTRKCVGLEEGDMR-NPQTQWFKLIAS  1734
             + I+T+ C  L   D   +P +QWFK+I S
Sbjct  514   NVIVTQTCKCLNTNDTTCDPGSQWFKIIDS  543



>ref|XP_003539156.1| PREDICTED: uncharacterized protein LOC100816102 [Glycine max]
Length=544

 Score =   400 bits (1027),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 210/507 (41%), Positives = 326/507 (64%), Gaps = 17/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG+RVKLAC +W  HL+ ++ EGL ++PL +I+  + TMGFNCVRLTW  ++ 
Sbjct  37    RWIVD-ESGKRVKLACVNWVSHLDAVVAEGLSQQPLDEISKRIKTMGFNCVRLTWPLFLV  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++T+  SF +LGL ++++G+ + NP+++ L L+ A +AVV+ +G + +M++LDN
Sbjct  96    TNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAVVKSLGENDVMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS+P WCC++ DGN FFG  YFDPD W+ GL  +A IFK    VV +SLRNELRGP QN
Sbjct  156   HVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNVVAMSLRNELRGPRQN  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+VWY+Y+ KGA+A++ ANP++LVI+SGL++D +  F++           K+V+E H Y+
Sbjct  216   VNVWYRYMPKGAEAVHAANPDVLVILSGLNFDTNLSFIRNE-AVKLSFNGKLVFEVHWYS  274

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +T  +  + GFL+  G   PLFVSEFG++  G S  DNR+
Sbjct  275   FSDGQ--AWTLGNPNQVCGQVTENVMRRAGFLLDQG--WPLFVSEFGVDLRGTSVNDNRY  330

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++ +A LDLDW++W L G+YY+R+G  G +E +G+  ++W  +RN +FL ++  +Q
Sbjct  331   LNCFMALVAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILNSDWIQVRNTSFLQRISAIQ  390

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA---RVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
                + P +S    Y++++HPL+G C      V   + +  CS  S   +  D K + + G
Sbjct  391   LPFKGPGLSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPCSN-SDAWEYTDQKILSIKG  449

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
             +  CL    E     L   C+ G ++ W + S+S   L+ + +N   +CLD D++   + 
Sbjct  450   TYFCLQAEEEGKQAKLGNACS-GSNSRWEMISDSKMHLSTQTNNASGVCLDVDTN---NI  505

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             I+T  C  L + +  +P TQWFKL+ S
Sbjct  506   IVTNICQCLSKDNTCDPATQWFKLVDS  532



>gb|EPS62091.1| hypothetical protein M569_12701, partial [Genlisea aurea]
Length=514

 Score =   399 bits (1024),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 218/508 (43%), Positives = 316/508 (62%), Gaps = 26/508 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKL C +W  H EPM+ EGL+++PL+ IA  +++ GFNCVR TW T+MF
Sbjct  23    RWIVD-RAGRRVKLTCVNWISHNEPMVAEGLEKKPLAYIAKAIASAGFNCVRFTWPTFMF  81

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y  +TV QS    GLT A +G++ NNP L+ +++V+   AVV+E+GR G+M+VLDN
Sbjct  82    TRPDYGKLTVGQSLDRYGLTAAKAGISKNNPQLMGMSVVEVHGAVVDELGRSGLMVVLDN  141

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS P WCC   DGN FFG   FDPDEW++GL  VA  +K  P VVG+SLRNELRGP QN
Sbjct  142   HVSHPQWCCGSDDGNGFFGDYNFDPDEWIRGLTAVARAYKSRPGVVGMSLRNELRGPKQN  201

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WY+Y+  GA A+++ NP+ LVIISGL++D +  FL+ +PL +  +  K+VYE H YA
Sbjct  202   EADWYRYMAAGAAAVHSENPDFLVIISGLNFDTNLGFLRSKPLPVGNLDNKLVYEGHWYA  261

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F  G+    +    N +CH +T        FL +     P+F+SEFGI+Q G +E DNR+
Sbjct  262   F--GRPLDQLIHQTNSICHSMTSGAYNNFLFLTQ---SFPVFLSEFGIDQTGSNEGDNRY  316

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C+L+  A++D+DW++W  QGSY  RE K   DE+YG+   NW   +NP+FL++LE ++
Sbjct  317   ISCLLAAAAEIDVDWALWTFQGSYIFRENKTNGDESYGVMDFNWDKPKNPSFLNRLEMIR  376

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
             Q +   M+ E  ++ ++HP SG CA      + + DC  A+      DG  I +  S  C
Sbjct  377   Q-MNQGMAGESKFK-IFHPQSGLCAVAGTAGVSLGDCRSATLWDSHQDGGEIRLANSQLC  434

Query  1486  LAVVGED-LPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
             ++    D  P++LS    +    TW+  S+S  QLA     G V CL+  +      +LT
Sbjct  435   ISPGNADGAPVSLSA---NNCGVTWNYGSSSGLQLATAYGGGHV-CLEAGN----GAVLT  486

Query  1663  RKCVGLEEGDMR-------NPQTQWFKL  1725
             +KC+ +++ ++        NP+ QWFKL
Sbjct  487   KKCLCIDDHNLSDFPTCADNPEVQWFKL  514



>ref|XP_010250986.1| PREDICTED: uncharacterized protein LOC104593039 [Nelumbo nucifera]
Length=583

 Score =   400 bits (1029),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 222/532 (42%), Positives = 329/532 (62%), Gaps = 17/532 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+  G+RVKLAC +WA HLE M+ EGL +RPL  I+  + +MGFNCVRLTW  ++ 
Sbjct  31    RWIVDED-GQRVKLACVNWASHLEAMVAEGLSKRPLDVISKRIVSMGFNCVRLTWPLFLA  89

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL+E I G+  NNP+L+ L L+ A +AVV  +G + +M++LDN
Sbjct  90    TNDSLASVTVRQSFRSLGLSETIVGIQVNNPSLVDLPLIQAYQAVVSNLGENNLMVILDN  149

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC+  DGN FFG  YFDP  W++GL  +A +F  TP VVG+SLRNELRG  QN
Sbjct  150   HISKPGWCCSSFDGNGFFGDKYFDPGVWIKGLTSMATMFNATPNVVGMSLRNELRGNKQN  209

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y+++G +A+++ANP++LVI+SGL+YD DF FL ++P        K+V+E H YA
Sbjct  210   VKDWYRYMQQGGEAVHSANPDVLVILSGLNYDKDFSFLAKQP-LNLTFSGKLVFELHWYA  268

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G  KAW  G  N+VC  +   +  K GFL+  G   PLF+SEFG++Q G +  DNR 
Sbjct  269   FSDG--KAWETGNPNQVCATVVNNLMRKGGFLLDRG--WPLFISEFGVDQRGTNVNDNRF  324

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L   A LD DW++W L G YYLR+G  G DETYG+ + +W  +RN  F+ ++  LQ
Sbjct  325   LNCFLGVAAQLDWDWALWTLVGRYYLRQGVVGMDETYGVLSWDWNNIRNSTFVQQISALQ  384

Query  1306  QKLQDP-MSSEPT-YQLLYHPLSGRCA---RVVGDQIHMSDCSGASRCIQEADGKPIHMI  1470
                Q P +SSE T +++++HP +G C     ++ + + +  C+  S        K + + 
Sbjct  385   SPFQGPGLSSEVTPHKVIFHPSTGLCVVRKSLMMELLKLGSCT-ESEAWSYTPEKTLSLK  443

Query  1471  GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
              +  CL          L  IC+D  S+ W + S+S   +++   NG  +C+D DS  + +
Sbjct  444   DTNLCLQADELGEAAKLGIICSD-LSSRWDMISDSKMHISSNLTNGSTVCIDVDS--NTN  500

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIASNTk*ikieiyiyiiyi*TRVVQNN  1806
             TI+T +C  L +    +P  QWF ++ S       +  +  +   + +V++N
Sbjct  501   TIITSQCKCLTKDHTCDPSGQWFIIVNSTRSTTATKFSLTTVNRKSSIVKHN  552



>ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus]
Length=549

 Score =   399 bits (1025),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 221/508 (44%), Positives = 320/508 (63%), Gaps = 19/508 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +GERVKL C +W  HLE ++ EGL ++P+ +I+  +  +GFNCVRLTW  ++ 
Sbjct  26    RWIVDG-AGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWLGFNCVRLTWPLFLA  84

Query  412   TRYA--NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  +  ++TV QSF  LGL EAI+G+ +NNP ++ L L+ A +AVV ++G   +M++LDN
Sbjct  85    TNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVVGKLGEGKLMVILDN  144

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A +F     VV +SLRNELRGP QN
Sbjct  145   HISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVVAMSLRNELRGPKQN  204

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+++GA+A+++ANP++L+I+SGLSYD D  FLK +P        K VYE H YA
Sbjct  205   VNDWYRYMQRGAEAVHSANPDILIILSGLSYDRDLSFLKNQP-INLTFTSKTVYEVHWYA  263

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G S  W  G  N+VC   T  + +  GFL++ G   PLF+SEFGI+Q G +  DNR+
Sbjct  264   FSDGSS--WESGNSNQVCGRTTNNLMKMSGFLLQQG--FPLFISEFGIDQRGTNVNDNRY  319

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A+LDLDW+VW L GSYYLREG  G +E YG+   NW  LRN  FL ++  LQ
Sbjct  320   LSCFLAVAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQ  379

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P ++    Y +++HPLSG C   + + D + +  C            K + + G+
Sbjct  380   SPFQGPGLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQ-KFLTLKGT  438

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
               C+    +G+   L +    N+ +   W + S+S   L++K  NG ++CLD DS  S +
Sbjct  439   YFCIQADEIGKQAKLGIICTVNNAK---WDMISDSKLHLSSKSSNGSLVCLDVDS--STN  493

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              I+T  C  L      +P +QWFKL+ S
Sbjct  494   EIVTNSCKCLSRDSSCDPSSQWFKLVNS  521



>gb|KGN51727.1| hypothetical protein Csa_5G593400 [Cucumis sativus]
Length=550

 Score =   399 bits (1024),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 221/508 (44%), Positives = 320/508 (63%), Gaps = 19/508 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +GERVKL C +W  HLE ++ EGL ++P+ +I+  +  +GFNCVRLTW  ++ 
Sbjct  27    RWIVDG-AGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWLGFNCVRLTWPLFLA  85

Query  412   TRYA--NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  +  ++TV QSF  LGL EAI+G+ +NNP ++ L L+ A +AVV ++G   +M++LDN
Sbjct  86    TNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVVGKLGEGKLMVILDN  145

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A +F     VV +SLRNELRGP QN
Sbjct  146   HISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVVAMSLRNELRGPKQN  205

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+++GA+A+++ANP++L+I+SGLSYD D  FLK +P        K VYE H YA
Sbjct  206   VNDWYRYMQRGAEAVHSANPDILIILSGLSYDRDLSFLKNQP-INLTFTSKTVYEVHWYA  264

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G S  W  G  N+VC   T  + +  GFL++ G   PLF+SEFGI+Q G +  DNR+
Sbjct  265   FSDGSS--WESGNSNQVCGRTTNNLMKMSGFLLQQG--FPLFISEFGIDQRGTNVNDNRY  320

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A+LDLDW+VW L GSYYLREG  G +E YG+   NW  LRN  FL ++  LQ
Sbjct  321   LSCFLAVAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQ  380

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P ++    Y +++HPLSG C   + + D + +  C            K + + G+
Sbjct  381   SPFQGPGLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQ-KFLTLKGT  439

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
               C+    +G+   L +    N+ +   W + S+S   L++K  NG ++CLD DS  S +
Sbjct  440   YFCIQADEIGKQAKLGIICTVNNAK---WDMISDSKLHLSSKSSNGSLVCLDVDS--STN  494

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              I+T  C  L      +P +QWFKL+ S
Sbjct  495   EIVTNSCKCLSRDSSCDPSSQWFKLVNS  522



>ref|XP_008446127.1| PREDICTED: uncharacterized protein LOC103488945 [Cucumis melo]
Length=554

 Score =   398 bits (1022),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 220/508 (43%), Positives = 322/508 (63%), Gaps = 19/508 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + GERVKL C +W  HLE ++ EGL ++P+ +I+  +  +GFNCVRLTW  ++ 
Sbjct  29    RWIVDGE-GERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIEGLGFNCVRLTWPLFLA  87

Query  412   TRYA--NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  +  ++TV QSF  LGLTEAI+G+ +NNP ++ L L+ A +AVV ++G   +M++LDN
Sbjct  88    TNESLNSLTVRQSFQRLGLTEAIAGIQANNPFIIDLPLLKAFEAVVGKLGEGKLMVILDN  147

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A +F     VV +SLRNELRGP QN
Sbjct  148   HISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRMATMFNGVNHVVAMSLRNELRGPKQN  207

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+++GA+A+++ANP++L+I+SGLS+D D  FLK +P        K VYE H YA
Sbjct  208   VNDWYRYMQRGAEAVHSANPDILIILSGLSFDRDLSFLKNQP-INLTFTSKTVYEVHWYA  266

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G S  W  G  N+VC   T  + +  GFL++ G   PLF+SEFGI+Q G +  DNR+
Sbjct  267   FSDGSS--WESGNSNQVCGRTTNNLMKMSGFLLQQG--FPLFISEFGIDQRGTNVNDNRY  322

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A+ DLDW++W L GSYYLREG  G +E YG+   NW  LRN  FL ++  LQ
Sbjct  323   LSCFLAVAAEFDLDWALWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISVLQ  382

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
               LQ P ++    Y L++HPLSG C   + + D + +  C   S        K + + G+
Sbjct  383   TPLQGPGLAERREYNLIFHPLSGLCVVRKSLLDPLRLGPCVD-SDAWYYTPQKFLTLKGT  441

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
               C+    +G+   L +    N+ +   W + S+S   L++K  NG ++CLD D+  + +
Sbjct  442   YFCIQADEIGKQAKLGIICTVNNAK---WDMISDSKLHLSSKSSNGSLVCLDVDA--NTN  496

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              I+T  C  L      +P +QWFKL+ S
Sbjct  497   EIVTNSCKCLSRDSSCDPSSQWFKLVNS  524



>gb|KEH20742.1| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=558

 Score =   398 bits (1022),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 214/505 (42%), Positives = 329/505 (65%), Gaps = 17/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ Q GERVKLAC +W  HL+ ++ EGL ++P+  I+  + +MGFNCVRLTW   + 
Sbjct  35    RWIVN-QDGERVKLACLNWVSHLDAVVAEGLSKKPVDVISNGIKSMGFNCVRLTWPILLL  93

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++TV QSF +LGL ++++   SNNP+++ ++L+ A +AVV+ +G + +M++LDN
Sbjct  94    TNDTLSSLTVRQSFQNLGLLQSVAAFQSNNPSIIDVSLIQAFQAVVKSLGDNDVMVILDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+++P WCC++ DGN FFG  YFDP+ W+QGL  +A +F     VVG+SLRNELRGP QN
Sbjct  154   HITQPGWCCSNSDGNGFFGDQYFDPNLWIQGLTKMATLFNGVSNVVGMSLRNELRGPKQN  213

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+ +GA+A++ ANP++LVI+SGL++D D  ++ +RP      K K+V+E H YA
Sbjct  214   VNDWYRYMVQGAEAVHAANPDVLVILSGLNFDKDLSYIAKRP-VNLTFKGKLVFEAHWYA  272

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW  G  N+VC  +   M+   G+LV  G   PLFVSEFG++  G +  DNR+
Sbjct  273   FTDGQ--AWASGNPNQVCGQVAGNMKRMSGYLVDQG--WPLFVSEFGVDLRGTNVNDNRY  328

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++Y A+LDLDW++W L GSYY R+G  G +E YG+F  +WT +RN +FL ++  LQ
Sbjct  329   LNCFIAYAAELDLDWALWTLVGSYYFRQGVIGMEEFYGIFNWDWTQVRNASFLQRIASLQ  388

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P ++    ++LL+HP +G C   + + + + +  CS  S        K + + G+
Sbjct  389   LPFQGPGITVGNPHKLLFHPSTGLCVIRKSLLEPLKLDPCS-LSDGWNYTPQKILSVKGT  447

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLV-LCLDFDSSYSPST  1653
               C+  V E +P TLS +C++  S  W + S+S   L++K ++G   +CLD + +   + 
Sbjct  448   YFCIQAVKEGMPATLSILCSNPNSK-WDMISDSKLHLSSKINSGSTNVCLDVNDN---NI  503

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLI  1728
             I+T  C  L      +P +QWFKLI
Sbjct  504   IVTNACKCLSNDHSCDPGSQWFKLI  528



>ref|XP_004504142.1| PREDICTED: uncharacterized protein LOC101503968 [Cicer arietinum]
Length=554

 Score =   397 bits (1021),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 214/506 (42%), Positives = 325/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ Q GERVKLAC +W  HL+ ++ EGL ++P+  I+  + +MGFNCVRLTW   + 
Sbjct  36    RWIVN-QDGERVKLACVNWVSHLDAVVAEGLSKKPVDVISHGIKSMGFNCVRLTWPILLL  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++TV QSF +LGL + I+G  SNNP+++ L+L+ A +AVV+ +G + +M++LDN
Sbjct  95    TNQSLSSLTVRQSFQNLGLLDTIAGFQSNNPSIIDLSLIHAFQAVVKSLGDNDVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+++P WCC++ DGN FFG  YFDP+ W+ GL  +A +F   P VV +SLRNELRGP QN
Sbjct  155   HMTQPGWCCSNTDGNGFFGDQYFDPNLWILGLTKMATLFNGVPTVVAMSLRNELRGPKQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+ +GA+A++ +NP++LVI+SGL++D D  F+ +R        +K+V+E H Y 
Sbjct  215   VNDWYRYMVQGAEAVHASNPDILVILSGLNFDKDLSFIAKRA-VNLTFTEKLVFEAHWYG  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW  G  N+VC  ++  M+   G+LV  G   PLFVSEFG +  G +  DNR 
Sbjct  274   FTDGQ--AWESGNPNQVCGQVSGNMKRMSGYLVNQG--WPLFVSEFGSDLRGTNVNDNRF  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++Y ADLDLDW++W L GSYY R+G  G +E YG+   +WT LRN +F+ ++  LQ
Sbjct  330   LNCFIAYAADLDLDWALWTLVGSYYFRQGVIGMEEFYGILNWDWTQLRNISFIQRIASLQ  389

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P  +E + ++L++HPL+G C   + + + + +  CS  S     +  K + + G+
Sbjct  390   LPFQGPGITEGSPHKLIFHPLTGLCVIRKSLVEPLMLGPCS-LSDGWNYSPQKTLSIKGT  448

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+    + +P  LS +C+D  S  W + S+S   L++  +NG  +CLD D +   + I
Sbjct  449   YFCIQAQKQGVPAILSIMCSDPNS-IWDMISDSKLHLSSNINNGTKVCLDVDDN---NVI  504

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L      +P +QWFKLI S
Sbjct  505   VTNACKCLSNDHTCDPASQWFKLIDS  530



>gb|KEH28356.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=523

 Score =   395 bits (1016),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/510 (41%), Positives = 306/510 (60%), Gaps = 25/510 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +GERVKL C +WAGHL+PM+PEGLDR PL ++   +    FNCVRLT+A YM+
Sbjct  32    RWIIDDSTGERVKLVCGNWAGHLQPMIPEGLDRIPLKELVGELVKNRFNCVRLTYAVYMW  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+A+  V  +F  L   E ++G+A  NP++L +  ++A  AVV E+G   + ++LDNHV
Sbjct  92    TRHAHGIVNNTFNYLDAPEVVAGIAKYNPSILKMTHIEAFDAVVNELGARNVKVLLDNHV  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC D D N FF   +FDP EW+ GL + A  F     +V +SLRNELRGP QN+ 
Sbjct  152   SEPKWCCNDDDDNGFFHDQHFDPQEWIHGLTLAAKHFYGHQPIVAMSLRNELRGPRQNLR  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF-  948
              WYKY+   A  I+  NPN+LV+ISGL+YD + +FL+  P     + +K+VYE H Y++ 
Sbjct  212   DWYKYMSHAALVIHKTNPNVLVVISGLNYDTELQFLRNNP-LKIDLGEKMVYEAHLYSWS  270

Query  949   ---TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
                T    + W K PLN++C +    +++  GFL  G N  PL ++EFG +Q G S  DN
Sbjct  271   GIGTLKLKEFWSKQPLNRICAENIEGLDQSAGFLTSGKNAVPLIITEFGFDQTGSSVEDN  330

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L C+ +YL   DLD+            E K   DE++G+    W  LR PNF  K + 
Sbjct  331   RFLTCLQTYLVGRDLDF------------EDKLQLDESFGVVDATWHKLRYPNFADKFQL  378

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARVV-GDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             LQ+K QDP S      ++YHPL+G+C +V   +++ +  C   +R I   +G  I +  S
Sbjct  379   LQRKNQDPTSKVSEAYIMYHPLTGQCGQVNDKNELEIGSCENQTRWI--YNGSQILLNDS  436

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
              KCL  +GE LP+ +S    + ++++W   S S   LA    NG  LCL  D  Y+ S +
Sbjct  437   KKCLTAIGEGLPVAISDDY-ENKNSSWKSESLSRLHLATVDQNGKHLCLHKD--YNSSFV  493

Query  1657  LTRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             +T KC+ + +    + +PQ+QWF+L+A+N 
Sbjct  494   VTSKCICINDDSLCLDDPQSQWFQLVATNV  523



>gb|KHN29014.1| Endoglucanase [Glycine soja]
Length=533

 Score =   395 bits (1015),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 217/506 (43%), Positives = 323/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ Q G+RVKLAC +W  HLE  + EGL ++P+  I+  + +MGFNCVRLTW T + 
Sbjct  12    RWILN-QDGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWPTLLA  70

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A+++V +SF  LGL E+++G+ +NNP+++ L L+ A +AVV+ +G + +M++LDN
Sbjct  71    TNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMVILDN  130

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H++ P WCC   DGN FFG  +F+PD+W+ GL  +A +F     VVG+SLRNELRGP QN
Sbjct  131   HLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGMSLRNELRGPKQN  190

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+ KGA+A++ ANP++LVI+SG+++D    F+++RP      K K+V+E HRY 
Sbjct  191   VNDWYKYMVKGAEAVHAANPDVLVILSGINFDTSLSFIRDRP-VSLTFKGKLVFEVHRYG  249

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G   AW  G LN+VC  +T ++++    LV  G   PLFVSEFG +  G +  DNR+
Sbjct  250   FTDG--GAWADGNLNQVCGKVTADIKQTSTLLVDQG--WPLFVSEFGGDLRGTNVNDNRY  305

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+ +A+LDLDW+ W L GSYY REG  G +E YG+ T +WT +R+ +FL+++  LQ
Sbjct  306   LNCFLALVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWTQVRSTSFLNRISALQ  365

Query  1306  QKLQDPMSSE-PTYQLLYHPLSGRC--ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E   Y+L++HPL+G C  ++     + +  CS +S        K + +  +
Sbjct  366   IPFRGPGIIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCS-SSDAWTYTPQKTLLINNT  424

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+    E  P TLS  C+D  S  W + S+S   L++K  +G  LCLD D +   + I
Sbjct  425   NFCIHAEQEGKPATLSITCSDANSK-WEMISDSNMHLSSKLSDGSNLCLDVDDN---NII  480

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L +    +P +QWFKLI S
Sbjct  481   VTTACKCLNQDKTCDPASQWFKLIDS  506



>ref|XP_008389746.1| PREDICTED: uncharacterized protein LOC103452050 [Malus domestica]
Length=552

 Score =   394 bits (1013),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 215/506 (42%), Positives = 315/506 (62%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG+RVKLAC +W  HL+ ++ EGL ++P+  IA  ++++GFNCVRLTW   + 
Sbjct  34    RWIVD-ESGQRVKLACVNWVSHLDAVVAEGLSKQPVDAIAKRIASLGFNCVRLTWPLLLA  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV QSF  LGL E+ISG+ SNNP L+ L L+ A +AVV  +G + +M++LDN
Sbjct  93    TNETLAAVTVRQSFQSLGLLESISGIQSNNPALVDLPLLKAYQAVVSSLGSNNVMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S P WCC ++D N FFG  YF+PD W+ GL  +A +FK    VVG+SLRNELRGP QN
Sbjct  153   HLSTPGWCCNNNDDNGFFGDKYFNPDLWITGLTRMATLFKGVSNVVGMSLRNELRGPKQN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WYKY+++GA+A+++AN ++LVI+SGLS+D D  FL +RP        K V+E H Y 
Sbjct  213   VDDWYKYMQRGAEAVHSANADVLVILSGLSFDTDLSFLAKRP-VSLTFAGKTVFEVHWYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   ++ K GFL+  G   PLFVSEFG++  G +  DNR+
Sbjct  272   FSDGQ--AWKNGNPNQVCGQVYNNVKRKSGFLLDNG--LPLFVSEFGVDHRGTNVNDNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++  A+ D+D+++W L GSYYLR+G  G +E YG+   +W+ +RN +   +L  LQ
Sbjct  328   LNCFMAAAAEFDVDFALWTLVGSYYLRQGVVGMEEYYGILNWDWSDIRNSSLTQRLSVLQ  387

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
               LQ P ++    +++++HP +G C   VG    + +  CS  S     +  K + + G+
Sbjct  388   SPLQGPGLAQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCS-QSGAWAYSSRKVLTLKGT  446

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+     + P  +   C    S  W + S+S   L +K  +G  +CLD DSS   +T+
Sbjct  447   YFCIQADKLNKPAAVGIJCTTRNSQ-WDIISDSKLHLQSKTMDGTEVCLDVDSS---NTV  502

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L      +P  QWFKL+ S
Sbjct  503   VTNSCNCLSRDSSCDPGNQWFKLVDS  528



>ref|XP_010044528.1| PREDICTED: uncharacterized protein LOC104433472 [Eucalyptus grandis]
 gb|KCW86615.1| hypothetical protein EUGRSUZ_B03243 [Eucalyptus grandis]
Length=560

 Score =   395 bits (1014),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 217/506 (43%), Positives = 308/506 (61%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  SG RVKLACA+W  HLEP++ EGL ++PL  I+  ++++GFNCVRLTW  ++ 
Sbjct  36    RWIVDG-SGRRVKLACANWVSHLEPVVAEGLSKQPLGAISARIASLGFNCVRLTWPLFLA  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL +AISG+ +NNP++L L+L++  +AVV  +G + +M++LDN
Sbjct  95    TNDSLASLTVRQSFQGLGLADAISGIQANNPDILDLSLIETFQAVVSSLGDNDVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H++KP WCC   DGN FFG  YFDPD W+ GL  +A +F+    VVG+SLRNELRG  QN
Sbjct  155   HLTKPGWCCGYSDGNGFFGDQYFDPDLWIHGLTRMATLFRGVGNVVGMSLRNELRGARQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WYKY+++GA+A++ +NP++LVI+SGLSYD D  FL            K+V+E H YA
Sbjct  215   VKDWYKYMQRGAEAVHASNPDVLVILSGLSYDKDLSFLNLDRPLNLSFSGKLVFELHWYA  274

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW  G  N+VC  +   +     FL++     PL VSEFG++Q G +  DNR+
Sbjct  275   FSDGS--AWASGNPNRVCGQVVGNLNRLSFFLLQ---RWPLLVSEFGVDQRGTNANDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     ADLD DW++W L GSYYLREG  G  E YG    NW  LRN +   +   LQ
Sbjct  330   LSCFAGVAADLDFDWALWTLVGSYYLREGVVGMIEYYGALDENWAELRNSSLFQRFRALQ  389

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
               L+ P  SE T +++++HP +G C   + + + + +  C+  S        K + +  +
Sbjct  390   PPLKGPGLSETTPHKVIFHPATGLCVLRKSLLEPMKLGPCT-ESEAWNYTPQKVLSLKAT  448

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+  V    P  L  IC  G ++ W + S S   L++   NG  +CLD DS    +TI
Sbjct  449   YFCIQAVEVGKPAKLGIICT-GSNSKWDIISESKMHLSSNTSNGASVCLDVDSD---NTI  504

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L      +P +QWFKL+ S
Sbjct  505   VTSSCKCLSRDSKCDPSSQWFKLVES  530



>emb|CAD41090.2| OSJNBb0011N17.7 [Oryza sativa Japonica Group]
Length=555

 Score =   394 bits (1012),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 217/519 (42%), Positives = 300/519 (58%), Gaps = 43/519 (8%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +W  HLEPML EGL ++P+  IA  V  MGFNCVRLTWAT+M 
Sbjct  36    RWIVD-EGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVDAMGFNCVRLTWATFMV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+++TV QSF  L LTE+++ +                +AVV  +G +G+M++LDN
Sbjct  95    TNASYSSLTVAQSFQRLNLTESLAAI----------------RAVVSSLGENGVMVILDN  138

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC ++DGN FFG  YFDPD W+ GL  +A +F   P VV +SLRNELRGP QN
Sbjct  139   HVSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQN  198

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+++GA+A++ ANP ++VI+SG+S+D D  FL  R         KV +E H Y 
Sbjct  199   SADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFLNSR-QVNVSFAGKVAFEVHWYG  257

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   +  +  +L+  G   P+F+SEFG++  G +  DNR+
Sbjct  258   FSDGQ--AWRAGNANQVCARVAASVSRRALYLLDQG--WPVFLSEFGVDNRGGNVNDNRY  313

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+ +  ADLDLDW++W LQGSYYLREG  G DE YG+    W   RN   L++L  LQ
Sbjct  314   YGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQ  373

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRC-----ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
             +  + P ++    Y +++HP +GRC     + VV   + +  C  A      A  + +  
Sbjct  374   RPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSP  433

Query  1468  IGS-LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKG---------DNGLVL  1617
               S L CL   G   P  L   C D +   WSL S+S   LA             NG +L
Sbjct  434   RDSPLLCLRAEGAGRPARLGLSCGD-ELARWSLTSDSKLHLAVNASSSSSSPETSNGGML  492

Query  1618  CLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             CLD        +++T  C  L   +  +P++QWFKL+ S
Sbjct  493   CLDVGD--DGRSLVTNPCRCLSADNSCDPESQWFKLVTS  529



>ref|XP_004975985.1| PREDICTED: uncharacterized protein LOC101760765 [Setaria italica]
Length=566

 Score =   394 bits (1013),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 220/512 (43%), Positives = 308/512 (60%), Gaps = 20/512 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D + G RVKLAC +W  HLEPML EGL +RP+  IA  V+ MGFNCVRLTW T++ 
Sbjct  38    RWVVD-EGGSRVKLACVNWPSHLEPMLAEGLSKRPVGAIAAAVAAMGFNCVRLTWPTFLA  96

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y  +TV QSF  L LTE+++G+ +NNP+ + L L+DA KAVV  +G+H +M++LDN
Sbjct  97    TDASYGELTVAQSFQRLNLTESLAGIRANNPDFVDLKLIDALKAVVSSLGKHDVMVILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W+ GL  +A +F     VVG+SLRNELRGP QN
Sbjct  157   HLSKPGWCCSNTDGNGFFGDTYFDPDVWVAGLKKMAAMFAGVDNVVGMSLRNELRGPRQN  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + WYKY++ GA+A++ ANP +LVI+SGLS+D D  F+  RP        K  +E H Y+
Sbjct  217   ANDWYKYMQLGAEAVHGANPRVLVILSGLSFDNDLAFINSRP-VNLSFSGKAAFEVHWYS  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+  Q   W  G  N+ C  IT  +  +  +L+  G   P+ +SEFG++  G +  DNR+
Sbjct  276   FSNSQE--WGSGNANQACARITAGVARRALYLLDKG--WPVILSEFGVDNRGGNTNDNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C  +  ADLD+DW++WALQGSYYLREG    DE YG+    W+  RN + LS+++ LQ
Sbjct  332   YGCAAAAAADLDMDWALWALQGSYYLREGVRDLDEVYGVLDRAWSGPRNASALSRVQALQ  391

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA-RVVGDQIHMSDCSGASRCIQEADGKPIHMI---  1470
             + L+ P +   P Y +L+HP++G C  R     + +  CS        A  + + +    
Sbjct  392   RPLRGPGLDQVPPYTVLFHPVTGTCVLRRRSPPLELGPCSETEAWAYSAQEQRLAVAPRD  451

Query  1471  GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKG----DNGLVLCLDFDSS  1638
             GS  CL   G   P +L   C D  +  W L S+S   +A       D    LCLD  + 
Sbjct  452   GSSLCLRAEGAGKPASLGASCGDAMAR-WRLVSDSKLHVATSSSAAVDGDGALCLDVGA-  509

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
                 +++T  C  L   +  +PQ+QWFKL+ S
Sbjct  510   -DGRSVVTNPCRCLSADNSCDPQSQWFKLVTS  540



>ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max]
Length=574

 Score =   395 bits (1014),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 217/506 (43%), Positives = 323/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ Q G+RVKLAC +W  HLE  + EGL ++P+  I+  + +MGFNCVRLTW T + 
Sbjct  53    RWILN-QGGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWPTLLA  111

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A+++V +SF  LGL E+++G+ +NNP+++ L L+ A +AVV+ +G + +M++LDN
Sbjct  112   TNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMVILDN  171

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H++ P WCC   DGN FFG  +F+PD+W+ GL  +A +F     VVG+SLRNELRGP QN
Sbjct  172   HLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGMSLRNELRGPKQN  231

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+ KGA+A++ ANP++LVI+SG+++D    F+++RP      K K+V+E HRY 
Sbjct  232   VNDWYKYMVKGAEAVHAANPDVLVILSGINFDTSLSFIRDRP-VSLTFKGKLVFEVHRYG  290

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G   AW  G  N+VC  +T ++++   FLV  G   PLFVSEFG +  G +  DNR+
Sbjct  291   FTDG--GAWADGNPNQVCGKVTADIKQTSTFLVDQG--WPLFVSEFGGDLRGTNVNDNRY  346

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+ +A+LDLDW+ W L GSYY REG  G +E YG+ T +WT +R+ +FL+++  LQ
Sbjct  347   LNCFLALVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWTQVRSTSFLNRISALQ  406

Query  1306  QKLQDPMSSE-PTYQLLYHPLSGRC--ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E   Y+L++HPL+G C  ++     + +  CS +S        K + +  +
Sbjct  407   IPFRGPGIIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCS-SSDAWTYTPQKTLLINNT  465

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+    E  P TLS  C+D  S  W + S+S   L++K  +G  LCLD D +   + I
Sbjct  466   NFCIHAEQEGKPATLSITCSDANSK-WEMISDSNMHLSSKLSDGSNLCLDVDDN---NII  521

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L +    +P +QWFKLI S
Sbjct  522   VTTACKCLNQDKTCDPASQWFKLIDS  547



>emb|CAH67677.1| H0510A06.2 [Oryza sativa Indica Group]
 emb|CAH66882.1| OSIGBa0158F13.13 [Oryza sativa Indica Group]
Length=555

 Score =   393 bits (1009),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 216/519 (42%), Positives = 300/519 (58%), Gaps = 43/519 (8%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +W  HLEPML EGL ++P+  IA  V  MGFNCVRLTWAT+M 
Sbjct  36    RWIVD-EGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+++TV QSF  L LTE+++ +                +AVV  +G +G+M++LDN
Sbjct  95    TNASYSSLTVAQSFQRLNLTESLAAI----------------RAVVSSLGENGVMVILDN  138

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC ++DGN FFG  YFDPD W+ GL  +A +F   P VV +SLRNELRGP QN
Sbjct  139   HVSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQN  198

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WYKY+++GA+A++ ANP ++VI+SG+S+D D  FL  R         KV +E H Y 
Sbjct  199   SADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFLNSR-QVNVSFAGKVAFEVHWYG  257

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   +  +  +L+  G   P+F+S+FG++  G +  DNR+
Sbjct  258   FSDGQ--AWRAGNANQVCARVAASVSRRALYLLDQG--WPVFLSDFGVDNRGGNVNDNRY  313

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+ +  ADLDLDW++W LQGSYYLREG  G DE YG+    W   RN   L++L  LQ
Sbjct  314   YGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQ  373

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRC-----ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
             +  + P ++    Y +++HP +GRC     + VV   + +  C  A      A  + +  
Sbjct  374   RPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSP  433

Query  1468  IGS-LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKG---------DNGLVL  1617
               S L CL   G   P  L   C D +   WSL S+S   LA             NG +L
Sbjct  434   RDSPLLCLRAEGAGRPARLGLSCGD-ELARWSLTSDSKLHLAVNASSSSSSPETSNGGML  492

Query  1618  CLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             CLD        +++T  C  L   +  +P++QWFKL+ S
Sbjct  493   CLDVGD--DGRSLVTNPCRCLSADNSCDPESQWFKLVTS  529



>ref|XP_002876948.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53207.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   391 bits (1004),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 212/507 (42%), Positives = 310/507 (61%), Gaps = 19/507 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P++ EGL ++ +  +A  +  MGFNCVRLTW   + 
Sbjct  10    RWIIDEK-GQRVKLACVNWPSHLQPVVAEGLSKQGVDDLAKKIVAMGFNCVRLTWPLDLA  68

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + ISG  + NP+++ L L++A K VV ++G   +M++LD
Sbjct  69    TNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGNKNVMVILD  128

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHV+KP WCC  +DGN FFG  +FDP  W+ GL  +A  FK    VVG+SLRNELRGP Q
Sbjct  129   NHVTKPGWCCGYNDGNGFFGDTFFDPATWISGLIKIATTFKGASNVVGMSLRNELRGPKQ  188

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANPN+LVI+SGLSYD D  F++ RP       +K+V+E HRY
Sbjct  189   NVDDWFKYMQQGAEAVHEANPNVLVILSGLSYDTDLSFVRSRP-VNLTFSRKLVFELHRY  247

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT   +K W     N+ C +I + +E   GF +R     P+F+SEFGI+  G +  DNR
Sbjct  248   SFT--NTKTWSSKNPNEACGEILQSIENGGGFNLRD---FPVFLSEFGIDLRGKNVNDNR  302

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+W LQGSYYLREG  G  E YG+  ++W  +R+ NFL +L  +
Sbjct  303   YIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGILDSDWVRVRSQNFLQRLSLI  362

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQ P S    Y L++HPL+G C   + +   ++ +  C+ +       +   + +  
Sbjct  363   QSPLQGPGSQSKVYNLVFHPLTGLCMLQSILDPTKVTLGLCNESQPWSYTPENTLLTLKD  422

Query  1474  SLKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
                CL   G + P+ LS   C+    + W   S S   LA K  N   LCLD D S   +
Sbjct  423   KSLCLETTGPNAPVKLSEASCSSPNLSKWETISASNMLLAAKSTNN-SLCLDVDES---N  478

Query  1651  TILTRKCVGLEEGDMR-NPQTQWFKLI  1728
              ++   C  ++  D   +P +QWFK++
Sbjct  479   NLIASNCKCVKGEDSSCDPISQWFKIV  505



>ref|XP_010691763.1| PREDICTED: uncharacterized protein LOC104905020 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   392 bits (1006),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 208/503 (41%), Positives = 315/503 (63%), Gaps = 16/503 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG+RVKLAC +W  H+E M+ EGL+ +P+  I+  +  MGFNCVRLT+  Y+ 
Sbjct  30    RWIVD-ESGQRVKLACVNWPSHVELMVTEGLNEQPVDAISKKIRDMGFNCVRLTYPIYLA  88

Query  412   TR--YANMTVVQSFGDLGL-TEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T    A+++V Q+F ++GL    I+   + NP+++ L  +DA +AVV  +G++ +M++LD
Sbjct  89    TNDTLASISVRQTFLNVGLPNRTIAKFQAYNPSIIDLPRIDAFQAVVTSLGKNKVMVILD  148

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHVSKP WCC   DGN FFG  YF+P+ W++GL  +A  F+D P VVG+SLRNELRGP Q
Sbjct  149   NHVSKPQWCCKQTDGNGFFGDKYFNPELWIKGLTNMATRFRDNPYVVGMSLRNELRGPNQ  208

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             N + WYKY+++GA+A++ ANPN+L I+SGLSYD D  F+  RP        K+V+E H+Y
Sbjct  209   NANDWYKYMQRGAEAVHKANPNVLTILSGLSYDSDLSFVANRP-VSLSYTNKLVFEVHQY  267

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AF+ G  + W    +++VC ++T+ + +  GFLV  G   PLFVSE+G++     + D R
Sbjct  268   AFSNG--RVWEGINVDEVCGNMTKNLTDGAGFLVDQG--FPLFVSEWGVDLSYFGKRDKR  323

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
                C L+++ + DLDW++WAL GSYYLREG+    E +G+    WT +RN  FL ++  +
Sbjct  324   FTNCFLAWMVEHDLDWALWALTGSYYLREGQVNAKEQFGILDPKWTHIRNERFLQRISVI  383

Query  1303  QQKLQDPMSS-EPTYQLLYHPLSGRCA-RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             Q   Q P +S    +++++HPL+G C     G ++ + +CS ++      +   + + GS
Sbjct  384   QYPRQGPEASFRNKHKMIFHPLTGLCILSKPGMEVQLGNCSKSNHWNHTPENT-LEIKGS  442

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL   G +LP  LST C  G+  +W+  S+S   LA    N    CLD DS    + +
Sbjct  443   YLCLKAQGLNLPAKLSTSCR-GEGTSWAPISDSKLHLATTLSNNSTACLDVDSQ---NNL  498

Query  1657  LTRKCVGLEEGDMRNPQTQWFKL  1725
             +T  C  L E +  +P +QWFK+
Sbjct  499   ITTSCKCLSEKNKCDPGSQWFKI  521



>ref|XP_004504189.1| PREDICTED: uncharacterized protein LOC101490831 [Cicer arietinum]
Length=527

 Score =   390 bits (1002),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 213/506 (42%), Positives = 317/506 (63%), Gaps = 20/506 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ Q+G RVKLAC +W  HL+ ++ EGL ++P+  I+  + +MGFNCVRLTW  ++ 
Sbjct  34    RWIVN-QNGVRVKLACVNWVSHLDAVVAEGLSKKPVDAISNIIKSMGFNCVRLTWPIHLL  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++TV QSF + GL + I+G  SNNP+++ L+L+ A +AVV+ +G + +M++LDN
Sbjct  93    TNQSLSSLTVRQSFQNHGLLDTIAGFQSNNPSIIDLSLIQAFQAVVKSLGDNNVMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV++P WCC + DGN FFG  YFDP  W+ GL  +A +F   P VV +SLRNELRGP Q+
Sbjct  153   HVTQPGWCCTNTDGNGFFGDQYFDPSLWITGLTKMATLFNGVPTVVAMSLRNELRGPKQD  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+ +GA+A++ ANPN+LVI+SGL++D D  F++ R        +K+VYE H Y 
Sbjct  213   VNNWYRYMVQGAEAVHAANPNVLVILSGLNFDTDLSFIRNR-AVSLTFNEKLVYEAHHYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G  + W+    N+VC  +TR M++  G+LV  G   PL +SEFG +  G +  DNR 
Sbjct  272   FTDG--RDWVSKNPNEVCGKVTRYMKKLSGYLVDQG--WPLIMSEFGGDLRGTNVNDNRF  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++Y AD DLDW++W L GSYY+ +G  G +E YG+  ++WT  RNP FL +L  LQ
Sbjct  328   LNCFIAYAADQDLDWALWTLAGSYYINQGVFGVEEVYGILNSDWTKPRNPTFLQRLASLQ  387

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRC-ARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P ++    Y+L+YHPL+G C AR    Q + ++ CS  S        K + +  S
Sbjct  388   LPFRGPGITQGKPYKLIYHPLTGLCVARKSKLQPLKLNACS-YSNGWNYKPQKTLSIYRS  446

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+  + +  P  +S  C     +TW + S+S   L+   +NG  +CLD D +   + I
Sbjct  447   HYCIQAMNQGKPAIISKSC-----STWDMISDSTLHLSTNINNGTNVCLDVDHN---NVI  498

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L      +P +QWFKLI S
Sbjct  499   VTNACKCLSNDSTCDPASQWFKLIDS  524



>ref|XP_011086688.1| PREDICTED: uncharacterized protein LOC105168334 [Sesamum indicum]
Length=574

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 228/510 (45%), Positives = 325/510 (64%), Gaps = 23/510 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL+C +W  HLE ++ EGL ++P+ +I+  + ++GFNCVRLTW  ++F
Sbjct  49    RWIVD-ETGQRVKLSCVNWPSHLEVVVAEGLSKQPVDKISEEIRSLGFNCVRLTWPLFLF  107

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV QS  +LGL EA++G  +NNP+++ L+L+DA +AVV  +G+  +M+VLDN
Sbjct  108   TNDTLAALTVRQSLTNLGLFEAVAGFQTNNPDIIDLSLMDAYQAVVGSLGKKNVMVVLDN  167

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H SKP WCC D DGN FFG  YF+PD W++GL  VA  FKDT  VVG+SLRNELRG  QN
Sbjct  168   HTSKPGWCCGDGDGNGFFGDEYFNPDLWVKGLTRVATTFKDTKHVVGMSLRNELRGRRQN  227

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y++KGA+A+++ANPN+L+I+SGL YD D  FL  +P       KK+VYE H Y 
Sbjct  228   VYDWYRYMQKGAEAVHSANPNVLIILSGLKYDRDLSFLLNKP-VTLTFSKKLVYELHWYG  286

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+ GQ  AW  G  N+VC  +  E   K GFL+  G   PLFVSEFG++  G +  DNR+
Sbjct  287   FSNGQ--AWATGNPNQVCGQLVAETATKAGFLLDQGY--PLFVSEFGVDMRGANVNDNRY  342

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C + + A+LD+DW++WAL GSYY+REG  G DETYG++  NW  +RN   L K+  LQ
Sbjct  343   LNCFMGWAAELDVDWALWALTGSYYIREGVVGHDETYGVYNWNWCDVRNQTTLHKISALQ  402

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMI--  1470
                + P  SE   +++L+HP++G C + +   + + +  CS A    +     P H +  
Sbjct  403   YPFRGPGYSERRPHKILFHPMTGLCVKRMSFVEPLVLGPCSEA----EAWSYTPQHTLTI  458

Query  1471  -GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP  1647
              G+  CL       P  L  IC D  S  W   S+S   L++K ++G  +CLD DS    
Sbjct  459   KGTYFCLQADALGHPAKLGIICTDSTSK-WEAVSDSKMHLSSKLEDGTNVCLDVDSD---  514

Query  1648  STILTRKCVGLEEGDMR-NPQTQWFKLIAS  1734
             + ++   C  L+  + + +P +QWFKLI S
Sbjct  515   NNVVMNNCKCLDNKNNKCDPASQWFKLIDS  544



>ref|XP_007159685.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
 gb|ESW31679.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
Length=565

 Score =   390 bits (1003),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 213/506 (42%), Positives = 319/506 (63%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+  Q G RVKLAC +W  HLE ++ EGL ++P+  I+  + +MGFNCVRLTW   + 
Sbjct  43    RWIVG-QDGRRVKLACVNWVSHLEVVVAEGLSKKPVDAISKGIKSMGFNCVRLTWPILLV  101

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV  SF +LGL E+++G+ +NNP+++ L L+ A + VV+ +G + +M++LDN
Sbjct  102   TNDSLASLTVRSSFQNLGLLESVAGVQTNNPSIIDLPLIQAFQVVVKSLGDNDVMVILDN  161

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+++P WCC++ DGN FFG  YFDP+ W+ GL  +A +F     VVG+SLRNELRG  QN
Sbjct  162   HITQPGWCCSNSDGNGFFGDKYFDPNLWMLGLTKMATLFNGVTNVVGMSLRNELRGAKQN  221

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WYKY+ KGA+ I+ ANP++LVI+SGL++D D  F+K++P      K+K+V+E H Y 
Sbjct  222   VDDWYKYMVKGAETIHAANPDVLVILSGLNFDKDLSFIKKQP-VNLTFKEKLVFEAHWYG  280

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G   AW+ G  N+VC  +   +    GFLV  G   PLF+SEFG++  G +  DNR+
Sbjct  281   FTDG--AAWVNGNPNQVCGQVAGNVMRTSGFLVNQG--WPLFISEFGVDLRGTNVNDNRY  336

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A+ DLDW++W L GSYY R+G  G +E YG+   +W  +RN +FL+++  LQ
Sbjct  337   LSCFLSVAAEHDLDWALWTLVGSYYFRQGVVGMEEFYGILNWDWNQVRNASFLNRISSLQ  396

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P ++    Y+L+YHPL+G C   + + + + +  C+  S   +    K + + G+
Sbjct  397   LPFRGPGITKGNPYKLIYHPLTGLCVIRKTLLEPLTLGPCN-LSDGWKYTPQKILSVKGT  455

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+    E +  TL  IC+D  S  W + S+S   L++K  +G  +CLD D +   + I
Sbjct  456   YFCIHAENEGMAATLGIICSDSNSR-WEMVSDSKLHLSSKLSDGSDVCLDVDDN---NII  511

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L      +P +QWFKLI S
Sbjct  512   VTNACKCLSRDHTCDPSSQWFKLIDS  537



>gb|KDP25367.1| hypothetical protein JCGZ_20523 [Jatropha curcas]
Length=483

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 201/485 (41%), Positives = 287/485 (59%), Gaps = 10/485 (2%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRYANMTVVQSFGDLGLTEAISGLA  486
             M+ EG+D++PL  I + +    FNCVR TWAT+MFTRY+  TV+ S     LT++I+G+A
Sbjct  1     MVTEGIDKQPLRYIVSELVKEKFNCVRFTWATHMFTRYSKRTVLNSLKSFNLTKSIAGIA  60

Query  487   snnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDE  666
              NN  LL L LVDA +AVV+E G+ G+M+V DN VS+P WCC   DGN FFG   FD +E
Sbjct  61    KNNNFLLRLTLVDAFEAVVDEFGKQGVMVVFDNQVSRPTWCCGYDDGNGFFGDKDFDVEE  120

Query  667   WLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIIS  846
             WL+GL ++A  F+    V+G+S RNE+RGP  N + WYKY+E+G + I+ ANP++L+  S
Sbjct  121   WLRGLTMIAKRFRGRHNVIGISTRNEIRGPRSNEEDWYKYMEQGIETIHKANPHVLIFAS  180

Query  847   GLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEE  1026
             GL Y  D  FLK++P        K+VYE H Y F+ G    W    +N VC++ T+ +  
Sbjct  181   GLGYASDLTFLKKKP-LETSFNNKLVYEAHWYPFSWGHGGYWSMEDVNGVCYNETQRVFN  239

Query  1027  KEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLR  1206
             + GF++    P P+F+ EFG+ Q   S  D R L C L+Y A+ DL+W +WA QGSY+ R
Sbjct  240   QTGFVMNAEKPFPMFMGEFGLVQRAFSRGDERFLACFLAYAAEFDLEWGLWAWQGSYHYR  299

Query  1207  EGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRCARV  1386
             E + G +ETYG+   NW  +RNP +  ++E ++ KLQDP       ++++HP SG C   
Sbjct  300   ENQIGMEETYGVMDYNWDRVRNPEYQRRMELIKLKLQDPSLKSQVSRIMFHPQSGTCISA  359

Query  1387  VGDQ-IHMSDCSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSL  1563
              G + I   DC   S  +   DG PI + G   C+ VV       LS  C+  QS +W  
Sbjct  360   DGTEGISAGDCKAPSHWVHTRDGDPIRLKGKRLCIKVVSNGWEPMLSEDCSSEQS-SWKK  418

Query  1564  ASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKC-VGLEEGD-----MRNPQTQWFKL  1725
              S + F  A+  D G  +CL  +S Y+   I+TR C + LE+ +     +  P  QWFK 
Sbjct  419   LSKTKFHFASVDDKGQQVCLQKESPYT-RKIITRNCTLMLEDAEYLKSPLNEPVAQWFKF  477

Query  1726  IASNT  1740
             + +N 
Sbjct  478   VETNV  482



>ref|XP_008445780.1| PREDICTED: uncharacterized protein LOC103488703 [Cucumis melo]
Length=448

 Score =   385 bits (989),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/449 (44%), Positives = 285/449 (63%), Gaps = 6/449 (1%)
 Frame = +1

Query  406   MFTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             MFTRYAN TV ++F  L L +A +GL   NP +L+  + +A +AVV+ +G  G+M++ DN
Sbjct  1     MFTRYANRTVEENFDLLDLGQAKAGLTQYNPFVLNKTIAEAYEAVVDVLGASGLMVIADN  60

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S+P WCC+  DGN FFG+ YFDP EWLQGL++VA  F +   VVG+SLRNE+RG ++N
Sbjct  61    HMSQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGMSLRNEIRGMMEN  120

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + W  YV +G   I+N NP +LVI+ GL+YD D R LKE+PL +  +  K+V+E H Y+
Sbjct  121   ANDWNHYVTQGVTTIHNINPEVLVIVGGLNYDNDLRCLKEKPLNVSTLDNKLVFEVHLYS  180

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+      +++ PLN +C  I  E  +   F++ G NP PLFVSE+G +Q    +A+NR 
Sbjct  181   FSGASESKFVQQPLNNICAKIINEFIDHAEFVIEGSNPFPLFVSEYGYDQREVDDAENRF  240

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C  ++LA  DLDW++W  QGSYY REG+    ET+G+  +NWT ++NPNF+ K + LQ
Sbjct  241   MSCFTAHLAQKDLDWALWTWQGSYYYREGQAELPETFGVLESNWTQIKNPNFVQKFQLLQ  300

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGDQ--IHMSDCSGASRCIQEADGKPIHMIGSL  1479
               LQDP S+     ++YHP SG+C  V  D   I +++CS +SR   + D  PI M  + 
Sbjct  301   TMLQDPNSNASFSYVIYHPQSGQCIEVSNDNKDIFLTNCSTSSRWSHDNDSTPIKMSNTG  360

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   GE L  +LS  C  G+ + WS  SNS   LA   +NG  LCL  +SS S S I+
Sbjct  361   LCLKASGEGLAASLSNDC-LGKQSVWSAISNSKLHLATVTENGKSLCLQIESSNS-SKIV  418

Query  1660  TRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             T  C+   +    +++ Q+QWF+L+ +NT
Sbjct  419   TNSCICTTDDPTCLQDTQSQWFELVETNT  447



>ref|XP_010249431.1| PREDICTED: uncharacterized protein LOC104591975 [Nelumbo nucifera]
Length=541

 Score =   388 bits (997),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 213/508 (42%), Positives = 313/508 (62%), Gaps = 17/508 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG+RVKLACA+W  HL+P+L EGL+R+PL  I+  + +MGFNC+RLTW  ++ 
Sbjct  39    RWIVD-ESGKRVKLACANWVSHLQPVLAEGLNRQPLDVISKWIVSMGFNCIRLTWPLWVA  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL E+I  +  NNP++L+L ++ A +AVV  +G++G+M+++DN
Sbjct  98    TNDTLASLTVQQSFESLGLLESIGAIRVNNPSMLNLTIIQAFQAVVSNLGKNGVMVIIDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S+P WCCA+ DGN FFG +YFDPD W++GL  +A +F  T  V+G+SLRNELRGP QN
Sbjct  158   HISQPGWCCANRDGNGFFGDIYFDPDLWIKGLTRMATLFNGTSNVIGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V VWYKY+++GA+A++ ANP++L I+SGL YD D  FL+ +P       +K+V+E H Y+
Sbjct  218   VSVWYKYMQQGAEAVHRANPDVLTILSGLDYDKDLHFLRNQP-LNLSFTRKLVFELHWYS  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW  G  N+VC  +   +++K  F++  G   PLFVSEFGI+  G S ADNR+
Sbjct  277   FSDGD--AWSTGNPNQVCGRVVNALKDKILFVLDQGY--PLFVSEFGIDLRGGSLADNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+    A+LD DW++WA  GSYYLREG  G DE Y +    W+  RN  FL +L  LQ
Sbjct  333   SNCIFGVAAELDFDWALWAFMGSYYLREGVMGLDEVYAVMNWGWSGPRNSTFLRRLSALQ  392

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGDQ----IHMSDCSGASRCIQEADGKPIHMI  1470
                +   +     YQ+LYHPL+G C +    +    + +  C+ +++ +   +       
Sbjct  393   SPFRGAGLDEVAPYQILYHPLTGLCVQRGSFKKPLDLKLGSCAESAQWMYTPEMTLAVNG  452

Query  1471  GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
              ++ CL   G      L   C+   +  W   S+S   L+         CLD DS    +
Sbjct  453   TTVLCLQADGLGRRAKLRGDCSS-PATKWKPISDSRMHLSTTLPTNSTACLDIDSK---N  508

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              I+  +C  L      +P +QWFK+I S
Sbjct  509   NIIASRCQCLWGDASCDPASQWFKIIYS  536



>ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera]
Length=552

 Score =   388 bits (997),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 214/504 (42%), Positives = 310/504 (62%), Gaps = 16/504 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +W  HLE ++ EGL ++P++ I+  + +MGFNCVRLTW  ++ 
Sbjct  34    RWIVD-EDGARVKLACVNWPSHLEAVVAEGLSKQPVAMISKKIGSMGFNCVRLTWPLFLA  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL E+I+G  +NNP+++ L L+ A +AVV  +  + +M++LDN
Sbjct  93    TNQSLASLTVRQSFQRLGLLESIAGFQANNPSMVDLPLISAYQAVVSGLADNNVMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC+  DGN FFG  YF+PD W+QGL  +A +F+    VVG+SLRNELRGP QN
Sbjct  153   HLSKPGWCCSSFDGNGFFGDQYFNPDLWVQGLTRMATMFRGVTNVVGMSLRNELRGPKQN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y++KGA+A+++ANP++LVI+SGLSYD D  F+ ++         K+V+E H Y 
Sbjct  213   VKDWYRYMQKGAEAVHSANPDVLVIVSGLSYDTDLSFVLKQ-ELELTFTGKLVFEMHWYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G   AW  G  N+VC  +   +  + G L+  G   PLFVSEFG++Q G +  DNR+
Sbjct  272   FTDG--SAWETGSPNQVCGRVVESVMRRGGVLLEKG--WPLFVSEFGVDQRGTNVNDNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     A+LD DW++W L GSYY REG  G +E YG+   NW  +RN +FL ++  LQ
Sbjct  328   LNCFFGLAAELDFDWALWTLVGSYYTREGVIGLEEFYGLLNWNWCEVRNSSFLQRISALQ  387

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P +S    +++++HP +G C   + V + + +  C   S        K + M  +
Sbjct  388   SPFQGPDLSDARPHKVIFHPATGLCIVWKSVFEPLTLGPCP-ESDAWSYTPQKTLIMKET  446

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL   G   P  L  IC +  S  W   S+S   L+ K  +G  +CLD DSS   + I
Sbjct  447   YFCLQADGPGNPGKLGIICTEPGSK-WESISDSKMHLSTKLGDGTTVCLDIDSS---NNI  502

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLI  1728
             +T  C  L   +  +P +QWFK++
Sbjct  503   VTNACKCLSGDNKCDPGSQWFKIV  526



>gb|KHN06534.1| Endoglucanase [Glycine soja]
Length=566

 Score =   389 bits (998),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 219/506 (43%), Positives = 324/506 (64%), Gaps = 19/506 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D Q G RVKLAC +W  HLE ++ EGL ++P+  I+  + +MGFNCVRLTW T + 
Sbjct  48    RWILD-QDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWPTLLV  106

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV +SF  LGL E+I+G+ +NNP+++ L+L+ A +AVV+ +G + +M++LDN
Sbjct  107   TNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMVILDN  166

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV++P WCC + DGN FFG  +FDP++W+ GL  +A +FK    VVG+SLRNELRG  QN
Sbjct  167   HVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGISLRNELRGSRQN  226

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+ KGA+A + ANP++LVI+SGL++D D  FL++RP      K K+V+E HRY 
Sbjct  227   VNDWYKYMVKGAEAAHAANPDVLVILSGLNFDTDLSFLRDRP-VSLTFKGKLVFEVHRYG  285

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G   AW  G  N+VC  +T  +++    LV  G   PLFVSEFG +  G +  DNR+
Sbjct  286   FTDG--GAWADGNPNQVCGKVTANIKKT---LVDQG--WPLFVSEFGGDLRGTNVNDNRY  338

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+ +A+LDLDW+ W L GS+Y REG  G +E YG+ + +W  +R+ +FL+++  LQ
Sbjct  339   LNCFLALVAELDLDWAYWTLVGSHYFREGVIGMEEFYGLLSWDWNQVRSTSFLNRISALQ  398

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRC--ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E   ++L++HPL+G C  ++     + ++ CS +S        K + +  +
Sbjct  399   IPFRGPGIIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACS-SSDAWTYTPQKTLLVNNT  457

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+    E  P TLS  C+D  S  W + S+S   L++K  +G  LCLD D +   + I
Sbjct  458   DFCIHAEEERKPATLSMTCSDPNSK-WEMISDSNMHLSSKLSDGSNLCLDVDDN---NII  513

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L +    +P +QWFKLI S
Sbjct  514   VTNACKCLSKDKTCDPGSQWFKLIDS  539



>gb|EYU30606.1| hypothetical protein MIMGU_mgv1a018920mg, partial [Erythranthe 
guttata]
Length=504

 Score =   385 bits (990),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 212/503 (42%), Positives = 299/503 (59%), Gaps = 41/503 (8%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+ SG RVKL C +W  HL+ ++ EGL ++P+ +I+  +  MGFNCVRLTW  ++F
Sbjct  9     RWIVDESSGRRVKLVCVNWPSHLDAVVAEGLSKQPVDEISQEIINMGFNCVRLTWPLFLF  68

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF +LGL+E+++G  +NNP+++ L+L+DA + VV  +GR  +M++LDN
Sbjct  69    TNDTLASLTVRQSFTNLGLSESVAGFQTNNPSIIDLSLIDAYQEVVASLGRKKVMIILDN  128

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H SKP WCC++ DGN FFG  YF+P  WL+GL  VA  F +T  VV +SLRNELRG  QN
Sbjct  129   HTSKPGWCCSNSDGNGFFGDEYFNPQLWLKGLTRVATTFNNTKNVVAMSLRNELRGRRQN  188

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A++ ANPNLLVI+SGL +D D  FL +RP+ L    K V +E H Y 
Sbjct  189   VNDWYRYMQKGAEAVHAANPNLLVILSGLKFDRDLSFLLKRPVSLSFSNKLV-FELHWYG  247

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW  G  N+VC  +  E  +K GFL+  G P  L +SEFG++  G +  DNR 
Sbjct  248   FSDGL--AWQSGNPNQVCGRLVGETTKKAGFLLDQGYP--LLLSEFGVDMRGSNVNDNRF  303

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C + + A+ D+DW++WAL GSYY+REG  G DETYG++  NW  +RN   L K+  LQ
Sbjct  304   LNCFMGWAAEQDVDWALWALTGSYYIREGVVGLDETYGVYNWNWGEIRNQTTLQKISALQ  363

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
                + P                              CS A         K + ++G+  C
Sbjct  364   YPFRGP------------------------------CSEAEAWSYSTPQKTLTIVGTYFC  393

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L       P  L   C+D  +  W   S S   L++K  +G  +CLD DS    + I+T 
Sbjct  394   LEADELGQPAKLGIFCSDATTK-WEAISESKNHLSSKLGDGTKVCLDIDSD---NNIVTN  449

Query  1666  KCVGLEEGDMRNPQTQWFKLIAS  1734
              C  L      +P +QWFK+I S
Sbjct  450   NCKCLNRNSKCDPGSQWFKIIDS  472



>gb|KGN50047.1| hypothetical protein Csa_5G151630 [Cucumis sativus]
Length=527

 Score =   386 bits (991),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/506 (40%), Positives = 310/506 (61%), Gaps = 11/506 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL+C +   H + M+ +GLD+RPL  +A  + +  +NCVRLTW+ YMF
Sbjct  29    RWIVDSKTGQRVKLSCVNLVSHAQSMVAQGLDKRPLKDLANEIVSRDYNCVRLTWSVYMF  88

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY   T+      L + +  +G+  +NP  L++ +  A K VV+ +G  G+M++LDNH+
Sbjct  89    TRYPFETIGDVLDGLDINKVKNGVKKHNPQFLNMTVTSAFKTVVDGLGNAGLMVILDNHI  148

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC+ HDGN FFG   F P EWL+GLA VA  F   P VVG+SLRNELRG   NV 
Sbjct  149   SQPRWCCSLHDGNGFFGDRNFKPIEWLRGLAYVARHFSWHPKVVGMSLRNELRGS-NNVG  207

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             VW KYV+ G+  I+  NP LLV+ISGL+YD D  +LK++P     +  KVV E H Y+F+
Sbjct  208   VWRKYVKLGSHLIHRINPRLLVVISGLNYDNDLSYLKKKP-LGYNLNNKVVLEAHLYSFS  266

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   ++K PLN  C+ +  + E + GF+V   +P PLF+SEFG +  G ++A NR + 
Sbjct  267   GEPESKFVKKPLNIACNQVMDKFEREAGFVVDMKDPYPLFLSEFGYDLRGGNKAQNRFMS  326

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C L+ +   D+DW+ WA QGSY  R+G+   DE++G+  ++WT  R+P     L+  ++ 
Sbjct  327   CFLARIIGKDIDWAYWAFQGSYMYRQGQQDVDESFGIMDSSWTKDRSPRLQQMLQLAKRI  386

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
              QDP S  P   ++ HP+SG+C ++ G   I + DC   +      DG P+ +    +CL
Sbjct  387   NQDPNSKGPMSYIMLHPVSGQCVKLDGKGGIELGDCETPTLWDHTGDGSPMKLWNG-QCL  445

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
                G+  P  +S  C+ G  ++W++AS +  QL+ K   G  +CL+ +S    ++I+ +K
Sbjct  446   KSAGDGKPPVVSAECS-GDGSSWTVASKAKLQLSTK-SGGENICLEKESD---TSIVVKK  500

Query  1669  CVGLEE--GDMRNPQTQWFKLIASNT  1740
             C+ L++      +PQ+QWFKL+ +N 
Sbjct  501   CICLKDEWNCFDDPQSQWFKLVPTNV  526



>ref|XP_010026595.1| PREDICTED: uncharacterized protein LOC104416964 [Eucalyptus grandis]
Length=535

 Score =   386 bits (991),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/503 (42%), Positives = 309/503 (61%), Gaps = 13/503 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +WA HLEPM+ EGLD++P+  I+  +++MGFNCVRLTW  +M 
Sbjct  36    RWIVD-KHGHRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIASMGFNCVRLTWPLFMV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     +M+V QSF DLGL + I G+  NNP+LL ++++ A +AVV  +G + +M++LDN
Sbjct  95    TNDSLGSMSVAQSFRDLGLVDYIGGIRQNNPSLLDVSVLAAFRAVVTSLGDNSVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDP+ W++GL  +A + +    VVG+SLRNELRGP +N
Sbjct  155   HISKPGWCCSNRDGNGFFGDQYFDPNLWIKGLTRMATMIRRIGNVVGMSLRNELRGPKEN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             +  W +Y+E+GA+ +++ANP++LVI SGL YD D  FL   P       +K+V+E H YA
Sbjct  215   LRDWLRYMERGAEVVHSANPHVLVIASGLYYDTDLWFLGHIP-MKVSFARKLVFELHWYA  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
              + G    W  G  N+ C D T ++  K GF++  G   PLFVSEFG    G +  D+R+
Sbjct  274   SSSG--TVWEDGNTNERCKDATDKVMSKAGFILNQGM--PLFVSEFGGELSGQNVNDDRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C     A LD DW++W + GSYYLR+G  G +ET+G+   +++  RN +FL ++  LQ
Sbjct  330   FNCFFGVAAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLNKDFSGPRNASFLQRISALQ  389

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
                Q   SS PT ++L+HPL+G C   +   +Q+ +  C+  S          I M G+ 
Sbjct  390   APFQGATSSSPTRRILFHPLTGLCIQRKREQEQLQLGACN-ESEAWTHTRHHTIRMRGTD  448

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              C+     + P+ LST C D  S   +++ + M   +N   + + +CLD D  +S  T++
Sbjct  449   LCMQADRLEKPVKLSTDCADHGSRWKTISESKMHFSSNIVGSNVTVCLDID--FSTKTVI  506

Query  1660  TRKCVGLEEGDMRNPQTQWFKLI  1728
                C  L E    NP +QWF+L+
Sbjct  507   ASPCKCLREDATCNPASQWFELV  529



>ref|XP_010425288.1| PREDICTED: uncharacterized protein LOC104710406 [Camelina sativa]
Length=555

 Score =   385 bits (990),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 214/507 (42%), Positives = 310/507 (61%), Gaps = 20/507 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G+RVKLAC +W  HL+P++ EGL ++ +  +A  +  MGFNCVRLTW   + 
Sbjct  57    RWIIDVK-GQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVRLTWPLDLA  115

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGLT+ ISG  + NP+++ L L++A K VV ++G   +M++LD
Sbjct  116   TNDTLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGDRNVMVILD  175

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHV+KP WCC   DGN FFG  +FDP  W+ GL  +A  FK T  VVG+SLRNELRGP Q
Sbjct  176   NHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLRNELRGPKQ  235

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANP +LVI+SGLSYD D  F++ RP        K+V+E HRY
Sbjct  236   NVDAWFKYMQQGAEAVHEANPEVLVILSGLSYDTDLSFVRSRP-VNLTFTGKLVFELHRY  294

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT   +  W     N+ C +I + +E+  GF +R     P+F+SEFGI+  G +  DNR
Sbjct  295   SFT--NTNTWSSKNPNEACGEILKSIEDGGGFNLRD---FPVFLSEFGIDLRGTNVNDNR  349

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+W LQGSYYLREG  G  E YG+  ++W  +R+ +FL +L  +
Sbjct  350   YIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRSFLQRLSLI  409

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQ P S    Y L++HPL+G C   + +   ++ +  C+ +       D        
Sbjct  410   QSPLQGPGSQPKVYNLVFHPLTGLCMLQSILDPTKVTLGLCNESQPWSYTPDNTLKLKEK  469

Query  1474  SLKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
             SL CL   G ++P+ LS + C+    + W   S S   LA K  N   LCLD D S   +
Sbjct  470   SL-CLESTGSNVPVKLSKMSCSSPNLSKWQSISASNMLLAAKSSNN-SLCLDVDES---N  524

Query  1651  TILTRKCVGLEEGDMR-NPQTQWFKLI  1728
              ++   C  ++  D   +P +QWFK++
Sbjct  525   NLMASDCKCVKGEDTSCDPTSQWFKIV  551



>gb|KCW59699.1| hypothetical protein EUGRSUZ_H02457, partial [Eucalyptus grandis]
Length=528

 Score =   384 bits (987),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 209/502 (42%), Positives = 308/502 (61%), Gaps = 13/502 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +WA HLEPM+ EGLD++P+  I+  +++MGFNCVRLTW  +M 
Sbjct  36    RWIVD-KHGHRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIASMGFNCVRLTWPLFMV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     +M+V QSF DLGL + I G+  NNP+LL ++++ A +AVV  +G + +M++LDN
Sbjct  95    TNDSLGSMSVAQSFRDLGLVDYIGGIRQNNPSLLDVSVLAAFRAVVTSLGDNSVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDP+ W++GL  +A + +    VVG+SLRNELRGP +N
Sbjct  155   HISKPGWCCSNRDGNGFFGDQYFDPNLWIKGLTRMATMIRRIGNVVGMSLRNELRGPKEN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             +  W +Y+E+GA+ +++ANP++LVI SGL YD D  FL   P       +K+V+E H YA
Sbjct  215   LRDWLRYMERGAEVVHSANPHVLVIASGLYYDTDLWFLGHIP-MKVSFARKLVFELHWYA  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
              + G    W  G  N+ C D T ++  K GF++  G   PLFVSEFG    G +  D+R+
Sbjct  274   SSSG--TVWEDGNTNERCKDATDKVMSKAGFILNQGM--PLFVSEFGGELSGQNVNDDRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C     A LD DW++W + GSYYLR+G  G +ET+G+   +++  RN +FL ++  LQ
Sbjct  330   FNCFFGVAAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLNKDFSGPRNASFLQRISALQ  389

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
                Q   SS PT ++L+HPL+G C   +   +Q+ +  C+  S          I M G+ 
Sbjct  390   APFQGATSSSPTRRILFHPLTGLCIQRKREQEQLQLGACN-ESEAWTHTRHHTIRMRGTD  448

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              C+     + P+ LST C D  S   +++ + M   +N   + + +CLD D  +S  T++
Sbjct  449   LCMQADRLEKPVKLSTDCADHGSRWKTISESKMHFSSNIVGSNVTVCLDID--FSTKTVI  506

Query  1660  TRKCVGLEEGDMRNPQTQWFKL  1725
                C  L E    NP +QWF+L
Sbjct  507   ASPCKCLREDATCNPASQWFEL  528



>ref|XP_007135020.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
 gb|ESW07014.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
Length=512

 Score =   383 bits (984),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 208/509 (41%), Positives = 308/509 (61%), Gaps = 32/509 (6%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+ +G+R KL CA+WAGHL+PM+PEGLD+RPL ++   +    FNCVRLT+A YM+
Sbjct  30    RWIIDEATGQRAKLVCANWAGHLKPMIPEGLDKRPLKELVGELVKHNFNCVRLTYAIYMW  89

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY++  V  SF  L   E + G++ NNP++LS+  V A  AVV E+G   + ++LDNHV
Sbjct  90    TRYSHENVSASFASLDAPEVVQGISKNNPSVLSMTHVQAFHAVVHELGVQNVKVLLDNHV  149

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+PMWCC D D N FF   +F+P EW++GL + A  F     VV +SLRNEL GP QN+ 
Sbjct  150   SEPMWCCDDDDENGFFHDRHFNPQEWVRGLTLAAKHFTGNHAVVAMSLRNELHGPRQNLQ  209

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF-  948
              WY+Y+ +GA AI+  NPN+LV+ISGL+YD + +FLK +P     + KK+VYETH Y++ 
Sbjct  210   DWYRYMSQGAVAIHKTNPNVLVLISGLNYDTELQFLKSKP-LKIDLGKKMVYETHLYSWS  268

Query  949   ---TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
                T    + W K PLN++C +  + ++ + GFL  G N  PL  +EFG N+ G S  D+
Sbjct  269   GIGTLKLKEIWTKQPLNRICANNIKGIDYRVGFLTTGKNAAPLIFTEFGFNEEGSSVEDS  328

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L C+ +YL   DLDW +WA QGSYY+++ +   DE++G+    W  LR PN   K + 
Sbjct  329   RFLTCLQTYLLGKDLDWGLWAFQGSYYVKKDQVQVDESFGLMDETWHHLRYPNLTHKFQL  388

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             LQ+K    + +E                   +++ +  C   +R +   +G  I + G+ 
Sbjct  389   LQRK---NIVNEK------------------NEVELGSCETKNRWVGGENGTKIILHGTK  427

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
             KCL   GE LP+ +S    + +S++W   S S   LA        LCL  DS  + S+I+
Sbjct  428   KCLTAAGEGLPVVVSDC--ERKSSSWKSVSLSKLHLATMNQQEEQLCLQKDS--NSSSIV  483

Query  1660  TRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             T KC+ +++    + +PQ+QWF+L+ +N 
Sbjct  484   TSKCICIKDDSLCLDDPQSQWFQLVETNV  512



>ref|XP_010502524.1| PREDICTED: uncharacterized protein LOC104779826 [Camelina sativa]
Length=534

 Score =   384 bits (986),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/507 (42%), Positives = 310/507 (61%), Gaps = 20/507 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G+RVKLAC +W  HL+P++ EGL ++ +  +A  +  MGFNCVRLTW   + 
Sbjct  36    RWIIDVK-GQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAEKILEMGFNCVRLTWPLDLA  94

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGLT+ ISG  + NP+++ L L++A K VV ++G   +M++LD
Sbjct  95    TNETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGDKNVMVILD  154

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHV+KP WCC   DGN FFG  +FDP  W+ GL  +A  FK T  VVG+SLRNELRGP Q
Sbjct  155   NHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLRNELRGPKQ  214

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANP +LVI+SGLSYD D  F++ RP       +K+V+E HRY
Sbjct  215   NVDAWFKYMQQGAEAVHEANPEVLVILSGLSYDTDLSFVRSRP-VNLTFTRKLVFEIHRY  273

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT   +  W     N+ C +I + +E+  GF +R     P+F+SEFGI+  G +  +NR
Sbjct  274   SFT--NTNTWSSKNPNEACGEILKSIEDGGGFNLRD---FPVFLSEFGIDLRGQNVNENR  328

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+W LQGSYYLREG  G  E YG+  ++W  +R+  FL +L  +
Sbjct  329   YIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRIFLQRLSLI  388

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQ P S    Y L++HPL+G C   + +   ++ +  C+  SR         + +  
Sbjct  389   QSPLQGPGSQPKVYNLVFHPLTGLCMLQSILDPTKVTLGLCN-ESRPWSYTPDNTLKLKE  447

Query  1474  SLKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
                CL   G + P+ LS + C+    + W   S S   LA K  N   LCLD D S   +
Sbjct  448   KSLCLESTGSNAPVKLSKMSCSSPNLSKWQTISASNMLLAAKSSNN-SLCLDVDES---N  503

Query  1651  TILTRKCVGLE-EGDMRNPQTQWFKLI  1728
              ++   C  ++ E +  +P +QWFK++
Sbjct  504   NLMASDCKCVKGEDNSCDPTSQWFKIV  530



>ref|XP_006292902.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
 gb|EOA25800.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
Length=511

 Score =   383 bits (983),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 217/510 (43%), Positives = 309/510 (61%), Gaps = 23/510 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HL+P++ EGL ++ +  +A  +  MGFNCVRLTW   + 
Sbjct  10    RWIID-ENGQRVKLACVNWPSHLQPVVAEGLSKQRVDDVAKKIVEMGFNCVRLTWPLDLA  68

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + ISG  + NP+++ L L++A K VV ++G   +M++LD
Sbjct  69    TNETLANNVTVRQSFQSLGLIDDISGFQTKNPSMIDLPLMEAYKTVVAKLGNKNVMVILD  128

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHV+KP WCC   DGN FFG  YFDP  W+ GL  +A  FK T  VVG+SLRNELRG  Q
Sbjct  129   NHVTKPGWCCGYDDGNGFFGDTYFDPATWIAGLTKIATTFKGTSNVVGMSLRNELRGARQ  188

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANPN LVI+SGLSYD+D  F++ RP        K+V+E HRY
Sbjct  189   NVDDWFKYMQQGAEAVHKANPNALVILSGLSYDVDLSFVRSRP-VNLTFTGKLVFELHRY  247

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT   +  W     N+ C +I + +E+  GF +R     P+F+SEFGI+  G +  DNR
Sbjct  248   SFT--NTNTWSSKNPNEACGEILKSIEDGGGFNLRD---FPVFLSEFGIDLRGKNVNDNR  302

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+W LQGSYYLREG  G  E YG+  ++W  +RN +FL +L  +
Sbjct  303   YIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRNMSFLQRLSLI  362

Query  1303  QQKLQD---PMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIH  1464
             Q  LQ    P S    Y L++HPL+G C   + +   ++ +  C+ +       D     
Sbjct  363   QSPLQSLPGPGSQPKVYNLVFHPLTGLCMLQSILDPTKVTLGLCNESQPWSYTPDNTLTL  422

Query  1465  MIGSLKCLAVVGEDLPLTLS-TICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSY  1641
                SL CL   G + P+ LS T C+    + W   S S   LA K  N   LCLD D S 
Sbjct  423   KDKSL-CLENTGPNAPVKLSKTSCSSPNLSKWHTISASNMLLAAKSTNN-SLCLDVDES-  479

Query  1642  SPSTILTRKCVGLEEGDMR-NPQTQWFKLI  1728
               + ++   C  ++  D   +P +QWFK+I
Sbjct  480   --NNLIASNCKCVKGEDSSCDPMSQWFKII  507



>emb|CDX83590.1| BnaC07g23300D [Brassica napus]
Length=557

 Score =   384 bits (986),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 214/515 (42%), Positives = 311/515 (60%), Gaps = 31/515 (6%)
 Frame = +1

Query  232   RWIMDD-QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +WA HLE  + EGL ++PL  I   + +MGFNCVRLTW  Y+
Sbjct  32    RWIVDDGNKGRRVKLTCVNWASHLETAVAEGLSKQPLDSIGAKIVSMGFNCVRLTWPLYL  91

Query  409   FTRYAN---MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T  +    MTV QS   LGL EAISG  +NNP +L L L+ A + VV  +G++ ++++L
Sbjct  92    ATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLGKNRLLVIL  151

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPL  759
             DNH+S+P WCC D+DGN FFG  Y +P  W++GL  +A +F +   VVG+SLRNELRGP 
Sbjct  152   DNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKNMATMFANVSNVVGMSLRNELRGPK  211

Query  760   QNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHR  939
             QN+  WYKY+ +GA+A+++ NPN+LVI+SGL+Y+ D  FL+++P      ++K+V+E H 
Sbjct  212   QNIKDWYKYMREGAEAVHSVNPNILVIVSGLNYETDLSFLRDKP-FEITFRRKLVFEIHW  270

Query  940   YAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
             Y F      +W    LNK+C   T  + +  GFL+  G   PLFVSEFGI+Q G++  DN
Sbjct  271   YGFWS----SWEGDNLNKICGRETENIMKMSGFLLEKG--FPLFVSEFGIDQRGNNVNDN  324

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L C ++  ADLDLDW++W L GSYY+RE   G DETYG+   +W+++RN   L  +  
Sbjct  325   RFLSCFMALAADLDLDWALWTLAGSYYIREKTIGYDETYGVLDWSWSSIRNSTILQMISA  384

Query  1300  LQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCS-------GASRCIQEAD  1449
             +Q   + P  M + P  ++++HP +G C  R    Q+ +  C         + R +  A+
Sbjct  385   IQSPFRGPGLMETHPK-KIIFHPSTGLCIVRKSLFQLKLGSCDRSESFRLSSQRVLSLAE  443

Query  1450  GKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDF  1629
              K +       CL    +   + L    ++   + W L S S  QL++   NG  +CLD 
Sbjct  444   EKIL-------CLKAYEKGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLDV  496

Query  1630  DSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             DS    + I+T+ C  LEE    +P++QWFK++ S
Sbjct  497   DS--DSNNIVTKSCKCLEEDASCDPKSQWFKVVTS  529



>ref|XP_010556350.1| PREDICTED: uncharacterized protein LOC104825676 [Tarenaya hassleriana]
Length=560

 Score =   383 bits (984),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 208/509 (41%), Positives = 306/509 (60%), Gaps = 16/509 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM-  408
             RWI+D ++G+RVKLACA+W  HL+P++ EGL ++P+ +IA  +  MGFNCVRLTW   + 
Sbjct  37    RWIVD-ETGQRVKLACANWPSHLQPVVAEGLSKKPVEEIAEKIVGMGFNCVRLTWPLDLA  95

Query  409   --FTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
               FT   N+TV QSF  LGL + I G  ++NP+++ L L+DA K VVE +G  G+M+VLD
Sbjct  96    TNFTLAHNVTVRQSFQSLGLNDDIVGFQTHNPSIIDLPLIDAFKTVVEALGNKGVMVVLD  155

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCC++ DGN FFG  +FDP  W+ GL  +A+IF     VVG+SLRNELRG  Q
Sbjct  156   NHITKPGWCCSNDDGNGFFGDRFFDPAVWISGLTNMASIFNGVSNVVGMSLRNELRGSRQ  215

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             N + W+KY+E+GA+AI++ANPN+LVI+SGLS+D D  F+  RP        K+V+E H Y
Sbjct  216   NTNDWFKYMEQGAEAIHSANPNVLVILSGLSFDADLSFVGARP-VNLSFAGKLVFELHWY  274

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AF++G S  W     N +C  +   + +  GFL+  G   PLF SEFGI++ G +  DNR
Sbjct  275   AFSDGNS--WATNNPNDICGRVLNRINKGGGFLLNKG--FPLFFSEFGIDERGGNANDNR  330

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C L + A+ D+DW++W L GSYY+R+G  G  E YG   ++W  +RN +FL +L  L
Sbjct  331   YFGCFLGWAAENDVDWALWTLTGSYYIRQGVVGMIEYYGALDSDWNDVRNSSFLQRLSLL  390

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q +LQ P      Y L++HPL+G C   + +    + +  C   S          + + G
Sbjct  391   QSQLQGPGPRTDFYDLIFHPLTGLCVVQSELDPTLLTLGPCK-ESEPWSYTSKNNLKIQG  449

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
                C+   G   P+ L   C    S   +++++ M   +   +    LCLD D++   S 
Sbjct  450   MPFCIQSTGTQKPVRLGLSCWSPNSKWQTISASKMHLASTTSNKTSSLCLDVDTN---SN  506

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIASNT  1740
             ++   C  L +     P +QWFK++ + T
Sbjct  507   VVANPCKCLSKDSSCEPMSQWFKIVRATT  535



>ref|XP_010556349.1| PREDICTED: uncharacterized protein LOC104825675 [Tarenaya hassleriana]
Length=555

 Score =   383 bits (983),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 211/507 (42%), Positives = 303/507 (60%), Gaps = 16/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM-  408
             RWI+D+ S +RVKL+CA+W  HL+P++ EGL ++P+ +IA  +  MGFNCVRLTW   + 
Sbjct  37    RWIVDETS-QRVKLSCANWPSHLQPVVAEGLSKKPVEEIADKIVGMGFNCVRLTWPLDLA  95

Query  409   --FTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
               FT   N+TV QSF  LGL +   G  ++NP+++ L L+DA K VVE +G  G+M+VLD
Sbjct  96    TNFTLAHNVTVRQSFQSLGLYDDFVGFQTHNPSIIDLPLIDAFKTVVETLGNEGVMVVLD  155

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHV+KP WCC+D DGN FFG  +FDP  W+ GL  +A+IF     VVG+SLRNELRG  Q
Sbjct  156   NHVTKPGWCCSDDDGNGFFGDRFFDPTVWISGLTNMASIFNGVSNVVGMSLRNELRGSRQ  215

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             N + W+KY+E+GA+A+++ANPN+LVI+SGL YDLD  +++ +P        K+V+E H Y
Sbjct  216   NTNDWFKYMEQGAEAVHSANPNVLVILSGLHYDLDLSYIRAQP-VNLSFDGKLVFELHWY  274

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AF++G S  W     N +C  I+  +    GFL+  G   PLF+SEFGI++ G +  DNR
Sbjct  275   AFSDGDS--WATNNPNDICGKISNRVNNAGGFLLDKGY--PLFLSEFGIDERGGNINDNR  330

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
                C L + A+ D+DW++W L GSYY+REG  G  E YG    +W   RN +FL ++  L
Sbjct  331   FFGCFLGWAAENDIDWALWVLSGSYYIREGVAGMVEFYGALDADWNDARNSSFLQRISLL  390

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQ P      Y L++HPL+G C   +++   ++ +  C  +      ++   + + G
Sbjct  391   QSPLQGPGPQTGDYNLIFHPLTGLCMVQSQINPTKLALGPCYESEPWSYTSENN-LKIQG  449

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
                CL   G   P+ L   C    S  W   S S   LA+     + LCLD D S   + 
Sbjct  450   LPFCLQNTGTGKPVKLGISCWSPVSK-WHTISASEMHLASTTSEQISLCLDVDGSN--NV  506

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             ++   C  + E     P +QWFK+I +
Sbjct  507   VIANDCKCMAEDSRCQPMSQWFKIIKA  533



>ref|XP_006395581.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
 gb|ESQ32867.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
Length=557

 Score =   382 bits (981),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 216/512 (42%), Positives = 312/512 (61%), Gaps = 26/512 (5%)
 Frame = +1

Query  232   RWIMDDQ-SGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +W  HLE  + EGL ++P+  IA  +  MGFNCVRLTW  Y+
Sbjct  34    RWIVDDGIKGRRVKLTCVNWPSHLETAVAEGLSKQPIDSIAEKIVLMGFNCVRLTWPLYL  93

Query  409   FTRYAN---MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T  +    MTV QS    GL EA+SG  +NNP++L L L+ A + VV  +G H +M+VL
Sbjct  94    ATDESFSGIMTVRQSLRKFGLFEAVSGFQANNPSILDLPLIKAFQEVVTCLGNHRLMVVL  153

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD-TPMVVGVSLRNELRGP  756
             DNH+S+P WCC+D+DGN FFG  + +P+ W++GL  +A++F + +  VVG+SLRNELRGP
Sbjct  154   DNHISQPGWCCSDNDGNGFFGDRHLNPNLWIKGLMKLASMFANVSSNVVGMSLRNELRGP  213

Query  757   LQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETH  936
              QN+  WYKY+ KGA+A+++ NP++LVI+SGL+YD D  FL++RP ++   +K V +E H
Sbjct  214   KQNIKDWYKYMRKGAEAVHSVNPDILVIVSGLNYDTDLSFLRDRPFEVSFRRKLV-FEIH  272

Query  937   RYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEAD  1116
              Y F      +W    LNK+C   T  + +  GFL+  G   PLFVSEFGI+Q G++  D
Sbjct  273   WYGFWS----SWEGDNLNKICGRETENIMKMSGFLLEKG--IPLFVSEFGIDQRGNNVND  326

Query  1117  NRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLE  1296
             NR L C ++  ADLDLDW++W L GSYY+RE   G DE++G+   NW+++RN   L  + 
Sbjct  327   NRFLSCFMALAADLDLDWALWTLAGSYYVREKTIGSDESFGVLDLNWSSIRNSIILQMIS  386

Query  1297  FLQQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
              +Q   +  M ++P  ++++HP SG C  R    Q+ +  C+ +     E+     H + 
Sbjct  387   AIQSPFRGLMETQPK-KIIFHPSSGLCIVRKSLFQLKLGSCNRS-----ESFKLSSHRVL  440

Query  1474  SLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
             SL      CL       P+ L    ++   + W   S S  QL++   NG  +CLD DS 
Sbjct  441   SLTEEQIFCLKAYEIGDPVKLRLFFSESYCSKWKFLSESKMQLSSFTKNGESVCLDVDS-  499

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
                + I+T+ C  LE     NP++QWFKL+ S
Sbjct  500   -DSNNIVTKSCKCLEGNASCNPKSQWFKLVTS  530



>ref|XP_010240029.1| PREDICTED: uncharacterized protein LOC100839976 [Brachypodium 
distachyon]
Length=562

 Score =   382 bits (982),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 217/509 (43%), Positives = 302/509 (59%), Gaps = 16/509 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLEPML EGL +RP+  IA  V+ MGFNCVRLTW T+M 
Sbjct  37    RWIVD-EAGDRVKLACVNWPSHLEPMLAEGLSKRPVGSIAGDVAAMGFNCVRLTWPTFMV  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y ++TV QSF  L LTE ++G+ +NNP L+ L L+DA KAVV  +G + +M++LDN
Sbjct  96    TNASYTSLTVAQSFQRLNLTEPLAGIRANNPALVDLRLIDAFKAVVSSLGENNLMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS P WCC++ DGN FFG  YF PD W+ GL  +A  F   P VVG+SLRNELRGP QN
Sbjct  156   HVSMPKWCCSNTDGNGFFGDAYFQPDVWVDGLTKMATTFAAVPNVVGMSLRNELRGPRQN  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + WYKY+++GA+A++ ANP  LVI+SGLSYD D  FL  R        +K  +E H Y+
Sbjct  216   ANDWYKYMQRGAEAVHAANPRALVILSGLSYDNDLAFLSSR-QVTLSFARKAAFEVHWYS  274

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+  Q   W     N+ C  I   +  +  +L+  G   P+F+SEFG++  G +  DNR+
Sbjct  275   FSNSQD--WASSNPNEACARIGASVSRRALYLLDQG--WPVFLSEFGVDNRGGNANDNRY  330

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C  +  ADLDLDW++W LQGSYYLREG    DE YG+   +W   RN   L ++  LQ
Sbjct  331   YGCAAAVAADLDLDWALWTLQGSYYLREGVRDLDEVYGVLDRSWRNPRNATALRRVRALQ  390

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCARVVGDQI---HMSDCSGASRCIQEADGKPIHMIG  1473
             +  + P  +E   Y  L+HP +G C       +    +  C GA     +A  + + +  
Sbjct  391   RAFRGPGFAEAAPYVALFHPSTGLCVARRSSPVSPLELGSCEGAEAWAYDAQRQRLALRD  450

Query  1474  S-LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGL-VLCLDFDSSYSP  1647
             S L CL   G   P+ +   C   +   W L S+S   +A    +G  +LCLD  +    
Sbjct  451   SPLMCLRAEGAGRPVRVGMACATDEMARWRLVSDSKLHVAANASSGAGMLCLDVGA--DG  508

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              +++T  C  L   +  +P++QWFKL++S
Sbjct  509   RSVVTNTCRCLSADNSCDPESQWFKLVSS  537



>ref|XP_004143963.1| PREDICTED: uncharacterized protein LOC101211910 [Cucumis sativus]
Length=525

 Score =   381 bits (978),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 204/514 (40%), Positives = 311/514 (61%), Gaps = 19/514 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACA--------SWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVR  387
             RWI+D ++G+RVKL+C         +   H + M+ +GLD+RPL  +A  + +  +NCVR
Sbjct  19    RWIVDSKTGQRVKLSCVKRVKLSCVNLVSHAQSMVAQGLDKRPLKDLANEIVSRDYNCVR  78

Query  388   LTWATYMFTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGI  567
             LTW+ YMFTRY   T+      L + +  +G+  +NP  L++ +  A K VV+ +G  G+
Sbjct  79    LTWSVYMFTRYPFETIGDVLDGLDINKVKNGVKKHNPQFLNMTVTSAFKTVVDGLGNAGL  138

Query  568   MMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNEL  747
             M++LDNH+S+P WCC+ HDGN FFG   F P EWL+GLA VA  F   P VVG+SLRNEL
Sbjct  139   MVILDNHISQPRWCCSLHDGNGFFGDRNFKPIEWLRGLAYVARHFSWHPKVVGMSLRNEL  198

Query  748   RGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvY  927
             RG   NV VW KYV+ G+  I+  NP LLV+ISGL+YD D  +LK++P     +  KVV 
Sbjct  199   RGS-NNVGVWRKYVKLGSHLIHRINPRLLVVISGLNYDNDLSYLKKKP-LGYNLNNKVVL  256

Query  928   ETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDS  1107
             E H Y+F+      ++K PLN VC+ +  + E + GF+V   +P PLF+SEFG +  G +
Sbjct  257   EAHLYSFSGEPESKFVKKPLNIVCNQVMEKFEREAGFVVDMKDPYPLFLSEFGYDLRGGN  316

Query  1108  EADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLS  1287
             +A NR + C L+ +   D+DW+ WA QGSY  R+G+   DE++G+  ++WT  R+P    
Sbjct  317   KAQNRFMSCFLARIIGKDIDWAYWAFQGSYMYRQGQQDVDESFGIMDSSWTKDRSPRLQQ  376

Query  1288  KLEFLQQKLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIH  1464
              L+  ++  QDP S  P   ++ HP+SG+C ++ G   I + DC   +      DG P+ 
Sbjct  377   MLQLAKRINQDPNSKGPMSYIMLHPVSGQCVKLDGKGGIELGDCETPTLWDHTGDGSPMK  436

Query  1465  MIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYS  1644
             +    +CL   G+  P  +S  C+ G  ++W++AS +  QL+ K   G  +CL+ +S   
Sbjct  437   LWNG-QCLKSAGDGKPPVVSAECS-GDGSSWTVASKAKLQLSTK-SGGENICLEKESD--  491

Query  1645  PSTILTRKCVGLEE--GDMRNPQTQWFKLIASNT  1740
              ++I+ +KC+ L++      +PQ+QWFKL+ +N 
Sbjct  492   -TSIVVKKCICLKDEWNCFDDPQSQWFKLVPTNV  524



>ref|XP_010250979.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250981.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   381 bits (978),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 216/508 (43%), Positives = 313/508 (62%), Gaps = 22/508 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL C +WA HL+P+L EGL+++PL  I+  +  MGFNCVR TW  +M 
Sbjct  37    RWIVD-ETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRFTWPLWMA  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    ++MTV QSF  LGL E+I  +  NNP++L+L ++ A + VV  +G +G+M++LDN
Sbjct  96    TNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENGVMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN +FG +YFDP+ W++GL  +A +F  T  V+G+SLRNELRGP Q+
Sbjct  156   HISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGMSLRNELRGPNQD  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +WYKY++ GA+A++ ANPN+L I+SGL +D D  FL  +P       +K+V+E H Y+
Sbjct  216   VSIWYKYMQLGAEAVHKANPNVLTILSGLDFDKDLHFLHNQP-VNLSFTRKLVFELHWYS  274

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW  G  N+VC  +   ++ K  F++  G   PLFVSEFGI+  G +  DNR+
Sbjct  275   FSDGN--AWATGNPNQVC-GVVNALKNKILFVLDQGY--PLFVSEFGIDLRGTNVKDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+    A+LD DW++W L GSYYLREG  G +E YG+   +W+  RN  FL +L  ++
Sbjct  330   SSCIFGVAAELDFDWALWTLMGSYYLREGVLGLEEVYGVMNWDWSGPRNSTFLRRLSSIR  389

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCARVVGD--QIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E T YQ+LYHPL+G C +      Q+ +  C   +  I   +   I + G+
Sbjct  390   SAFRGPGLDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCDEPASWIYTPE-MTIKVKGT  448

Query  1477  LKCLA--VVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
               CL    +GE   L     CN   S  W   ++S   LA+K   G  +CLD DS    +
Sbjct  449   GLCLHGDRLGERANL---QDCNSPGS-IWMPITDSKMHLASKLAGGSTVCLDIDSK---N  501

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              I+T  C  L      +P +QWFK+I S
Sbjct  502   KIITSPCQCLLGDPTCDPGSQWFKIINS  529



>ref|XP_008389747.1| PREDICTED: uncharacterized protein LOC103452051 [Malus domestica]
Length=545

 Score =   381 bits (978),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 211/506 (42%), Positives = 309/506 (61%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKLAC +W  HL+ +L EGL ++P++ I   ++++GFNCVRLTW  ++ 
Sbjct  30    RWIVD-ENGRRVKLACVNWVSHLDTVLAEGLSKQPVNAIIKRITSLGFNCVRLTWPLFLA  88

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV QSF  LGL  +ISGL SNNP  L L+L+ A +AVV  +G++ +M+VLDN
Sbjct  89    TNSTLAEVTVRQSFQSLGLLGSISGLQSNNPGFLDLSLIKAFQAVVSSLGKNNVMVVLDN  148

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W+ GL  +A +F     VVG+SLRNELRGP QN
Sbjct  149   HLSKPGWCCSNTDGNGFFGDEYFNPDNWIVGLTRMAALFHGVRNVVGMSLRNELRGPKQN  208

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY Y+++GA+A++ ANP +LVI+SGL +D D  FL  RP        K VYE H Y 
Sbjct  209   VNDWYTYMQRGAEAVHKANPVVLVILSGLKFDTDLSFLANRP-VKLTFSGKTVYEVHWYG  267

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ   W  G  N+VC  +   ++ + GFL+  G   PLFVSEFG++Q G +  DNR+
Sbjct  268   FTDGQE--WKSGNSNQVCGHVYNNVKGRSGFLLDRG--FPLFVSEFGVDQRGTNVIDNRY  323

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++   +LD+D++ W+L GSYYLR+G  G  E YG+  ++W+ +RN +   K+  LQ
Sbjct  324   LNCFMAAAVELDVDFAQWSLVGSYYLRQGVKGMKEYYGILNSDWSGIRNSSLTQKISVLQ  383

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCARVVGDQ--IHMSDCSGASRCIQEADGKPIHMIGS  1476
               ++      P  +++++HP +G C   VG +  + +  CS  ++    +  K + +  +
Sbjct  384   TSIKGAGLHTPRLHKIIFHPATGLCLLKVGTRGPLKLGPCS-QTQGWTYSSTKVLLLNKN  442

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+     + P  L   C    S  W   S+S   L +K  +G  +CLD DS     TI
Sbjct  443   EFCIQADQLNKPAVLGIPCTTPNSR-WETISDSQMHLQSKTTDGTEVCLDVDSD---KTI  498

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L      +P +QWFK++ S
Sbjct  499   VTNACKCLSGDSSCDPASQWFKVVDS  524



>gb|AAD31066.1|AC007357_15 F3F19.15 [Arabidopsis thaliana]
Length=522

 Score =   380 bits (975),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 205/505 (41%), Positives = 303/505 (60%), Gaps = 13/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKL CA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  10    RWIVD-ENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWPLDLM  68

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + I G  +NNP+++ L L++A K VV  +G + +M++LD
Sbjct  69    TNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGNNDVMVILD  128

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA+ DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  129   NHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLRNELRGPKQ  188

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN  +LVI+SGLS+D D  F++ RP        K+V+E H Y
Sbjct  189   NVNDWFKYMQQGAEAVHSANNKVLVILSGLSFDADLSFVRSRP-VKLSFTGKLVFELHWY  247

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G S  W     N +C  +   +    G+L+  G   PLF+SEFGI++ G +  DNR
Sbjct  248   SFSDGNS--WAANNPNDICGRVLNRIGNGGGYLLNQG--FPLFLSEFGIDERGVNTNDNR  303

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A+ D+DWS+WAL GSYYLR+GK G +E YG+  ++W ++RN +FL K+ FL
Sbjct  304   YFGCLTGWAAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFL  363

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  R + D   ++     S        K + +    
Sbjct  364   QSPLQGPGPRTDAYNLVFHPLTGLCIVRSLDDPKMLTLGPCNSSEPWSYTKKALRIKDQQ  423

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G   P+T++        + W   S S   LA+   N   LCLD D++   + ++
Sbjct  424   LCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTA---NNVV  480

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWFK+I +
Sbjct  481   ANACKCLSKDKSCEPMSQWFKIIKA  505



>ref|XP_010249430.1| PREDICTED: uncharacterized protein LOC104591974 [Nelumbo nucifera]
Length=538

 Score =   380 bits (975),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 212/507 (42%), Positives = 303/507 (60%), Gaps = 16/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             +WI+D ++G+RVKLAC +W  HL+P+L EGL+R+PL  I+  + +MGFNCVR TW  +M 
Sbjct  38    QWIVD-ENGQRVKLACVNWISHLQPLLAEGLNRQPLDTISKTIVSMGFNCVRFTWPLFMA  96

Query  412   TRYA--NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  +  ++ V QSF +LGL E+I  +  NNP++L+L ++ A KAVV+ +G + +M++LDN
Sbjct  97    TNESLYSLNVRQSFENLGLNESIGAILVNNPSMLNLTVIQAFKAVVDNLGDNNVMVILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC+  DGN FFG  YFDP+ W++GL  +A  F  T  V+G+SLRNELRG  QN
Sbjct  157   HISKPGWCCSRTDGNGFFGDTYFDPELWIKGLTQMATWFNGTTNVIGMSLRNELRGSRQN  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V VWYKY++ GA+AI+ ANP++L I+SGL +D D  FL  R        +K+V+E H YA
Sbjct  217   VSVWYKYMQAGAEAIHKANPHVLTILSGLEFDHDLSFLHSR-QVKLSYSRKLVFELHWYA  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G   AW +G  N VC  I   ++ +  F++  G   PLF+SEFGI+  G     +R 
Sbjct  276   FTDGH--AWEEGNPNDVCGRIVNTLKSQSLFVLDQGY--PLFLSEFGIDLRGGDPNGDRF  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C     ADLD DW++WA  GSYYLREG +  +E Y +   +W   RN  FL ++  +Q
Sbjct  332   SNCFFGVAADLDFDWALWAFMGSYYLREGYYALNEVYAVLDWDWAKPRNTTFLKRVAGIQ  391

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVG--DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P  S    Y +LYHPL+G C + V   + + +  C+ A         K + +   
Sbjct  392   SPFRGPGFSDVRPYNILYHPLTGLCVQKVSPMEPVKLGSCAAAPEAWIYTPQKTLMLNNG  451

Query  1477  LK-CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPST  1653
             ++ CL   G    + L   C+ G  + W   S S   L++K  NG  +CLD D SY+   
Sbjct  452   MRYCLQADGVGNGVMLGNACS-GPGSNWYQISASKLHLSSKLANGTSVCLDIDPSYN---  507

Query  1654  ILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             I+T  C  L      +P  QWFK+I S
Sbjct  508   IVTNTCQCLTGDKTCDPAGQWFKIITS  534



>ref|XP_008437728.1| PREDICTED: uncharacterized protein LOC103483074 [Cucumis melo]
Length=480

 Score =   378 bits (970),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 201/485 (41%), Positives = 297/485 (61%), Gaps = 13/485 (3%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRYANMTVVQSFGDLGLTEAISGLA  486
             ML +GLD+RPL  +A  + +  FNCVRLTW+T+MFTRY++MT+V    DL +    SG+ 
Sbjct  1     MLAQGLDKRPLKDLANDIISRDFNCVRLTWSTHMFTRYSHMTIVDVLDDLDIQNVKSGVQ  60

Query  487   snnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDE  666
             ++NP +L++ +  A K VV+ +G  G+M+VLDNH+S+P WCC+  DGN FFG  +FD  E
Sbjct  61    THNPEMLNMTVAHAFKTVVDGLGNAGLMIVLDNHISQPRWCCSLDDGNGFFGDRHFDALE  120

Query  667   WLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIIS  846
             WLQGL  VA  F     V+G+SLRNELRGP  N+D WYKYV  G+  I+  NPNLLVIIS
Sbjct  121   WLQGLDYVARNFTGHSQVIGMSLRNELRGPYTNMDNWYKYVSNGSHLIHTKNPNLLVIIS  180

Query  847   GLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQS---KAWMKGPLNKVCHDITRE  1017
             G+++D D  FLKE+P     +  KVV E H Y F+  +      ++K PLN VC+ +  +
Sbjct  181   GVTFDTDLSFLKEKP-LGYNLHNKVVLEAHLYPFSGSEKLPESKFVKKPLNVVCNQVKEK  239

Query  1018  MEEKEGFLVR-GGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGS  1194
              E + GF+V     P PL++SEFG +  GD++A NR + C L+++   DLDW+ WA QG+
Sbjct  240   FEREAGFVVNMEDEPYPLWLSEFGYDLRGDNKAQNRFMSCFLAHIVGKDLDWAYWAFQGT  299

Query  1195  YYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGR  1374
             Y  R+G+   DE +G+  + WT  RNP     L+  ++  QDP S+     ++ HP+SG+
Sbjct  300   YMYRQGQESVDEAFGIMDSTWTKDRNPQLNQMLQLAKRINQDPNSNASMSYIILHPVSGQ  359

Query  1375  CARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSN  1551
             C R  G   I + DC   ++     DG  + ++ + +CL   G+  P  +ST C+ G+ +
Sbjct  360   CIRSNGQGGIALGDCLTPTQWTYSGDGSSMKLLSNGQCLKSAGDGKPPVVSTECS-GEES  418

Query  1552  TWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKCVGLEE--GDMRNPQTQWFKL  1725
              W++AS +  QLA K   G   CL+     S + I+ ++C+ L++      +PQ QWFKL
Sbjct  419   KWTMASKAKLQLATKS-GGEDFCLE---KKSDTKIVVKRCICLKDELNCFNDPQPQWFKL  474

Query  1726  IASNT  1740
             + +N 
Sbjct  475   VPTNV  479



>ref|XP_009152075.1| PREDICTED: uncharacterized protein LOC103875317 [Brassica rapa]
Length=538

 Score =   380 bits (975),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 210/510 (41%), Positives = 308/510 (60%), Gaps = 20/510 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ GER KLAC +W  HL+P + EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  35    RWIIDEK-GERTKLACVNWPAHLQPAVAEGLSKQPVDAVAQKIVAMGFNCVRLTWPLDLA  93

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      ++TV  SF  LGL   ISG  + NP+++ L L++A ++VV  +G + +M++LD
Sbjct  94    TNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQSVVTTLGNYNVMVILD  153

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCC + DGN FFG ++FDP  W+ GL  +A  FKDT  VVG+SLRNELRGP Q
Sbjct  154   NHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSNVVGMSLRNELRGPKQ  213

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+ +GA+A++ ANP  LVI+SG SYD D  F++ RP        K+V+E HRY
Sbjct  214   NVDDWFKYMLQGAEAVHEANPYALVILSGFSYDTDLSFVRSRP-VSLTFSGKLVFELHRY  272

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT      W     N  C +I + +++  GFL+R     P+F+SEFGI+  G +  D+R
Sbjct  273   SFT--NVDIWSSKNPNDACGEILKIIDDGGGFLLRD---FPVFLSEFGIDLRGGNINDDR  327

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+WALQGSYYLREG  G  E YG+  ++W ++RN +F+ +L  +
Sbjct  328   YIGCILGWAAENDIDWSIWALQGSYYLREGVVGMTEYYGVLNSDWISVRNNSFMQRLSLI  387

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQ P        L++HPL+G C   + +   ++++  C+ +       D   + +  
Sbjct  388   QSTLQGPDPQPEVSNLIFHPLTGLCMLQSSLDPTKVNLGRCNQSQPWDYTTDNT-LKLKN  446

Query  1474  SLKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
                CLA  G + P+ LS   C+    + W   S S   LA K  N   LCLD D     +
Sbjct  447   IPLCLANTGPNAPVKLSEASCSTPSLSQWQPISASNMLLAAKSTNN-SLCLDVDGDN--N  503

Query  1651  TILTR-KCVGLEEGDMRNPQTQWFKLIASN  1737
              + T  KCV  E+    +P +QWFK++  N
Sbjct  504   VVATNCKCVNGEDSSC-DPMSQWFKIVKVN  532



>ref|XP_004955049.1| PREDICTED: uncharacterized protein LOC101776534 [Setaria italica]
Length=556

 Score =   380 bits (975),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 226/520 (43%), Positives = 303/520 (58%), Gaps = 28/520 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D Q+G RVKLAC +W  HLEP++ EGL R+P+  IA  V ++GFNCVRLT+   + 
Sbjct  35    RWIVD-QAGHRVKLACVNWPSHLEPVVTEGLGRQPVGAIAGMVVSLGFNCVRLTYPIALA  93

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++TV QS    GL E   G+  NNP  L L L+++ KAVV  +G   +M++LDN
Sbjct  94    TNASLSSLTVRQSLLAHGLAETAGGVEVNNPGFLDLTLMESLKAVVNTLGEKDVMVILDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC D DGN FFG   FDPD W+ GLA +A IF D P V+G+SLRNELRGP QN
Sbjct  154   HVSKPGWCCGDDDGNGFFGDRDFDPDVWVDGLASMATIFADVPSVIGMSLRNELRGPRQN  213

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklk-mmkkkvvYETHRY  942
              + WY Y+++GA+A++ ANP  LVI+ GLSYD D  FL  RP+ +    + K+V+E H Y
Sbjct  214   TEDWYTYMQRGAEAVHAANPRALVIMGGLSYDYDLSFLAARPVGVSFAAEGKLVFEVHWY  273

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++  ++AW  G  N+VC    R+ E + GFL+  G   PLF+SEFG +  G     NR
Sbjct  274   SFSD--ARAWEAGNANEVCARAARDFERRGGFLLARGL--PLFLSEFGADLRGGDLRGNR  329

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             + PC  +  A  DLDW+ WALQGSY LR+G  G DE YG+   +WT  RN   LS+++ L
Sbjct  330   YFPCAAAVAAKHDLDWAYWALQGSYALRQGVAGMDEVYGVLDWSWTKPRNETVLSRIQAL  389

Query  1303  QQKLQDPMSSEP-TYQLLYHPLSGRC--ARVVGDQIHMSDC--------SGASRCIQEAD  1449
             Q+ +Q P   E   Y +L+HPL+G C  A      + +  C        +  S  +   D
Sbjct  390   QRPIQGPGYGEALPYTVLFHPLTGLCAAASAAAGTLELRPCNETDAWAYAPPSSTLVRRD  449

Query  1450  GKPIHMIGSLKCLAVVGEDLPLTLST-ICNDGQSNTWSLASNSMFQLANKGD---NGLVL  1617
                    G L CL   G  LP  L T  C D  S TW +AS+S   +A        G  L
Sbjct  450   AAAAG--GLLPCLRAEGRGLPARLGTKACGDALS-TWRIASDSGMHVAVDAAPELGGGTL  506

Query  1618  CLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             CLD  +     +I+T  C  L      +P+ QWFKL+ S 
Sbjct  507   CLDVGA--DGRSIVTNPCACLRGDGTCDPERQWFKLVTST  544



>ref|XP_007132485.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
 gb|ESW04479.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
Length=530

 Score =   379 bits (973),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 201/506 (40%), Positives = 316/506 (62%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ ++G+RVKLAC +W  HL+ ++ EGL ++PL  I+  + +MGFNCVRLTW   + 
Sbjct  32    RWIVN-ENGKRVKLACVNWVSHLDTVVAEGLSQQPLDTISKRIKSMGFNCVRLTWPLLLL  90

Query  412   TRY--ANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T +  A++TV  SF +L L ++I  + + NP+++ L L+ A + VV+ +G + +M++LDN
Sbjct  91    TNHSLASLTVRNSFKNLALLQSIDAVQAINPSIIDLPLIKAYQEVVKSLGENDVMVILDN  150

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV+ P WCC+  DGN FFG  YFDPD W+ GL  +A +FK    VVG+SLRNELRGP Q+
Sbjct  151   HVTVPGWCCSSMDGNGFFGDQYFDPDLWIIGLTNMATLFKGVSNVVGMSLRNELRGPKQD  210

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y+ KGA+A++ ANP +LVI+SGL++D D  F+KE          K+V E H Y+
Sbjct  211   VNQWYRYMPKGAEAVHAANPEVLVILSGLNFDTDLSFIKEE-ALKLSFNGKLVLEVHWYS  269

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+EG  K+W     N+VC ++T       GFL+  G   PLFVSEFG++  G    DNR+
Sbjct  270   FSEG--KSWTSSNENQVCGEVTENQMRIAGFLLDQG--LPLFVSEFGLDLRGSDANDNRY  325

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C +++ A LDLDW++W L GSYY+R+G  G +E+YG+  ++W+ + NP+FL ++  +Q
Sbjct  326   INCFMAFAAQLDLDWALWTLGGSYYIRKGVVGMNESYGILNSDWSEVSNPSFLQRISAIQ  385

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P +S    +++++HPL+G C   + + + + +  CS  S   +  +   + + G+
Sbjct  386   IPFRGPGLSEAKPFKVIFHPLTGFCIIRKSLVEALRLGPCSN-SDGWEYTEQNILSIKGT  444

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL   GE     +  IC    S  W + S+S   L+ + +N   LCLD D++   + I
Sbjct  445   NFCLQAEGEGKQAKIGNICLAPNSR-WEMISDSKMHLSTQINNSSGLCLDVDNN---NII  500

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L + +   P +QWFK++ S
Sbjct  501   VTNTCKCLSKDNTCEPASQWFKVVDS  526



>ref|NP_172772.2| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AAU05478.1| At1g13130 [Arabidopsis thaliana]
 gb|AEE28973.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=552

 Score =   379 bits (974),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 205/505 (41%), Positives = 303/505 (60%), Gaps = 13/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKL CA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVD-ENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWPLDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + I G  +NNP+++ L L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGNNDVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA+ DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN  +LVI+SGLS+D D  F++ RP        K+V+E H Y
Sbjct  219   NVNDWFKYMQQGAEAVHSANNKVLVILSGLSFDADLSFVRSRP-VKLSFTGKLVFELHWY  277

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G S  W     N +C  +   +    G+L+  G   PLF+SEFGI++ G +  DNR
Sbjct  278   SFSDGNS--WAANNPNDICGRVLNRIGNGGGYLLNQG--FPLFLSEFGIDERGVNTNDNR  333

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A+ D+DWS+WAL GSYYLR+GK G +E YG+  ++W ++RN +FL K+ FL
Sbjct  334   YFGCLTGWAAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFL  393

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  R + D   ++     S        K + +    
Sbjct  394   QSPLQGPGPRTDAYNLVFHPLTGLCIVRSLDDPKMLTLGPCNSSEPWSYTKKALRIKDQQ  453

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G   P+T++        + W   S S   LA+   N   LCLD D++   + ++
Sbjct  454   LCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTA---NNVV  510

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWFK+I +
Sbjct  511   ANACKCLSKDKSCEPMSQWFKIIKA  535



>ref|NP_189245.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 dbj|BAB02434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77125.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=508

 Score =   377 bits (969),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 208/507 (41%), Positives = 308/507 (61%), Gaps = 20/507 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P++ EGL ++ +  +A  +  MGFNCVR TW   + 
Sbjct  10    RWIIDEK-GQRVKLACVNWPSHLQPVVAEGLSKQSVDDLAKKIMAMGFNCVRFTWPLDLA  68

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + ISG  + NP+++ L L++A K VV ++G + +M++LD
Sbjct  69    TNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGNNNVMVILD  128

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHV+KP WCC  +DGN FFG  +FDP  W+ GL  +A  FK    VVG+SLRNELRGP Q
Sbjct  129   NHVTKPGWCCGYNDGNGFFGDTFFDPTTWIAGLTKIAMTFKGATNVVGMSLRNELRGPKQ  188

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANPN+LVI+SGLSYD D  F++ R        +K+V+E HRY
Sbjct  189   NVDDWFKYMQQGAEAVHEANPNVLVILSGLSYDTDLSFVRSR-HVNLTFTRKLVFELHRY  247

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT   +  W     N+ C +I + +E   GF +R     P+F+SEFGI+  G +  DNR
Sbjct  248   SFT--NTNTWSSKNPNEACGEILKSIENGGGFNLRD---FPVFLSEFGIDLRGKNVNDNR  302

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+W LQGSYYLREG  G  E YG+  ++W  +R+ +FL +L  +
Sbjct  303   YIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEFYGILDSDWVRVRSQSFLQRLSLI  362

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
                LQ P S    Y L++HPL+G C   + +   ++ +  C+  S+         + +  
Sbjct  363   LSPLQGPGSQSKVYNLVFHPLTGLCMLQSILDPTKVTLGLCN-ESQPWSYTPQNTLTLKD  421

Query  1474  SLKCLAVVGEDLPLTLS-TICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
                CL   G + P+ LS T C+    + W   S S   LA K  N   LCLD D +   +
Sbjct  422   KSLCLESTGPNAPVKLSETSCSSPNLSEWETISASNMLLAAKSTNN-SLCLDVDET---N  477

Query  1651  TILTRKCVGLEEGDMR-NPQTQWFKLI  1728
              ++   C  ++  D   +P +QWFK++
Sbjct  478   NLMASNCKCVKGEDSSCDPISQWFKIV  504



>ref|XP_006395580.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32866.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=534

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 211/506 (42%), Positives = 307/506 (61%), Gaps = 17/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLACA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  35    RWIIDEK-GQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVRLTWPLDLA  93

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL   +SG  +NNP+++ L L++A K +V  +G H +M++LD
Sbjct  94    TNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGNHNVMVILD  153

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH +KP WCC + DGN FFG  +FDP  W+ GL  +A IFKD   VVG+SLRNELRGP Q
Sbjct  154   NHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGMSLRNELRGPKQ  213

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANPN+LVIISGLS+D D  F++ RP        K+V+E HRY
Sbjct  214   NVDDWFKYMQQGAEAVHGANPNVLVIISGLSFDTDLSFVRSRP-VTLTFSGKLVFELHRY  272

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT   ++ W     N  C ++ + +++  GF +R     P+F+SEFGI+  G +  DNR
Sbjct  273   AFT--NTEIWSSKNPNDACGEVQKIIDDGGGFNLRD---FPVFLSEFGIDLRGGNVNDNR  327

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+WAL GSYY+REG  G  E YGM  ++  ++R+  FL +L  +
Sbjct  328   YIGCILGWAAENDVDWSIWALTGSYYIREGVAGMVEYYGMLDSDGISIRSIGFLLRLSLI  387

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVG---DQIHMSDCSGASRCIQEADGKPIHMIG  1473
             Q  LQ P+     Y L++HPL+G C        +++ +  C+ + +     D        
Sbjct  388   QTLLQGPVPQPKVYNLVFHPLTGLCMVQTSSDPNKVTLGTCNTSPQWSYTLDNTLKIKDK  447

Query  1474  SLKCLAVVGEDLPLTLS-TICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
             SL CL   G +  + LS T C     + W   S S+  L     +   LCLD D  +   
Sbjct  448   SL-CLENTGPNQRVKLSETSCWSPNLSKWQTISGSINMLLASKSSDNSLCLDVD-GHKNI  505

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLI  1728
                  KCV  E+    +P +QWFK++
Sbjct  506   VATNCKCVKGEDSSC-DPTSQWFKIV  530



>ref|XP_002446674.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
 gb|EES11002.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
Length=556

 Score =   378 bits (971),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 222/509 (44%), Positives = 305/509 (60%), Gaps = 19/509 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+    G RVKLACA+WA HLEP   EGL RR +S IA  V+ MGFNCVRLTW TY+ 
Sbjct  35    RWIVG-ADGRRVKLACATWASHLEPAAAEGLARRGVSDIAARVAAMGFNCVRLTWPTYLA  93

Query  412   TRY--ANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++ +  S   LG+ E+++G+  NNP LL L LVD  + VV  +   GIM++LDN
Sbjct  94    TNVTLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLVDVFREVVSSLASKGIMVILDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG VYFDPDEWL+GL+ +A +F +T  VVG+SLRNELRGP QN
Sbjct  154   QMTTPGWCCSRIDGNGFFGDVYFDPDEWLKGLSAMATMFNNTKNVVGMSLRNELRGPKQN  213

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFL-KERPlklkmmkkkvvYETHRY  942
             V +WY+Y++ GA+A++ ANPN+LVI+SGL +D    FL KE+         K+VYE H Y
Sbjct  214   VSLWYRYMQMGAEAVHAANPNVLVILSGLDFDNTLSFLFKEK--VHLSFSGKLVYEQHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
              F++G +  W     N VC  +   +  K  FL++ G   PLF SEFG +  G    DNR
Sbjct  272   GFSDGGN--WETQNQNDVCAMVVDFIWAKGLFLLQQG--WPLFFSEFGFDMSGTHIGDNR  327

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +L C LS  A++DLDWS+WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  L
Sbjct  328   YLTCFLSVAAEMDLDWSIWALQGSYYIREGILAYDESYGLLSWDWCTARNPSFIKRINSL  387

Query  1303  QQKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             Q   Q P   +S+  Y +++HP SG C      ++        S          + +  +
Sbjct  388   QSPFQGPGLPNSQEPYNIIFHPQSGLCVLARSSKLLELGPCDESNAWNYTSAYNLVVKNT  447

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCLDFDSSYSPS-  1650
              +CL V        L T C+   S+ W+L SNS   + A    NG  +CLD     SP+ 
Sbjct  448   GQCLQVKSVGKNAKLGTDCSK-PSSKWNLISNSKMHVSAELTKNGTRVCLD----ASPAG  502

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
              I+T +C  L      +P++QWFK+I S+
Sbjct  503   AIITNQCKCLSVDPTCDPESQWFKVIVSS  531



>emb|CDY13613.1| BnaA06g33100D [Brassica napus]
Length=559

 Score =   378 bits (971),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 214/516 (41%), Positives = 309/516 (60%), Gaps = 32/516 (6%)
 Frame = +1

Query  232   RWIMDD-QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +W  HLE  + EGL ++PL  I   + +MGFNCVRLTW  Y+
Sbjct  33    RWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCVRLTWPLYL  92

Query  409   FTRYAN---MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T  +    MTV QS   LGL EAISG  +NNP +L L L+ A + VV  +G+H +M++L
Sbjct  93    ATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLGKHRLMVIL  152

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD-TPMVVGVSLRNELRGP  756
             DNH+S+P WCC D+DGN FFG  Y +P  W++GL  +A +F + +  VVG+SLRNELRGP
Sbjct  153   DNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGMSLRNELRGP  212

Query  757   LQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETH  936
              QN+  WYKY+ +GA+A+++ NPN+LVI+SGL+Y+ D  FL+++P ++   +K V +E H
Sbjct  213   KQNIKDWYKYMREGAEAVHSVNPNILVIVSGLNYETDLSFLRDKPFEVTFRRKLV-FEIH  271

Query  937   RYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEAD  1116
              Y F      +W    LNK+C   T  + +  GFL+  G   PLFVSEFGI+Q G++  D
Sbjct  272   WYGFWS----SWEGDNLNKICGRETENIMKMSGFLLEKG--FPLFVSEFGIDQRGNNVND  325

Query  1117  NRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLE  1296
             NR L C ++  ADLDLDW++W L GSYY+RE   G DETYG+   +W+++RN   L  + 
Sbjct  326   NRFLSCFMAVAADLDLDWALWTLAGSYYVREKTIGYDETYGVLDWSWSSIRNSTILQMIS  385

Query  1297  FLQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCS-------GASRCIQEA  1446
              +Q   + P  M + P  ++++HP +G C  R    Q+ +  C         + R +  A
Sbjct  386   SIQSPFRGPGLMETHPK-KIIFHPSTGLCIVRKSLFQLKLGSCDRSESFRLSSQRVLSLA  444

Query  1447  DGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLD  1626
             + K +       CL        + L    ++   + W L S S  QL++   NG  +CLD
Sbjct  445   EEKIL-------CLKAYERGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLD  497

Query  1627  FDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              DS    + I+T+ C  LE     +P++QWFK++ S
Sbjct  498   VDS--DSNNIVTKSCKCLEGDASCDPKSQWFKVVTS  531



>ref|XP_002298005.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
 gb|EEE82810.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
Length=535

 Score =   377 bits (969),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 197/506 (39%), Positives = 300/506 (59%), Gaps = 10/506 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D+++GERVKL CA+W  H+ PML EGLD++PL  IA+ +    +NC+R T++ +MF
Sbjct  33    RWLVDERTGERVKLHCANWPAHVFPMLAEGLDKQPLPFIASEIVKNNYNCIRFTFSIHMF  92

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN+T+ +SF  L L +A +G+  +NP +L + +  A +AVV+ +G +GIM+  DNH+
Sbjct  93    TRYANLTIEESFDRLNLKKAKAGVIKHNPFVLKMTVPQAYEAVVDVLGSYGIMIDADNHI  152

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P+WCC++ D N F    +FDP+EW++GL +VA  FK    ++ + LRNE RG  QN  
Sbjct  153   SEPIWCCSNDDENGFPNDPHFDPEEWIEGLKLVAQRFKGKSQLISIGLRNEPRGKNQNAT  212

Query  772   VWY-KYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF  948
             +W+  Y+ + A  ++ ANP++LVI SGL++  D  + K           K+++E H Y++
Sbjct  213   LWFDHYIMEAAAQVHQANPDVLVIASGLNFATDLTYFKNH-SLKSNFDNKLIFEGHSYSW  271

Query  949   TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
               G+   W+ G +NK C D    +    GF+  G N  PLF SEFGI++      D+R L
Sbjct  272   G-GKGNPWVDGSVNKACADKIGSLNNNLGFVTNGENAVPLFFSEFGIDRKQMPAGDDRFL  330

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
              C  ++ A+ DLDW +WALQGSYYLR+     +E +G+   +W  ++NP    +L  L+Q
Sbjct  331   SCFSTWAAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLEIDWDRVKNPEVERRLGLLKQ  390

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
              L DP S+ P   ++YHP SG C     D QI   +C G +R        P+ +  +  C
Sbjct  391   TLLDPKSTAPLNYIMYHPQSGACVGEGMDGQIRAGNCKGLTRWTHNGHEGPLELKRTGLC  450

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L  +G+ LP  L+  C+     TW   S S   LA+K   G  LCL  +  ++   I+T+
Sbjct  451   LKAIGDGLPPILTPDCS---QTTWKPISASKLHLASKDHRGEYLCLHLEPPFA-GNIVTK  506

Query  1666  K--CVGLEEGDMRNPQTQWFKLIASN  1737
             K  CVG +     NP +QWFKL+ +N
Sbjct  507   KCICVGDDPTCKDNPTSQWFKLVETN  532



>dbj|BAK05121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   378 bits (970),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 219/513 (43%), Positives = 309/513 (60%), Gaps = 21/513 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D + G+RVKLAC +W  HLEPML EGL +RP+  IA  V+ MGFNCVRLTW T++ 
Sbjct  42    RWVVD-EDGDRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAAMGFNCVRLTWPTFLV  100

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+++TV QSF  L LTE+++G+ +NNP ++ L L+DA KAVV  +G + +M++LDN
Sbjct  101   TNASYSSLTVEQSFQRLNLTESLAGIRANNPAVVDLKLIDAFKAVVSSLGENNVMVILDN  160

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC + DGN FFG  YF+PD W+ GL  +A +F   P VVG+SLRNELRGP QN
Sbjct  161   HVSKPGWCCDNADGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHVVGMSLRNELRGPRQN  220

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + WYKY+++GA+A++ ANP +LVI+SGLS+D D  FL  R        +K  +E H Y+
Sbjct  221   SNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFLNSR-QVSLSFARKAAFEVHWYS  279

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+ GQ   W  G  N+VC  I   +  +  +L+  G   P+F+SEFG++  G +  DNR+
Sbjct  280   FSNGQE--WASGNPNEVCARIGASVSRRALYLLDQG--WPVFLSEFGVDNRGGNANDNRY  335

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C  +  ADLDLDW++W LQGSYYLR+G    DE YG+    W++ RN   L +++ LQ
Sbjct  336   YGCAAAVAADLDLDWALWTLQGSYYLRQGVLDLDEVYGVLDRAWSSPRNHTALRRVQPLQ  395

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--RVVGDQIHMSDCSGASRC-IQEADGKPIHMIG  1473
             + L+ P  +E   Y +L+HP +G C   R     + +  C+           G+      
Sbjct  396   RPLRGPGYAEAAPYTVLFHPATGLCVLRRSPTQPLELGACANTEAWEYAPQQGRLALRDS  455

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKG------DNGLVLCLDFDS  1635
              L CL   G  LP+     C+D  S  W L S+S   +A           G +LCLD D+
Sbjct  456   PLMCLHAQGAGLPVRFGMPCDDDMSR-WRLVSDSKLHVAVNASSSGSGSGGGMLCLDVDA  514

Query  1636  SYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
                  +++T  C  L   +  +P+ QWFKL+ S
Sbjct  515   --DGQSVVTNPCRCLSADNSCDPENQWFKLVTS  545



>ref|XP_008437726.1| PREDICTED: uncharacterized protein LOC103483073 [Cucumis melo]
Length=517

 Score =   376 bits (966),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 199/506 (39%), Positives = 307/506 (61%), Gaps = 21/506 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL+C +   H + M+ +GLD+RPL  +A  + +  +NCVRLTW+ YMF
Sbjct  29    RWIVDSKTGQRVKLSCVNLVSHAQSMVAQGLDKRPLKDLANEIVSRDYNCVRLTWSVYMF  88

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+   T+      L + +  +G+  +NP +L++ +  A K VV+ +G  G+M+++DNH+
Sbjct  89    TRHPFETIGDVLDGLDINKVKNGVKKHNPQILNMTVTSAFKTVVDGLGNAGLMVIMDNHI  148

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC+ HDGN FFG   F P EWL+GLA           VVG+SLRNELRG   NVD
Sbjct  149   SQPRWCCSLHDGNGFFGDRNFKPIEWLRGLA----------FVVGMSLRNELRGS-NNVD  197

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
             VW KYV++G+  I+  NP LLV+ISGL+YD D  +LK++P     +  KVV E H Y+F+
Sbjct  198   VWRKYVKQGSHLIHRINPRLLVVISGLNYDNDLSYLKKKP-LGYNLHNKVVLEAHLYSFS  256

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                   ++K PLN  C+ +  + E + GF+V   NP PLF+SEFG +  G ++A NR + 
Sbjct  257   GEPESKFVKKPLNIACNQVMDKFEREAGFVVDMKNPYPLFLSEFGYDLRGVNKAQNRFMS  316

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C L+ +   D++W+ WA QGSY  R+G+   DE++G+  + WT  R+P     L+  ++ 
Sbjct  317   CFLARIIGKDIEWAYWAFQGSYMYRQGQQDVDESFGIMDSTWTKDRSPRLQQMLKLAKRI  376

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
              QDP S  P   ++ HP+SG+C ++ G   I + DC   +      DG P+ +    +CL
Sbjct  377   NQDPNSKAPLSYIMLHPVSGQCVQLDGKGGIELGDCEKPTLWDHTGDGSPMKLSNG-QCL  435

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRK  1668
                G+  P  +S  C+ G  ++W++AS +  QLA K   G  +CL+ +S    ++I+ +K
Sbjct  436   KSAGDGKPPVVSAECS-GDGSSWTVASKAKLQLATKS-GGEKICLEKESD---TSIVVKK  490

Query  1669  CVGLEE--GDMRNPQTQWFKLIASNT  1740
             C+ L++      +PQ QWFKL+ +N 
Sbjct  491   CICLKDEWNCFDDPQPQWFKLVPTNV  516



>ref|XP_010502521.1| PREDICTED: uncharacterized protein LOC104779823 [Camelina sativa]
Length=558

 Score =   377 bits (968),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 213/516 (41%), Positives = 313/516 (61%), Gaps = 30/516 (6%)
 Frame = +1

Query  232   RWIMDD--QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATY  405
             RWI+DD    G RVKL C +W  HLE  + EGL ++PL  IA  + +MGFNCVRLTW  Y
Sbjct  31    RWIVDDGINKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIAEMIVSMGFNCVRLTWPLY  90

Query  406   MFT--RYANMTVV-QSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMV  576
             + T   ++++T V QS   L L +A+SG   +NP +L L L+ A + VV  +G+H +M++
Sbjct  91    LATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEVVSCLGKHKVMVI  150

Query  577   LDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD--TPMVVGVSLRNELR  750
             LDNH+S+P WCC+D+DGN FFG  + +P  W++GL  +A++F +  +  VVG+SLRNELR
Sbjct  151   LDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSSNVVGMSLRNELR  210

Query  751   GPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYE  930
             GP QN   WY Y+ KGA+A+++ NPN+LVI+SGL+Y  D  FL++RP ++   +K V +E
Sbjct  211   GPKQNTKDWYTYMRKGAEAVHSVNPNVLVIVSGLNYATDLSFLRDRPFEVSFRRKLV-FE  269

Query  931   THRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSE  1110
              H Y F      +W    LNK+C   T ++ +  GFL++ G P  LFVSEFG++Q G++ 
Sbjct  270   IHWYGFWS----SWEGDNLNKICGRETEKIMKMSGFLLKKGIP--LFVSEFGVDQRGNNV  323

Query  1111  ADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSK  1290
              DN+ L C ++  ADLDLDW++W L GSYY+R    G DETYG+   NW  +RN   L  
Sbjct  324   NDNKFLSCFMALAADLDLDWALWTLAGSYYIRGKTIGSDETYGVLDWNWLNVRNSTILQM  383

Query  1291  LEFLQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPI  1461
             +  +Q     P  M ++P  ++++HPLSG C  R    ++ +  C  +     E+     
Sbjct  384   VSAIQTPFTGPGLMETQPK-KIMFHPLSGLCIVRKPLFRLKLGSCKRS-----ESWRLSS  437

Query  1462  HMIGSLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLD  1626
             H + SL      CL    +  P+ L     + Q + W L S+S  QL++   NG  +CLD
Sbjct  438   HRVLSLAEERILCLKAYEKGNPVKLRLFFTEFQCSKWRLLSDSKMQLSSITKNGAFVCLD  497

Query  1627  FDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              DS    + I+TR+C  L+     +P++QWFKL+ S
Sbjct  498   VDS--RSNKIVTRRCKCLQGNSSCDPRSQWFKLVTS  531



>ref|XP_006652422.1| PREDICTED: uncharacterized protein LOC102702088, partial [Oryza 
brachyantha]
Length=529

 Score =   375 bits (964),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 225/513 (44%), Positives = 308/513 (60%), Gaps = 26/513 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACA+WA HLEP   EGL RR +  IA  V+ MGFNCVRLTW TY+ 
Sbjct  8     RWVVGGADGRRVKLACANWASHLEPAAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTYLA  67

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    AN+ +  S   LG+ E+ +G+  NNP LL L L+D  K VV  +GR+ IM++LDN
Sbjct  68    TNATLANLPLRWSLELLGMRESAAGVRVNNPQLLDLPLIDVFKEVVSALGRNNIMVILDN  127

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG  YFDPDEWL GL+ +A +F++T  VVG+SLRNELRG  QN
Sbjct  128   QMTTPGWCCSQRDGNGFFGDTYFDPDEWLSGLSTMATMFRNTKNVVGMSLRNELRGDKQN  187

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYD--LDFRFLKERPlklkmmkkkvvYETHR  939
             V +W++Y+++GA+ ++ ANP +LVI+SGL +D  LDF F K+          K+VYE H 
Sbjct  188   VTLWFRYMQQGAEVVHAANPGVLVILSGLEFDNTLDFLFSKK---VQLSFTGKLVYEQHW  244

Query  940   YAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
             Y F++G +  W     N VC  +   ++ K  FL++ G   PLF SEFG +  G   ADN
Sbjct  245   YGFSDGGN--WGSQNQNDVCGMVVGFIKYKGLFLLQQG--WPLFFSEFGFDMSGAHVADN  300

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R+L C LS  A++DLDW++WALQGSYY+REG    DE+YG+ + +W+A RNP+F+ ++  
Sbjct  301   RYLTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWSATRNPSFIKRINS  360

Query  1300  LQQKLQD---PMSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHM  1467
             LQ   Q    P S EP Y +++HPL+G C  V   + + +  C   S          + +
Sbjct  361   LQSPFQGPGLPNSKEP-YNVIFHPLTGLCLVVKSSEALELGPCD-ESNAWSYTSTNQLVL  418

Query  1468  IGSLKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNS-MFQLANKGDNGLVLCLDFDSS  1638
               + +CL    VGE+    L T C+   S  W L S S M   A    NG  +CLD   +
Sbjct  419   KHTGQCLQAKSVGEN--AKLGTDCSK-SSAKWQLISYSGMHVSAELTKNGTRVCLD---A  472

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
                 TI T  C  L      NP++QWFK+I S+
Sbjct  473   TPDGTIETNLCECLTLDPNCNPESQWFKIILSS  505



>ref|XP_009152076.1| PREDICTED: uncharacterized protein LOC103875318 [Brassica rapa]
Length=559

 Score =   376 bits (966),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 213/516 (41%), Positives = 309/516 (60%), Gaps = 32/516 (6%)
 Frame = +1

Query  232   RWIMDD-QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +W  HLE  + EGL ++PL  I   + +MGFNCVRLTW  Y+
Sbjct  33    RWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCVRLTWPLYL  92

Query  409   FTRYAN---MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T  +    MTV QS   LGL EAISG  +NNP +L L L+ A + VV  +G+H +M++L
Sbjct  93    ATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLGKHRLMVIL  152

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD-TPMVVGVSLRNELRGP  756
             DNH+S+P WCC D+DGN FFG  Y +P  W++GL  +A +F + +  VVG+SLRNELRGP
Sbjct  153   DNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGMSLRNELRGP  212

Query  757   LQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETH  936
              QN+  WYKY+ +GA+A+++ NPN+LVI+SGL+Y+ D  FL+++P ++   +K V +E H
Sbjct  213   KQNIKDWYKYMREGAEAVHSVNPNILVIVSGLNYETDLSFLRDKPFEVTFRRKLV-FEIH  271

Query  937   RYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEAD  1116
              Y F      +W    LNK+C   T  + +  GFL+  G   PL VSEFGI+Q G++  D
Sbjct  272   WYGFWS----SWEGDNLNKICGRETENIMKMSGFLLEKG--FPLLVSEFGIDQRGNNVND  325

Query  1117  NRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLE  1296
             NR L C ++  ADLDLDW++W L GSYY+RE   G DETYG+   +W+++RN   L  + 
Sbjct  326   NRFLSCFMALAADLDLDWALWTLAGSYYVREKTIGYDETYGVLDWSWSSIRNSTILQMIS  385

Query  1297  FLQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCS-------GASRCIQEA  1446
              +Q   + P  M + P  ++++HP +G C  R    Q+ +  C         + R +  A
Sbjct  386   SIQSPFRGPGLMETHPK-KIIFHPSTGLCIVRKSLFQLKLGSCDRSESFRLSSQRVLSLA  444

Query  1447  DGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLD  1626
             + K +       CL    +   + L    ++   + W L S S  QL++   NG  +CLD
Sbjct  445   EEKIL-------CLKAYEKGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLD  497

Query  1627  FDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              DS    + I+T+ C  LE     +P++QWFK++ S
Sbjct  498   VDS--DSNNIVTKSCKCLEGDASCDPKSQWFKVVTS  531



>gb|EAY86525.1| hypothetical protein OsI_07905 [Oryza sativa Indica Group]
Length=582

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 216/537 (40%), Positives = 312/537 (58%), Gaps = 41/537 (8%)
 Frame = +1

Query  232   RWIMDDQSG-ERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD++G  RVKLAC +W  HLEP++ EGL  +P+  I+  V+++GFNCVRLT+   +
Sbjct  32    RWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVASLGFNCVRLTYPIAL  91

Query  409   FTR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
              T    +++TV +S    GL  A++G+ +NNP LL L L+++ +AVV+ +G  G+M++LD
Sbjct  92    ATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRAVVDSLGESGVMVILD  151

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHVS+P WCCAD DGN FFG  +F PD W++GL  +A +F   P VVG+SLRNELRGP Q
Sbjct  152   NHVSRPGWCCADDDGNGFFGDRHFVPDAWVRGLGAMAALFAGVPNVVGMSLRNELRGPRQ  211

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERP---lklkmmkkkvvYET  933
             N D WY+Y++ GA+A++ ANP  LVI+ GL YD D  FL  RP         + K+V+E 
Sbjct  212   NADDWYRYMQMGAEAVHAANPAALVIMGGLGYDTDLSFLAARPVDVSFAAAERGKLVFEL  271

Query  934   HRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEA  1113
             H Y+F +  ++AW     N+VC  + R +  + GFL+  G   PLF+SEFG +  G S  
Sbjct  272   HWYSFAD--ARAWESEDANEVCGRVARGVARRGGFLLDAGF--PLFLSEFGADTRGGSRK  327

Query  1114  DNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKL  1293
             D+R+LPC  +  A+LDLDW++WALQGSY LR+G  G DE YG+   +W+  RN   LS++
Sbjct  328   DDRYLPCAAAVAAELDLDWALWALQGSYALRQGVAGADEVYGVLDWSWSKPRNATALSRI  387

Query  1294  EFLQQKLQDPMSSEPT-YQLLYHPLSGRCA--------RVVGDQIHMSDCSGASRCIQEA  1446
             + LQ+ L+ P   E   Y +L+HPL+GRC               + +  C          
Sbjct  388   QSLQRPLRGPGYDEARPYTVLFHPLTGRCVVRRAADDAAAAAATLELGRCEDTDAWAYTQ  447

Query  1447  DGKPIHMIGSLK-----CLAVVGEDLPLTLSTI----CNDGQSNTWSLASNSMFQLA---  1590
                 + M G+ +     CL   G   P  L+T     C     +TW L S S   +A   
Sbjct  448   PASTLAMRGAGRGSPPLCLRAEGSGRPARLATSDAGGCRGDALSTWRLVSGSTMHVAVNA  507

Query  1591  ------NKGDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMR--NPQTQWFKLIASN  1737
                   ++   G +LCLD        +++T  C  L++      +P+TQWFKL+ S 
Sbjct  508   TTTTTPSRDGGGGLLCLDVGD--DGRSVVTNPCRCLDDAAAGECDPETQWFKLVTST  562



>ref|NP_189244.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AEE77124.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=551

 Score =   375 bits (964),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 211/512 (41%), Positives = 307/512 (60%), Gaps = 26/512 (5%)
 Frame = +1

Query  232   RWIMDD-QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +W  HLE  + EGL ++PL  IA  + +MGFNCVRLTW  Y+
Sbjct  28    RWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGFNCVRLTWPLYL  87

Query  409   FTR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T     A MTV QS     L EA+SG  ++NP +L L L+ A + VV  + +H +M++L
Sbjct  88    ATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVYCLEKHRVMVIL  147

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD-TPMVVGVSLRNELRGP  756
             DNH+S+P WCC+D+DGN FFG  + +P  W++GL  +A++F + +  VVG+SLRNELRGP
Sbjct  148   DNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVVGMSLRNELRGP  207

Query  757   LQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETH  936
              QN+  WYKY+ +GA+A+++ NPN+LVI+SGL+Y  D  FL+ERP ++   +K V +E H
Sbjct  208   KQNIKDWYKYMREGAEAVHSVNPNVLVIVSGLNYATDLSFLRERPFEVSFRRKVV-FEIH  266

Query  937   RYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEAD  1116
              Y F       W    LNK+C   T +M +  GFL+  G   PLFVSEFGI+Q G++  D
Sbjct  267   WYGFWN----TWEGDNLNKICGKETEKMMKMSGFLLEKG--IPLFVSEFGIDQRGNNAND  320

Query  1117  NRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLE  1296
             N+ L C ++  AD DLDWS+W L GSYY+RE   G DE+YG+   NW+++RN   L  + 
Sbjct  321   NKFLSCFMALAADRDLDWSLWTLAGSYYIREKSIGSDESYGVLDFNWSSIRNSTILQMIS  380

Query  1297  FLQQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
              +Q      M ++P  ++++HP +G C  R    Q+ +  C+ +     E+     H + 
Sbjct  381   AIQTPFIGLMETQPK-KIMFHPSTGLCIVRKSLFQLKLGSCNRS-----ESWRLSSHRVL  434

Query  1474  SLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
             SL      CL    +   + L    ++   + W L S+S  QL++   NG  +CLD D+ 
Sbjct  435   SLAEEQILCLKAYEKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSITKNGFSVCLDVDT-  493

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
                + I+T  C  L      +P++QWFKL+ S
Sbjct  494   -ENNNIVTNSCKCLRGNSSCDPRSQWFKLVTS  524



>gb|AIZ06017.1| hypothetical protein [Zea nicaraguensis]
Length=555

 Score =   375 bits (964),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 218/509 (43%), Positives = 304/509 (60%), Gaps = 19/509 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+    G RVKLACA+WA HLEP   EGL RRP+S IA  V+ MGFNCVRLTW TY+ 
Sbjct  34    RWIVG-VDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRLTWPTYLV  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++ +  S   LG+ E+++G+  NNP LL L L+D  + VV  + R GIM++LDN
Sbjct  93    TNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKGIMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG VYFDP+EWL+GL+ +A +F +T  VVG+SLRNELRGP QN
Sbjct  153   QMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGMSLRNELRGPKQN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRF-LKERPlklkmmkkkvvYETHRY  942
             V +WY+Y++ GA+A++ ANPN+L+I+SGL +D    F LKE+         K+VYE H Y
Sbjct  213   VSLWYRYMQLGAEAVHAANPNVLIILSGLDFDNTLSFLLKEK--VRLSFSGKLVYEQHWY  270

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
              F++G +  W     N VC  +   +  K  FL++ G   PLF SEFG +  G    DNR
Sbjct  271   GFSDGGN--WETQNQNDVCGMVVDFIWAKGLFLLQQG--WPLFFSEFGFDMSGTHIGDNR  326

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +L C LS  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP F+ ++  L
Sbjct  327   YLTCFLSVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWCTARNPGFIKRINSL  386

Query  1303  QQKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             Q   Q P   +++  Y +++HP SG C      ++      G S          + +  +
Sbjct  387   QSVFQGPGLPNTQQPYYIIFHPQSGLCVLARSSKLLELGPCGESNAWNYTSAYELVVKST  446

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCLDFDSSYSP-S  1650
              +CL          L T C++  S+ W L S+S   L A    NG  +CL+     SP  
Sbjct  447   GQCLQAQSVGKNAKLGTDCSE-PSSKWHLISDSKMHLSAELAKNGTRVCLE----ASPDG  501

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
              I T +C  L      +P++QWFK+I S+
Sbjct  502   AIRTNQCKCLSVDPTCDPESQWFKVILSS  530



>ref|XP_002876947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   375 bits (963),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 213/515 (41%), Positives = 311/515 (60%), Gaps = 32/515 (6%)
 Frame = +1

Query  232   RWIMDD-QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +W  HLE  + EGL ++ L  IA  + +MGFNCVRLTW  Y+
Sbjct  28    RWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQSLDSIAEKIVSMGFNCVRLTWPLYL  87

Query  409   FTRYAN---MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T  +    MTV QS     L EA+SG  ++NP +L L L+ A + VV  +G+H +M++L
Sbjct  88    ATDESFSDIMTVRQSLRKFRLLEAVSGFQTHNPTILDLPLIKAFQEVVSCLGKHRVMVIL  147

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD-TPMVVGVSLRNELRGP  756
             DNH+S+P WCC+D+DGN FFG  + +P  W++GL  +A++F + +  VVG+ LRNELRGP
Sbjct  148   DNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVVGMCLRNELRGP  207

Query  757   LQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETH  936
              QN+  WY Y+ KGA+A+++ NP++LVI+SGL+Y  D  FL++RP ++   +K V +E H
Sbjct  208   KQNIKDWYTYMRKGAEAVHSMNPDVLVIVSGLNYATDLSFLRDRPFEVSFRRKLV-FEIH  266

Query  937   RYAF---TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDS  1107
              Y F    EG +       LNK+C   T +M +  GFL+  G   PLFVSEFGI+Q G++
Sbjct  267   WYGFWNSLEGDN-------LNKICGKETEKMMKMSGFLLEKG--VPLFVSEFGIDQRGNN  317

Query  1108  EADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLS  1287
               DN+ L C ++  ADLDLDWS+W L GSYY+RE   G DETYG+   NW+++RN   L 
Sbjct  318   ANDNKFLSCFMALAADLDLDWSLWTLAGSYYIREKTIGTDETYGVLDWNWSSIRNSTILQ  377

Query  1288  KLEFLQQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIH  1464
              +  +Q   Q  M ++P  ++++HP +G C  R    Q+ +  C+ +     E+     H
Sbjct  378   MISAIQSPFQGLMETQPK-KIMFHPSTGLCIVRKSLFQLKLGSCNRS-----ESWKLSSH  431

Query  1465  MIGSLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDF  1629
              + SL      CL    +   + L    +D   + W L S+S  QL++   NG+ +CLD 
Sbjct  432   RVLSLTEEKILCLKAYEDGKSVKLRLFFSDSYCSKWKLLSDSKMQLSSITKNGVSICLDV  491

Query  1630  DSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             DS  + + I+T  C  L      +P++QWFKL+ S
Sbjct  492   DS--NNNNIVTNSCKCLLGNSSCDPRSQWFKLVTS  524



>ref|XP_007159684.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
 gb|ESW31678.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
Length=573

 Score =   376 bits (965),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 216/506 (43%), Positives = 326/506 (64%), Gaps = 16/506 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+  Q G RVKLAC +W  HLE  +PEGL ++P+  I+  + +MGFNCVRLTW T + 
Sbjct  52    RWIVG-QDGRRVKLACVNWVSHLEVAVPEGLSKKPVDVISKGIKSMGFNCVRLTWPTLLV  110

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A+++V  SF  LGL E ++G+ +NNP+++ L L+ A +A+V+ +G + +M++LDN
Sbjct  111   TNDSLASLSVRSSFQKLGLLEPVAGVQTNNPSIIDLPLIQAFEAMVKNLGDNDVMVILDN  170

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+++P WCC + DGN FF   +F+PD+W+ GL  +A +FK    VVG+SLRNELRG  QN
Sbjct  171   HLTQPGWCCGNTDGNGFFTDKFFNPDQWISGLTKMATLFKGVKTVVGMSLRNELRGSKQN  230

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+ KGA+A++ AN ++LVI+SGL++D D  F+++RP      K K+V+E HRY 
Sbjct  231   VNDWYKYMVKGAEAVHAANSDVLVILSGLNFDTDLSFIRDRP-VSVTFKGKLVFEVHRYG  289

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW  G  N+VC  +T  +++   +L+  G   PLFVSEFG +  G +  DNR+
Sbjct  290   FTDGQ--AWGDGNPNEVCGKVTETIKKTSAYLLDQG--WPLFVSEFGGDLRGTNVNDNRY  345

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+ LA+LDLDW+ W L GSYY+REG  G +E YG+ T +W  +R+ +FL+++  LQ
Sbjct  346   LTCFLALLAELDLDWAYWTLVGSYYIREGVVGMEEVYGVLTWDWNQVRSISFLNRISALQ  405

Query  1306  QKLQDPMSSE-PTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E  +Y+L++HP++G C   +   + + +  CS +S   +    K + +  +
Sbjct  406   HPFRGPGIIEGNSYKLMFHPVTGLCVIRKSQVNTLTLGPCS-SSDGWKYTSQKSLLVNDT  464

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               C+    E  P TLST C+D  S+ W + S+S   L++K  +G  +CLD D+    + I
Sbjct  465   NLCIHGERERKPATLSTACSD-SSSKWEVISDSNMHLSSKLSDGSNVCLDVDAD---NII  520

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L + +  +P TQWFKLI S
Sbjct  521   VTNTCKCLSKDNKCDPGTQWFKLIDS  546



>ref|XP_006307168.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
 gb|EOA40066.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
Length=552

 Score =   375 bits (962),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 206/505 (41%), Positives = 303/505 (60%), Gaps = 13/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKL C +W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVDEK-GQRVKLVCVNWPSHLQPIVAEGLSKQPVDALAKKIVDMGFNCVRLTWPLDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + I G  +NNP+++ L+L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGNNDVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCC ++DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCDNNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN N+LVI+SGLS+D D  F++ RP        K+V+E H Y
Sbjct  219   NVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDCDLSFVRSRP-VKVSFTGKLVFELHWY  277

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G S  W     N +C  +   +    GFL+  G   PLF+SEFGI++ G +  D+R
Sbjct  278   SFSDGNS--WATNNPNDICGRVLNRIGNGGGFLLNQG--FPLFLSEFGIDERGGNANDDR  333

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A+ DLDWS+WAL GSYYLR+G  G +E YG+   +W ++RN +FL KL  L
Sbjct  334   YFGCLTGWAAEHDLDWSLWALTGSYYLRQGVVGLNEYYGVLDKDWISVRNSSFLQKLSLL  393

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  R + D   ++     S        K I +    
Sbjct  394   QSPLQGPHPQTDAYNLVFHPLTGLCIVRSLKDTTMLTLGPCNSSEPWSYTKKAIRIKDQP  453

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G   P+TL+       S+ W   S S   L++   N   LCLD D++   + ++
Sbjct  454   LCLQSNGPKNPVTLTRTSCSTSSSIWQTVSASRMHLSSTTSNKTSLCLDVDAT---NNVV  510

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWFK+I +
Sbjct  511   ANACKCLSKDSTCEPMSQWFKIIKA  535



>ref|XP_006290844.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
 gb|EOA23742.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
Length=554

 Score =   375 bits (962),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 210/516 (41%), Positives = 310/516 (60%), Gaps = 30/516 (6%)
 Frame = +1

Query  232   RWIMDD-QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +W  HLE  + EGL ++P+  IA  + +MGFNCVRLTW  Y+
Sbjct  29    RWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPMDSIAEKIVSMGFNCVRLTWPLYL  88

Query  409   FTRYAN---MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T  +    MTV QS    GL EA+SG   +NP +L L L+ A + VV  +G+H +M++L
Sbjct  89    ATDESFSDIMTVRQSLLKFGLFEAVSGFQVHNPTVLDLPLIKAFQEVVACLGKHRVMVIL  148

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD--TPMVVGVSLRNELRG  753
             DNH+S+P WCC+D+DGN FFG  + +P  W++GL  +A++F    +  VVG+SLRNELRG
Sbjct  149   DNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFASNVSSNVVGMSLRNELRG  208

Query  754   PLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYET  933
             P QN+  WY Y++KGA+A+++ NP++LVI+SGL+Y  D  FL+++P ++   +K V +E 
Sbjct  209   PKQNIKDWYMYMKKGAEAVHSINPDVLVIVSGLNYATDLSFLRDKPFEVSFRRKLV-FEI  267

Query  934   HRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEA  1113
             H Y F      +W    LNK+C   T  + +  GFL+  G   PLFVSEFGI+Q G +  
Sbjct  268   HWYGFWN----SWEGDSLNKICGRETENLMKMSGFLLEKG--FPLFVSEFGIDQRGSNAN  321

Query  1114  DNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKL  1293
             DN+ L C ++  ADLD+DW++W L GSYY+R+   G DETYG+   +W+++RN   L  +
Sbjct  322   DNKFLSCFMALAADLDVDWALWTLAGSYYIRDKTIGSDETYGVLDWDWSSIRNSTILQMI  381

Query  1294  EFLQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIH  1464
               +Q     P  M ++P  ++++HP SG C  R    Q+ +  C+ +     E+     H
Sbjct  382   SAIQTPFTGPGLMETQPK-KIMFHPSSGLCIVRKSLFQLKLGSCNRS-----ESWKLSSH  435

Query  1465  MIGSLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDF  1629
              + SL      CL    +   + L    +D   + W L S+S  QL +   NG ++CLD 
Sbjct  436   QVLSLTEERILCLKAYEKGKAVKLRLFFSDFHCSKWKLLSDSKMQLLSVTKNGTIVCLDV  495

Query  1630  DSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             DS    S I+ R C  L+     +P++QWFKL+ S+
Sbjct  496   DSY---SKIVMRSCKCLQGNSSCDPRSQWFKLVTSS  528



>ref|XP_011026965.1| PREDICTED: uncharacterized protein LOC105127394 [Populus euphratica]
Length=535

 Score =   374 bits (960),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 196/506 (39%), Positives = 298/506 (59%), Gaps = 10/506 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D+++GERVKL CA+W  H+ PML EGLD++PL  IA+ +    +NC+R T++ +MF
Sbjct  33    RWLVDERTGERVKLHCANWPAHVFPMLAEGLDKQPLPFIASEIVKNNYNCIRFTFSIHMF  92

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN+T+ +SF  L L +A +G+  +NP +L + +  A +AVV+ +G +GIM+  DNH+
Sbjct  93    TRYANLTIEESFDRLNLKKAKAGVIKHNPFVLKMTVPQAYEAVVDVLGSYGIMIDADNHI  152

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P+WCC++ D N F    +FDP+EW++GL +VA  FK    ++ + LRNE RG  QN  
Sbjct  153   SEPIWCCSNDDENGFPNDPHFDPEEWIEGLKLVAQRFKGKTQLISIGLRNEPRGKNQNAT  212

Query  772   VWY-KYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF  948
             +W+  Y+ + A  ++ ANP++LV+ SGL++  D  + K           K+++E H Y++
Sbjct  213   LWFDHYIMEAAAQVHQANPDVLVVASGLNFATDLTYFKNH-SLKSNFDNKLIFEGHSYSW  271

Query  949   TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
               G+   W+ G +NK C D    +     F+  G N  PLF SEFGI++      D+R L
Sbjct  272   G-GKGNPWVDGSVNKACADKIGSLNNNLAFVTDGENAVPLFFSEFGIDRKQMPAGDDRFL  330

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
              C  ++ A+ DLDW +WALQGSYYLR+     +E +G+   +W  ++NP    +L  L+Q
Sbjct  331   SCFSTWAAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLEIDWDRVKNPAVERRLGLLKQ  390

Query  1309  KLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKC  1485
              L DP S  P   ++YHP SG C     D QI   +C G +R        P+ + G+  C
Sbjct  391   TLLDPKSMAPLNYIMYHPQSGACVGEGMDGQIRAGNCKGLTRWTHNGHEGPLELKGTGLC  450

Query  1486  LAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTR  1665
             L  +G+ LP  L+  C+     TW   S S   LA+K   G  LCL     ++   I+T+
Sbjct  451   LKAIGDGLPPILTPDCS---QTTWKPISASKLHLASKDHKGEYLCLHLAPPFA-GNIVTK  506

Query  1666  K--CVGLEEGDMRNPQTQWFKLIASN  1737
             K  CVG +     NP +QWFKL+ +N
Sbjct  507   KCICVGDDPTCKDNPTSQWFKLVETN  532



>ref|XP_006417151.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
 gb|ESQ35504.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
Length=561

 Score =   375 bits (962),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 201/505 (40%), Positives = 300/505 (59%), Gaps = 13/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVD-ENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWPLDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF   GL + I G  +NNP+++ L+L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGNNDVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA++DGN FFG  +FDP  W   L+ +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCANNDGNGFFGDRFFDPTVWTAALSKMATTFDGVTNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN N+LV++SGLS+D D  F++ RP        K+V+E H Y
Sbjct  219   NVNDWFKYMQQGAEAVHSANKNVLVVLSGLSFDADLSFVRSRP-VKLSFTGKLVFELHWY  277

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT+G S  W     N +C  +   +    GFL+  G   PLF+SEFG+++ G +  D+R
Sbjct  278   SFTDGNS--WTTNNPNDICGRVLNRIGNNGGFLLNKG--FPLFLSEFGVDERGQNANDDR  333

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A+ D+DWS+WAL GSYYLR+G  G  E YG   ++W ++RN +FL K+  L
Sbjct  334   YFGCLSGWAAENDVDWSLWALTGSYYLRQGVVGMIEYYGALDSDWISVRNSSFLQKISLL  393

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  R + D   ++     S        K + +   L
Sbjct  394   QSPLQGPGPRTDAYNLVFHPLTGLCVVRSLKDTTMLTLGPCNSSQPWSYTKKTLRIKDQL  453

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G    +T++        + W   S S   LA    N   +CLD D++   + ++
Sbjct  454   LCLQSNGPKNRVTMTRTSCSKPGSIWQTISASRMHLAATTSNKTSICLDVDAT---NNVV  510

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L       P +QWFK+I +
Sbjct  511   ANACKCLSNDSSCEPMSQWFKIIKA  535



>dbj|BAB02432.1| unnamed protein product [Arabidopsis thaliana]
Length=561

 Score =   374 bits (960),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 212/514 (41%), Positives = 308/514 (60%), Gaps = 28/514 (5%)
 Frame = +1

Query  232   RWIMDD-QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD   G RVKL C +W  HLE  + EGL ++PL  IA  + +MGFNCVRLTW  Y+
Sbjct  36    RWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGFNCVRLTWPLYL  95

Query  409   FTR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T     A MTV QS     L EA+SG  ++NP +L L L+ A + VV  + +H +M++L
Sbjct  96    ATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVYCLEKHRVMVIL  155

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD-TPMVVGVSLRNELRGP  756
             DNH+S+P WCC+D+DGN FFG  + +P  W++GL  +A++F + +  VVG+SLRNELRGP
Sbjct  156   DNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVVGMSLRNELRGP  215

Query  757   LQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETH  936
              QN+  WYKY+ +GA+A+++ NPN+LVI+SGL+Y  D  FL+ERP ++   +K V +E H
Sbjct  216   KQNIKDWYKYMREGAEAVHSVNPNVLVIVSGLNYATDLSFLRERPFEVSFRRKVV-FEIH  274

Query  937   RYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEAD  1116
              Y F       W    LNK+C   T +M +  GFL+  G   PLFVSEFGI+Q G++  D
Sbjct  275   WYGFWN----TWEGDNLNKICGKETEKMMKMSGFLLEKG--IPLFVSEFGIDQRGNNAND  328

Query  1117  NRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLE  1296
             N+ L C ++  AD DLDWS+W L GSYY+RE   G DE+YG+   NW+++RN   L  + 
Sbjct  329   NKFLSCFMALAADRDLDWSLWTLAGSYYIREKSIGSDESYGVLDFNWSSIRNSTILQMIS  388

Query  1297  FLQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
              +Q     P  M ++P  ++++HP +G C  R    Q+ +  C+ +     E+     H 
Sbjct  389   AIQTPFIGPGLMETQPK-KIMFHPSTGLCIVRKSLFQLKLGSCNRS-----ESWRLSSHR  442

Query  1468  IGSLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFD  1632
             + SL      CL    +   + L    ++   + W L S+S  QL++   NG  +CLD D
Sbjct  443   VLSLAEEQILCLKAYEKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSITKNGFSVCLDVD  502

Query  1633  SSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +    + I+T  C  L      +P++QWFKL+ S
Sbjct  503   T--ENNNIVTNSCKCLRGNSSCDPRSQWFKLVTS  534



>ref|XP_008793758.1| PREDICTED: uncharacterized protein LOC103709981 [Phoenix dactylifera]
Length=549

 Score =   374 bits (959),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 219/508 (43%), Positives = 311/508 (61%), Gaps = 18/508 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKLAC +WA HLE    EGL ++PL  I+  V  +GFNCVRLTW  Y+ 
Sbjct  36    RWIVDG-NGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISRRVVALGFNCVRLTWPLYLL  94

Query  412   TRYA--NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  +  ++ +  S   LGL E+ + +A NNP LL L L+ A +AVV  +  + IM++LDN
Sbjct  95    TNASLGSLPLRASLAGLGLLESAAAVAVNNPALLDLPLLQAFQAVVSNLASNNIMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              +SKP WCC+  D N FFG  YFDPDEWL+GL ++A +F  +  VVG+SLRNELRGP QN
Sbjct  155   QISKPGWCCSKFDENGFFGDKYFDPDEWLRGLTMMATMFNSSANVVGMSLRNELRGPKQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             + +WY+Y++ GA+A++ ANP+LL+I+SGL YD D  FL E+         KVV+E H Y 
Sbjct  215   ISLWYRYMQIGAEAVHAANPDLLIILSGLDYDKDLSFLSEK-QVKLTFTDKVVFELHWYG  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G    W  G  N+VC  +   M +  GFL+  G   PLF+SEFG++Q G + ADNR 
Sbjct  274   FSDGGD--WENGNPNEVCGSVVDNMTKNGGFLLEQG--WPLFLSEFGVDQSGRNMADNRF  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A+LDLDW++WALQGSYY+REG+ G DETYG+   +W   RN +F++++  LQ
Sbjct  330   LSCFLSVAAELDLDWALWALQGSYYIREGQLGYDETYGVLGWDWCKARNSSFVNRIAALQ  389

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA---RVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
                Q P +S+   Y +++HPL+G C        + + +  C+ +      A+ + + + G
Sbjct  390   APFQGPGLSNNSPYDIIFHPLTGLCVVKKSSSKNLLELGLCANSEAWNYTAE-QNVMLEG  448

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANK-GDNGLVLCLDFDSSYSPS  1650
             +  C+   G      L T C  G ++ W L S+S   +++K   NG  +CLD        
Sbjct  449   TKYCMLAKGAGRRARLGTGCG-GSNSIWELISDSRMHVSSKLPKNGSTVCLDISQD---G  504

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             TI+T  C  L +    NP +QWFK+I S
Sbjct  505   TIITNLCKCLSQDGTCNPDSQWFKIIRS  532



>ref|XP_010495004.1| PREDICTED: uncharacterized protein LOC104772051 [Camelina sativa]
Length=550

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 202/505 (40%), Positives = 308/505 (61%), Gaps = 12/505 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKL CA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVDEK-GQRVKLTCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWPLELM  98

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + I G  +NNP+++ ++L++A K VV  +G + +M++LD
Sbjct  99    TNDTLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDISLIEAYKTVVTTLGNNNVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA++DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCANNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN N+LVI+SGLS+D D  F++ RP        K+V+E H Y
Sbjct  219   NVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDSDLSFVRSRP-VKLSFTGKLVFELHWY  277

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G S  W     N +C  +   +    G+L+  G   PLF+SEFGI++ G +  D+R
Sbjct  278   SFSDGNS--WATNNPNDMCGRVLNRIGNGGGYLLNQG--FPLFLSEFGIDERGGNANDDR  333

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+  + A+ DLDWS+WAL GSYYLR+G  G  E YG+  ++W ++RN +FL K+  L
Sbjct  334   YIECLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLL  393

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  + + D+  ++     S        K + +    
Sbjct  394   QSPLQGPGPRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPCNSSEPWSYTKKALRIKDRP  453

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G + P+T++       S+ W   S S   L++   N   LCLD D++   + ++
Sbjct  454   LCLQSNGPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAASNNTSLCLDVDATN--NNVV  511

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWFK+I +
Sbjct  512   ANACKCLSKDSSCEPMSQWFKIIKA  536



>ref|NP_001132121.1| hypothetical protein precursor [Zea mays]
 gb|ACF80825.1| unknown [Zea mays]
 gb|AFW58604.1| hypothetical protein ZEAMMB73_652830 [Zea mays]
Length=555

 Score =   374 bits (959),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 218/509 (43%), Positives = 303/509 (60%), Gaps = 19/509 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+    G RVKLACA+WA HLEP   EGL RRP+S IA  V+ MGFNCVRLTW TY+ 
Sbjct  34    RWIVG-VDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRLTWPTYLV  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++ +  S   LG+ E+++G+  NNP LL L L+D  + VV  + R GIM++LDN
Sbjct  93    TNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKGIMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG VYFDP+EWL+GL+ +A +F +T  VVG+SLRNELRGP QN
Sbjct  153   QMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGMSLRNELRGPKQN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFL-KERPlklkmmkkkvvYETHRY  942
             V +WY+Y++ GA+A++ ANPN+LVI+SGL +D    FL KE+         K+VYE H Y
Sbjct  213   VSLWYRYMQLGAEAVHAANPNVLVILSGLDFDNTLSFLFKEK--VRLSFSGKLVYEQHWY  270

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
              F++G +  W     N VC  +   +  K  FL++ G   PLF SEFG +  G    DNR
Sbjct  271   GFSDGGN--WETQNQNDVCGMVVDFIWAKGLFLLQHG--WPLFFSEFGFDMSGTHIGDNR  326

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +L C LS  A++DLDW++WALQGSYY+REG    DE+YG+ T +W   RNP+F+ ++  L
Sbjct  327   YLTCFLSVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLTWDWCTARNPSFIKRINSL  386

Query  1303  QQKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             Q   Q P   +++  Y +++HP SG C      ++        S          + +  +
Sbjct  387   QSAFQGPGLPNTQQPYYIIFHPQSGLCVLARSSKLLELGPCDESNAWNYTSAYELVVKST  446

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCLDFDSSYSP-S  1650
              +CL          L T C+   S+ W L S+S   + A    NG  +CL+     SP  
Sbjct  447   GQCLQAQSVGKNAKLGTDCSK-PSSKWHLISDSKMHVSAELAKNGTRVCLE----ASPDG  501

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
              I T +C  L      +P++QWFK+I S+
Sbjct  502   AIRTNQCKCLSVDPTCDPESQWFKVILSS  530



>ref|XP_002889989.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66248.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   372 bits (956),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 203/505 (40%), Positives = 302/505 (60%), Gaps = 13/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL CA+W  HL+P++ EGL ++P   +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVD-ENGQRVKLMCANWPSHLQPVVAEGLSKQPADAVAKKIVEMGFNCVRLTWPLDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + I G  +NNP+++ L+L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGNNDVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA+ DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFDGVSNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A++++N  +LVI+SGLS+D D  F++ RP        K+V+E H Y
Sbjct  219   NVNDWFKYMQQGAEAVHSSNKKVLVILSGLSFDADLSFVRSRP-VNLSFTGKLVFELHWY  277

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G S  W     N +C  +   +    G+L+  G   PLF+SEFGI++ G +  DNR
Sbjct  278   SFSDGNS--WAANNPNDICGRVLNRIGNGGGYLLNQG--FPLFLSEFGIDERGVNTNDNR  333

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A+ D+DWS+WAL GSYYLR+G  G  E YG+  ++W ++RN +FL K+ FL
Sbjct  334   YFGCVTGWAAENDVDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISFL  393

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  R + D   ++     S        K + +    
Sbjct  394   QSPLQGPGPRIDAYNLVFHPLTGLCIVRSLDDPKMLTLGPCNSSEPWSYTKKALRIKDQH  453

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G   P+T++        + W   S S   L++   N   LCLD D++   + I+
Sbjct  454   LCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLSSTTSNKTSLCLDVDTA---NNIV  510

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWFK+I +
Sbjct  511   ANACKCLSKDSSCEPMSQWFKIIKA  535



>ref|XP_009148543.1| PREDICTED: uncharacterized protein LOC103871957 [Brassica rapa]
Length=574

 Score =   373 bits (958),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 203/505 (40%), Positives = 300/505 (59%), Gaps = 14/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTWA  + 
Sbjct  57    RWIVD-ENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKIVEMGFNCVRLTWALDLM  115

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF   GL + I G  +NNP+++ ++L++A K VV  +G + +M++LD
Sbjct  116   TNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGNNDVMVILD  175

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA++DGN FFG  +FDP EW   L+ +A  F     VVG+SLRNELRGP Q
Sbjct  176   NHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLRNELRGPKQ  235

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             N D W+KY+++GA+A++ AN N+LVI+SGLS+D D  F++ RP       KK+V+E H Y
Sbjct  236   NADDWFKYMQQGAEAVHAANKNVLVILSGLSFDADLSFVRSRP-VKLSFTKKLVFELHWY  294

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G    W     N +C  +   ++    FL+  G   PLF+SEFGI++ G +  DNR
Sbjct  295   SFSDGN---WATNNPNDICGQVLNRIKNGGEFLLNKG--FPLFLSEFGIDERGGNADDNR  349

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A  D+DWS+WAL GSYYLREGK G  E YG+  ++W ++RN +FL K+  L
Sbjct  350   YFGCVSGWAAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLL  409

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q +LQ P  S   Y L++HP +G C  R + D   ++     S        + +      
Sbjct  410   QSQLQGPGPSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPCNSSEPWSYTKQTLRSKDQS  469

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G    +T++ +      + W   S S   LA+   N   +CLD D+      +L
Sbjct  470   LCLQSNGPGNRVTMTKMDCSSPGSIWQTISASKMHLASTTSNNTSVCLDVDAD---DNVL  526

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWF +I +
Sbjct  527   ANACKCLSKDSSCEPMSQWFTIIKA  551



>ref|XP_010458755.1| PREDICTED: uncharacterized protein LOC104739968 isoform X1 [Camelina 
sativa]
Length=550

 Score =   372 bits (955),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 201/505 (40%), Positives = 308/505 (61%), Gaps = 12/505 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+R+KL CA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVDEK-GQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWPLDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + I G  +NNP+++ L+L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGNNNVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA++DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN N+LVI+SGLS+D D  F++ RP        K+V+E H Y
Sbjct  219   NVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDSDLSFVRSRP-VKLSFTGKLVFELHWY  277

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G S  W     N +C  +   +    G+L+  G   PLF+SEFGI++ G +  D+R
Sbjct  278   SFSDGNS--WATNNPNDMCGRVLNRIGNGGGYLLNQG--FPLFLSEFGIDERGGNTNDDR  333

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+  + A+ DLDWS+WAL GSYYLR+G  G  E YG+  ++W ++RN +FL K+  L
Sbjct  334   YIGCLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLL  393

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  + + D+  ++     S        + + +    
Sbjct  394   QSPLQGPGPQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPCNSSEPWSYTKQALRIKDQP  453

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G + P+T++       S+ W   S S   L++   N   LCLD D++   + ++
Sbjct  454   LCLQSNGPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTASNNTSLCLDVDATN--NNVV  511

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWFK+I +
Sbjct  512   ANACKCLSKDSSCEPMSQWFKIIKA  536



>ref|XP_010250982.1| PREDICTED: uncharacterized protein LOC104593037 isoform X2 [Nelumbo 
nucifera]
Length=531

 Score =   371 bits (953),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 214/508 (42%), Positives = 311/508 (61%), Gaps = 24/508 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL C +WA HL+P+L EGL+++PL  I+  +  MGFNCVR TW  +M 
Sbjct  37    RWIVD-ETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRFTWPLWMA  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    ++MTV QSF  LGL E+I  +  NNP++L+L ++ A + VV  +G +G+M++LDN
Sbjct  96    TNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENGVMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN +FG +YFDP+ W++GL  +A +F  T  V+G+SLRNELRGP Q+
Sbjct  156   HISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGMSLRNELRGPNQD  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +W  Y++ GA+A++ ANPN+L I+SGL +D D  FL  +P       +K+V+E H Y+
Sbjct  216   VSIW--YMQLGAEAVHKANPNVLTILSGLDFDKDLHFLHNQP-VNLSFTRKLVFELHWYS  272

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G   AW  G  N+VC  +   ++ K  F++  G   PLFVSEFGI+  G +  DNR+
Sbjct  273   FSDGN--AWATGNPNQVC-GVVNALKNKILFVLDQGY--PLFVSEFGIDLRGTNVKDNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+    A+LD DW++W L GSYYLREG  G +E YG+   +W+  RN  FL +L  ++
Sbjct  328   SSCIFGVAAELDFDWALWTLMGSYYLREGVLGLEEVYGVMNWDWSGPRNSTFLRRLSSIR  387

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCARVVGD--QIHMSDCSGASRCIQEADGKPIHMIGS  1476
                + P   E T YQ+LYHPL+G C +      Q+ +  C   +  I   +   I + G+
Sbjct  388   SAFRGPGLDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCDEPASWIYTPE-MTIKVKGT  446

Query  1477  LKCLA--VVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
               CL    +GE   L     CN   S  W   ++S   LA+K   G  +CLD DS    +
Sbjct  447   GLCLHGDRLGERANL---QDCNSPGS-IWMPITDSKMHLASKLAGGSTVCLDIDSK---N  499

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              I+T  C  L      +P +QWFK+I S
Sbjct  500   KIITSPCQCLLGDPTCDPGSQWFKIINS  527



>ref|XP_010904544.1| PREDICTED: uncharacterized protein LOC105031943 [Elaeis guineensis]
Length=554

 Score =   372 bits (955),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 220/508 (43%), Positives = 309/508 (61%), Gaps = 18/508 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKLAC +WA HLE    EGL ++PL  I+  V  +GFNCVRLTW  Y+ 
Sbjct  41    RWIVDG-NGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISGGVVALGFNCVRLTWPLYLL  99

Query  412   TRYA--NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  +  ++ +  S   LGL E+ + +A NNP LL L+L+ A +AVV  +  + IM++LDN
Sbjct  100   TNVSLGSLPLRASLAGLGLLESAAAVAVNNPALLDLSLLQAFQAVVSNLASNNIMVILDN  159

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              +SK  WCC+  D N FFG  YFDPDEWLQGL ++A +F  T  VVG+SLRNELRGP QN
Sbjct  160   QISKAGWCCSKFDDNGFFGDKYFDPDEWLQGLTMMATMFNSTTNVVGMSLRNELRGPKQN  219

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             + +WY+Y+++GA+A++ ANPNLL+I+SGL YD D  FL E          KVV+E H Y 
Sbjct  220   ISLWYRYMQRGAEAVHAANPNLLIILSGLDYDKDLSFLSE-SQVNLTFTDKVVFELHWYG  278

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G    W  G  N+VC  +   M +K GFL+  G   PLF+SEFG++Q G + ADNR 
Sbjct  279   FSDGGD--WENGNPNEVCGSVVDNMMKKGGFLLEQG--WPLFLSEFGVDQSGRNMADNRF  334

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A+LDLDW++WALQGSYY+REG+ G DETYG+   +W   RN +F++++  LQ
Sbjct  335   LSCFLSVAAELDLDWALWALQGSYYIREGQLGYDETYGLLGWDWCKARNSSFVNRISALQ  394

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCAR---VVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
                Q P +S+   Y +++HPL+G C        + + +  C+ +      A+ + + +  
Sbjct  395   APFQGPGLSNNSPYNIIFHPLTGLCVVKKFSSKNLLELGQCADSEAWNYTAE-QHVMLED  453

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANK-GDNGLVLCLDFDSSYSPS  1650
             +  C+   G      L T C  G ++ W L S+S   ++ K   NG  +CLD        
Sbjct  454   TKYCMLAKGVGRRARLGTSCG-GSNSIWELISDSKMHVSTKLPINGSTVCLDISQD---G  509

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             T++T  C  L      NP +QWFK+I S
Sbjct  510   TVITNLCKCLSLDGTCNPDSQWFKIIRS  537



>gb|AES72136.2| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=608

 Score =   373 bits (957),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 208/512 (41%), Positives = 317/512 (62%), Gaps = 21/512 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ +S +RVKLAC +WA HL+  + EGL  +PL  I+  + +MGFNCVRLTW   + 
Sbjct  37    RWIVN-ESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCVRLTWPLLLL  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   +A++ V  S  +LGL ++ISG+ +NNP+++ L L+ A + VV+ +G   +M++LDN
Sbjct  96    TNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGDMDLMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV++P WCC++ DGN FFG  YFDPD WL GL  +A +F     VVG+SLRNELRGP QN
Sbjct  156   HVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGMSLRNELRGPRQN  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             ++ WY+Y+ KGA+ ++ AN N+LVI+SGL++D D  F+  +P        K+V+E H Y+
Sbjct  216   LNDWYRYMPKGAEVVHAANSNVLVILSGLNFDTDLSFITNQP-VKLTFNGKLVFEEHWYS  274

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++ Q  AW     N+VC  +T       GFL+  G   PLFVSEFG++  G +   NR 
Sbjct  275   FSDSQ--AWTLENPNQVCGQVTSSFVRNSGFLLDQG--WPLFVSEFGLDLRGKNMNQNRF  330

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C ++  A+LDLDW+ W L GSYY+R+G    DET+G+   NW+ +RN +FL ++  +Q
Sbjct  331   FNCFMAVAAELDLDWAYWTLSGSYYIRQGVVDVDETFGILNGNWSQVRNTSFLQRISAIQ  390

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRC--ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
                Q P  + SEP Y++++HPL G C  ++ + + + M  CS  S   +      + + G
Sbjct  391   HPFQGPGLLESEP-YKVIFHPLRGLCVLSKSLHEPLKMGPCSN-SDGWEYTPQNILLLKG  448

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLA-NKGDNGLV--LCLDFDSSYS  1644
             +  CL   GE   + L T C+ G  +TW + S+S   L+ N  +NG    +CLD D++  
Sbjct  449   TKFCLQGEGEGKQVKLGTTCS-GPESTWEMISDSKMHLSYNVNNNGSTSSVCLDVDAN--  505

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLIASNT  1740
              + ++T  C  + + +  +P +QWFKL+  +T
Sbjct  506   -NIVVTNSCKCISKVNTCDPASQWFKLVDRST  536



>emb|CDY19395.1| BnaC05g09040D [Brassica napus]
Length=527

 Score =   370 bits (950),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 202/503 (40%), Positives = 297/503 (59%), Gaps = 14/503 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTWA  + 
Sbjct  10    RWIVD-ENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWALDLM  68

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF   GL + I G  +NNP+++ ++L++A K VV  +G + +M++LD
Sbjct  69    TNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGNNDVMVILD  128

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA++DGN FFG  +FDP EW   L+ +A  F     VVG+SLRNELRGP Q
Sbjct  129   NHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLRNELRGPKQ  188

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             N D W+KY+++GA+A++ AN N+LVI+SGLS+D D  F++ RP       KK+V+E H Y
Sbjct  189   NADDWFKYMQQGAEAVHAANKNVLVILSGLSFDADLSFVRSRP-VKLSFTKKLVFELHWY  247

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G    W     N +C  +   +     FL+  G   PLF+SEFGI++ G +  DNR
Sbjct  248   SFSDGN---WATNNPNDICGRVLNRIRNGGEFLLNKG--FPLFLSEFGIDERGGNADDNR  302

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A  D+DWS+WAL GSYYLREGK G  E YG+  ++W ++RN +FL K+  L
Sbjct  303   YFGCVSGWAAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLL  362

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q +LQ P  S   Y L++HP +G C  R + D   ++     S        + + +    
Sbjct  363   QSQLQGPGPSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPCNSSEPWSYTKQTLRIKDQS  422

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G    +T++        + W   S S   LA+   N   +CLD  +      +L
Sbjct  423   LCLQSNGPGNRVTMTKTDCSSPGSIWQTISASKMHLASTTSNNTSVCLDVAAD---DKVL  479

Query  1660  TRKCVGLEEGDMRNPQTQWFKLI  1728
                C  L +     P +QWF +I
Sbjct  480   ANACKCLSKDSSCEPMSQWFTII  502



>ref|XP_003617143.1| Oligoribonuclease [Medicago truncatula]
Length=1551

 Score =   391 bits (1005),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 209/506 (41%), Positives = 303/506 (60%), Gaps = 25/506 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DD +GERVKL C +WAGHL+PM+PEGLDR PL ++   +    FNCVRLT+A YM+
Sbjct  107   RWIIDDSTGERVKLVCGNWAGHLQPMIPEGLDRIPLKELVGELVKNRFNCVRLTYAVYMW  166

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TR+A+  V  +F  L   E ++G+A  NP++L +  ++A  AVV E+G   + ++LDNHV
Sbjct  167   TRHAHGIVNNTFNYLDAPEVVAGIAKYNPSILKMTHIEAFDAVVNELGARNVKVLLDNHV  226

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC D D N FF   +FDP EW+ GL + A  F     +V +SLRNELRGP QN+ 
Sbjct  227   SEPKWCCNDDDDNGFFHDQHFDPQEWIHGLTLAAKHFYGHQPIVAMSLRNELRGPRQNLR  286

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF-  948
              WYKY+   A  I+  NPN+LV+ISGL+YD + +FL+  P     + +K+VYE H Y++ 
Sbjct  287   DWYKYMSHAALVIHKTNPNVLVVISGLNYDTELQFLRNNP-LKIDLGEKMVYEAHLYSWS  345

Query  949   ---TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
                T    + W K PLN++C +    +++  GFL  G N  PL ++EFG +Q G S  DN
Sbjct  346   GIGTLKLKEFWSKQPLNRICAENIEGLDQSAGFLTSGKNAVPLIITEFGFDQTGSSVEDN  405

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L C+ +YL   DLD+            E K   DE++G+    W  LR PNF  K + 
Sbjct  406   RFLTCLQTYLVGRDLDF------------EDKLQLDESFGVVDATWHKLRYPNFADKFQL  453

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARVV-GDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             LQ+K QDP S      ++YHPL+G+C +V   +++ +  C   +R I   +G  I +  S
Sbjct  454   LQRKNQDPTSKVSEAYIMYHPLTGQCGQVNDKNELEIGSCENQTRWI--YNGSQILLNDS  511

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
              KCL  +GE LP+ +S    + ++++W   S S   LA    NG  LCL  D  Y+ S +
Sbjct  512   KKCLTAIGEGLPVAISDDY-ENKNSSWKSESLSRLHLATVDQNGKHLCLHKD--YNSSFV  568

Query  1657  LTRKCVGLEEGD--MRNPQTQWFKLI  1728
             +T KC+ + +    + +PQ+QWF+L+
Sbjct  569   VTSKCICINDDSLCLDDPQSQWFQLV  594



>ref|XP_010514260.1| PREDICTED: uncharacterized protein LOC104790246 [Camelina sativa]
Length=511

 Score =   368 bits (945),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 197/461 (43%), Positives = 287/461 (62%), Gaps = 15/461 (3%)
 Frame = +1

Query  235   WIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFT  414
             WI+D++ G+RVKLAC +W  HL+P++ EGL ++ +  +A  +  MGFNCVRLTW   + T
Sbjct  59    WIIDEK-GQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVRLTWPLDLAT  117

Query  415   RYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
                   N+TV QSF  LGLT+ ISG  + NP+++ L L++A K VV ++G   +M++LDN
Sbjct  118   NETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGDKNVMVILDN  177

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV+KP WCC   DGN FFG  +FDP  W+ GL  +A  FK T  VVG+SLRNELRGP QN
Sbjct  178   HVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLRNELRGPKQN  237

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD W+KY+++GA+A++ ANP +LVI+SGLSYD D  F++ RP       +K+V+E HRY+
Sbjct  238   VDAWFKYMQQGAEAVHEANPEVLVILSGLSYDTDLSFVRSRP-VNLTFTRKLVFEIHRYS  296

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT   +  W     N+ C +I + +E+  GF +R     P+F+SEFGI+  G +  DNR+
Sbjct  297   FT--NTNTWSSKNPNEACGEILKSIEDGGGFNLRD---FPVFLSEFGIDLRGKNVNDNRY  351

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C+L + A+ D+DWS+W LQGSYYLREG  G  E YG+  ++W  +R+ +FL +L  +Q
Sbjct  352   IGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRSFLQRLSLIQ  411

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
               LQ P S    Y L++HPL+G C   + +   ++ +  C+ +       D   + +   
Sbjct  412   SPLQGPGSQPKVYNLVFHPLTGLCMLQSILDPTKVTLGLCNESQPWSYTPDNT-LRLKDK  470

Query  1477  LKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLANK  1596
               CL   G + P+ LS + C+    + W   S S   LA K
Sbjct  471   SLCLESTGSNAPVKLSNMSCSSPNLSKWQTTSASNMLLAAK  511



>ref|XP_003601885.1| Endoglucanase [Medicago truncatula]
Length=655

 Score =   373 bits (957),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 207/511 (41%), Positives = 317/511 (62%), Gaps = 21/511 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ +S +RVKLAC +WA HL+  + EGL  +PL  I+  + +MGFNCVRLTW   + 
Sbjct  27    RWIVN-ESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCVRLTWPLLLL  85

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   +A++ V  S  +LGL ++ISG+ +NNP+++ L L+ A + VV+ +G   +M++LDN
Sbjct  86    TNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGDMDLMVILDN  145

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HV++P WCC++ DGN FFG  YFDPD WL GL  +A +F     VVG+SLRNELRGP QN
Sbjct  146   HVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGMSLRNELRGPRQN  205

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             ++ WY+Y+ KGA+ ++ AN N+LVI+SGL++D D  F+  +P        K+V+E H Y+
Sbjct  206   LNDWYRYMPKGAEVVHAANSNVLVILSGLNFDTDLSFITNQP-VKLTFNGKLVFEEHWYS  264

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++ Q  AW     N+VC  +T       GFL+  G   PLFVSEFG++  G +   NR 
Sbjct  265   FSDSQ--AWTLENPNQVCGQVTSSFVRNSGFLLDQG--WPLFVSEFGLDLRGKNMNQNRF  320

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C ++  A+LDLDW+ W L GSYY+R+G    DET+G+   NW+ +RN +FL ++  +Q
Sbjct  321   FNCFMAVAAELDLDWAYWTLSGSYYIRQGVVDVDETFGILNGNWSQVRNTSFLQRISAIQ  380

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRC--ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
                Q P  + SEP Y++++HPL G C  ++ + + + M  CS  S   +      + + G
Sbjct  381   HPFQGPGLLESEP-YKVIFHPLRGLCVLSKSLHEPLKMGPCSN-SDGWEYTPQNILLLKG  438

Query  1474  SLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLA-NKGDNGLV--LCLDFDSSYS  1644
             +  CL   GE   + L T C+ G  +TW + S+S   L+ N  +NG    +CLD D++  
Sbjct  439   TKFCLQGEGEGKQVKLGTTCS-GPESTWEMISDSKMHLSYNVNNNGSTSSVCLDVDAN--  495

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
              + ++T  C  + + +  +P +QWFKL+ ++
Sbjct  496   -NIVVTNSCKCISKVNTCDPASQWFKLLGAS  525



>ref|XP_010476303.1| PREDICTED: uncharacterized protein LOC104755594 [Camelina sativa]
Length=559

 Score =   369 bits (947),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 202/508 (40%), Positives = 307/508 (60%), Gaps = 17/508 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKL CA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  52    RWIVDEK-GQRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVDMGFNCVRLTWPLDLM  110

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV  SF  LGL + I G  +NNP+++ L+L++A K VV  +G + +M++LD
Sbjct  111   TNETLANNVTVRHSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGNNNVMVILD  170

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCC ++DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  171   NHLTKPGWCCDNNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLRNELRGPKQ  230

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+ Y+++GA+A+++AN N+LVI+SGLS+D D  F++ RP        K+V+E H Y
Sbjct  231   NVNDWFNYMQQGAEAVHSANKNVLVILSGLSFDSDLSFVRSRP-VKLSFTGKLVFELHWY  289

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AF++G S  W     N +C  +   +    G+L+  G   PLF+SEFGI++ G + AD+R
Sbjct  290   AFSDGNS--WATNNPNDMCGRVLNRIGNGGGYLLNQG--FPLFLSEFGIDERGGNAADDR  345

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+  + A+ DLDWS+WAL GSYYLR+G  G  E YG+  ++W ++RN +FL ++  L
Sbjct  346   YIGCLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQQISLL  405

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHM---SDCSGASRCIQEADGKPIHMI  1470
             Q  LQ P      Y L++HPL+G C  R + D+  M     C+ +         + + + 
Sbjct  406   QSPLQGPGPRTDAYNLVFHPLTGLCMVRSLNDKTMMLTLGPCNSSEP--WSYTKQALRIK  463

Query  1471  GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
                 CL   G + P+T++       S+ W   S S   L++   N   LCLD D++   +
Sbjct  464   DQSLCLQSNGPNNPVTMTRTSCSTSSSKWQTVSASRMHLSSTASNNTSLCLDVDATN--N  521

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              ++   C  L +     P +QWFK+I +
Sbjct  522   NVVANACKCLSKDSSCEPMSQWFKIIKA  549



>ref|XP_010026596.1| PREDICTED: uncharacterized protein LOC104416965 [Eucalyptus grandis]
Length=515

 Score =   367 bits (943),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 207/511 (41%), Positives = 311/511 (61%), Gaps = 29/511 (6%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATY--  405
             RWI+D   G RVKLAC +W  HL+P+L EGL + P   IA  +  MGFNCVRLTWA    
Sbjct  17    RWIVDG-DGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCVRLTWALELP  75

Query  406   MFTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             M    A++TV QSF +LGL E+++G+ SNNP+L++L L++A K+V+  +  + +M++LDN
Sbjct  76    MNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRNNQVMVILDN  135

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H++ P WCC+  DGN FFG  YFDP  W+QGL  +A +      V+G+SLRNELRGP QN
Sbjct  136   HITTPGWCCSGEDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGMSLRNELRGPRQN  195

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WYKY+++GA++++ ANP++LVI+SGL YD    F++ RP       KK+V+E H Y 
Sbjct  196   VDDWYKYMQQGAESVHAANPDVLVILSGLHYDKVLSFIQNRP-VSLSFTKKLVFEMHWYG  254

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G+  AW  G  N VC  ++ E+  +  FL+  G   PLFVSEFG ++ G +  DNR+
Sbjct  255   FTDGE--AWQSGNPNDVCKAVSNEVMSQSVFLLEQGY--PLFVSEFGADERGTNVNDNRY  310

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C ++  A+ D D+++W LQGSYYLR+G  G +E YG+F  +W+ +RN ++L ++  LQ
Sbjct  311   MNCFMAMAAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQ  370

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--------RVVGDQIHMSDCSGASR-CIQEADGK  1455
                Q P   +   +++++HPL+G C          V+G  I+    S   +  +    GK
Sbjct  371   LPFQGPGGRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSHTPQNALGLMAGK  430

Query  1456  PIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDS  1635
             P++       L  VG   P TL T   +     W + S S   L++  ++G  +CLD  +
Sbjct  431   PLY-------LRAVGLGRPATLGTSPTE-PGTKWEMISASEMHLSSMAEDGSTVCLDVIA  482

Query  1636  SYSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
             +   +T++   C  L      +P +QWF+L+
Sbjct  483   N---NTVMVEACKCLSSESSCDPASQWFRLV  510



>ref|XP_010514258.1| PREDICTED: uncharacterized protein LOC104790245 [Camelina sativa]
Length=562

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 208/517 (40%), Positives = 313/517 (61%), Gaps = 31/517 (6%)
 Frame = +1

Query  232   RWIMDD---QSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWAT  402
             RWI+DD     G RVK+ C +W  HLE  + EGL ++PL  IA  + +MGFNCVRLTW  
Sbjct  31    RWIVDDDGSNKGRRVKVTCVNWPSHLETAVAEGLSKQPLDSIAEKIVSMGFNCVRLTWPL  90

Query  403   YMFT--RYANMTVV-QSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMM  573
             Y+ T   ++++T V QS   L L +A+SG   +NP +L L L+ A + VV  +G+H +M+
Sbjct  91    YLATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEVVSCLGKHRVMV  150

Query  574   VLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD--TPMVVGVSLRNEL  747
             +LDNH+S+P WCC+D+DGN FFG  + +P  W++GL  +A++F +  +  VVG+SLRNEL
Sbjct  151   ILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSSNVVGMSLRNEL  210

Query  748   RGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvY  927
             RGP QN+  WY Y+ KGA+A+++ NP++LVI+SGL+Y  D  FL++RP ++   +K V +
Sbjct  211   RGPKQNIKDWYTYMRKGAEAVHSVNPDVLVIVSGLNYATDLSFLRDRPFEVSFRRKLV-F  269

Query  928   ETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDS  1107
             E H Y F      +W +   N +C   T ++ +  GFL+  G   PLFVSEFG++Q G++
Sbjct  270   EIHWYGFWN----SWEEDNSNMICGRETEKIMKMSGFLLEKG--IPLFVSEFGVDQRGNN  323

Query  1108  EADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLS  1287
               DN+ L C ++  ADLDLDW++W L GSYY+R    G DETYG+   NW ++RN   L 
Sbjct  324   VNDNKFLSCFMALAADLDLDWALWTLAGSYYIRGRTIGSDETYGVLDWNWLSIRNSTILQ  383

Query  1288  KLEFLQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKP  1458
              +  +Q   + P  M ++P  ++++HPLSG C  R    Q+ +  C+ +     E+    
Sbjct  384   MVSTIQTPFRGPGLMETQPK-KIMFHPLSGLCVVRKSLFQLKLGSCNRS-----ESWRLS  437

Query  1459  IHMIGSLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCL  1623
              H + SL      CL    +   + L     +   + W L S+S  QL++   NG  +CL
Sbjct  438   SHRVLSLAEERILCLKAYEKGNSVKLRLFFTEFHCSKWRLLSDSKMQLSSVTKNGAFVCL  497

Query  1624  DFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             D DS    + I+TR+C  L+     +P++QWFKL+ S
Sbjct  498   DVDS--RSNKIVTRRCKCLQGNSSCDPRSQWFKLVTS  532



>ref|XP_002446675.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
 gb|EES11003.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
Length=586

 Score =   369 bits (948),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 224/527 (43%), Positives = 309/527 (59%), Gaps = 35/527 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D +SG RVKLAC +W  HLEPML EGL +RP+  IA  V+ MGFNCVR TW T++ 
Sbjct  43    RWVVD-ESGSRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAAMGFNCVRFTWPTFLV  101

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+ +TV QSF  L LTE+++G+  NNP  + L L+DA KAVV  +G H +M++LDN
Sbjct  102   TNASYSGLTVAQSFLRLNLTESLAGIRVNNPGFVDLKLIDAFKAVVSSLGEHDVMVILDN  161

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG   FDPD W+ GL  +A +F   P VVG+SLRNELRGP QN
Sbjct  162   HLSKPGWCCSNTDGNGFFGDALFDPDVWVDGLTKMATMFAGVPNVVGMSLRNELRGPRQN  221

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + WYKY+++GA+A++ ANP +LVI+SGL +D D  FL  RP        KV +E H Y+
Sbjct  222   ANDWYKYMQRGAEAVHAANPRVLVILSGLQFDNDLAFLNSRP-VNLSFTGKVAFEVHWYS  280

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+  Q   W  G  N+ C  IT  +  +  +L+  G   P+ +SEFG++  G +  DNR+
Sbjct  281   FSNTQE--WSSGNANQACARITAGIARRAFYLLDRG--WPVILSEFGVDNRGGNTNDNRY  336

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C  +  ADLDLDW++WALQGSYYLREG  G DE YG+    W   RN   L +++ LQ
Sbjct  337   YGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALRRVQALQ  396

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGD----------QIHMSDCS--GASRCIQEA  1446
             + L+ P ++    Y +L+HP+SG C  V             ++ +  CS  GA     + 
Sbjct  397   RPLRGPGLAEAAPYAVLFHPVSGMCVVVRRRSPTPTLAQPFELGLGPCSETGAWEYSAQQ  456

Query  1447  DGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKG---------  1599
                 +    +L CL   G   P TL   C D  +  WSL S+S   +A            
Sbjct  457   QRLGLRDTAALLCLRAEGAGRPATLGVTCGDAMAR-WSLVSDSKLHVAVNATSSSSAGVS  515

Query  1600  --DNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
               D   +LCLD  +     +++T  C  L   +  +PQ+QWFKL++S
Sbjct  516   DSDGNGLLCLDVGA--DGRSVVTNPCRCLSADNSCDPQSQWFKLVSS  560



>ref|XP_010026600.1| PREDICTED: uncharacterized protein LOC104416972 [Eucalyptus grandis]
Length=647

 Score =   371 bits (953),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 208/507 (41%), Positives = 307/507 (61%), Gaps = 21/507 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D   G RVKLAC +W  HL+P+L EGL + P   IA  +  MGFNCVRLTW   + 
Sbjct  149   RWIVDGD-GRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCVRLTWPLELP  207

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
                  A+ TV QSF +LGL E+++G+ SNNP+L++L +++A K+V+  +  + +M++LDN
Sbjct  208   INETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRNNQVMVILDN  267

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H++ P WCC++ DGN FFG  YFDP  W+QGL  +A +      V+G+SLRNELRGP QN
Sbjct  268   HITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGMSLRNELRGPRQN  327

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WYKY+++GA+ ++ ANP++LVI+SG ++D D  FL+ RP       KK+V+E H Y 
Sbjct  328   VDAWYKYMQQGAETVHAANPDVLVILSGFNFDTDLSFLQHRP-VNLSFSKKLVFEMHWYG  386

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FTE   KAW  G  N VC  ++ ++  +  FL+  G   PLFVSEFG ++ G +  DNR+
Sbjct  387   FTE--KKAWQSGNPNDVCKAVSNKVMNQSVFLL--GQGYPLFVSEFGADERGTNVNDNRY  442

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C ++  A+ D D+++W LQGSYYLREG  G +E YG+F  +W+ +RN ++L +L  LQ
Sbjct  443   MNCFMAMAAEFDWDFALWTLQGSYYLREGVVGVEEFYGLFNNDWSGIRNSSYLRRLSVLQ  502

Query  1306  QKLQDPMSSEPTYQ-LLYHPLSGRCA--RVVGDQIHMSDCSGA---SRCIQEADGKPIHM  1467
                Q P   +   Q +++HPL+G C   R    ++ +  C  +   S   Q A G    M
Sbjct  503   LPFQGPGGRQTVAQKVIFHPLTGLCILRRTRPTRLVLGPCIYSEPWSHTPQNALGL---M  559

Query  1468  IGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP  1647
              G    L  VG   P TL T   +     W + S S   L++  ++G  +CLD  ++   
Sbjct  560   AGKPLYLRAVGLGRPATLGTSPTE-PGTKWEMISASEMHLSSMAEDGSTVCLDMIAN---  615

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLI  1728
             +T++   C  L      +P +QWF+L+
Sbjct  616   NTVMVEACKCLSSESSCDPASQWFRLV  642



>ref|XP_009381699.1| PREDICTED: uncharacterized protein LOC103969775 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   365 bits (937),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 207/484 (43%), Positives = 293/484 (61%), Gaps = 20/484 (4%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFT--RYANMTVVQSFGDLGLTEAISG  480
             ML EGL ++PL+ I  ++  MGFNCVRLT+ T++ T    A++TV QSF   GL   I  
Sbjct  1     MLAEGLSKQPLASITWNIHLMGFNCVRLTYPTFLLTDESLASLTVRQSFERAGLDATIPL  60

Query  481   LAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDP  660
             +A +NP  + LNL+ A KAVV ++G   IM++LDNH+SKP WCC++ DGN FFG  YFDP
Sbjct  61    IALHNPTFVDLNLLQAYKAVVAKLGATNIMVILDNHISKPGWCCSNSDGNGFFGDTYFDP  120

Query  661   DEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVI  840
             + W QGL  +A +FK TP VVG+SLRNELRG  QNVD W+ Y++KGA+A++ AN ++LV+
Sbjct  121   NVWYQGLIKMATMFKGTPNVVGMSLRNELRGRRQNVDDWFTYMQKGAEAVHGANQDVLVV  180

Query  841   ISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREM  1020
             +SGLS+D D  FL  R       ++K+V+E H Y+F+ G   AW+KG  N VC  I+  +
Sbjct  181   LSGLSFDNDLSFLANR-QVDVSFQRKLVFELHWYSFSNGD--AWVKGNPNNVCGSISGSV  237

Query  1021  EEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYY  1200
               + GFL+      PLFVSE+G++Q G +  DNR+  C+L++LAD D+DW++W LQGSYY
Sbjct  238   NTRAGFLLD--RQLPLFVSEYGVDQQGGNLNDNRYFGCILAFLADKDVDWALWTLQGSYY  295

Query  1201  LREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDP-MSSEPTYQLLYHPLSGRC  1377
             LREG     E+YGM T +W  +RN   L K+  +QQ  Q P +S  P Y ++ HP +G C
Sbjct  296   LREGVVDKGESYGMLTYDWAGVRNQTVLQKVRAVQQPFQGPGVSKTPPYIIILHPSTGLC  355

Query  1378  ARVVGDQIHMSD---CSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQS  1548
              R      H  D   C G  +       + +  + S  C++  G   P+   +  + G S
Sbjct  356   VRQGSLTSHTLDFGPCDGNMQAFHYTQQQTLTSVDSSLCVSATGSGKPVKFDSCSDSGSS  415

Query  1549  NTWSLASNSMFQLANK--GDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFK  1722
               W L S+S   ++    GD G  LCLD       + ++T  C  L +    +P +QWFK
Sbjct  416   --WDLVSDSGMHVSTTLPGD-GSTLCLDV----GQNGVVTNPCKCLRDDANCDPGSQWFK  468

Query  1723  LIAS  1734
             L+ S
Sbjct  469   LVTS  472



>dbj|BAK00694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   367 bits (943),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 211/507 (42%), Positives = 297/507 (59%), Gaps = 15/507 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKL CA+WA HLEP+  EGL RR +  IA  V+ MGFNCVRLTW TY+ 
Sbjct  39    RWVVG-ADGRRVKLVCANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTYLA  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++ +  S   LGL E+ +G+  NNP+LL L L+D  + VV  +  + IM++LDN
Sbjct  98    TNSTLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFREVVSALASNSIMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG  YFDP+EWL+GL+ +A +F+    VVG+SLRNELRGP QN
Sbjct  158   QMTTPGWCCSRTDGNGFFGDKYFDPEEWLKGLSAMATMFRHAKNVVGMSLRNELRGPYQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +WY+Y+++GA+A++ ANPN+LVI+SGL +D    FL  +         K+V+E H Y 
Sbjct  218   VSLWYRYMQQGAEAVHAANPNVLVILSGLDFDNSLSFLSPK-QVKLSFTGKLVFEQHWYG  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G    W     N  C +    +  K  FL++ G   PLF SE G +  G   ADNR+
Sbjct  277   FSDGTD--WENSNQNDACGEAVESIRTKGLFLLQQG--WPLFFSEIGFDMSGTHIADNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A++DLDW+VWAL+GSYY+REG    DETYG+ T +W   RNP+F+ ++  LQ
Sbjct  333   LTCFLSVAAEMDLDWAVWALEGSYYIREGILAYDETYGLLTWDWYTARNPSFIERINSLQ  392

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
                Q P   SS  +Y++++HPL+G C  V    +        S          + +  + 
Sbjct  393   SPFQGPGLSSSHKSYKVIFHPLTGLCVLVESANVLKLGPCDESNAWNYTSTYELVLKQTG  452

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNS-MFQLANKGDNGLVLCLDFDSSYSPSTI  1656
             +CL          L T C+   S  W L S+S M   A    NG  +CLD   +     I
Sbjct  453   QCLEAKSVGDTAKLGTGCSKSCSK-WQLISDSGMHVSAELTKNGTRVCLD---AGPDGVI  508

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIASN  1737
              T +C  L E    +P++QWFK+I+S+
Sbjct  509   TTDQCKCLTEDPTCDPESQWFKVISSS  535



>ref|XP_002509878.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51265.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=521

 Score =   365 bits (938),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 210/512 (41%), Positives = 292/512 (57%), Gaps = 36/512 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  H+E ML EGL  +PL +I   ++   FNCVRLT+ATYM+
Sbjct  35    RWIIDTKTGQRVKLACVNWPSHMETMLAEGLHEQPLKRIVALLAKQKFNCVRLTYATYMW  94

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+N TV +SF    L EA  G+A NNP+LLS  L  A + VV+E+   G+M +LDNHV
Sbjct  95    TRYSNRTVSESFN--FLPEAKEGIAKNNPDLLSKTLPQAYETVVDELAAQGVMTLLDNHV  152

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             SKP WCC++ DGN+FFG  YFD  EW+QGL  VA  F+  P V+ +S RNELRGPLQN D
Sbjct  153   SKPTWCCSETDGNTFFGDTYFDVKEWIQGLTTVATRFRGKPKVMAISTRNELRGPLQNQD  212

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              WYKY+ +GA AI+NANP++L+  SGLSY  D  +LK +         K+VY+ H Y ++
Sbjct  213   DWYKYILEGASAIHNANPDVLIFASGLSYANDLTYLKSK-TLGTNFDDKLVYDAHWYPWS  271

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGF-LVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
                   W    LN  C+  T+    + GF       P PLF+ EFG++Q G S AD+  L
Sbjct  272   WEDVSTWDVELLNDACYRKTQYFINQTGFTYALHEEPIPLFMGEFGMDQRGLSRADDHFL  331

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
              C L++  D+DLDW +W  QGSYY RE K   DET+G    +W  +R+P ++S+++F++ 
Sbjct  332   SCFLAFATDIDLDWGMWGWQGSYYFRENKTNIDETFGAMDHHWNRIRSPQYMSRVDFVKN  391

Query  1309  KL----QDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
             KL       M +    +L        C R   +QI       AS C +            
Sbjct  392   KLIGTSYRKMQATTKMEL--------CRRRESNQIGRKQSVLAS-CWRWTS---------  433

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
                   VG+  P  LS  C   Q ++W L + +   +A   + G  LCL  +S  +   I
Sbjct  434   ----XXVGDGHPAILSKNCT-SQKSSWRLLTATKLHVATVDETGEYLCLQKESPLTTKVI  488

Query  1657  LTRKCVGLEEGD-----MRNPQTQWFKLIASN  1737
              ++  V L E D     +++P  QWFKL ++N
Sbjct  489   TSKCVVTLSEPDCQRDPLQDPTMQWFKLTSTN  520



>ref|XP_010026597.1| PREDICTED: uncharacterized protein LOC104416968 [Eucalyptus grandis]
 gb|KCW59702.1| hypothetical protein EUGRSUZ_H02462 [Eucalyptus grandis]
Length=514

 Score =   365 bits (937),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 205/510 (40%), Positives = 309/510 (61%), Gaps = 28/510 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATY--  405
             RWI+D   G RVKLAC +W  HL+P+L EGL + P   IA  +  MGFNCVRLTWA    
Sbjct  17    RWIVDG-DGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCVRLTWALELP  75

Query  406   MFTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             M    A++TV QSF +LGL E+++G+ SNNP+L++L L++A K+V+  +  + +M++LDN
Sbjct  76    MNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRNNQVMVILDN  135

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H++ P WCC+  DGN FFG  YFDP  W+QGL  +A +      V+G+SLRNELRGP QN
Sbjct  136   HITTPGWCCSGEDGNGFFGDKYFDPQVWIQGLHKMATMATGFSNVIGMSLRNELRGPRQN  195

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WYKY+++GA++++ ANP++LVI+SGL YD    FL+ RP       KK+V+E H Y 
Sbjct  196   VDDWYKYMQQGAESVHAANPDVLVILSGLHYDKVLSFLQNRP-VSLSFTKKLVFEMHWYG  254

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G+  AW  G  N VC  ++ E+  +  FL+  G   PLFVSEFG ++ G +  DNR+
Sbjct  255   FTDGE--AWQSGNPNDVCKAVSNEVMSQSVFLLEQGY--PLFVSEFGADERGTNVNDNRY  310

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C ++  A+ D D+++W LQG+YYLR+G  G +E YG+F  +W+ +RN ++L ++  LQ
Sbjct  311   MNCFMAMAAEFDWDFALWTLQGNYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQ  370

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA--------RVVGDQIHMSDCSGASRCIQEADGKP  1458
                Q P   +   +++++HPL+G C          V+G  I+    S   +      G P
Sbjct  371   LPFQGPGGLQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSYTPQNALWVMGLP  430

Query  1459  IHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
             ++       L  +G   P  L T   +     W + S S   L++K ++G  +CLD ++ 
Sbjct  431   LY-------LRAIGLGRPARLGTSPTE-PGTKWEMISASEMHLSSKAEDGSTVCLDVNTH  482

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
                +T++   C  L      +P +QWF+L+
Sbjct  483   ---NTVMVEACKCLSSESSCDPASQWFRLV  509



>gb|ACF79301.1| unknown [Zea mays]
Length=576

 Score =   367 bits (942),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 219/519 (42%), Positives = 311/519 (60%), Gaps = 27/519 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D +SG RVKLAC +W  HLEP+L EGL +RP+  IA  V+ MGFNCVR TW T++ 
Sbjct  41    RWVLD-ESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCVRFTWPTFLV  99

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+++TV QSF  L LTE+++G+  NNP ++ L L+DA KAVV  +G H +M++LDN
Sbjct  100   TDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGEHNLMVILDN  159

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DG+ FFG  YFDPD W+ GL  +A +F   P VVG+SLRNELRGP QN
Sbjct  160   HLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGMSLRNELRGPRQN  219

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+++GA+A++ ANP +LVI+SGLS+D D  FL  RP        KV +E H Y+
Sbjct  220   VNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFLNSRP-VNLSFTGKVAFEVHWYS  278

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+ G    W  G  N+ C  IT  +  +  +L+  G   P+ +SEFG++  G +  DNR+
Sbjct  279   FSNGPE--WSSGNANQACARITAGITRRAFYLLDRG--WPVILSEFGVDNRGVNTNDNRY  334

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C  +  ADLDLDW++WALQGSYYLREG  G DE YG+    W   RN   L +++ LQ
Sbjct  335   YGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQ  394

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGD--------QIHMSDCSGASRCIQEADGKP  1458
             + L+ P ++    Y +L+HP+SG C              Q+ +  C+        A  + 
Sbjct  395   RPLRGPGLAEAAPYTVLFHPVSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQR  454

Query  1459  IHMI-GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGL------VL  1617
             + +   +L CL   G   P +L+  C D  +  W   S+S   +A    +        +L
Sbjct  455   LALRNAALLCLRAEGAGRPASLAVSCGDAMAR-WGFVSDSKLHVAVNATSSAGSVGDGLL  513

Query  1618  CLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             CLD  +     +++T  C  L   +  +PQ QWFKL++S
Sbjct  514   CLDVGA--DGRSVVTNPCRCLSADNSCDPQGQWFKLVSS  550



>ref|NP_001130915.1| hydrolase, hydrolyzing O-glycosyl compound precursor [Zea mays]
 gb|ACF85192.1| unknown [Zea mays]
 gb|ACG23910.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
 gb|ACN27949.1| unknown [Zea mays]
 gb|ACN28477.1| unknown [Zea mays]
 gb|ACN34624.1| unknown [Zea mays]
 gb|ACN34788.1| unknown [Zea mays]
 tpg|DAA37297.1| TPA: hydrolase, hydrolyzing O-glycosyl compound [Zea mays]
Length=576

 Score =   367 bits (942),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 219/519 (42%), Positives = 311/519 (60%), Gaps = 27/519 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D +SG RVKLAC +W  HLEP+L EGL +RP+  IA  V+ MGFNCVR TW T++ 
Sbjct  41    RWVLD-ESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCVRFTWPTFLV  99

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   Y+++TV QSF  L LTE+++G+  NNP ++ L L+DA KAVV  +G H +M++LDN
Sbjct  100   TDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGEHNLMVILDN  159

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DG+ FFG  YFDPD W+ GL  +A +F   P VVG+SLRNELRGP QN
Sbjct  160   HLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGMSLRNELRGPRQN  219

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WYKY+++GA+A++ ANP +LVI+SGLS+D D  FL  RP        KV +E H Y+
Sbjct  220   VNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFLNSRP-VNLSFTGKVAFEVHWYS  278

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F+ G    W  G  N+ C  IT  +  +  +L+  G   P+ +SEFG++  G +  DNR+
Sbjct  279   FSNGPE--WSSGNANQACARITAGITRRAFYLLDRG--WPVILSEFGVDNRGVNTNDNRY  334

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C  +  ADLDLDW++WALQGSYYLREG  G DE YG+    W   RN   L +++ LQ
Sbjct  335   YGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQ  394

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGD--------QIHMSDCSGASRCIQEADGKP  1458
             + L+ P ++    Y +L+HP+SG C              Q+ +  C+        A  + 
Sbjct  395   RPLRGPGLAEAAPYTVLFHPVSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQR  454

Query  1459  IHMI-GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGL------VL  1617
             + +   +L CL   G   P +L+  C D  +  W   S+S   +A    +        +L
Sbjct  455   LALRDAALLCLRAEGAGRPASLAVSCGDAMAR-WGFVSDSKLHVAVNATSSAGSVGDGLL  513

Query  1618  CLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             CLD  +     +++T  C  L   +  +PQ QWFKL++S
Sbjct  514   CLDVGA--DGRSVVTNPCRCLSADNSCDPQGQWFKLVSS  550



>emb|CDX98009.1| BnaA06g07600D [Brassica napus]
Length=557

 Score =   366 bits (940),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 201/505 (40%), Positives = 297/505 (59%), Gaps = 14/505 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTWA  + 
Sbjct  40    RWIVD-ENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKILEMGFNCVRLTWALDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF   GL + I G  +NNP+++ ++L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGNNDVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA++DGN FFG  +FDP EW   L+ +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             N D W+KY+++GA+A++ AN N+LVI+SGLS+D D  F++ RP       KK+V+E H Y
Sbjct  219   NADDWFKYMQQGAEAVHAANKNVLVILSGLSFDADLSFVRSRP-VKLSFTKKLVFELHWY  277

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G    W     N +C  +   ++    FL+  G   PLF+SEFGI++ G +  DNR
Sbjct  278   SFSDGN---WATNNPNDICGQVLNRIKNGGEFLLNKG--FPLFLSEFGIDERGGNADDNR  332

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A  D+DWS+WAL G YYLREGK G  E YG+  ++W ++RN +FL K+  L
Sbjct  333   YFGCVSGWAAGNDVDWSLWALTGRYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLL  392

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q +LQ P  S   Y L++HP +G C  R   D   ++     S        + +      
Sbjct  393   QSQLQGPGPSTDAYNLVFHPYTGLCLVRSPNDTTMLTLGPCNSSEPWSYTKQTLRSKDQS  452

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G    +T++        + W   S S   LA+   N   +CLD D+    + +L
Sbjct  453   LCLQSNGPGNRVTMTKRDCSSPGSIWQTISASNMHLASTTSNNTSVCLDVDAD---NNVL  509

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWF +  +
Sbjct  510   ANDCKCLSKDSSCEPMSQWFTITKA  534



>ref|XP_006378253.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
 gb|ERP56050.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
Length=396

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/364 (50%), Positives = 253/364 (70%), Gaps = 8/364 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLE M+ EGL ++PL  IA  + +MGFNCVRLTW  ++ 
Sbjct  39    RWIVD-ENGQRVKLACVNWVSHLEVMVAEGLSKQPLDGIAKRILSMGFNCVRLTWPVFLV  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     ++TV QS    GL E+ISG+ +NNP+++ L+L+D  +AVV  +G + +M++LDN
Sbjct  98    TNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGNNNVMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W+ GL  +A++F   P VVG+SLRNELRGP QN
Sbjct  158   HISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLRNELRGPKQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP+++VI+SGL+YD D  FL+ RP        K+V+E H Y+
Sbjct  218   VNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFLRNRP-MNLTFSGKIVFEVHWYS  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G+  AW  G  N+VC  +   M    GFL+  G   PLFVSEFG++Q G +  DNR+
Sbjct  277   FTDGE--AWKNGNSNQVCGRVVDNMMRVSGFLLDQG--WPLFVSEFGVDQRGTNVNDNRY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A+LDLDW++W L GSYYLR+G  G +E YG+   NW   RN  FL ++  LQ
Sbjct  333   LGCFLSVAAELDLDWALWTLVGSYYLRQGVIGMNEYYGVMNWNWCEARNSTFLQQISVLQ  392

Query  1306  QKLQ  1317
                Q
Sbjct  393   SPFQ  396



>emb|CDY16066.1| BnaC08g40570D [Brassica napus]
Length=553

 Score =   366 bits (939),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 205/504 (41%), Positives = 301/504 (60%), Gaps = 19/504 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  39    RWIVD-ENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWPLDLM  97

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGLT+ I G  +NNP+++  +L++A K VV ++G H +M +LD
Sbjct  98    TNETLANNVTVRQSFQSLGLTDDIVGFQTNNPSIIDFSLIEALKMVVTKLGNHNVMAILD  157

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++K  WCCA++DGN FFG  +FDP  W   L+ +A  F     VVG+SLRNELRGP Q
Sbjct  158   NHLTKSGWCCANNDGNGFFGDNFFDPTVWTAALSKMAATFNGVSNVVGMSLRNELRGPKQ  217

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A ++AN N+LVI+SGLS+D D  F+  RP        K+V+E H Y
Sbjct  218   NVNDWFKYMQQGAEAAHSANKNVLVIMSGLSFDTDLSFIMPRP-VHLSFTGKLVFELHWY  276

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G S  W     N  C ++   +    GFL+  G   PLF+SEFGI++ G +  ++R
Sbjct  277   SFSDGNS--WSTNNSNDNCGEVLNRIRNNGGFLLNQG--FPLFLSEFGIDERGGNVNNDR  332

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A+ D+DWS+WAL G+YYLR+G  G +E YG+  ++W ++RN +FL K+  L
Sbjct  333   YFGCLTGWAAENDVDWSLWALTGTYYLRQGVVGLNEYYGVLDSDWISVRNSSFLQKISLL  392

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  R + D   ++     S        K + +    
Sbjct  393   QSTLQGPGPRTDAYNLVFHPLTGLCLVRSLKDTTMLTLGPCNSSEPWSYTKKTLRIEDQP  452

Query  1480  KCLAVVGEDLPLTLS-TICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
              CL   G +  +T+S T C     + W   S S   LA        LCLD D++   + I
Sbjct  453   LCLQSNGPENRVTMSRTGC-----SRWQTISASRMHLALTTSKNNSLCLDVDAT---NNI  504

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLI  1728
             L   C  L +     P +QWFK+I
Sbjct  505   LANPCKCLSKDSSCQPMSQWFKII  528



>ref|XP_003552802.1| PREDICTED: uncharacterized protein LOC100805196 [Glycine max]
Length=533

 Score =   364 bits (935),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 214/505 (42%), Positives = 303/505 (60%), Gaps = 19/505 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +  RVKLAC +W  HLE M+ EGL  RPL  IA  + +MGFNCVRLTW  Y+ 
Sbjct  39    RWIVDGNA-TRVKLACVNWVSHLEYMVAEGLGERPLDGIAKEIKSMGFNCVRLTWPIYLI  97

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV QSF +LGL +AIS L  NNP+L+ L L+ A + VV+ +G  G+M++LDN
Sbjct  98    TNDSLATLTVRQSFNNLGLPQAISALQVNNPSLIDLPLIKAYQDVVKGLGDKGLMVILDN  157

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP WCC++ DGN FFG  YFDPD W++GL  +A +FK    VV +SLRNELRGP QN
Sbjct  158   HVSKPQWCCSNDDGNGFFGDQYFDPDLWIKGLTKMATLFKGVTNVVAMSLRNELRGPRQN  217

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              + W+KY+ KGA+A++ ANP++LVI+SGL+YDLD  FL+++        +K+V+E H Y+
Sbjct  218   ANDWFKYMPKGAEAVHGANPDVLVIMSGLNYDLDLSFLRKQ-QVKLSFSRKLVFELHWYS  276

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G S  W     N+VC  +T  +    G+L+  G   PL +SEFG +  G ++ DN +
Sbjct  277   FSDGDS--WTTENPNQVCGKVTGRVMRSAGYLLEQGY--PLVLSEFGWDLRGTNQNDNSY  332

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+L   A LD DW+ W L GSYYLREG  G  E YG+ T N T       L ++  +Q
Sbjct  333   FNCLLPLAAQLDFDWAYWTLAGSYYLREGTVGLIEVYGILTQNTTLPTTTFLLQRISAIQ  392

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIG-SL  1479
                + P +S    +++++HPL+G C     + + +  CS  S   +    K + + G + 
Sbjct  393   LPYRGPGLSEVEAHKVIFHPLTGLCISGKLEPLKLGPCSN-SEGWEYTAQKVLSVKGRNS  451

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   GE     L   C     + W + S+S   L++K +N   +CLD DS+   + I+
Sbjct  452   TCLQAEGEGKEAKLGNEC-----SVWEIVSDSKLHLSSKINNASDVCLDVDSN---NNIV  503

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
             T  C  L      +P +QWFKL+ S
Sbjct  504   TNACKCLSGDKTCDPASQWFKLVDS  528



>ref|XP_010528075.1| PREDICTED: uncharacterized protein LOC104805267 [Tarenaya hassleriana]
Length=575

 Score =   365 bits (938),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 205/511 (40%), Positives = 310/511 (61%), Gaps = 25/511 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+   +G RVKLAC  W  HL+  + EGL +RP+  IA  + +MGFNCVR TW  Y+ 
Sbjct  32    RWIVG-LTGRRVKLACIVWPSHLDAAVAEGLSKRPMDAIAEKILSMGFNCVRFTWPLYLA  90

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T   +A+MTV QS   LGL EAISG+ +NNP+++ L L+ A + +V  +G++ +M++LDN
Sbjct  91    TDDSFASMTVRQSLRRLGLFEAISGVQANNPSIIDLPLIRAFQEMVSCLGKNRLMVILDN  150

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             + S+P WCC+D+DGN FF   +F+PD W+  L  +A++F +   VVG+SLRN+LRGP QN
Sbjct  151   YTSQPGWCCSDNDGNGFFWDRHFNPDLWINSLKKMASMFANVSNVVGMSLRNDLRGPRQN  210

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
              D WYKY++KGA+A+++ NPN+LVI+SGLSY+ D  FL+++        +K+V+E H Y 
Sbjct  211   TDDWYKYMQKGAEAVHSMNPNVLVIVSGLSYETDLSFLRDK-SLNLTFTRKLVFEIHWYG  269

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F      +W    LN++C  +T  M    GFL+  G   PLFVSEFG++Q G++  DNR 
Sbjct  270   FWN----SWETENLNQICARLTENMMNMSGFLLEKG--IPLFVSEFGVDQRGNNRNDNRF  323

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C ++  A+LDLDW++W L GSYY RE   G DE +G+   +W  +RN  F  ++  +Q
Sbjct  324   LNCFMAVAAELDLDWALWTLAGSYYTREKAIGADEYFGVLDWSWIGIRNSTFFQRISAIQ  383

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGD------QIHMSDCSGASRCIQEADGKPI  1461
             +  + P  M + P +++++HP +G C  VV +      ++ +  C+  S   +    + +
Sbjct  384   RPFRGPGLMETYP-HKVIFHPSTGLC--VVRESWPNPFRLKLGPCN-ESDSWRHTPHRIL  439

Query  1462  HMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSY  1641
              +   L C+ V     P  L    ++   + W + S S  QLA+   +G  +CLD DS  
Sbjct  440   SVKEQLLCIKVDERGQPAKLRIFFSEASCSKWKVTSESKMQLASLTWSGASVCLDVDSD-  498

Query  1642  SPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
               S I+T  C  L   +  +P +QWFKL+ S
Sbjct  499   --SNIVTTSCKCLHGNEPCDPGSQWFKLVTS  527



>ref|XP_002315653.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
 gb|EEF01824.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
Length=377

 Score =   358 bits (918),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 254/371 (68%), Gaps = 12/371 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKLAC +W  HLE M+ EG+ ++P+  IA  + +MGFNCVRLTW  ++ 
Sbjct  17    RWIVD-ENGQRVKLACVNWVSHLEVMVAEGISKQPMDGIAKRILSMGFNCVRLTWPVFLV  75

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     ++TV QS    GL E+ISG+ +NNP+++ L+L+D  +AVV  +G + +M++LDN
Sbjct  76    TNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGNNNVMVILDN  135

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFDPD W+ GL  +A++FK  P VVG+SLRNELRGP QN
Sbjct  136   HISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFKGVPNVVGMSLRNELRGPKQN  195

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A+++ANP+++VI+SGL+YD D  FL+ RP        K+V+E H Y 
Sbjct  196   VNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFLRNRP-VHLTFSGKIVFEVHWYG  254

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+G+  AW  G  N+VC  +   M    GFL+  G   PLFVSEFG++Q G +  DNR+
Sbjct  255   FTDGE--AWKSGNSNQVCGRVVDNMMRVSGFLLDQG--WPLFVSEFGVDQRGTNVNDNRY  310

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A+LDLDW++W L GSYYLR+G  G +E YG+   NW  +RN  FL     L 
Sbjct  311   LGCFLSVAAELDLDWALWTLVGSYYLRQGVIGMNEYYGVLNWNWREVRNSTFLQ----LI  366

Query  1306  QKLQDPMSSEP  1338
               LQ P    P
Sbjct  367   SALQSPFRVNP  377



>ref|XP_004975980.1| PREDICTED: uncharacterized protein LOC101758857 [Setaria italica]
Length=557

 Score =   364 bits (934),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 218/511 (43%), Positives = 298/511 (58%), Gaps = 23/511 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACA+WA HLEP   EGL RR +  IA  V+ MGFNCVRLTW TY+ 
Sbjct  36    RWLVG-ADGRRVKLACANWASHLEPAAAEGLSRRGVEGIAGRVAAMGFNCVRLTWPTYLA  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++    S   LG+ E+++G+  NNP LL L L+D  + VV  +G   IM++LDN
Sbjct  95    TNATLASLPFRWSLERLGMRESVAGVRVNNPALLDLPLIDVFREVVSALGSKSIMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG  YFDPDEWL+GL  +A IF DT  VVG+SLRNELRGP QN
Sbjct  155   QMTTPGWCCSRTDGNGFFGDKYFDPDEWLKGLNAMATIFNDTKNVVGMSLRNELRGPNQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             + +WY+Y++ GA+A++ ANPN+LVI+SGL +D    FL  +         K+V+E H Y 
Sbjct  215   ISLWYRYMQLGAEAVHAANPNVLVILSGLDFDNTLSFLHSK-KPELRFTGKLVFEQHWYG  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G    W     N  C  +   +  K  FL++ G   PLF SEFG +  G    DNR+
Sbjct  274   FSDGGH--WEILNQNDACRMVVDSIWAKGLFLLQQG--WPLFFSEFGFDMSGTHIGDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  LQ
Sbjct  330   LTCFLSVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWCTARNPSFIKRINSLQ  389

Query  1306  QKLQD---PMSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIG  1473
                Q    P S EP Y L++HP +G C      + + +  C   S          + +  
Sbjct  390   SPFQGPGLPNSREP-YNLIFHPQTGLCVLATSSKSLELGPCD-RSNAWNYTSAYELVVKS  447

Query  1474  SLKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCLDFDSSYS  1644
             + +CL    VGE+    L T C+   S+ W L SNS   + A    NG  +CLD      
Sbjct  448   TGQCLQAKSVGEN--AKLGTDCSK-PSSKWQLISNSRMHVSAELTKNGTRVCLDAGPD--  502

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
                I+T +C  L      NP++QWFK+I S+
Sbjct  503   -GAIITNQCKCLIIDPACNPESQWFKVILSS  532



>ref|XP_004158142.1| PREDICTED: uncharacterized LOC101213113 [Cucumis sativus]
Length=400

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 249/368 (68%), Gaps = 2/368 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKL C +W  H + ML EGLDRRPL  +A  V  + FNCVRLT+AT+MF
Sbjct  32    RWIVDSATGRRVKLVCVNWPSHTQSMLIEGLDRRPLKDLANEVVRLRFNCVRLTYATHMF  91

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRYAN TV ++F  L L  A  GLA +NP +L++ + +A +AVV+ +G  G+M++ DNH+
Sbjct  92    TRYANRTVEENFDLLDLRAAKVGLALHNPFVLNMTIFEAYEAVVDVLGTSGLMVIADNHI  151

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S+P WCC+  DGN FFG  YFD +EWL+GL +VA  F +   VV +SLRNELRG      
Sbjct  152   SQPRWCCSLEDGNGFFGDRYFDTEEWLEGLRLVARRFYNKSAVVAMSLRNELRGASSKSK  211

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W KY+ +GA  I+N NP +LVIISGL++D D R  ++ PL+L  +  K+V+E H Y+F+
Sbjct  212   DWNKYITQGATTIHNINPKILVIISGLNFDNDLRCQRQYPLQLNNLHNKLVFEVHLYSFS  271

Query  952   -EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHL  1128
              E QSK ++  PLNK+C  +     E+  F++ G    PLFVSEFG++Q G +EAD+R L
Sbjct  272   GESQSK-FIHNPLNKICSKVINGFVERAEFVMEGAEAVPLFVSEFGLDQRGVNEADDRFL  330

Query  1129  PCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQ  1308
              C  ++L + DLDW++W  QGSYY R+GK GP+E +G+   NW+ +RNP+F    + LQ 
Sbjct  331   SCFSAHLVEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLNYNWSDVRNPHFSQMFQLLQT  390

Query  1309  KLQDPMSS  1332
              LQ  +SS
Sbjct  391   MLQGMISS  398



>ref|XP_003579979.1| PREDICTED: uncharacterized protein LOC100845861 [Brachypodium 
distachyon]
Length=558

 Score =   362 bits (930),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 210/509 (41%), Positives = 301/509 (59%), Gaps = 19/509 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACASWA HLEP+  EGL RR +  IA  V+ MGFNCVRLTW TY+ 
Sbjct  38    RWVVG-ADGRRVKLACASWASHLEPVAAEGLSRRDVGGIAARVAAMGFNCVRLTWPTYLA  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++ +  S   LGL E+++G+  NNP+LL L L+D  + VV  +    IM++LDN
Sbjct  97    TNTTLSSLPLRWSLERLGLRESVAGVRVNNPDLLDLPLIDVFREVVSALASSNIMVILDN  156

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG  YFDP+EWL+GL+ +A +F+ T  VVG+SLRNELRGP QN
Sbjct  157   QMTTPGWCCSRSDGNGFFGDKYFDPEEWLKGLSAMATMFRYTKNVVGMSLRNELRGPYQN  216

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +WY+Y+++GA+A++ ANPN+LVI+SGL +D    FL  +         K+V+E H Y 
Sbjct  217   VSLWYRYMQQGAEAVHAANPNVLVILSGLDFDNTLSFLFSK-QVELSFTGKLVFEQHWYG  275

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G    W     N  C      +  K  FL++ G   PLF SE G +  G    DNR+
Sbjct  276   FSDGTD--WEDWNQNDACGVAVESIRTKGLFLLKQG--WPLFFSEIGFDMSGTHIPDNRY  331

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C +S  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++ +LQ
Sbjct  332   LTCFISVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWYTARNPSFIKRINYLQ  391

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVG-DQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P   +S+  Y  ++HPL+G C  V   + + +  C   S          + +  S
Sbjct  392   SPFQGPGLPNSKKPYNAIFHPLTGLCVLVKSPNSLELGPCD-ESNAWNYTSTCELVLKHS  450

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANK-GDNGLVLCLDFDSSYSPST  1653
              +CL          L T+ +   S  W L S+S   ++ +   NG  +CLD     SP  
Sbjct  451   GQCLEAKSVGDIAKLGTVSSKSCSK-WQLISDSRMHVSTELTKNGTRVCLD----ASPDG  505

Query  1654  IL-TRKCVGLEEGDMRNPQTQWFKLIASN  1737
             ++ T +C  L E    NP++QWFK+I S+
Sbjct  506   VISTNQCKCLIEDPTCNPESQWFKVILSS  534



>gb|EAY94563.1| hypothetical protein OsI_16341 [Oryza sativa Indica Group]
Length=552

 Score =   361 bits (926),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 211/510 (41%), Positives = 303/510 (59%), Gaps = 21/510 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACA+WA HLEP+  EGL RR +  IA  V+ MGFNCVRLT  TY+ 
Sbjct  34    RWVVG-ADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTCPTYLA  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++ +  S    G+ E+++G+  NNP LL L L+D  + VV  + R+ IM++LDN
Sbjct  93    TNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG  YFDP+EWL GL  +A +F+ T  VVG+SLRNELRGP  N
Sbjct  153   QMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPYAN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +WY+Y+++GA+A++ ANP++LVI+SGL +D    F+            K+V+E H Y 
Sbjct  213   VSLWYRYMKEGAEAVHTANPDVLVILSGLEFDNTLNFVVPN-QIHLSFTGKLVFEQHWYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G +  W     N VC  +   ++ K  FL++ G   PLF SEFG +  G    DNR+
Sbjct  272   FSDGGN--WESQNQNDVCGMVVGFIKNKGLFLLQQG--WPLFFSEFGFDMSGTHTGDNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  LQ
Sbjct  328   LTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQ  387

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P   +S+  Y +++HPLSG C  V   + + +  C   S          + +  +
Sbjct  388   SPFQGPGLPNSQEPYNVIFHPLSGLCVVVKSSEALELGPCD-ESNAWNYTSTHELVLQHT  446

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANK-GDNGLVLCLDFDSSYSP  1647
              +CL    VGE+    L T C+   S+ W L SNS   ++ +   NG  +CLD   +   
Sbjct  447   GQCLQAKSVGEN--AQLGTDCSK-SSSKWQLISNSGMHVSTELTKNGTGVCLD---ATPD  500

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
               I T  C  L    + NP++QWFK+I S+
Sbjct  501   GIITTNPCKCLTGDPICNPESQWFKIILSS  530



>emb|CAH67676.1| H0510A06.1 [Oryza sativa Indica Group]
 emb|CAH66881.1| OSIGBa0158F13.12 [Oryza sativa Indica Group]
Length=553

 Score =   359 bits (922),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 213/511 (42%), Positives = 306/511 (60%), Gaps = 25/511 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACA+WA HLEP+  EGL RR +  IA  V+ MGFNCVRLTW TY+ 
Sbjct  37    RWVVG-ADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTYLA  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++ +  S   LG+ E+++G+  NNP LL L L+D  + VV  + R+ IM++LDN
Sbjct  96    TNATLASLPLRWSLERLGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG  YFDP+EWL GL  +A +F+ T  VVG+SLRNELRGP +N
Sbjct  156   QMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPYEN  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +W  Y+++GA++++ ANP++LVI+SGL +D    F+            K+V+E H Y 
Sbjct  216   VSLW--YMKEGAESVHTANPDVLVILSGLEFDNTLNFVVPN-QIHLSFTGKLVFEQHWYG  272

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G +  W     N VC  +   ++ K  FL++ G   PLF SEFG +  G    DNR+
Sbjct  273   FSDGGN--WESQNQNDVCGMVVGFIKNKGLFLLQQG--WPLFFSEFGFDMSGTHTGDNRY  328

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  LQ
Sbjct  329   LTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQ  388

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P   +S+  Y +++HPLSG C  V   + + +  C   S          + +  +
Sbjct  389   SPFQGPGLPNSQEPYNVIFHPLSGLCVVVKSSEALELGPCD-ESNAWNYTSTHELVLQHT  447

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANK-GDNGLVLCLDFDSSYSP  1647
              +CL V  VGE+    L T C+   S+ W L SNS   ++ +   NG  +CLD     +P
Sbjct  448   GQCLQVKSVGEN--AQLGTDCSK-SSSKWQLISNSGMHVSTELTKNGTRVCLD----ATP  500

Query  1648  STILTRKCVGLEEGDMR-NPQTQWFKLIASN  1737
               I+T        GD   NP++QWFK+I S+
Sbjct  501   DGIITTNPCKCLTGDPNCNPESQWFKIILSS  531



>gb|EAZ23667.1| hypothetical protein OsJ_07369 [Oryza sativa Japonica Group]
Length=583

 Score =   360 bits (923),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 185/389 (48%), Positives = 262/389 (67%), Gaps = 11/389 (3%)
 Frame = +1

Query  232   RWIMDDQSG-ERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD++G  RVKLAC +W  HLEP++ EGL  +P+  I+  V+++GFNCVRLT+   +
Sbjct  32    RWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVASLGFNCVRLTYPIAL  91

Query  409   FTR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
              T    +++TV +S    GL  A++G+ +NNP LL L L+++ +AVV+ +G  G+M++LD
Sbjct  92    ATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRAVVDSLGESGVMVILD  151

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHVS+P WCCAD DGN FFG  +FDPD W++GL  +A +F   P VVG+SLRNELRGP Q
Sbjct  152   NHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPNVVGMSLRNELRGPRQ  211

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERP---lklkmmkkkvvYET  933
             N D WY+Y++ GA+A++ ANP  LVI+ GL YD D  FL  RP         + K+V+E 
Sbjct  212   NADDWYRYMQMGAEAVHAANPAALVIMGGLGYDTDLSFLAARPVDVSFAAAERGKLVFEL  271

Query  934   HRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEA  1113
             H Y+F +  ++AW     N+VC  + R +  + GFL+  G   PLF+SEFG +  G S  
Sbjct  272   HWYSFAD--ARAWESEDANEVCGRVARGVARRGGFLLDAGF--PLFLSEFGADTRGGSRK  327

Query  1114  DNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKL  1293
             D+R+LPC  +  A+LDLDW++WALQGSY LR+G  G DE YG+   +W+  RN   LS++
Sbjct  328   DDRYLPCAAAVAAELDLDWALWALQGSYALRQGVAGADEVYGVLDWSWSKPRNATALSRI  387

Query  1294  EFLQQKLQDPMSSEPT-YQLLYHPLSGRC  1377
             + LQ+ L+ P   E   Y +L+HPL+GRC
Sbjct  388   QSLQRPLRGPGYDEARPYTVLFHPLTGRC  416



>emb|CAD41089.2| OSJNBb0011N17.6 [Oryza sativa Japonica Group]
 gb|EAZ31113.1| hypothetical protein OsJ_15211 [Oryza sativa Japonica Group]
Length=550

 Score =   358 bits (918),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 212/511 (41%), Positives = 305/511 (60%), Gaps = 25/511 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACA+WA HLEP+  EGL RR +  IA  V+ MGFNCVRLTW TY+ 
Sbjct  34    RWVVG-ADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTYLA  92

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++ +  S    G+ E+++G+  NNP LL L L+D  + VV  + R+ IM++LDN
Sbjct  93    TNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVILDN  152

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+  DGN FFG  YFDP+EWL GL  +A +F+ T  VVG+SLRNELRGP +N
Sbjct  153   QMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPYEN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +W  Y+++GA++++ ANP++LVI+SGL +D    F+            K+V+E H Y 
Sbjct  213   VSLW--YMKEGAESVHTANPDVLVILSGLEFDNTLNFVVPN-QIHLSFTGKLVFEQHWYG  269

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++G +  W     N VC  +   ++ K  FL++ G   PLF SEFG +  G    DNR+
Sbjct  270   FSDGGN--WESQNQNDVCGMVVGFIKNKGLFLLQQG--WPLFFSEFGFDMSGTHTGDNRY  325

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C LS  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  LQ
Sbjct  326   LTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQ  385

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P   +S+  Y +++HPLSG C  V   + + +  C   S          + +  +
Sbjct  386   SPFQGPGLPNSQEPYNVIFHPLSGLCVVVKSSEALELGPCD-ESNAWNYTSTHELVLQHT  444

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANK-GDNGLVLCLDFDSSYSP  1647
              +CL V  VGE+    L T C+   S+ W L SNS   ++ +   NG  +CLD     +P
Sbjct  445   GQCLQVKSVGEN--AQLGTDCSK-SSSKWQLISNSGMHVSTELTKNGTRVCLD----ATP  497

Query  1648  STILTRKCVGLEEGDMR-NPQTQWFKLIASN  1737
               I+T        GD   NP++QWFK+I S+
Sbjct  498   DGIITTNPCKCLTGDPNCNPESQWFKIILSS  528



>ref|XP_010658499.1| PREDICTED: uncharacterized protein LOC100267356 isoform X2 [Vitis 
vinifera]
Length=502

 Score =   356 bits (914),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 240/364 (66%), Gaps = 5/364 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+ +G RVK+AC +W  HLEP++ EG+  +P+ +IA  V  MGFNC+RLT+AT+M+
Sbjct  70    RWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLTYATFMW  129

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             TR  Y N TV QS     LT+A  G+A NNP LL+L ++DA +AVV E+G HG+M+VLDN
Sbjct  130   TRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGLMLVLDN  189

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVSKP+WCCA  DGN FFG +YFDP EW++GL  V+  FK+ P VV +S+RNE+RG   N
Sbjct  190   HVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEMRGARSN  249

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y+ KGAKAI+ ANP +LVI+SGL++D D  FL  R      +  KVV+E H Y 
Sbjct  250   VPDWYRYMRKGAKAIHKANPKVLVIVSGLNFDKDLSFLG-RKSFGFTLNNKVVFEAHWYT  308

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F   Q   W + P N+ C     E +    FL  G    PLF+SE+GIN    S+ D+R+
Sbjct  309   FDFTQQ--WQQLPPNRACRQRADEFQRDAAFLTTGDKAAPLFISEYGINLQETSQVDSRY  366

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C L  +A+ DLDW++W LQ SY+ R+G  G  E+Y +   +W+  R P FL ++  LQ
Sbjct  367   FTCFLPTVAEKDLDWALWTLQASYHYRQGHAGGGESYSVLDYSWSKPRYPQFLERMVILQ  426

Query  1306  QKLQ  1317
               LQ
Sbjct  427   NLLQ  430



>ref|XP_010261410.1| PREDICTED: uncharacterized protein LOC104600255 [Nelumbo nucifera]
Length=418

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 249/376 (66%), Gaps = 11/376 (3%)
 Frame = +1

Query  298   LEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRY--ANMTVVQSFGDLGLTEA  471
             ++PML EGLD++PL  I   VS++GFNCVRLTWATYMFTR   A  TV +S   +GLTEA
Sbjct  1     MQPMLAEGLDKKPLRDIVGLVSSLGFNCVRLTWATYMFTRTRAAQRTVAESLDSMGLTEA  60

Query  472   ISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVY  651
              +G+A NNP+LL+L +V A   V+ E+G  G+M+VLDNHVS P WCC  +DGN FFG  Y
Sbjct  61    KAGVARNNPSLLNLTVVQAYGTVINELGAAGLMVVLDNHVSLPKWCCGSNDGNGFFGDAY  120

Query  652   FDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNL  831
             F+PDEW++GL  VA  FK  P VVG+S+RNELRGP QN   W++Y++ GA+ I+  NP+L
Sbjct  121   FNPDEWVEGLGRVAKRFKGRPQVVGMSMRNELRGPRQNEQDWFRYIQLGARKIHKMNPDL  180

Query  832   LVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDIT  1011
             LVI+SGLSYD D  FL  R         K+VYE H Y+F++ + +  M+ P + VC +  
Sbjct  181   LVIVSGLSYDTDLSFLG-RKSLGVNFNNKLVYEAHWYSFSDDRRQWEMQQP-SPVCANAI  238

Query  1012  REMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQG  1191
             R  +   GF++R  NP PLFVSEFG++Q G + ADNR L C L++ A+ DLDW++WALQG
Sbjct  239   RRFDGAAGFVMRSKNPVPLFVSEFGVDQRGVNRADNRFLSCFLAFAAERDLDWAMWALQG  298

Query  1192  SYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSG  1371
             SYYLR G+ G +ETYG+   +W   RNP F  +   +Q  +Q  MSS     L+      
Sbjct  299   SYYLRNGRAGFEETYGVLDASWDQPRNPKFQERFRLIQNLMQG-MSSPSVRPLIL-----  352

Query  1372  RCARVVGDQIHMSDCS  1419
              C  V+  + H++  S
Sbjct  353   -CLSVLNTRKHLTPLS  367



>gb|EPS64690.1| hypothetical protein M569_10090, partial [Genlisea aurea]
Length=389

 Score =   352 bits (903),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/392 (46%), Positives = 254/392 (65%), Gaps = 7/392 (2%)
 Frame = +1

Query  286   WAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTR--YANMTVVQSFGDLG  459
             W+ H++ +LPEGLD++PLS IA  +   GFNCVR+  ATYMFTR  Y N+T+ Q+     
Sbjct  1     WSAHMDLLLPEGLDKQPLSAIAAKIQAAGFNCVRMNTATYMFTRLEYGNVTIPQTLDLFP  60

Query  460   LTEAISGLAsnn--pnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNS  633
             +  A +G+A NN     +  N++D   A V+E+G+  +M+++DNHVS P WCC++ DGN 
Sbjct  61    VPGAKAGVARNNPGLLGVEKNVLDGLMAAVDELGKRNLMVIVDNHVSSPGWCCSNDDGNG  120

Query  634   FFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAIN  813
             FFG  +FDP EWL+GL I+ANIFK  P V+G+SLRNELRG  QN   WYK++ +GA A++
Sbjct  121   FFGDQFFDPYEWLRGLIIMANIFKHHPAVIGISLRNELRGSRQNEAEWYKFMAEGAMAVH  180

Query  814   NANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNK  993
               NP+ LVI+SGLSY  D  FL   PL +  +  K+VYE H YAF  G S        N 
Sbjct  181   KENPDFLVIVSGLSYAGDLGFLHRTPLGVGNLGNKLVYEAHWYAF--GNSAQKWAARTNY  238

Query  994   VCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWS  1173
             +C  IT  + +K  F+ +G NP PLF+SEFGI+Q G +EADNR++ C+L+ +A+LD+DWS
Sbjct  239   LCGLITNSIIDKFMFVTQGQNPFPLFLSEFGIDQRGINEADNRYISCLLATVAELDVDWS  298

Query  1174  VWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLL  1353
             +W  QGSY+LR+G    +ETYG+   NW   RNP FLS+L+ + + +    +  P Y+ L
Sbjct  299   LWTFQGSYFLRQGNANFEETYGVMDFNWNQFRNPQFLSRLDMI-RAINIANNQSPIYRKL  357

Query  1354  YHPLSGRCARVVGDQIHMSDCSGASRCIQEAD  1449
             +HP SG+C   +   + + +C  A+      D
Sbjct  358   FHPQSGKCLGALDGSVFLVNCKAATLWANHVD  389



>gb|KHN06535.1| Endoglucanase [Glycine soja]
Length=474

 Score =   354 bits (909),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 198/461 (43%), Positives = 292/461 (63%), Gaps = 15/461 (3%)
 Frame = +1

Query  367   MGFNCVRLTWATYMFTR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAV  540
             MGFNCVRLTW   + T    A++TV  SF +L L E+I+G+ +NNP+++ L L+ A +AV
Sbjct  1     MGFNCVRLTWPIVLVTNDSLASLTVRSSFQNLALLESIAGVQTNNPSIIDLPLIQAFQAV  60

Query  541   VEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMV  720
             V+ +G + +M++LDNH+++P WCC++ DGN FFG  +FDP++W+ GL  +A++F     V
Sbjct  61    VKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKFFDPNQWILGLTKMASLFNGVTNV  120

Query  721   VGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlkl  900
             VG+SLRNELRGP QNV+ WYKY+ KGA+AI+ ANP++LVI+SGL++D D  F++ RP   
Sbjct  121   VGMSLRNELRGPKQNVNDWYKYMVKGAEAIHAANPDVLVILSGLNFDKDLSFIQNRP-VS  179

Query  901   kmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSE  1080
                K K+VYE H YAFT+GQ  AW+ G  N+VC  +   M    GFLV  G   PLF+SE
Sbjct  180   LTFKGKLVYEAHWYAFTDGQ--AWVNGNPNQVCGQVAGNMMRTSGFLVNQG--WPLFISE  235

Query  1081  FGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWT  1260
             FG +  G +  DNR+L C L+  A+LDLDW++W L GSYY R+G  G +E YG+ + +WT
Sbjct  236   FGGDLRGTNVNDNRYLNCFLAVAAELDLDWALWTLVGSYYFRQGVIGMEEFYGILSWDWT  295

Query  1261  ALRNPNFLSKLEFLQQKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASR  1431
              +RN  FL+++  LQ   + P ++    Y+L++HPL+G C   + + D + +  C   S 
Sbjct  296   QVRNTTFLNRISALQLPFRGPGITRGNPYKLIFHPLTGLCVIRKSLLDPLTLGPCY-LSD  354

Query  1432  CIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGL  1611
               +    K + + G+  C+    E +P  L  IC+D  S  W + S+S   L++K  +  
Sbjct  355   GWKYTPQKILSIKGTYFCIQAENEGMPAKLGIICSDPNSR-WEMISDSKLHLSSKLSDDS  413

Query  1612  VLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
              +CLD D +   + I+T  C  L      +P +QWFKLI S
Sbjct  414   NVCLDVDDN---NNIVTNACKCLSRDRTCDPSSQWFKLIDS  451



>ref|XP_004975262.1| PREDICTED: uncharacterized protein LOC101779133 [Setaria italica]
Length=595

 Score =   358 bits (919),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 215/519 (41%), Positives = 298/519 (57%), Gaps = 26/519 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D++ G RVKLAC +WA HLEPML EGL   PL  IA  V+ MGFNCVRLTW T++ 
Sbjct  57    RWVVDER-GRRVKLACVNWASHLEPMLAEGLGHLPLGAIAAGVAAMGFNCVRLTWPTFLV  115

Query  412   TRYAN--MTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T  A+  +TV  S   L LT A++G+ +NNP  L L+L DA  AVV  +G  G+M++LDN
Sbjct  116   TDAASSSLTVADSLRRLNLTAALAGVGANNPGFLGLSLADAFGAVVRGLGDSGVMVILDN  175

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS+P WCC   DGN FFG   FDPD W++GL  +A +F     VVG+SLRNELRGP QN
Sbjct  176   HVSRPGWCCRAGDGNGFFGDADFDPDVWVEGLRRMAAMFAGEENVVGMSLRNELRGPRQN  235

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                WY+Y+++GA+A++ ANP +LVI+SGL+ D D  FL  RP        KV +E H Y+
Sbjct  236   TADWYRYMQRGAEAVHAANPRVLVILSGLNNDNDLAFLNRRP-VHLTFSNKVAFEVHWYS  294

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++     W+ G  N+VC  +   +  +  +L+  G   P+ +SEFG++  G + ADNR+
Sbjct  295   FSDPHQ--WLAGNANQVCARVAASVARRTLYLL--GRGWPVILSEFGVDNRGGNAADNRY  350

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C+ +  A LDLDW++WALQGSYYLREG  G DE YG+   +W   RN   L ++  LQ
Sbjct  351   WGCVAAAAAGLDLDWALWALQGSYYLREGVAGHDEAYGVLGHDWLRPRNGTALRRVRALQ  410

Query  1306  QKLQDPMSSEPT-YQLLYHPLSGRCA---RVVGDQIHMSDCSGASRCIQEADGKPIHMIG  1473
             +  + P   E   Y  L+HP +G C    R     + +  C+         + + +    
Sbjct  411   RPFRGPGLDEAAPYDALFHPATGLCVVRRRRSSLTLELGPCNETEAWEYNPEHRLVLRGS  470

Query  1474  SLK-CLAVVGEDLPLTLS---TICNDGQSNTWSLASNSMFQLANKGDNGL------VLCL  1623
              L+ CL   G   P+ L      C   Q+  W L S S   +A             +LCL
Sbjct  471   WLRPCLRAEGAGRPVRLGVGRAGCAGAQAR-WLLESKSKLHVAVHAPPSSSSSRSEILCL  529

Query  1624  DFDSSYSPSTILTRKCVGLEEGDMR-NPQTQWFKLIASN  1737
             D   S    +I+T +C  L  G  R +P++QWFKL++S 
Sbjct  530   DV--SADGRSIVTNRCRCLSGGSSRCDPESQWFKLVSST  566



>gb|KFK33555.1| hypothetical protein AALP_AA5G028800 [Arabis alpina]
Length=552

 Score =   356 bits (913),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 207/514 (40%), Positives = 305/514 (59%), Gaps = 28/514 (5%)
 Frame = +1

Query  232   RWIMDDQS-GERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD + G RVKL C +W  HLE  + EGL ++PL  IA  + +MGFNCVRLTW  Y+
Sbjct  30    RWIVDDSNHGRRVKLTCINWPSHLETAVAEGLSKQPLDSIADKIFSMGFNCVRLTWPLYL  89

Query  409   FTRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVL  579
              T  +    MTV QS     L EA+SG   NNP++L L L+ A + VV  +G HG+M++L
Sbjct  90    ATDESFSGVMTVRQSLRKFRLFEAVSGFQVNNPSILDLPLIKAFQEVVTCLGNHGLMVIL  149

Query  580   DNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKD-TPMVVGVSLRNELRGP  756
             DNH+S+P WCC  +DGN FFG  + +P  W++GL  +A++F + +  VVG+SLRNELRGP
Sbjct  150   DNHISQPGWCCNANDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVVGMSLRNELRGP  209

Query  757   LQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETH  936
              QN++ WYKY+ +GA+A+++ NP++LVI+SGL+Y+ D  FL+ER  ++   +K V +E H
Sbjct  210   KQNINDWYKYMREGAEAVHSVNPDILVIVSGLNYETDLSFLRERAFEVSFRRKLV-FEIH  268

Query  937   RYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEAD  1116
              Y F      +W    LNK+C   T  + +  GFL+  G   PLFVSEFG++Q G++  D
Sbjct  269   WYGFWN----SWEGENLNKICGRETENIMKMSGFLLEKG--IPLFVSEFGVDQRGNNAND  322

Query  1117  NRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLE  1296
             N  L C ++  ADLDLDW++W + GSYY+RE     DETYG+   NW+++RN   L  + 
Sbjct  323   NMFLSCFMALAADLDLDWALWTVVGSYYVREKTIEYDETYGVLDWNWSSIRNSTMLQMIS  382

Query  1297  FLQQKLQDP--MSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
              +Q   + P  M + P  ++++HP +G C  R    Q+ +  C        E+     H 
Sbjct  383   SIQSPFRGPGLMETHPK-KIMFHPSTGLCVVRKSLFQLKLGSCDKP-----ESWRLTSHR  436

Query  1468  IGSLK-----CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFD  1632
             + SL+     CL    +   + L         + W L S S  Q+++   +G  +CLD D
Sbjct  437   VLSLREEEIFCLKAYEKGKSVKLRVFFFGLYCSKWKLKSESKMQISSVSRSGNSVCLDVD  496

Query  1633  SSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             S    + I+T  C  L+     +P++QWFKL+ S
Sbjct  497   S--ENNNIVTNSCKCLKGNSSCDPRSQWFKLVTS  528



>ref|XP_004143962.1| PREDICTED: uncharacterized protein LOC101211675 [Cucumis sativus]
 ref|XP_004170741.1| PREDICTED: uncharacterized protein LOC101224959 [Cucumis sativus]
 gb|KGN50046.1| hypothetical protein Csa_5G151620 [Cucumis sativus]
Length=479

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 291/485 (60%), Gaps = 14/485 (3%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRYANMTVVQSFGDLGLTEAISGLA  486
             ML +GLD+R L  +A  + +  FNCVRLTW+T+MFTRY++MT++    +L +    SG+ 
Sbjct  1     MLAQGLDKRTLKDLANDIISRDFNCVRLTWSTHMFTRYSHMTIIDVLDNLDIQNVKSGVQ  60

Query  487   snnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDE  666
              +NP +L++ +  A K VV  +G  G+M+VLDNH+S+P WCC+  DGN FFG  +FD  E
Sbjct  61    KHNPKMLNMTVDHAFKTVVYGLGNAGLMIVLDNHISQPRWCCSLDDGNGFFGDRHFDTLE  120

Query  667   WLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIIS  846
             WLQGL  VA  F     V+G+SLRNELRGP  N+D WYKYV++G+  I+  N  LLVIIS
Sbjct  121   WLQGLDYVARHFTWHSQVIGMSLRNELRGPYTNMDNWYKYVKEGSHLIHTKNRKLLVIIS  180

Query  847   GLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQS---KAWMKGPLNKVCHDITRE  1017
             G+++D D  FLK++      +  KVV E H Y F+  +      ++K PLN VC+ +  +
Sbjct  181   GITFDNDLSFLKKKS-LGYNLHNKVVLEAHLYPFSGSEKLPESKFVKKPLNIVCNQVMEK  239

Query  1018  MEEKEGFLVRGGN-PGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGS  1194
              E + GF+V   + P PL++SEFG +  GD++A NR + C L+++   DLDW+ WA QG+
Sbjct  240   FEREAGFVVNMEDEPYPLWLSEFGYDLRGDNKAQNRFMSCFLAHIVAKDLDWAYWAFQGT  299

Query  1195  YYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGR  1374
             Y  R+G+   DET+G+  + WT  RNP     L+  ++  QDP S+     ++ HP+SG+
Sbjct  300   YMYRQGQESVDETFGVMDSTWTNDRNPQLNQMLQLAKRINQDPNSNASMSYIILHPVSGQ  359

Query  1375  CARVVGD-QIHMSDCSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSN  1551
             C R  G   I + DC   +      DG  + +    +CL   G+  PL +S  C+   S 
Sbjct  360   CIRSNGQGGIVLGDCLTPTHWTHSGDGSSMKLSNG-QCLQSAGDGKPLIVSAECSSDGSK  418

Query  1552  TWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKCVGLEE--GDMRNPQTQWFKL  1725
              W++AS +  QLA K   G   CL+  S+   + I+ ++C+ LE+      +PQ QWFKL
Sbjct  419   -WTMASKAKLQLATKS-GGENFCLEKKSN---TKIVVKRCICLEDELNCFNDPQPQWFKL  473

Query  1726  IASNT  1740
             + +N 
Sbjct  474   VPTNV  478



>gb|EMT27118.1| hypothetical protein F775_19072 [Aegilops tauschii]
Length=571

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 211/518 (41%), Positives = 296/518 (57%), Gaps = 26/518 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++D   G RVKL CA+ A HLEP+  EGL RR +  IA  V+ MGFNCVRLTW TY+ 
Sbjct  38    RWLVD-ADGRRVKLVCANGASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTYLA  96

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDA-----------RKAVVEEI  552
             T    +++ +  S   LGL E+ +G+  NNP+LL L L+D             + VV  +
Sbjct  97    TNATLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFRVSSWVWGSPEEEVVSAL  156

Query  553   GRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVS  732
               + IM++LDN ++ P WCC+  DGN FFG  YFDP+EWL+GL+ +A +F+DT  VVG+S
Sbjct  157   ASNSIMVILDNQMTTPGWCCSRTDGNGFFGDKYFDPEEWLRGLSAMAAVFRDTKNVVGMS  216

Query  733   LRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmk  912
             LRNELRGP QNV +WY+Y+++GA+A++ ANPN+LVI+SGL +D    FL  +        
Sbjct  217   LRNELRGPYQNVSLWYRYMQQGAEAVHAANPNVLVILSGLDFDNSLSFLSPK-QVKLSFT  275

Query  913   kkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGIN  1092
              K+V+E H Y F++G    W     N  C      +  K  FL++ G   PLF SE G +
Sbjct  276   GKLVFEQHWYGFSDGTD--WENWNQNDACGVAVESIRTKGLFLLQQG--WPLFFSEIGFD  331

Query  1093  QMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRN  1272
               G   ADNR+L C LS  A++DLDW+VWAL+GSYY+REG    DETYG+ T +W   RN
Sbjct  332   MSGTHIADNRYLTCFLSVAAEMDLDWAVWALEGSYYIREGILAYDETYGLLTWDWYTARN  391

Query  1273  PNFLSKLEFLQQKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEA  1446
             P+F+ ++  LQ   Q P   SS   Y++++HPL+G C  V    +        S      
Sbjct  392   PSFIERINSLQSPFQGPGLPSSHQPYKVIFHPLTGLCVLVESANVLKLGPCDESDAWNYT  451

Query  1447  DGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQL-ANKGDNGLVLCL  1623
                 + +  + +CL          L T C+   S  W L S+S   + A    NG  +CL
Sbjct  452   SAYELVLKHTGQCLEAKSVGDTAKLGTGCSKSCSK-WQLISDSRMHVSAELTKNGTRVCL  510

Query  1624  DFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             +         I T +C  L E    +P++QWFK+I+S+
Sbjct  511   EAGPD---GVITTDQCKCLTEDPTCDPESQWFKVISSS  545



>ref|XP_003621368.1| Endoglucanase [Medicago truncatula]
 gb|AES77586.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=457

 Score =   351 bits (900),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 186/451 (41%), Positives = 274/451 (61%), Gaps = 35/451 (8%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL C +W+ H+  M+ EGLD  PL  +   +  +GF+CVR TWATYMF
Sbjct  32    RWIVD-ETGKRVKLHCVNWSSHMNAMVAEGLDAIPLKDVIAQLKGLGFDCVRYTWATYMF  90

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+N  V ++   L LT +  G+ + NP+L S+ +V+A   VV+E G+ G+M++ DNHV
Sbjct  91    TRYSNYKVGENLDKLNLTSSRLGIGNFNPSLESITVVEAFDFVVDEFGKQGMMVLADNHV  150

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S P WCC ++DGN  FG  YF+ +EWLQGL+ VAN  K  P +V V LRNELRGP QN D
Sbjct  151   SDPKWCCDNNDGNGCFGDQYFNLEEWLQGLSNVANRVKGKPQIVAVGLRNELRGPGQNND  210

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              WYKY+ +G   ++ ANPN+LV +SGL+YD D  FLK +P     +  K+VYE H YA  
Sbjct  211   NWYKYMSQGVTTVHKANPNVLVFVSGLNYDTDLSFLKTKP-LNVNIGDKLVYEVHSYA--  267

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
                                        GFL+ G NP PL ++EFG++     + + R+L 
Sbjct  268   ---------------------------GFLMSGSNPNPLVMTEFGMDMENIDDQNQRYLS  300

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             C+L+YL  +DLDW++WA QGSYY+RE ++   E YG+++ ++++LR   F  + + LQ+K
Sbjct  301   CILAYLGGVDLDWALWAAQGSYYIREKENIVREHYGLWSIDFSSLRYQEFPQRFQLLQKK  360

Query  1312  LQDPMSSEPTYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPIHMIGSLKCL  1488
             L +P S+     ++YHPLSG+C +V   +++ +  C  AS+  QE  G+ I ++G+   +
Sbjct  361   LLEPSSNSSKSYIIYHPLSGQCVKVNSNNELELGHCEWASKWNQE--GQHIKLVGNGTYI  418

Query  1489  AVVGEDLPLTLSTICNDGQSNTWSLASNSMF  1581
                 +   + LS  C   QS  W   S S +
Sbjct  419   EANSDGSKVKLSKDCKSKQS-FWKTLSTSQW  448



>ref|XP_003621386.1| Endoglucanase E1 [Medicago truncatula]
Length=416

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/361 (46%), Positives = 241/361 (67%), Gaps = 2/361 (1%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+RVKL C +W+ HL  M+ EGL+ +PL  +   +  +GF+CVR TWAT+MF
Sbjct  31    RWIID-ETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTWATHMF  89

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY+N  V ++   L LT +  G+ + NP+L ++ +V+A   V++E G+ G+M+++DNHV
Sbjct  90    TRYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMMVLVDNHV  149

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
             S P WCC + DGN FFG  Y DP EWLQGL+ VAN  K    VV V LRNELRGP QN+D
Sbjct  150   SDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAVGLRNELRGPGQNID  209

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFT  951
              W KY+ +GA  ++  NPN+LV +SG +YD D  FLK  P     +  K+VYE H YA++
Sbjct  210   NWQKYMSQGATTVHKENPNVLVFVSGFNYDTDLSFLKTNP-LNTSIGDKLVYEVHSYAWS  268

Query  952   EGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLP  1131
              G  K W+  PLN+ C ++   + ++ GFL+ G NP PL +SEFG++     + + R L 
Sbjct  269   TGSPKDWIVKPLNQKCANVMNGLNDRAGFLMSGSNPNPLVMSEFGLDMTDMDDKNQRFLS  328

Query  1132  CMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQK  1311
             CML+YLA +DLDW++W  QGSYY+RE +    E YG++  ++ +LR P+F  + + +Q+K
Sbjct  329   CMLAYLAGVDLDWALWTAQGSYYIREKESNVSEHYGLWNIDFKSLRYPDFPQRFQLVQKK  388

Query  1312  L  1314
             L
Sbjct  389   L  389



>gb|KHN19917.1| hypothetical protein glysoja_032397 [Glycine soja]
Length=464

 Score =   350 bits (898),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 292/462 (63%), Gaps = 16/462 (3%)
 Frame = +1

Query  367   MGFNCVRLTWATYMFTR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAV  540
             MGFNCVRLTW  ++ T    A++T+  SF +LGL ++++G+ + NP+++ L L+ A +AV
Sbjct  1     MGFNCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAV  60

Query  541   VEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMV  720
             V+ +G + +M++LDNHVS+P WCC++ DGN FFG  YFDPD W+ GL  +A IFK    V
Sbjct  61    VKSLGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNV  120

Query  721   VGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlkl  900
             V +SLRNELRGP QNV+VWY+Y+ KGA+A++ ANP++LVI+SGL++D +  F++      
Sbjct  121   VAMSLRNELRGPRQNVNVWYRYMPKGAEAVHAANPDVLVILSGLNFDTNLSFIRNE-AVK  179

Query  901   kmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSE  1080
                  K+V+E H Y+F++GQ  AW  G  N+VC  +T  +  + GFL+  G   PLFVSE
Sbjct  180   LSFNGKLVFEVHWYSFSDGQ--AWTLGNPNQVCGQVTENVMRRAGFLLDQG--WPLFVSE  235

Query  1081  FGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWT  1260
             FG++  G S  DNR+L C ++ +A LDLDW++W L G+YY+R+G  G +E +G+  ++W 
Sbjct  236   FGVDLRGTSVNDNRYLNCFMALVAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILNSDWI  295

Query  1261  ALRNPNFLSKLEFLQQKLQDP-MSSEPTYQLLYHPLSGRCA---RVVGDQIHMSDCSGAS  1428
              +RN +FL ++  +Q   + P +S    Y++++HPL+G C      V   + +  CS  S
Sbjct  296   QVRNTSFLQRISAIQLPFKGPGLSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPCSN-S  354

Query  1429  RCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNG  1608
                +  D K + + G+  CL    E     L   C+ G ++ W + S+S   L+ + +N 
Sbjct  355   DAWEYTDQKILSIKGTYFCLQAEEEGKQAKLGNACS-GSNSRWEMISDSKMHLSTQTNNA  413

Query  1609  LVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
               +CLD D++   + I+T  C  L + +  +P TQWFKL+ S
Sbjct  414   SGVCLDVDTN---NIIVTNICQCLSKDNTCDPATQWFKLVDS  452



>ref|XP_006395579.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32865.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=507

 Score =   350 bits (897),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 203/506 (40%), Positives = 292/506 (58%), Gaps = 44/506 (9%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLACA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  35    RWIIDEK-GQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVRLTWPLDLA  93

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL   +SG  +NNP+++ L L++A K +V  +G H +M++LD
Sbjct  94    TNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGNHNVMVILD  153

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH +KP WCC + DGN FFG  +FDP  W+ GL  +A IFKD   VVG+SLRNELRGP Q
Sbjct  154   NHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGMSLRNELRGPKQ  213

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANPN+LVIISGLS+D D  F++ RP        K+V+E HRY
Sbjct  214   NVDDWFKYMQQGAEAVHGANPNVLVIISGLSFDTDLSFVRSRP-VTLTFSGKLVFELHRY  272

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT   ++ W     N  C ++ + +++  GF +R     P+F+SEFGI+  G +  DNR
Sbjct  273   AFT--NTEIWSSKNPNDACGEVQKIIDDGGGFNLRD---FPVFLSEFGIDLRGGNVNDNR  327

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+L + A+ D+DWS+WAL GSYY+REG  G  E YG                     
Sbjct  328   YIGCILGWAAENDVDWSIWALTGSYYIREGVAGMVEYYG---------------------  366

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVG---DQIHMSDCSGASRCIQEADGKPIHMIG  1473
                   P+     Y L++HPL+G C        +++ +  C+ + +     D        
Sbjct  367   ------PVPQPKVYNLVFHPLTGLCMVQTSSDPNKVTLGTCNTSPQWSYTLDNTLKIKDK  420

Query  1474  SLKCLAVVGEDLPLTLS-TICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
             SL CL   G +  + LS T C     + W   S S+  L     +   LCLD D  +   
Sbjct  421   SL-CLENTGPNQRVKLSETSCWSPNLSKWQTISGSINMLLASKSSDNSLCLDVD-GHKNI  478

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLI  1728
                  KCV  E+    +P +QWFK++
Sbjct  479   VATNCKCVKGEDSSC-DPTSQWFKIV  503



>ref|XP_002452393.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
 gb|EES05369.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
Length=570

 Score =   350 bits (897),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 210/534 (39%), Positives = 301/534 (56%), Gaps = 43/534 (8%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKLAC +W  HL+P++ EGL R+P+  I   + +MGFNCVRLT+   + 
Sbjct  37    RWIVD-PAGHRVKLACVNWPSHLDPVVTEGLGRQPVGAITGMIVSMGFNCVRLTYPIALA  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    + +TV QS    GL+E + G+  NNP+ L L L+D+ KAVV  +G   +M++LDN
Sbjct  96    TNASLSALTVRQSLLAHGLSETVGGVEVNNPSFLDLTLIDSLKAVVNALGEKNVMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+S P WCC++ DGN FFG   FDP+ W+ GL  +A  F D P VVG+SLRNELRGP QN
Sbjct  156   HISTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATTFADVPNVVGMSLRNELRGPRQN  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklk-mmkkkvvYETHRY  942
              + WY Y+++GA+A++ ANP  LVI+ GLSYD D  FL  R + +    + K+V+E H Y
Sbjct  216   SEDWYTYMQRGAEAVHAANPRALVIMGGLSYDYDLSFLAARQVGVSFAAENKLVFEVHWY  275

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++  ++AW     N+VC    R+   +  FL+ GG   PLF+SEFG +  G    DNR
Sbjct  276   SFSD--ARAWEAEGANEVCGRAARDFARRGAFLLAGGF--PLFLSEFGADSRGGDRKDNR  331

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             + PC  +  A+ D+DW+ WALQGSY LR+G  G DE YG+   +W+  RN   L +++ L
Sbjct  332   YFPCAAAVAAEHDVDWAYWALQGSYALRQGVVGMDEVYGVLDWSWSKPRNQTVLPRIQAL  391

Query  1303  QQKLQDPMSSEP-TYQLLYHPLSGRC-----ARVVGDQIHMSDCS----------GASRC  1434
             Q+ LQ P   E   Y +L+HPL+G C     +      + +  C+           ++  
Sbjct  392   QRPLQGPGYGEALPYTVLFHPLTGLCAVRRASAAAATTLELGPCNETDAWAYAPPSSTLV  451

Query  1435  IQEADGKPIHMIGSLKCLAVVGEDLPLTLST-ICNDGQSNTWSLASNSMFQLA-------  1590
             +++A        G   CL   G   P  L T  C D  S TW LA++S   +A       
Sbjct  452   LRDAAAA---AGGLPTCLRAEGRGQPARLGTNACGDPLS-TWRLATDSAMHVAVDAAALG  507

Query  1591  -----NKGDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
                  + G    +LCLD  +     +I+T  C         +P+ QWFKL+ S 
Sbjct  508   LGGGEDGGGGSGMLCLDVGT--DGRSIVTNPCACQRGDGACDPEGQWFKLVTST  559



>gb|KDO82155.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=435

 Score =   343 bits (879),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 248/369 (67%), Gaps = 8/369 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G RVKLAC +W  HLEP++ EGL ++P+  ++  V  MGFNCVRLTW  Y+ 
Sbjct  44    RWIVD-ENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLA  102

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV QSF  LGL EAI G+ SNNP+++ L L+ A +AVV  +G + +M++LDN
Sbjct  103   TNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDN  162

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YF+PD W++GL  +A IF     VVG+SLRNELRGP QN
Sbjct  163   HISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQN  222

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y++ GA+A++ ANP +LVI+SGL++D D  F++ +         K+V+E H Y 
Sbjct  223   VKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQA-VNLTFTGKLVFEAHWYG  281

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW+ G  N+VC  +   +    GFL+  G   PLFVSEFG +  G++  DNR+
Sbjct  282   FTDGQ--AWVDGNPNQVCGRVVDNVMRLSGFLLEQG--WPLFVSEFGADLRGNNVNDNRY  337

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     A+LD DW++W L GSYYLREG  G +E YG+F  NW  +RN +FL ++  LQ
Sbjct  338   LNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQ  397

Query  1306  QKLQDPMSS  1332
                +  + S
Sbjct  398   SPFRGTLLS  406



>ref|XP_010458756.1| PREDICTED: uncharacterized protein LOC104739968 isoform X2 [Camelina 
sativa]
Length=516

 Score =   345 bits (886),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 192/505 (38%), Positives = 294/505 (58%), Gaps = 46/505 (9%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+R+KL CA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVDEK-GQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVRLTWPLDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL + I G  +NNP+++ L+L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGNNNVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCCA++DGN FFG  +FDP  W+  L  +A  F     VVG+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN N+LVI+SGLS+D D  F++ RP+              + 
Sbjct  219   NVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDSDLSFVRSRPV--------------KL  264

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT                           G+L+  G   PLF+SEFGI++ G +  D+R
Sbjct  265   SFTGNGG-----------------------GYLLNQG--FPLFLSEFGIDERGGNTNDDR  299

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C+  + A+ DLDWS+WAL GSYYLR+G  G  E YG+  ++W ++RN +FL K+  L
Sbjct  300   YIGCLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLL  359

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L++HPL+G C  + + D+  ++     S        + + +    
Sbjct  360   QSPLQGPGPQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPCNSSEPWSYTKQALRIKDQP  419

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
              CL   G + P+T++       S+ W   S S   L++   N   LCLD D++   + ++
Sbjct  420   LCLQSNGPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTASNNTSLCLDVDATN--NNVV  477

Query  1660  TRKCVGLEEGDMRNPQTQWFKLIAS  1734
                C  L +     P +QWFK+I +
Sbjct  478   ANACKCLSKDSSCEPMSQWFKIIKA  502



>ref|NP_001053105.1| Os04g0480900 [Oryza sativa Japonica Group]
 emb|CAD41088.2| OSJNBb0011N17.5 [Oryza sativa Japonica Group]
 dbj|BAF15019.1| Os04g0480900 [Oryza sativa Japonica Group]
 dbj|BAG98948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61201.1| hypothetical protein OsJ_15210 [Oryza sativa Japonica Group]
Length=554

 Score =   346 bits (888),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 207/510 (41%), Positives = 305/510 (60%), Gaps = 22/510 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACA+WA HLEP+  EGL RR L  IA  V+ MG NCVRLTW TY+ 
Sbjct  35    RWVVG-ADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTWPTYLA  93

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    AN+ +  S   LG+ E+++G+  NNP LL L L+D  + VV  + ++ IM++LDN
Sbjct  94    TNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIMVILDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+++DGN FFG  YF P+EWL+GL+ +A +F++T  VVG+SLRNELRG  +N
Sbjct  154   QMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELRGS-KN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +W++Y++ GA+ ++ ANP +LVI+SGL++D    FL            K+V+E H Y 
Sbjct  213   VSLWFRYMQLGAEVVHAANPGVLVILSGLNFDNTLDFLVPN-QIQLTFTGKLVFEQHWYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++  +  W     N  C  +   +++K  FL++ G   PLF SEFG +  G   ADNR+
Sbjct  272   FSDDGN--WGSQNQNDACGMVVDSIKKKGLFLLQQG--WPLFFSEFGFDMSGTHVADNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  LQ
Sbjct  328   LTCFLTVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQ  387

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P   +S+  Y +++HPLSG C  V   + + +  C   S       G  + +  +
Sbjct  388   SPFQGPGLPNSQQPYNVIFHPLSGLCVLVKSSEALELGPCD-KSNAWNYTKGYELILKQT  446

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP-  1647
              +CL    VGE+    L T C+   S    L+++ M       +NG  +CL+     SP 
Sbjct  447   GQCLQAKSVGEN--AKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLE----ASPD  500

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
               I T +C  L      NP++QWFK+I S+
Sbjct  501   GNITTNQCKCLTVDPNCNPESQWFKIILSS  530



>emb|CAH66880.1| OSIGBa0158F13.11 [Oryza sativa Indica Group]
Length=554

 Score =   344 bits (883),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 206/510 (40%), Positives = 304/510 (60%), Gaps = 22/510 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKL CA+WA HLEP+  EGL RR L  IA  V+ MG NCVRLTW TY+ 
Sbjct  35    RWVVG-ADGRRVKLTCANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTWPTYLA  93

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    AN+ +  S   LG+ E+++G+  NNP LL L L+D  + VV  + ++ IM++LDN
Sbjct  94    TNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIMVILDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+++DGN FFG  YF P+EWL+GL+ +A +F++T  VVG+SLRNELRG  +N
Sbjct  154   QMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELRGS-KN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +W++Y++ GA+ ++ ANP +LVI+SGL++D    FL            K+V+E H Y 
Sbjct  213   VSLWFRYMQLGAEVVHAANPGVLVILSGLNFDNTLDFLVPN-QIQLTFTGKLVFEQHWYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++  +  W     N  C  +   +++K  FL++ G   PLF SEFG +  G   ADNR+
Sbjct  272   FSDDGN--WGSQNQNDACGMVVDSIKKKGLFLLQQG--WPLFFSEFGFDMSGTHVADNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  LQ
Sbjct  328   LTCFLTVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQ  387

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P   +S+  Y +++HPLSG C  V   + + +  C   S       G  + +  +
Sbjct  388   SPFQGPGLPNSQQPYNVIFHPLSGLCVLVKSSEALELGPCD-KSNAWNYTKGYELILKQT  446

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP-  1647
              +CL    VGE+    L T C+   S    L+++ M       +NG  +CL+     SP 
Sbjct  447   GQCLQAKSVGEN--AKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLE----ASPD  500

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
               I T +C  L      NP++QWFK+I S+
Sbjct  501   GNITTNQCKCLTVDPNCNPESQWFKIILSS  530



>gb|EEC77494.1| hypothetical protein OsI_16340 [Oryza sativa Indica Group]
Length=554

 Score =   343 bits (881),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 207/510 (41%), Positives = 304/510 (60%), Gaps = 22/510 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RW++    G RVKLACA+WA HLEP+  EGL RR L  IA  V+ MG NCVRLTW TY+ 
Sbjct  35    RWLVG-ADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTWPTYLA  93

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    AN+ +  S   LG+ E+++G+  NNP LL L L+D  + VV  + ++ IM++LDN
Sbjct  94    TNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIMVILDN  153

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              ++ P WCC+++DGN FFG  YF P+EWL+GL+ +A +F++T  VVG+SLRNELRG  +N
Sbjct  154   QMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELRGS-KN  212

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V +W++Y++ GA+ ++ ANP +LVI+SGL++D    FL            K+V+E H Y 
Sbjct  213   VSLWFRYMQLGAEVVHAANPGVLVILSGLNFDNTLDFLVPN-QIQLTFTGKLVFEQHWYG  271

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++  +  W     N  C  +   +++K  F+++ G   PLF SEFG +  G   ADNR+
Sbjct  272   FSDDGN--WGSRNQNDACGMVVDFIKKKGLFILQQG--WPLFFSEFGFDMSGTHVADNRY  327

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L+  A++DLDW++WALQGSYY+REG    DE+YG+ + +W   RNP+F+ ++  LQ
Sbjct  328   LTCFLTVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQ  387

Query  1306  QKLQDP--MSSEPTYQLLYHPLSGRCARVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
                Q P   +S   Y +++HPLSG C  V   + + +  C   S       G  + +  +
Sbjct  388   SPFQGPGLPNSHQPYNVIFHPLSGLCVLVKSSEALELGPCD-KSNAWNYTKGYELILKQT  446

Query  1477  LKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP-  1647
              +CL    VGE+    L T C+   S    L+++ M       +NG  +CLD     SP 
Sbjct  447   GQCLQAKSVGEN--AKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLD----ASPD  500

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
               I T +C  L      NP++QWFK+I S+
Sbjct  501   GNITTNQCKCLTVDPDCNPESQWFKIILSS  530



>ref|XP_006400290.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
 gb|ESQ41743.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
Length=528

 Score =   342 bits (878),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 200/510 (39%), Positives = 295/510 (58%), Gaps = 26/510 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ +SG RVKLACA+W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  34    RWIVN-ESGHRVKLACANWPSHLQPVVAEGLSSQPMDSISKKIREMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP+++++ L++A +AVV  +GR+ +M++LD
Sbjct  93    INDTLAYNVTVKQSFERYGLDHELQGIHNHNPSIVNIPLINAFQAVVHSLGRNDVMVILD  152

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FFG   FDPD W+ GL  +A IF +   VVG+SLRNELRG   
Sbjct  153   NHKTVPGWCCSNGDPDAFFGDPKFDPDLWMLGLKKMATIFMNVNNVVGMSLRNELRGHNH  212

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WY Y++KGA+A++ +NPN+LVI+SGL +D D  FLK+RP      KKK+V E H Y
Sbjct  213   TAKDWYTYMQKGAEAVHTSNPNVLVILSGLEFDADLTFLKDRP-VNLSFKKKLVLELHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT+G  + W    +N  C  I  +     GFL+  G   PLF+SEFG +Q G     NR
Sbjct  272   AFTDGTGQ-WKSHNVNDFCSQIFAKERRTGGFLLEQG--LPLFLSEFGTDQRGGDFEGNR  328

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY REGK G  E YGM   NW  + N  +L +L  +
Sbjct  329   YMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHNVHNYTYLQRLSVI  388

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQE-----ADGKPIHM  1467
             Q   + P      ++ L+HPL+G C  V     H S+ +    C ++     + G  + +
Sbjct  389   QPPHKGPGIKHNHHKKLFHPLTGLCL-VRKSPCHESELT-LGPCTKDEPWSYSHGGTLEI  446

Query  1468  IGSLKCLAVVGEDL---PLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
              G  +   + GE +    + L T C   +       S +   L+ K  +G ++CLD DS 
Sbjct  447   KGGTQRSCLEGETMVGKSVKLGTRCTKVKR-----ISATKMHLSFKSKDGSLVCLDVDSD  501

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
                + +   +C  L       P +QWFK+ 
Sbjct  502   ---NNVFANRCKCLTGDSSCEPASQWFKIF  528



>ref|XP_008678767.1| PREDICTED: uncharacterized protein LOC100501654 isoform X1 [Zea 
mays]
Length=564

 Score =   343 bits (880),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 208/524 (40%), Positives = 291/524 (56%), Gaps = 28/524 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKLAC +W  HLE ++ EGL R+P+  I+  + +MGFNCVRLT+   + 
Sbjct  36    RWIVD-PAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIVSMGFNCVRLTYPIALV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    + +TV QS    GL E + G+  NNP+ L L L+++ KAVV  +G   +M++LDN
Sbjct  95    TNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKAVVNALGEKNVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS P WCC++ DGN FFG   FDP+ W+ GL  +A IF D P VVG+SLRNELRGP QN
Sbjct  155   HVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPNVVGMSLRNELRGPRQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklk-mmkkkvvYETHRY  942
                WY Y+++GA+A++ A+P  LVI+ GLSYD D  FL  R + +    + K+V+E H Y
Sbjct  215   PQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFLAARQVGVSFAAENKLVFEVHWY  274

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++  ++AW     N+VC    R+   + GFL+  G   PLF+SEFG +  G    DNR
Sbjct  275   SFSD--ARAWETESANEVCGRAARDFARRGGFLLARGF--PLFLSEFGADSRGGDPKDNR  330

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
               PC  +  A+ D+DW+ WALQGSY LR+G  G DE YG+   +W+  RN   L +++ L
Sbjct  331   FFPCAAAVAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQAL  390

Query  1303  QQKLQDPMSSEP-TYQLLYHPLSGRC----ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
             Q+ LQ P   E   Y +L+HPL+G C    A  V   + +  C+             + +
Sbjct  391   QRPLQGPGYGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGPCNETDAWAYAPPSSTLVL  450

Query  1468  ----IGSLKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLA---------NKGDN  1605
                    L CL   G   P  L    C D  S TW LA++S   +A          +   
Sbjct  451   RDAAAAGLPCLRAEGPGQPARLGIRDCGDPMS-TWRLATDSGMHVAVDAALGLGGGEDGG  509

Query  1606  GLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             G    L  D      +I+T  C         +P+ QWFKL+ S 
Sbjct  510   GGGGMLCLDVGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTST  553



>ref|XP_010549752.1| PREDICTED: uncharacterized protein LOC104820833 [Tarenaya hassleriana]
Length=531

 Score =   340 bits (873),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 195/513 (38%), Positives = 294/513 (57%), Gaps = 31/513 (6%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G RVKLACA+W  HL+P++ EGL ++P+  I+  +  MGFNCVR TW   + 
Sbjct  36    RWIVDER-GHRVKLACANWPSHLQPVVAEGLHKQPMDSISERIRFMGFNCVRFTWPLELM  94

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      ++TV QSF    L + + G+  +NP++L L L +A +AVV  +GR+G+M++LD
Sbjct  95    TNDTLAFHVTVTQSFQRYRLFQELDGIRRHNPSILHLPLFNAFEAVVSSMGRYGVMVILD  154

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC +HD ++FFG   FDP+ W+ GL  +A  F++   V+G+SLRNELRGP +
Sbjct  155   NHKTVPGWCCGNHDPDAFFGDPEFDPNLWILGLKKMAASFRNVKNVIGMSLRNELRGPKE  214

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                VWYKY+++GA+A++ +NPN+LVI+SG+++D D  FL+  P      K K+V+E H Y
Sbjct  215   YPHVWYKYMQQGAEAVHASNPNVLVILSGINFDTDLSFLEHLP-VHVSFKSKLVFELHWY  273

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G+  +W    LN  C  I  ++    GFL+  G   PLF+SEFG NQ G     NR
Sbjct  274   SFSDGRG-SWRSHNLNDFCAKILGKVRNNGGFLLEKG--FPLFLSEFGTNQGGGDGDGNR  330

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML + A+ D+DW++WAL G YYLR+GK G  ETYGM   NW  + N  FL ++  +
Sbjct  331   YMNCMLGWAAEKDVDWAIWALAGDYYLRQGKRGLVETYGMLNPNWHHIHNSTFLRRISVI  390

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC----ARVVGDQIHMSDCSGASRCIQEADGKPIHMI  1470
             Q   + P  S   +  ++HPL+G C    +R    ++ +  C            +P    
Sbjct  391   QPPYKGPGVSHNQHNRIFHPLTGFCVVRNSRKRRSELTLGPC---------GRHEPWSYN  441

Query  1471  GSLKCLAVVGEDLPLTLSTICNDG-------QSNTWSLASNSMFQLANKGDNGLVLCLDF  1629
             G +  L +      L L      G       + +     S S   L+ K   G  LCLD 
Sbjct  442   GHIGTLVMKDHRSVLCLEGDVTGGRRVKLGKKCSKIERVSASKMHLSFKTRLGSSLCLDV  501

Query  1630  DSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
             DS    + ++   C  L +    +P +QWFK++
Sbjct  502   DSM---NNVVANPCKCLSKDASCDPTSQWFKIL  531



>gb|KHN43979.1| Endoglucanase E1 [Glycine soja]
Length=471

 Score =   337 bits (863),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 200/480 (42%), Positives = 286/480 (60%), Gaps = 18/480 (4%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTR--YANMTVVQSFGDLGLTEAISG  480
             M+ EGL  RPL  IA  + +MGFNCVRLTW  Y+ T    A +TV QSF +LGL +AIS 
Sbjct  1     MVAEGLGERPLDGIAKEIKSMGFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISA  60

Query  481   LAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDP  660
             +  NNP+L+ L L+ A + VV+ +G  G+M++LDNHVSKP WCC++ DGN FFG  YFDP
Sbjct  61    VQVNNPSLIDLPLIKAYQDVVKGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDP  120

Query  661   DEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVI  840
             D W++GL  +A +FK    VV +SLRNELRGP QN + W+KY+ KGA+A++ ANP++LVI
Sbjct  121   DLWIKGLTKMATLFKGVTNVVAMSLRNELRGPRQNANDWFKYMPKGAEAVHGANPDVLVI  180

Query  841   ISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREM  1020
             +SGL+YDLD  FL+++        +K+V+E H Y+F++G S  W     N+VC  +T  +
Sbjct  181   MSGLNYDLDLSFLRKQ-QVKLSFSRKLVFELHWYSFSDGDS--WTTENPNQVCGKVTGRV  237

Query  1021  EEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYY  1200
                 G+L+  G   PL +SEFG +  G ++ DN +  C+L   A LD DW+ W L GSYY
Sbjct  238   MRSAGYLLEQGY--PLVLSEFGWDLRGTNQNDNSYFNCLLPLAAQLDFDWAYWTLAGSYY  295

Query  1201  LREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSE-PTYQLLYHPLSGRC  1377
             LREG  G  E YG+ T N T       L ++  +Q   + P  SE   +++++HPL+G C
Sbjct  296   LREGTVGLIEVYGILTQNTTLPTTTFLLQRISAIQLPYRGPGLSEVEAHKVIFHPLTGLC  355

Query  1378  ARVVGDQIHMSDCSGASRCIQEADGKPIHMIG-SLKCLAVVGEDLPLTLSTICNDGQSNT  1554
                  + + +  CS  S   +    K + + G +  CL   GE     L   C     + 
Sbjct  356   ISGKLEPLKLGPCSN-SEGWEYTAQKVLSVKGRNSTCLQAEGEGKEAKLGNEC-----SV  409

Query  1555  WSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             W + S+S   L++K +N   +CLD DS+   + I+T  C  L      +P +QWFKL+ S
Sbjct  410   WEIVSDSKLHLSSKINNASDVCLDVDSN---NNIVTNACKCLSGDKTCDPASQWFKLVDS  466



>gb|KCW59703.1| hypothetical protein EUGRSUZ_H02464 [Eucalyptus grandis]
Length=470

 Score =   336 bits (861),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 181/427 (42%), Positives = 270/427 (63%), Gaps = 20/427 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D   G RVKLAC +W  HL+P+L EGL + P   IA  +  MGFNCVRLTW   + 
Sbjct  37    RWIVDGD-GRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCVRLTWPLELP  95

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
                  A+ TV QSF +LGL E+++G+ SNNP+L++L +++A K+V+  +  + +M++LDN
Sbjct  96    INETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRNNQVMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H++ P WCC++ DGN FFG  YFDP  W+QGL  +A +      V+G+SLRNELRGP QN
Sbjct  156   HITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGMSLRNELRGPRQN  215

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             VD WYKY+++GA+ ++ ANP++LVI+SG ++D D  FL+ RP       KK+V+E H Y 
Sbjct  216   VDAWYKYMQQGAETVHAANPDVLVILSGFNFDTDLSFLQHRP-VNLSFSKKLVFEMHWYG  274

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FTE   KAW  G  N VC  ++ ++  +  FL+  G   PLFVSEFG ++ G +  DNR+
Sbjct  275   FTE--KKAWQSGNPNDVCKAVSNKVMNQSVFLL--GQGYPLFVSEFGADERGTNVNDNRY  330

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             + C ++  A+ D D+++W LQGSYYLREG  G +E YG+F  +W+ +RN ++L +L  LQ
Sbjct  331   MNCFMAMAAEFDWDFALWTLQGSYYLREGVVGVEEFYGLFNNDWSGIRNSSYLRRLSVLQ  390

Query  1306  QKLQD---PMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCS--GASRCIQEADGKPIHMI  1470
                Q     + + PT      P   +   +   ++H+S  +  G++ C+       + M+
Sbjct  391   LPFQGRPATLGTSPT-----EP-GTKWEMISASEMHLSSMAEDGSTVCLDMIANNTV-MV  443

Query  1471  GSLKCLA  1491
              + KCL+
Sbjct  444   EACKCLS  450



>ref|XP_010026599.1| PREDICTED: uncharacterized protein LOC104416971 [Eucalyptus grandis]
Length=419

 Score =   333 bits (855),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 249/384 (65%), Gaps = 8/384 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +WA HLEPM+ EGLD++P+  I+  +++MGFNCVRLTW  +M 
Sbjct  36    RWIVD-KHGRRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIASMGFNCVRLTWPLFMV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T     +M+V QSF +LGL + I G+  NN +LL ++++ A +AVV+ +G + +M++LDN
Sbjct  95    TNDSLGSMSVAQSFRNLGLVDYIGGIRQNNLSLLDVSVLAAFRAVVKSLGDNNVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ D N FFG  YFDP+ W++GL  +A +F     VVG+SLRNELRGP +N
Sbjct  155   HISKPGWCCSNRDSNGFFGDPYFDPNLWIKGLTRMATLFHRVGNVVGMSLRNELRGPKEN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             +  W +Y++ GA+A++ ANP++LVI+SGL  D D  FL   P     +  K+V+E H YA
Sbjct  215   LRDWLRYMKSGAEAVHLANPHVLVIVSGLYCDTDLWFLGHIP-MRVSVTGKLVFELHWYA  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             ++ G    W     N+ C D   ++  K GF++  G   PLFVSEFG    G +  DNR+
Sbjct  274   YSSGT--IWEDCNANERCKDAMDKVMIKAGFILNQGM--PLFVSEFGGELSGQNVNDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
               C     A LD DW++W + GSYY  +G  G DET+G+   +++  RN +FL ++  LQ
Sbjct  330   FNCFFGVAAKLDFDWALWTIVGSYYFGKGIVGMDETFGVLNKDFSGPRNASFLQRISALQ  389

Query  1306  QKLQDPMSSEPTYQLLYHPLSGRC  1377
                Q   SS PT  +L+HPL+G C
Sbjct  390   APFQGVTSSNPTRIILFHPLTGLC  413



>ref|XP_010492706.1| PREDICTED: uncharacterized protein LOC104770057 [Camelina sativa]
Length=528

 Score =   337 bits (863),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 198/512 (39%), Positives = 293/512 (57%), Gaps = 30/512 (6%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ + G RVKLAC +W  HLEP++ EGL  +P+  I   +  MGFNCVRLTW   + 
Sbjct  34    RWIVN-KKGHRVKLACTNWPSHLEPVVAEGLSSQPMDCITKKIKDMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP+++++ L++  +AVV  +GRH +M++LD
Sbjct  93    INDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDVMVILD  152

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FFG   F+PD W+ GL  +A IF +   VVG+SLRNELRG   
Sbjct  153   NHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNELRGYNH  212

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WYKY++KGA+A++ +NPN+LVI+SGL++D+D  FLK+RP      KKK+V E H Y
Sbjct  213   TSKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDVDLSFLKKRP-VNLSFKKKLVLELHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT G  + W    +N  C  +  +     GF++  G   PLF+SEFG +Q G     NR
Sbjct  272   AFTNGAGQ-WKSHNVNDFCSQMFAKERRTGGFVLEQG--FPLFLSEFGTDQRGGDLEGNR  328

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY+REGK G  E+YGM   NW  + N  +L +L  +
Sbjct  329   YMSCMLAWAAEKDMDWAVWALTGVYYIREGKRGVVESYGMLDANWHNVHNSTYLRRLSVI  388

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
             QQ  + P      ++ ++HPL+G C  V     H S+ +    C ++      H  G L+
Sbjct  389   QQPHKGPGIKHNHHKKIFHPLTGLCL-VRKSPCHESELT-LGPCTKDEPWSYSHHGGVLE  446

Query  1483  -------CL---AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFD  1632
                    CL     VG+ + L         +       S +   L+ K + G ++CLD D
Sbjct  447   IKGGHKSCLESETAVGKSVKL-------GKKCTKIKQISATKMHLSFKTNEGSLVCLDVD  499

Query  1633  SSYSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
             S    + ++   C  L       P +QWFK+ 
Sbjct  500   SD---NNVVANSCKCLTGDVSCEPASQWFKIF  528



>ref|XP_008678768.1| PREDICTED: uncharacterized protein LOC100501654 isoform X2 [Zea 
mays]
 gb|AFW62834.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=548

 Score =   335 bits (859),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 201/524 (38%), Positives = 281/524 (54%), Gaps = 44/524 (8%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKLAC +W  HLE ++ EGL R+P+  I+  + +MGFNCVRLT+   + 
Sbjct  36    RWIVD-PAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIVSMGFNCVRLTYPIALV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    + +TV QS    GL E + G+                +AVV  +G   +M++LDN
Sbjct  95    TNASLSVLTVRQSLLANGLAETVGGV----------------EAVVNALGEKNVMVILDN  138

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS P WCC++ DGN FFG   FDP+ W+ GL  +A IF D P VVG+SLRNELRGP QN
Sbjct  139   HVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPNVVGMSLRNELRGPRQN  198

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklk-mmkkkvvYETHRY  942
                WY Y+++GA+A++ A+P  LVI+ GLSYD D  FL  R + +    + K+V+E H Y
Sbjct  199   PQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFLAARQVGVSFAAENKLVFEVHWY  258

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++  ++AW     N+VC    R+   + GFL+  G   PLF+SEFG +  G    DNR
Sbjct  259   SFSD--ARAWETESANEVCGRAARDFARRGGFLLARGF--PLFLSEFGADSRGGDPKDNR  314

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
               PC  +  A+ D+DW+ WALQGSY LR+G  G DE YG+   +W+  RN   L +++ L
Sbjct  315   FFPCAAAVAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQAL  374

Query  1303  QQKLQDPMSSEP-TYQLLYHPLSGRC----ARVVGDQIHMSDCSGASRCIQEADGKPIHM  1467
             Q+ LQ P   E   Y +L+HPL+G C    A  V   + +  C+             + +
Sbjct  375   QRPLQGPGYGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGPCNETDAWAYAPPSSTLVL  434

Query  1468  ----IGSLKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLA---------NKGDN  1605
                    L CL   G   P  L    C D  S TW LA++S   +A          +   
Sbjct  435   RDAAAAGLPCLRAEGPGQPARLGIRDCGDPMS-TWRLATDSGMHVAVDAALGLGGGEDGG  493

Query  1606  GLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASN  1737
             G    L  D      +I+T  C         +P+ QWFKL+ S 
Sbjct  494   GGGGMLCLDVGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTST  537



>ref|XP_010420476.1| PREDICTED: uncharacterized protein LOC104706046 [Camelina sativa]
Length=527

 Score =   333 bits (854),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 196/509 (39%), Positives = 296/509 (58%), Gaps = 25/509 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ + G RVKLAC +W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  34    RWIVN-KKGHRVKLACTNWPSHLKPVVAEGLSSQPMDFISKKIKDMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP+++++ L++  +AVV  +GRH +M++LD
Sbjct  93    INDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDVMVILD  152

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FFG   F+PD W+ GL  +A IF +   VVG+SLRNELRG   
Sbjct  153   NHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNELRGYNH  212

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WYKY++KGA+A++ +NPN+LVI+SGL++D+D  FLK+RP      KKK+V E H Y
Sbjct  213   TAKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDVDLSFLKKRP-VNLSFKKKLVLELHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT G  + W    +N  C  +  +     GF++  G   PLF+SEFG +Q G     NR
Sbjct  272   AFTNGAGQ-WKSHNVNDFCSQMFAKERSTGGFVLEQG--FPLFLSEFGTDQRGGDLEGNR  328

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY+REGK G  E+YGM   NW  + N  +L +L  +
Sbjct  329   YMSCMLAWAAEKDMDWAVWALTGVYYIREGKRGVVESYGMLDANWHNVHNSTYLRRLSVI  388

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQE-----ADGKPIHM  1467
             QQ  + P      ++ ++HPL+G C  V     H S+ +    C ++     + G  + +
Sbjct  389   QQPHKGPGIKHNHHKKIFHPLTGLCL-VRKSPCHESELT-LGPCTKDEPWSYSHGGVLEI  446

Query  1468  IGSLK-CL-AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSY  1641
              G  K CL     E   + L   C    +    +++  M  L+ K + G ++CLD D   
Sbjct  447   KGGHKSCLEGETAEGKSVKLGKRC----TKIMQISATKM-HLSFKTNEGSLVCLDVDPD-  500

Query  1642  SPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
               + ++   C  L       P +QWFK+ 
Sbjct  501   --NNVVANPCKCLTGDVSCEPASQWFKIF  527



>ref|XP_002871770.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48029.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   333 bits (853),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 194/510 (38%), Positives = 293/510 (57%), Gaps = 27/510 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ + G RVKLACA+W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  34    RWIVN-KKGHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP+++++ L++A +AVV  +GRH +M++LD
Sbjct  93    INDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNIPLINAFQAVVYSLGRHDVMVILD  152

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC+++D ++FFG   F+PD W+ GL  +A IF +   VVG+SLRNELRG   
Sbjct  153   NHKTVPGWCCSNNDPDAFFGDPKFNPDLWMLGLKKMATIFMNVNNVVGMSLRNELRGYNH  212

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WYKY++KGA+A++ +NPN+LVI+SGL++D D  FL++RP      KKK+V E H Y
Sbjct  213   TAKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDADLSFLQDRP-VNLSFKKKLVLELHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT+G  + W    +N  C  +  +     GF++  G   PLF+SEFG +Q G     NR
Sbjct  272   SFTDGTGQ-WKSHNVNDFCSQMFAKEHRTGGFVLEQG--FPLFLSEFGTDQRGGDFEGNR  328

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY REGK G  E YGM   NW  + N  +L +L  +
Sbjct  329   YMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVLEAYGMLDANWHNVHNYTYLRRLSVI  388

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC----ARVVGDQIHMSDCSGASRCIQEADGKPIHMI  1470
             Q   + P      ++ ++HPL+G C    +     ++ +  C+          G      
Sbjct  389   QPPHKGPGIKHNHHKKIFHPLTGLCLVRKSSCYESELMLGPCTKGEPWSYSHGGILEIKG  448

Query  1471  GSLKCL---AVVGEDLPLTLSTICNDGQSNTWSLA-SNSMFQLANKGDNGLVLCLDFDSS  1638
             G   CL     VG  + L        G+  T  +  S +   L+ K ++G ++CLD DS 
Sbjct  449   GHKSCLEGETAVGRSVKL--------GKKCTKIMQISATKMHLSLKTNDGSLVCLDVDSD  500

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
                + ++   C  L       P +QWFK+ 
Sbjct  501   ---NNVVANSCKCLTGDITCEPASQWFKIF  527



>ref|XP_009107523.1| PREDICTED: uncharacterized protein LOC103833179 [Brassica rapa]
Length=527

 Score =   333 bits (853),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 196/509 (39%), Positives = 289/509 (57%), Gaps = 25/509 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ +SG RVKLAC +W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  34    RWIVN-KSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP++++  L++  +AVV  +GR+ +M++LD
Sbjct  93    INDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLINVFQAVVYSLGRNDVMVILD  152

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FFG   F+PD W+ GL  +A IF D   V+G+SLRNELRG   
Sbjct  153   NHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNELRGYNH  212

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WY Y+++GA+A++ +NPN+LVI+SGL +D D  FLK+RP      KKK+V E H Y
Sbjct  213   TAKDWYTYMQRGAEAVHGSNPNVLVILSGLDFDADLTFLKDRP-VNLSFKKKLVLELHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT G  + W    +N  C  I  +     GFL+  G   PLF+SEFG +Q G     NR
Sbjct  272   AFTNGTGQ-WKSHNVNDFCSQIFTKEHRTGGFLLDQG--FPLFLSEFGTDQRGGDFEGNR  328

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY REGK G  E YGM   NW  + N  +L +L  +
Sbjct  329   YMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVI  388

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC----ARVVGDQIHMSDCSGASRCIQEADGKPIHMI  1470
             Q   + P      ++ ++HPL+G C    +     ++ +  C+        + G  + + 
Sbjct  389   QPPHKGPGIKHNHHKKIFHPLTGLCLVRKSPCYESELTLGPCT-KDEPWSYSHGDRLEIK  447

Query  1471  GSLKCLAVVGED---LPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSY  1641
             G  K   V GE      + L   C   +       S +   LA K ++GL++CLD DS  
Sbjct  448   GGHKS-CVEGETSVGRSVKLGKKCTKIKR-----ISATKMHLAFKNNDGLLVCLDVDSD-  500

Query  1642  SPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
               + I+   C  L       P +QWFK+ 
Sbjct  501   --NNIVANHCKCLTGDISCEPASQWFKIF  527



>gb|KFK25904.1| hypothetical protein AALP_AA8G177600 [Arabis alpina]
Length=523

 Score =   332 bits (851),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 193/508 (38%), Positives = 298/508 (59%), Gaps = 24/508 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL P + EGL ++PL  I+  + +M FNCVRLTW   + 
Sbjct  31    RWILDEK-GQRVKLACVNWPAHLLPAVAEGLSKQPLDSISKKIVSMRFNCVRLTWPLDLM  89

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  L L E ++G+ ++NP +L+L L++A + VV  +G++G+M++LD
Sbjct  90    TNDTLALNVTVKQSFESLKLFEDVAGIQTHNPKILNLPLLNAFQEVVSNLGQNGLMVILD  149

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC+D+D ++FFG   FDP EW  GL  +A +F++   VVG+SLRNE RG   
Sbjct  150   NHLTTPGWCCSDNDLDAFFGYPNFDPAEWATGLKKMATLFRNATNVVGMSLRNEPRGTRD  209

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               D+W++++ +GA+A++  NP LLVI+SG+ YD +  FL++R         K+V+E H Y
Sbjct  210   YPDLWFRFMPQGAEAVHAGNPKLLVIVSGIDYDTNLSFLRDR-SINVSFTDKIVFELHWY  268

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT+G+  +W K   N  C  I  ++    GFL+  G   PL +SEFG ++ G   + NR
Sbjct  269   SFTDGRG-SWAKHNSNDFCVKIIEKVTRNGGFLL--GRGLPLILSEFGTDESGADMSGNR  325

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A+ DLDW+VWAL G YYLR G     ETYG+   NW  +RN +FL +L  +
Sbjct  326   YMNCLVAWAAENDLDWAVWALAGDYYLRTGDTNMVETYGVLDANWIDVRNTSFLQQLSGI  385

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC----ARVVGDQIHMSDCSGAS-RCIQEADGKPIHM  1467
             Q   + P     +  LL+HPL+G C           + +  C+ +        +G     
Sbjct  386   QLPFRGP--GLQSKNLLFHPLTGLCISNNPSANSPTLRLGPCAKSEPSTYNPKEGNLWIN  443

Query  1468  IGSLKCLAVVGEDLPLTLSTICND-GQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYS  1644
                ++   VVG+ + L + T C+  GQ       S +   L+ K  NGL+LCLD D    
Sbjct  444   KMCVEAPNVVGQKVKLRVGTRCSKLGQ------ISATKMHLSFKTSNGLLLCLDVDQ--R  495

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
              ++I+   C  L      +P +QWFK++
Sbjct  496   DNSIVANPCKCLTRDASCDPASQWFKVL  523



>ref|XP_009387346.1| PREDICTED: uncharacterized protein LOC103974285 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   330 bits (845),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 167/329 (51%), Positives = 237/329 (72%), Gaps = 8/329 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D +SG RVKLAC +W  HLEP++ EG+ ++PL  I+  ++ MGFNCVRLTW  ++ 
Sbjct  36    RWIVD-ESGLRVKLACVNWVSHLEPVVVEGMGKQPLDTISKKIAAMGFNCVRLTWPLFLV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A +TV QSF  LGL E+I+ +  NNP+LL+L L+ A KAVV  +  + +M++LDN
Sbjct  95    TNDSLAGLTVRQSFQALGLMESIAAIQVNNPDLLNLTLIQAFKAVVSNLADNNVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC++ DGN FFG  YFD +EW++GL  +A +F  +P VVG+SLRNELRGP Q 
Sbjct  155   HISKPGWCCSNFDGNGFFGDKYFDAEEWIKGLTKMATMFNGSPNVVGMSLRNELRGPKQG  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y+++GA+A+++ANPN+LVI+SGLS+D D  +L ++P      + K+V+E H YA
Sbjct  215   VTEWYRYMQRGAEAVHSANPNVLVILSGLSFDNDLGYLSKKP-VELTFQGKLVFELHWYA  273

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++GQ  AW  G  N+VC  +   +  + GFL+  G   PLF+SEFG++Q G +  DNR+
Sbjct  274   FSDGQ--AWANGNPNQVCGRVAGNVMRRAGFLLDQG--WPLFLSEFGLDQRGTNVNDNRY  329

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREG  1212
             L CM+   A+LDLDW++W LQGSYY+R+G
Sbjct  330   LGCMMGVAAELDLDWALWTLQGSYYIRQG  358



>ref|NP_197252.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAC01894.1| putative protein [Arabidopsis thaliana]
 gb|AED92434.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   332 bits (851),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 198/511 (39%), Positives = 289/511 (57%), Gaps = 29/511 (6%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++++ G RVKLACA+W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  33    RWIVNNK-GHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTWPLELM  91

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP +++  L++  +AVV  +GRH +M++LD
Sbjct  92    INDTLAFNVTVKQSFERYGLDHELQGIYTHNPYIVNTPLINVFQAVVYSLGRHDVMVILD  151

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FFG   F+PD W+ GL  +A IF +   VVG+SLRNELRG   
Sbjct  152   NHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMNVKNVVGMSLRNELRGYNH  211

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WYKY++KGA+A++ +NPN+LVI+SGL++D D  FLK+RP      KKK+V E H Y
Sbjct  212   TSKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDADLSFLKDRP-VNLSFKKKLVLELHWY  270

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +FT+G  + W    +N  C  +  +     GF++  G   PLF+SEFG +Q G     NR
Sbjct  271   SFTDGTGQ-WKSHNVNDFCSQMFSKERRTGGFVLDQG--FPLFLSEFGTDQRGGDLEGNR  327

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ DLDW+VWA+ G YY REGK G  E YGM   NW  + N  +L +L  +
Sbjct  328   YMNCMLAWAAEKDLDWAVWAVTGVYYFREGKRGVVEAYGMLDANWHNVHNYTYLRRLSVI  387

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIH------  1464
             Q     P      ++ ++HPL+G C  V     H S+ +    C ++      H      
Sbjct  388   QPPHTGPGVKHNHHKKIFHPLTGLCL-VRKSHCHESELT-LGPCTKDEPWSYSHGGILEI  445

Query  1465  MIGSLKCL---AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDS  1635
               G   CL     VG+   + L  IC   +     +++  M    N  D  LV CLD DS
Sbjct  446   RRGHKSCLEGETAVGKS--VKLGRICTKIE----QISATKMHLSFNTSDGSLV-CLDVDS  498

Query  1636  SYSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
                 + ++   C  L       P +QWFK+ 
Sbjct  499   D---NNVVANSCNCLTGDTTCEPASQWFKIF  526



>ref|XP_006289374.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
 gb|EOA22272.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
Length=527

 Score =   332 bits (850),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 197/511 (39%), Positives = 295/511 (58%), Gaps = 29/511 (6%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++++ G+RVKLAC +W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  34    RWIVNNK-GQRVKLACTNWPSHLKPVVAEGLSSQPIDYISKKIKDMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP+++++ L++  +AVV  +GRH +M++LD
Sbjct  93    INDTLAFNVTVKQSFERYGLDHELQGIYAHNPSIVNIPLINVFQAVVYSLGRHDLMVILD  152

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FF    F+PD W+ GL  +A IF +   VVG+SLRNELRG   
Sbjct  153   NHKTVPGWCCSNDDPDAFFNDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNELRGYNH  212

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WYKY++KGA+A++ +NPN+LVI+SGLS+D D  FLK+RP      KKK+V E H Y
Sbjct  213   TAKDWYKYMQKGAEAVHTSNPNVLVILSGLSFDADLSFLKDRP-VSLSFKKKLVLELHWY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT+G  + W    +N  C  +  +     GF++  G   PLF+SEFG +Q G     NR
Sbjct  272   AFTDGTGQ-WKSHNVNDFCSQMFAKERRTGGFVLEQG--FPLFLSEFGTDQRGGDFEGNR  328

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY REGK G  E YGM   NW  + N  +L +L  +
Sbjct  329   YMSCMLAWAAEKDMDWAVWALTGVYYFREGKRGVVEAYGMLDANWHNVHNSTYLRRLSVI  388

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQE-----ADGKPIHM  1467
             Q   + P      ++ ++HPL+G C  V     H S+ +    C ++     + G  + +
Sbjct  389   QPPHKGPGIRRNHHKKIFHPLTGLCL-VRKSPCHDSELT-LGPCTKDEPWSYSHGGTLEI  446

Query  1468  IGSLK-CL---AVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDS  1635
              G  K CL     VG+   + L   C   +       S +   L+ + D G ++CLD DS
Sbjct  447   KGGHKSCLEGETAVGKS--VKLGKRCTKVKQ-----ISATKMHLSFETDEGSLVCLDVDS  499

Query  1636  SYSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
                 + ++   C  L       P +QWFK+ 
Sbjct  500   D---NNVIANSCKCLTGDVSCEPASQWFKIF  527



>emb|CDY13614.1| BnaA06g33090D [Brassica napus]
Length=460

 Score =   330 bits (845),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 190/465 (41%), Positives = 277/465 (60%), Gaps = 19/465 (4%)
 Frame = +1

Query  367   MGFNCVRLTWATYMFTRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKA  537
             MGFNCVRLTW   + T      ++TV  SF  LGL   ISG  + NP+++ L L++A ++
Sbjct  1     MGFNCVRLTWPLDLATNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQS  60

Query  538   VVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPM  717
             VV  +G + +M++LDNH++KP WCC + DGN FFG ++FDP  W+ GL  +A  FKDT  
Sbjct  61    VVTTLGNYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  718   VVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlk  897
             VVG+SLRNELRGP QNVD W+KY+ +GA+A++ ANP  LVI+SG SYD D  F++ RP  
Sbjct  121   VVGMSLRNELRGPKQNVDDWFKYMLQGAEAVHEANPYALVILSGFSYDTDLSFVRSRP-V  179

Query  898   lkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVS  1077
                   K+V+E HRY+FT      W     N  C +I + +++  GFL+R     P+F+S
Sbjct  180   SLTFSGKLVFELHRYSFT--NVDIWSSKNPNDACGEILKIIDDGGGFLLRD---FPVFLS  234

Query  1078  EFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNW  1257
             EFGI+  G +  D+R++ C+L + A+ D+DWS+WALQGSYYLREG  G  E YG+  ++W
Sbjct  235   EFGIDLRGGNINDDRYIGCILGWAAENDIDWSIWALQGSYYLREGVVGMTEYYGVLDSDW  294

Query  1258  TALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGAS  1428
              ++RN +F+ +L  +Q  LQ P        L++HPL+G C   + +   ++++  C+ + 
Sbjct  295   ISVRNNSFMQRLSLIQSTLQGPDPQPEVSNLIFHPLTGLCMLQSSLDLTKVNLGRCNQSQ  354

Query  1429  RCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTI-CNDGQSNTWSLASNSMFQLANKGDN  1605
                   D   + +     CLA  G + P+ LS   C+    + W   S S   LA K  N
Sbjct  355   PWDYTTDNT-LKLKNIPLCLANTGPNAPVKLSEASCSIPSLSQWQPISASNMLLAAKSTN  413

Query  1606  GLVLCLDFDSSYSPSTILTR-KCVGLEEGDMRNPQTQWFKLIASN  1737
                LCLD D     + + T  KCV  E+    +P +QWFK++  N
Sbjct  414   N-SLCLDVDGDN--NVVATNCKCVNGEDTSC-DPMSQWFKIVKVN  454



>ref|XP_004168759.1| PREDICTED: uncharacterized protein LOC101223591 [Cucumis sativus]
Length=522

 Score =   332 bits (850),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 278/462 (60%), Gaps = 40/462 (9%)
 Frame = +1

Query  307   MLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMFTRYANMTVVQSFGDLGLTEAISGLA  486
             ML EGL+ RPL  +A     + FNCVRLT+AT+MFTRYAN T+ ++F  L L +A +GLA
Sbjct  1     MLAEGLNHRPLKDLADEAIKLRFNCVRLTYATHMFTRYANRTIEENFDLLDLKQAKAGLA  60

Query  487   snnpnllslnlVDARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDE  666
               NP +L+  + +A +AVV+ +G  G+M++ DNH+S+P WCC+  DGN FFG+  FDP E
Sbjct  61    QYNPFVLNKTIAEAYEAVVDVLGASGLMVIADNHMSQPRWCCSLDDGNGFFGNNNFDPQE  120

Query  667   WLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIIS  846
             WLQGL++VA  F++   VVG+SLRNE+RG ++N + W KY+ +G   I+N N  +LVI+S
Sbjct  121   WLQGLSLVAQRFRNKSTVVGMSLRNEIRGFMENANDWNKYITQGVTTIHNINSEVLVIVS  180

Query  847   GLSYDLDFRFLKERPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEE  1026
             GL+YD D R LKE+PL +  +  K+V+E H Y+F+ G S++                   
Sbjct  181   GLNYDNDLRCLKEKPLNVSTLDNKLVFEVHLYSFS-GDSES-------------------  220

Query  1027  KEGFLVRGGNPGPLFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLR  1206
                             +E+G +Q   ++A+NR + C  ++LA  DLDW++WA QGSYY R
Sbjct  221   ----------------NEYGYDQREVNDAENRFMSCFTAHLAQRDLDWALWAWQGSYYFR  264

Query  1207  EGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRCARV  1386
             EG+  P E++G+  +NWT ++NPNF+ K + LQ  LQDP S+     ++YHP S +C +V
Sbjct  265   EGQAEPGESFGVLDSNWTQIKNPNFVQKFQLLQTMLQDPNSNASFSYVIYHPQSSQCIQV  324

Query  1387  VGD--QIHMSDCSGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWS  1560
               D  +I +++CS  +R     DG PI M  +   L   GE L  +LS+     QS  WS
Sbjct  325   SNDNKEIFLTNCSTPTRWSHNNDGTPIEMSSTGLYLKASGEGLEASLSSDTLSQQS-VWS  383

Query  1561  LASNSMFQLANKGDNGLVLCLDFDSSYSPSTILTRKCVGLEE  1686
               SNS   LA     G  LCL  DSS S S ++T  C+   E
Sbjct  384   AISNSKLHLATFTQGGKNLCLQIDSSNS-SKVVTNSCICTNE  424



>emb|CDX83591.1| BnaC07g23310D [Brassica napus]
Length=460

 Score =   327 bits (838),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 189/465 (41%), Positives = 278/465 (60%), Gaps = 19/465 (4%)
 Frame = +1

Query  367   MGFNCVRLTWATYMFTRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKA  537
             MGFNCVRLTW   + T      N+TV  SF  LGL   ISG  +NNP+++ L L++A ++
Sbjct  1     MGFNCVRLTWPLDLATNVTLATNVTVRDSFQSLGLNTDISGFETNNPSMIDLPLIEAYQS  60

Query  538   VVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPM  717
             VV  +G++ +M++LDNH++KP WCC + DGN FFG ++FDP  W+ GL  +A  FKDT  
Sbjct  61    VVTTLGKYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  718   VVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlk  897
             VVG+SLRNELRGP QNVD W+KY+++GA+A++ ANP  LVI+SG SYD D  F++     
Sbjct  121   VVGMSLRNELRGPKQNVDDWFKYMQQGAEAVHEANPYALVILSGFSYDTDLSFVQSI-HV  179

Query  898   lkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVS  1077
                   K+V+E HRY+FT   +  W     N  C +I + +++  GF++R     P+ +S
Sbjct  180   NLTFSGKLVFELHRYSFT--NADIWSSKNPNDACGEILKIIDDGGGFILRD---FPVILS  234

Query  1078  EFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNW  1257
             EFGI+  G +  DNR++ C+L + A+ D+DWS+W LQGSYY+REG  G  E YG+  ++W
Sbjct  235   EFGIDLRGGNVNDNRYMGCILGWAAENDIDWSIWGLQGSYYIREGVVGMTEYYGVLDSDW  294

Query  1258  TALRNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRC---ARVVGDQIHMSDCSGAS  1428
              ++RN +F+ +L  +Q  LQ P        L++HPL+G C   + +   ++++  C+  S
Sbjct  295   ISVRNNSFMQRLSLIQSTLQGPDPQPDVSNLIFHPLTGLCMLQSSLDPTKVNLGRCN-QS  353

Query  1429  RCIQEADGKPIHMIGSLKCLAVVGEDLPLTLS-TICNDGQSNTWSLASNSMFQLANKGDN  1605
             +         + +     CLA  G + PL LS T C+    + W   S S   LA K  N
Sbjct  354   QPWDYTTENTLKLKNIPLCLANTGPNAPLKLSETSCSIPSLSQWQPISASNMLLAAKSTN  413

Query  1606  GLVLCLDFDSSYSPSTILTR-KCVGLEEGDMRNPQTQWFKLIASN  1737
                LCLD D     + + T  KCV  E+    +P +QWFK++  N
Sbjct  414   N-SLCLDVDGDN--NVVATNCKCVNGEDSSC-DPMSQWFKIVKVN  454



>gb|KDO76363.1| hypothetical protein CISIN_1g039248mg [Citrus sinensis]
Length=400

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/356 (46%), Positives = 228/356 (64%), Gaps = 7/356 (2%)
 Frame = +1

Query  568   MMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNEL  747
             M++LDNH+SKP WCC++ DGN FFG  YFDP+EW++GL+ VA+ FK+   VV +SLRNEL
Sbjct  1     MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNEL  60

Query  748   RGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvY  927
             RGP QN   WYKY+ +GA+ ++  NP++LV +SGL++DLD RFL++ P     +  K+VY
Sbjct  61    RGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSP-LALDLDNKLVY  119

Query  928   ETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDS  1107
             E H Y+F++ Q+  W   P N VC+ +T+    +  FL    NP PL +SEFG +Q   +
Sbjct  120   EIHWYSFSQDQN-MWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVN  178

Query  1108  EADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLS  1287
              ADN ++ C+++Y A+ DLDW++WALQGSYYLR G  G +ET+G   + W   RNPNFL 
Sbjct  179   LADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLE  238

Query  1288  KLEFLQQKLQDPMSSEP-TYQLLYHPLSGRCARV-VGDQIHMSDCSGASRCIQEADGKPI  1461
             +L FLQ K   P +S   T  +++HPLSG C      ++++ S+    SR     DG PI
Sbjct  239   RLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPI  298

Query  1462  HMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDN--GLVLCL  1623
              ++    CL VVG+ LP  LS  C   QS  WSL S+S   LA K D   G +LCL
Sbjct  299   RLMDRSLCLKVVGDGLPPMLSNDCQSNQS-AWSLVSSSKLHLATKDDEHGGELLCL  353



>gb|KFK43579.1| hypothetical protein AALP_AA1G144700 [Arabis alpina]
Length=646

 Score =   331 bits (849),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 277/473 (59%), Gaps = 34/473 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D ++G+R+KLACA+W  HL+P++ EGL ++P+  +A  +  MGFNCVRLTW   + 
Sbjct  40    RWIVD-ENGQRIKLACANWPSHLQPVVAEGLSKQPVDALAKKIVEMGFNCVRLTWPLDLM  98

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF   GL + I G  +NNP+++ L+L++A K VV  +G + +M++LD
Sbjct  99    TNETLANNVTVRQSFQSFGLNDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGNNDVMVILD  158

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCC+++DGN FFG  +FDP  W   L+ +A  F     V+G+SLRNELRGP Q
Sbjct  159   NHLTKPGWCCSNNDGNGFFGDRFFDPTVWTAALSKMAATFDGVSNVIGMSLRNELRGPKQ  218

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ W+KY+++GA+A+++AN N+LVI+SG+++D D  F++ RP       KK+V+E H  
Sbjct  219   NVNDWFKYMQQGAEAVHSANKNVLVILSGINFDTDLSFVRSRP-VNLSFSKKLVFELH--  275

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
                      W+                   GFL+  G   PLF+SEFGI++ G +  D+ 
Sbjct  276   ---------WIG---------------NNGGFLLNKG--FPLFLSEFGIDERGQNANDDH  309

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+  + A+ D+DWS+WAL GSYYLR+G  G +E YG   T+W ++RN +FL KL  L
Sbjct  310   YFGCLTGWAAENDVDWSLWALTGSYYLRQGVVGLNEYYGALDTDWNSVRNSSFLQKLYLL  369

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC-ARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
             Q  LQ P      Y L+ HPL+G C  R + D+  ++     S        K + +    
Sbjct  370   QSSLQGPGPRIDAYNLVLHPLTGLCLVRSLNDKTMLTLGPCNSSEPWSYTKKTLKIKDQS  429

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
              CL   G    +T++        + W   S S   LA+   N   LCLD D++
Sbjct  430   LCLQSNGPKNRITMTRTSCSRPDSKWETISASRMHLASTTSNKTSLCLDVDAT  482



>emb|CDY38435.1| BnaA10g17230D [Brassica napus]
Length=524

 Score =   327 bits (839),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 196/509 (39%), Positives = 288/509 (57%), Gaps = 28/509 (6%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ +SG RVKLAC +W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  34    RWIVN-KSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP++++  L++A   VV  +GR+ +M++LD
Sbjct  93    INDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLINA---VVYSLGRNDVMVILD  149

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FFG   F+PD W+ GL  +A IF D   V+G+SLRNELRG   
Sbjct  150   NHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNELRGYNH  209

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WY Y+++GA+A++ +NPN+LVI+SGL +D D  FLK+RP      KKK+V E H Y
Sbjct  210   TAKDWYTYMQRGAEAVHGSNPNVLVILSGLDFDADLTFLKDRP-VNLSFKKKLVLELHWY  268

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT G  + W    +N  C  I  +     GFL+  G   PLF+SEFG +Q G     NR
Sbjct  269   AFTNGTGQ-WKSHNVNDFCSQIFTKEHRTGGFLLDQG--FPLFLSEFGTDQRGGDFEGNR  325

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY REGK G  E YGM   NW  + N  +L +L  +
Sbjct  326   YMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVI  385

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC----ARVVGDQIHMSDCSGASRCIQEADGKPIHMI  1470
             Q   + P      ++ ++HPL+G C    +     ++ +  C+        + G  + + 
Sbjct  386   QPPHKGPGIKHNHHKKIFHPLTGLCLVRKSPCYESELTLGPCT-KDEPWSYSHGDRLEIK  444

Query  1471  GSLKCLAVVGED---LPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSY  1641
             G  K   V GE      + L   C   +       S +   LA K ++GL++CLD DS  
Sbjct  445   GGHKS-CVEGETSVGRSVKLGKKCTKIKR-----ISATKMHLAFKNNDGLLVCLDVDSD-  497

Query  1642  SPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
               + I+   C  L       P +QWFK+ 
Sbjct  498   --NNIVANHCKCLTGDISCEPASQWFKIF  524



>ref|XP_010492588.1| PREDICTED: uncharacterized protein LOC104769956 isoform X1 [Camelina 
sativa]
Length=523

 Score =   327 bits (837),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 192/507 (38%), Positives = 294/507 (58%), Gaps = 22/507 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL ++PL  I+  + +MGFNCVRLTW   + 
Sbjct  31    RWIVDEK-GQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCVRLTWPLDLM  89

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T       +TV QSF  L L E + G+ ++NP +L+L L++A + VV  +G++G+M++LD
Sbjct  90    TNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLGQNGVMVILD  149

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC ++D ++FFG   FDP  W  GL+ +A +FK    VVG+SLRNE RG   
Sbjct  150   NHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKGATNVVGMSLRNEPRGTRD  209

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               D+W++++ +GA+A++ ANP LLVI+SG+ +D +  FL++R         K+V+E H Y
Sbjct  210   YPDLWFRHMPEGAEAVHAANPKLLVILSGIDFDTNLSFLRDR-FFNVSFTDKLVFELHWY  268

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G   +W K   N  C  I  ++    GFLV  G   PL +SEFG ++ G   + NR
Sbjct  269   SFSDG-GDSWKKYNSNDFCAKIISKVTHNGGFLV--GRGSPLILSEFGTDEGGGDISGNR  325

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A  DLDW+VWAL G YYLR GK    ETYG+   NW  +RN  +L KL  +
Sbjct  326   YMNCLVAWAAQNDLDWAVWALTGDYYLRSGKTDMAETYGILNPNWKDVRNATYLQKLSGI  385

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARV----VGDQIHMSDCSGA-SRCIQEADGKPIHM  1467
             QQ  + P     T  +L+HP SG C           + +  C  A +      +G     
Sbjct  386   QQPFRGP--GLQTKNVLFHPSSGLCVTNNPSDRSPTLRLGPCPKADTSAFNINEGILWVN  443

Query  1468  IGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP  1647
                +K  +  G+ + L + T C    S    +A+  M   + K  NGL+LCLD D     
Sbjct  444   KMCVKIPSFAGQKVELGVGTNC----SKLGQIAATKM-HWSFKTSNGLLLCLDVDE--RD  496

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLI  1728
             ++++   C  L +    +P +QWFK++
Sbjct  497   NSVVVNPCKCLTKDGSCDPASQWFKVL  523



>emb|CDY16914.1| BnaC09g40410D [Brassica napus]
Length=524

 Score =   326 bits (836),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 193/506 (38%), Positives = 288/506 (57%), Gaps = 22/506 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ +SG RVKLAC +W  HL+P++ EGL  +P+  I+  +  MGFNCVRLTW   + 
Sbjct  34    RWIVN-KSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTWPLELM  92

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   N+TV QSF   GL   + G+ ++NP++++  L++A   VV  +GR+ +M++LD
Sbjct  93    INDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLINA---VVYSLGRNDVMVILD  149

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH + P WCC++ D ++FFG   F+PD W+ GL  +A IF D   V+G+SLRNELRG   
Sbjct  150   NHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNELRGYNH  209

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
                 WY Y+++GA+A++ +NPN+LVI+SGL +D D  FLK+RP      KKK+V E H Y
Sbjct  210   TAKDWYTYMQRGAEAVHGSNPNVLVILSGLDFDADLTFLKDRP-VNLSFKKKLVLELHWY  268

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             AFT G  + W    +N  C  I  +     GFL+  G   PLF+SEFG +Q G     NR
Sbjct  269   AFTNGTGQ-WKSHNVNDFCSQIFTKEHRTGGFLLDQG--FPLFLSEFGTDQRGGDFEGNR  325

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ CML++ A+ D+DW+VWAL G YY REGK G  E YGM   NW  + N  +L +L  +
Sbjct  326   YMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVI  385

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC----ARVVGDQIHMSDCSGASRCIQEADGKPIHMI  1470
             Q   + P      ++ ++HPL+G C    +     ++ +  C+        + G  + + 
Sbjct  386   QPPHKGPGIKHNHHKKIFHPLTGLCLVRKSPCYESELTLGPCT-KDEPWSYSHGDRLEIK  444

Query  1471  GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
             G  K   V GE      S++    +       S +   L+ K ++GL++CLD DS    +
Sbjct  445   GGHKS-CVEGET--SVGSSVKLGKKCTKIKRISATKMHLSFKNNDGLLVCLDVDSD---N  498

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLI  1728
              ++   C  L       P +QWFK+ 
Sbjct  499   NVVANHCKCLTGDISCEPASQWFKIF  524



>ref|XP_010437042.1| PREDICTED: uncharacterized protein LOC104720845 isoform X1 [Camelina 
sativa]
 ref|XP_010437060.1| PREDICTED: uncharacterized protein LOC104720858 isoform X1 [Camelina 
sativa]
Length=523

 Score =   325 bits (833),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 193/508 (38%), Positives = 297/508 (58%), Gaps = 24/508 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL ++PL  I+  + +MGFNCVRLTW   + 
Sbjct  31    RWIVDEK-GQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCVRLTWPLDLM  89

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T       +TV QSF  L L E + G+ ++NP +L+L L++A + VV  +G++G+M++LD
Sbjct  90    TNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLGQNGVMVILD  149

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC ++D ++FFG   FDP  W  GL+ +A +FK    VVGVSLRNE RG   
Sbjct  150   NHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGVSLRNEPRGARD  209

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               D+W++++ +GA+A++ ANP LLVI+SG+ +D +  FL++R         K+V+E H Y
Sbjct  210   YPDLWFRHMPEGAEAVHAANPKLLVILSGIDFDTNLSFLRDR-FFNVSFTDKLVFELHWY  268

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G+  +W K   N  C  I  ++    GFLV  G   PL ++EFG  + G   + NR
Sbjct  269   SFSDGRD-SWRKHNSNDFCAKIITKVTRNGGFLV--GRGFPLMLTEFGTEESGRDISGNR  325

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A  DLDW+VWAL G YYLR GK    ET+G+   NW  +RN  +L +L  +
Sbjct  326   YMNCLVAWAAQNDLDWAVWALTGDYYLRTGKTDMVETFGILDANWKDVRNATYLQQLSGI  385

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCA-RVVGDQ---IHMSDCSGASRCIQEADGKPIHMI  1470
             Q   + P     +   ++HPLSG C      D+   + +  C  A       + + I  I
Sbjct  386   QYPFKGP--GLQSKNAIFHPLSGLCVTHNPSDKLPTLRLGPCPKADTSTFNPN-EGILWI  442

Query  1471  GSLKCLA--VVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYS  1644
               +   A  V G+ + L + T C    S    +A+  M  LA K  NGL+LCLD D    
Sbjct  443   NKMCVEAPNVAGQKVKLGVGTKC----SKLGQIAATKM-HLAFKTSNGLLLCLDVDE--R  495

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
              ++++   C  L +    +P +QWFK++
Sbjct  496   DNSVVANPCKCLTKDASCDPASQWFKVL  523



>emb|CDX69429.1| BnaA10g17780D [Brassica napus]
Length=524

 Score =   323 bits (828),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 189/513 (37%), Positives = 302/513 (59%), Gaps = 34/513 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL+++PL  I+  + +MGFNCVRLTW   + 
Sbjct  32    RWIVDEK-GQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGFNCVRLTWPLDLM  90

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  L L + + G+ ++NP +L+L + +A + VV  +G++G+M++LD
Sbjct  91    TNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVSNLGQNGVMVILD  150

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC+D+D ++FF    FDP  W +GL+ +A++F++   VVG+SLRNE RG   
Sbjct  151   NHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVGMSLRNEPRGTRD  210

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               ++W+KY+ KG +A++ ANP +LVI+SG+ YD +  FL++R         K+V+E H Y
Sbjct  211   YPNLWFKYMPKGGEAVHAANPEVLVILSGIDYDTNLSFLRDR-FFNVSFTDKLVFEQHWY  269

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G+  +W+K   N  C  I  ++    GFL+  G   PLF++EFG N      + NR
Sbjct  270   SFSDGRD-SWVKHNSNDFCAKIIEKVTHNGGFLI--GRGFPLFLTEFGANLRSGDVSGNR  326

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A+ DLDW+VWAL G YYLR G+    ET+G+   NW  + N  +L KL  +
Sbjct  327   YMNCLVAWAAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGI  386

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS--  1476
             Q  ++ P     + +LL+HP +G C        ++S+ S   R  Q    +P     S  
Sbjct  387   QLPVRGP--GLQSKKLLFHPTTGLCVTS-----NLSNNSPTLRLEQCRKAEPSTFNPSEG  439

Query  1477  --------LKCLAVVGEDLPLTLSTICND-GQSNTWSLASNSMFQLANKGDNGLVLCLDF  1629
                     ++    VG+ + L   T C+  GQ+      S +   L+ K +NG ++CLD 
Sbjct  440   ILWSNKMCVEAPDAVGQKVKLGAGTKCSKLGQT------SATHMHLSFKTNNGSLICLDV  493

Query  1630  DSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
             D     ++I+   C  L      +P TQWFK++
Sbjct  494   DE--RDNSIVANPCKCLTMDASCDPATQWFKVL  524



>ref|XP_006341815.1| PREDICTED: uncharacterized protein LOC102587665, partial [Solanum 
tuberosum]
Length=425

 Score =   318 bits (815),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 253/408 (62%), Gaps = 19/408 (5%)
 Frame = +1

Query  532   KAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDT  711
             +AVV  +  + +M++LDNH+SKP WCC+  DGN FFG  YFDP  W+QGL  VA  FK T
Sbjct  1     QAVVASLAMNNVMIILDNHISKPGWCCSRFDGNGFFGDEYFDPHLWIQGLTKVATTFKAT  60

Query  712   PMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERP  891
               VVG+SLRNELRGPLQNVD WY+Y++KGA+A++ AN ++L+I+SGLS+D D  FL++RP
Sbjct  61    TNVVGMSLRNELRGPLQNVDDWYRYMQKGAEAVHAANSDVLIILSGLSFDKDLSFLQQRP  120

Query  892   lklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLF  1071
                     K+V+E HRY+FT+G +  W     N+ C ++  +M  +  F++  G   PLF
Sbjct  121   -VNLTFSGKLVFEIHRYSFTDGDT--WSADNANQACGEVLNDMVSRGAFVLEQGY--PLF  175

Query  1072  VSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTT  1251
             VSEFG++Q G +  DNR+  C L   A+LD DW++W L GSYYLR+G  G +E YG+   
Sbjct  176   VSEFGVDQRGTNVNDNRYFNCFLGLAAELDFDWALWTLVGSYYLRDGIVGLNEYYGILDW  235

Query  1252  NWTALRNPNFLSKLEFLQQKLQDPMSSEP-TYQLLYHPLSGRCARVVG--DQIHMSDCSG  1422
             NW  +RN +FL ++  ++   Q P  +E  ++++++HP++G C +       + +  CS 
Sbjct  236   NWFDIRNSSFLQRISVIRTPFQGPGYAETRSHKVIFHPMTGLCVQRTSLLQPLELGPCSE  295

Query  1423  ASRCIQEADGKPIHMIGSLKCLAV---VGEDLPLTLSTICNDGQSNTWSLASNSMFQLAN  1593
             A      A  K + ++G+  CL     +G+  P  LS IC+D  S+ W + S+S   L++
Sbjct  296   A-EAWSYAPAKALIVLGTYFCLQADNKLGQ--PAKLSMICSD-DSSKWDIISDSKMHLSS  351

Query  1594  KGDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMR-NPQTQWFKLIAS  1734
             K  +   +CLD D +   + I+T+ C  L   D   +P +QWFK+I S
Sbjct  352   KLQDATSVCLDVDPN---NVIVTQTCKCLSTNDTTCDPGSQWFKIIDS  396



>gb|KHG22500.1| Endoglucanase E1 [Gossypium arboreum]
Length=524

 Score =   320 bits (821),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 191/506 (38%), Positives = 285/506 (56%), Gaps = 70/506 (14%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+DDQ+  RVKLAC +W  HLEP+  EGL +R +  IA  + +MGFNCVRLTW  Y+ 
Sbjct  30    RWIVDDQTHRRVKLACVNWPSHLEPVFAEGLSKRSMDSIAEQIVSMGFNCVRLTWPLYLA  89

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    +++TV +SF +LGL E I+G+ +NNP+++ ++L+ A +AVV  +G++ +M++LDN
Sbjct  90    TNDSLSSLTVRRSFQNLGLMEPIAGIQANNPSVIDVSLIQAFQAVVSSLGKNNVMVILDN  149

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H+SKP WCC            Y+D D                                  
Sbjct  150   HLSKPGWCCG-----------YYDGD----------------------------------  164

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
                       GA+A++ ANPNLL+I+SGLS+D D  F+K RPL L   +K V +E H Y 
Sbjct  165   ----------GAEAVHAANPNLLIILSGLSFDKDLSFIKNRPLILTFSRKLV-FEMHWYG  213

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             FT+GQ  AW+ G  N+VC  +T +M+   GFLV  G P  LFVSEFG++  G +  DNR+
Sbjct  214   FTDGQ--AWVTGNPNRVCGRVTNDMKRMSGFLVDKGYP--LFVSEFGVDLRGTNVNDNRY  269

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C L  +A+LDLDW++W L GSYYLREG  G +E YG+   NW  +RN +F+ ++  LQ
Sbjct  270   LNCFLGTVAELDLDWALWTLVGSYYLREGVIGLNEYYGIMDWNWIDMRNSSFVERISALQ  329

Query  1306  QKLQD-PMSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMIGS  1476
                +   +S    +++++HPL+G C   +  G  + +  C+  S     +  K + + G+
Sbjct  330   SPFRGLGLSETELHKVIFHPLTGLCVLRKQSGSSLSLGPCTD-SEAWNYSPQKTLELKGT  388

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL        + L TIC  G ++ W   S+S   L+ K  N   +C+D DS+   + +
Sbjct  389   QLCLQADEPGTMVKLGTICG-GSNSRWETISDSKMHLSLKLGNVTSVCMDIDSN---NNV  444

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +   C  L +    +P++QWFKL+ S
Sbjct  445   VVADCKCLNDDSQCDPKSQWFKLVNS  470



>ref|XP_009121460.1| PREDICTED: uncharacterized protein LOC103846306 [Brassica rapa]
Length=524

 Score =   319 bits (817),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 187/513 (36%), Positives = 302/513 (59%), Gaps = 34/513 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL+++PL  I+  + +MGFNCVRLTW   + 
Sbjct  32    RWIVDEK-GQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGFNCVRLTWPLDLM  90

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  L L + + G+ ++NP +L+L + +A + VV  +G++G+M++LD
Sbjct  91    TNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVSNLGQNGVMVILD  150

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC+D+D ++FF    FDP  W +GL+ +A++F++   VVG+SLRNE RG   
Sbjct  151   NHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVGMSLRNEPRGTRD  210

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               ++W+KY+ KG +A++ A+P +LVI+SG+ YD +  FL++R         K+V+E H Y
Sbjct  211   YPNLWFKYMPKGGEAVHAASPEVLVILSGIDYDTNLSFLRDR-FFNVSFTDKLVFEQHWY  269

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G+  +W+K   N  C  I  ++    GFL+  G   PLF++EFG N      + NR
Sbjct  270   SFSDGRD-SWVKHNSNDFCAKIIEKVTHNGGFLI--GRGFPLFLTEFGANLRSGDVSGNR  326

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A+ DLDW+VWAL G YYLR G+    ET+G+   NW  + N  +L KL  +
Sbjct  327   YMNCLVAWAAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGI  386

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGS--  1476
             Q  ++ P     + +LL+HP +G C        ++S+ S   R  Q    +P     S  
Sbjct  387   QLPVRGP--GLQSKKLLFHPTTGLCVTS-----NLSNNSPTLRLEQCRKAEPSTFNPSEG  439

Query  1477  --------LKCLAVVGEDLPLTLSTICND-GQSNTWSLASNSMFQLANKGDNGLVLCLDF  1629
                     ++    VG+ + L   T C+  GQ+      S +   L+ K +NG ++CLD 
Sbjct  440   ILWSNKMCVEAPDAVGQKVKLGAGTKCSKLGQT------SATHMHLSFKTNNGSLICLDV  493

Query  1630  DSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
             D     ++I+   C  L      +P +QWFK++
Sbjct  494   DE--LDNSIVANPCKCLTMDASCDPASQWFKVL  524



>gb|KHN04647.1| Endoglucanase [Glycine soja]
Length=451

 Score =   316 bits (810),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 191/509 (38%), Positives = 271/509 (53%), Gaps = 98/509 (19%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D+ +G+R KL C +WAGHL+PM+PEGLDRRPL  I + +    F+CVRLT+A YM+
Sbjct  35    RWIIDEATGQRAKLVCGNWAGHLKPMIPEGLDRRPLKDIVSELVEHKFSCVRLTYAIYMW  94

Query  412   TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDNHV  591
             TRY N  V  +F  L   E + G+A NNP++LS+  V+   AVV E+G   + ++LDNH 
Sbjct  95    TRYGNGNVNATFDSLDAPEVVEGIAKNNPSVLSMTHVEVFDAVVHELGAQNVKVLLDNH-  153

Query  592   SKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQNVD  771
                                     EW+ GL + A  F     VV +SLRNEL GP QN+ 
Sbjct  154   ------------------------EWVHGLTLAAEHFSGNHAVVAMSLRNELHGPRQNLR  189

Query  772   VWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYAF-  948
              WY+Y+ +GA AI+ ANPN+LV+ISGL+YD + +FLK +P     + KK+V+ETH Y++ 
Sbjct  190   DWYRYMSQGALAIHKANPNVLVVISGLNYDTELQFLKSKP-LKIGLGKKMVFETHLYSWS  248

Query  949   ---TEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADN  1119
                T    + W K PLN++C +  + ++ + GFL  G N  PL  +EFG ++ G S  DN
Sbjct  249   GIGTLKLKQIWTKQPLNRICANSIKGIDHRAGFLTAGKNASPLIFTEFGFDETGSSVEDN  308

Query  1120  RHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             R L C+ +YL   DLDW + A QGSYY+RE                              
Sbjct  309   RFLTCLQTYLVGRDLDWGLGAFQGSYYVRE------------------------------  338

Query  1300  LQQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSL  1479
                    P S  P+  +LYHPLSG+CA+V                    +GK    +GS 
Sbjct  339   -------PSSKVPSLYILYHPLSGQCAQV--------------------NGKNELEVGS-  370

Query  1480  KCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTIL  1659
                    E L + +S  C    S +W   S S   LA    +   LCL  DS  + S+I+
Sbjct  371   -----SAEGLSVVVSDECQSKNS-SWETVSLSKLHLATTDQHEKQLCLQKDS--NSSSIV  422

Query  1660  TRKCVGLEEGD--MRNPQTQWFKLIASNT  1740
             T KC+ +++    + +PQ+QWF+L+A+N 
Sbjct  423   TSKCICIKDDSQCLDDPQSQWFQLVATNV  451



>gb|AFW62836.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=396

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/365 (46%), Positives = 233/365 (64%), Gaps = 8/365 (2%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKLAC +W  HLE ++ EGL R+P+  I+  + +MGFNCVRLT+   + 
Sbjct  36    RWIVD-PAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIVSMGFNCVRLTYPIALV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    + +TV QS    GL E + G+  NNP+ L L L+++ KAVV  +G   +M++LDN
Sbjct  95    TNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKAVVNALGEKNVMVILDN  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS P WCC++ DGN FFG   FDP+ W+ GL  +A IF D P VVG+SLRNELRGP QN
Sbjct  155   HVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPNVVGMSLRNELRGPRQN  214

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPl-klkmmkkkvvYETHRY  942
                WY Y+++GA+A++ A+P  LVI+ GLSYD D  FL  R +      + K+V+E H Y
Sbjct  215   PQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFLAARQVGVSFAAENKLVFEVHWY  274

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++  ++AW     N+VC    R+   + GFL+  G   PLF+SEFG +  G    DNR
Sbjct  275   SFSD--ARAWETESANEVCGRAARDFARRGGFLLARGF--PLFLSEFGADSRGGDPKDNR  330

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
               PC  +  A+ D+DW+ WALQGSY LR+G  G DE YG+   +W+  RN   L +++ L
Sbjct  331   FFPCAAAVAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQAL  390

Query  1303  QQKLQ  1317
             Q+ LQ
Sbjct  391   QRPLQ  395



>emb|CDY38091.1| BnaC02g06820D [Brassica napus]
Length=523

 Score =   318 bits (815),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 185/507 (36%), Positives = 297/507 (59%), Gaps = 22/507 (4%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL ++PL  I+ ++ +MGFNCVRLTW   + 
Sbjct  31    RWIVDEK-GQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKNIVSMGFNCVRLTWPLDLM  89

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T       +TV QSF  L L + + G+ ++NP +L+L + +A + VV  +G++G+M++LD
Sbjct  90    TNDTLALKITVKQSFESLNLFDDVLGIQTHNPKILNLPIFNAFQEVVSNLGQNGLMVILD  149

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC+D+D ++FFG   FDP  W +GL  +A +F++   V+G+SLRNE RG   
Sbjct  150   NHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEPRGTRD  209

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               D+W++++ KGA+A++ ANP +LVI+SG+ +D +  FL++R         K+V+E H Y
Sbjct  210   YPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFLRDR-FFNVSFTDKLVFEQHWY  268

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F+  +  AW+K   N +C  I  E+    GFL+  G   PL +SEFG ++ G   + NR
Sbjct  269   SFSH-EGGAWVKHNSNDICAKIIGEVNHNGGFLLDRG--FPLILSEFGTDERGVDVSGNR  325

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A+ DLDW+VWAL G YYLR G     ETYG+    W  +RN  +L KL  +
Sbjct  326   YMNCLVAWAAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGI  385

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGD----QIHMSDCSGA-SRCIQEADGKPIHM  1467
             Q   + P   E   +L+ HP +G C           + +  C+ + S      +G     
Sbjct  386   QHPFRGPGLQEK--KLILHPHTGLCVTNNHSGNVPTLRLELCTQSESSTFNPKEGILWVN  443

Query  1468  IGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSP  1647
                ++   V G+ + L + + C    S    +++  M  L+ K  NGL+LCLD D     
Sbjct  444   KMCVETPDVAGQKVKLGVGSKC----SKLGPISATKM-HLSFKTSNGLLLCLDVDE--RD  496

Query  1648  STILTRKCVGLEEGDMRNPQTQWFKLI  1728
             ++I+   C  L +    +P +QWFK++
Sbjct  497   NSIVANPCKCLTKDASCDPASQWFKVL  523



>emb|CDX89335.1| BnaA01g15580D [Brassica napus]
Length=523

 Score =   317 bits (813),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/508 (37%), Positives = 293/508 (58%), Gaps = 24/508 (5%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL ++PL  I+  + +MGFNCVRLTW   + 
Sbjct  31    RWIVDEK-GQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTWPLDLM  89

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T       +TV QSF  L L +   G+  +NP +L+L + +A + VV  +G++G+M++LD
Sbjct  90    TNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGLMVILD  149

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC+D+D ++FFG   FDP  W +GL  +A +F++   V+G+SLRNE RG   
Sbjct  150   NHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEPRGTRD  209

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               D+W++++ KGA+A++ ANP +LVI+SG+ +D +  FL++R         K+V+E H Y
Sbjct  210   YPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFLRDR-FFNVSFTDKLVFEQHWY  268

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F+  +  AW+K   N +C  I  E+    GFL+  G   PL +SEFG ++ G   + NR
Sbjct  269   SFSH-EGGAWVKHNSNDICAKIIGEVNHNGGFLLDRG--FPLILSEFGTDERGVDVSGNR  325

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A+ DLDW+VWAL G YYLR G     ETYG+    W  +RN  +L KL  +
Sbjct  326   YMNCLVAWAAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGI  385

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGD----QIHMSDCSGA-SRCIQEADGKPIHM  1467
             Q   + P   E   +L+ HP +G C           + +  C+ + S      +G     
Sbjct  386   QHPFRGPGLQEK--KLVLHPHTGLCVTTNHSGNVPTLRLELCTQSESSTFNPKEGILWVN  443

Query  1468  IGSLKCLAVVGEDLPLTLSTICND-GQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYS  1644
                ++   V G+ + L + + C+  GQ       S +   L+ K  NGL+LCLD D    
Sbjct  444   KMCVETPDVAGQKVKLGVGSKCSKLGQ------ISATKMHLSFKTSNGLLLCLDVDE--R  495

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
              + I+   C  L +    +P +QWFK++
Sbjct  496   DNIIVANPCKCLTKDASCDPASQWFKVL  523



>ref|XP_004170960.1| PREDICTED: uncharacterized LOC101217177, partial [Cucumis sativus]
Length=421

 Score =   313 bits (802),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 171/401 (43%), Positives = 245/401 (61%), Gaps = 16/401 (4%)
 Frame = +1

Query  547   EIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVG  726
             +IG   +M++LDNH+SKP WCC++ DGN FFG  YF+PD W++GL  +A +F     VV 
Sbjct  4     KIGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVVA  63

Query  727   VSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkm  906
             +SLRNELRGP QNV+ WY+Y+++GA+A+++ANP++L+I+SGLSYD D  FLK +P     
Sbjct  64    MSLRNELRGPKQNVNDWYRYMQRGAEAVHSANPDILIILSGLSYDRDLSFLKNQP-INLT  122

Query  907   mkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFG  1086
                K VYE H YAF++G S  W  G  N+VC   T  + +  GFL++ G   PLF+SEFG
Sbjct  123   FTSKTVYEVHWYAFSDGSS--WESGNSNQVCGRTTNNLMKMSGFLLQQG--FPLFISEFG  178

Query  1087  INQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTAL  1266
             I+Q G +  DNR+L C L+  A+LDLDW+VW L GSYYLREG  G +E YG+   NW  L
Sbjct  179   IDQRGTNVNDNRYLSCFLAVAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNL  238

Query  1267  RNPNFLSKLEFLQQKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCI  1437
             RN  FL ++  LQ   Q P ++    Y +++HPLSG C   + + D + +  C       
Sbjct  239   RNSTFLQRISALQSPFQGPGLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWY  298

Query  1438  QEADGKPIHMIGSLKCLAV--VGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGL  1611
                  K + + G+  C+    +G+   L +    N+ +   W + S+S   L++K  NG 
Sbjct  299   YTPQ-KFLTLKGTYFCIQADEIGKQAKLGIICTVNNAK---WDMISDSKLHLSSKSSNGS  354

Query  1612  VLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             ++CLD DS  S + I+T  C  L      +P +QWFKL+ S
Sbjct  355   LVCLDVDS--STNEIVTNSCKCLSRDSSCDPSSQWFKLVNS  393



>gb|KCW59700.1| hypothetical protein EUGRSUZ_H02458, partial [Eucalyptus grandis]
Length=516

 Score =   315 bits (806),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 195/496 (39%), Positives = 287/496 (58%), Gaps = 43/496 (9%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATY--  405
             RWI+D   G RVKLAC +W  HL+P+L EGL + P   IA  +  MGFNCVRLTWA    
Sbjct  37    RWIVDG-DGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCVRLTWALELP  95

Query  406   MFTRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDA----RKAVVEEIGRHGIMM  573
             M    A++TV QSF +LGL E+++G+ SNNP+L++L L++A    R A     G     M
Sbjct  96    MNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKDKRIAQFASYGYEIFNM  155

Query  574   VLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRG  753
             + D+            DGN FFG  YFDP  W+QGL  +A +      V+G+SLRNELRG
Sbjct  156   MRDD----------GEDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGMSLRNELRG  205

Query  754   PLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYET  933
             P QNVD WYKY+++GA++++ ANP++LVI+SGL YD    F++ RP       KK+V+E 
Sbjct  206   PRQNVDDWYKYMQQGAESVHAANPDVLVILSGLHYDKVLSFIQNRP-VSLSFTKKLVFEM  264

Query  934   HRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEA  1113
             H Y FT+G+  AW  G  N VC  ++ E+  +  FL+  G   PLFVSEFG ++ G +  
Sbjct  265   HWYGFTDGE--AWQSGNPNDVCKAVSNEVMSQSVFLLEQGY--PLFVSEFGADERGTNVN  320

Query  1114  DNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKL  1293
             DNR++ C ++  A+ D D+++W LQGSYYLR+G  G +E YG+F  +W+ +RN ++L ++
Sbjct  321   DNRYMNCFMAMAAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRI  380

Query  1294  EFLQQKLQDPMSSEPT-YQLLYHPLSGRCA--------RVVGDQIHMSDCSGASR-CIQE  1443
               LQ   Q P   +   +++++HPL+G C          V+G  I+    S   +  +  
Sbjct  381   SVLQLPFQGPGGRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSHTPQNALGL  440

Query  1444  ADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCL  1623
               GKP++       L  VG   P TL T   +     W + S S   L++  ++G  +CL
Sbjct  441   MAGKPLY-------LRAVGLGRPATLGTSPTE-PGTKWEMISASEMHLSSMAEDGSTVCL  492

Query  1624  DFDSSYSPSTILTRKC  1671
             D  ++   +T++   C
Sbjct  493   DVIAN---NTVMVEAC  505



>gb|ACF85134.1| unknown [Zea mays]
Length=492

 Score =   314 bits (804),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 194/474 (41%), Positives = 278/474 (59%), Gaps = 26/474 (5%)
 Frame = +1

Query  367   MGFNCVRLTWATYMFT--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAV  540
             MGFNCVR TW T++ T   Y+++TV QSF  L LTE+++G+  NNP ++ L L+DA KAV
Sbjct  1     MGFNCVRFTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAV  60

Query  541   VEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMV  720
             V  +G H +M++LDNH+SKP WCC++ DG+ FFG  YFDPD W+ GL  +A +F   P V
Sbjct  61    VSSLGEHNLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNV  120

Query  721   VGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlkl  900
             VG+SLRNELRGP QNV+ WYKY+++GA+A++ ANP +LVI+SGLS+D D  FL  RP   
Sbjct  121   VGMSLRNELRGPRQNVNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFLNSRP-VN  179

Query  901   kmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSE  1080
                  KV +E H Y+F+ G    W  G  N+ C  IT  +  +  +L+  G   P+ +SE
Sbjct  180   LSFTGKVAFEVHWYSFSNGPE--WSSGNANQACARITAGITRRAFYLLDRG--WPVILSE  235

Query  1081  FGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWT  1260
             FG++  G +  DNR+  C  +  ADLDLDW++WALQGSYYLREG  G DE YG+    W 
Sbjct  236   FGVDNRGVNTNDNRYYGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLDWAWC  295

Query  1261  ALRNPNFLSKLEFLQQKLQDP-MSSEPTYQLLYHPLSGRCARVVGD--------QIHMSD  1413
               RN   L +++ LQ+ L+ P ++    Y +L+HP+SG C              Q+ +  
Sbjct  296   RPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHPVSGMCVVRRSPTPSLTQPFQLSLGP  355

Query  1414  CSGASRCIQEADGKPIHMI-GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLA  1590
             C+        A  + + +   +L CL   G   P +L+  C D  +  W   S+S   +A
Sbjct  356   CNETEAWEYSAQQQRLALRDAALLCLRAEGAGRPASLAVSCGDAMAR-WGFVSDSKLHVA  414

Query  1591  NKGDNGL------VLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIAS  1734
                 +        +LCLD  +     +++T  C  L   +  +PQ QWFKL++S
Sbjct  415   VNATSSAGSVGDGLLCLDVGA--DGRSVVTNPCRCLSADNSCDPQGQWFKLVSS  466



>ref|XP_010535458.1| PREDICTED: uncharacterized protein LOC104810759 [Tarenaya hassleriana]
Length=394

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 233/359 (65%), Gaps = 12/359 (3%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++ + G+RVKLAC +W  HL+P++ EGL ++P+++IA  +  M FNCVRLTW   + 
Sbjct  36    RWIVN-EGGQRVKLACVNWPSHLQPVVAEGLSQQPVTEIANRIVAMKFNCVRLTWPLELA  94

Query  412   ---TRYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
                T   ++TV QSF  LGL + I G+   NPN + L L++A K VV  +G+ G+M++LD
Sbjct  95    INDTLANSVTVRQSFQSLGLNDDIDGIQRKNPNFIDLPLIEALKTVVNVLGQKGVMVILD  154

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC+  DGN FFG  +FDP  W+ G   +A IF     V+G+SLRNELRG  Q
Sbjct  155   NHLTVPGWCCSAGDGNGFFGDRFFDPTAWINGWKKMAGIFNGVSNVIGMSLRNELRGRKQ  214

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NV+ WY Y+++GA+AI++ NPN+LVI+SGL +D D  F++ RP        K+V+E H Y
Sbjct  215   NVNDWYTYMQQGAEAIHSVNPNVLVIMSGLGFDTDLSFVQNRP-VSLSFAGKLVFELHWY  273

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             ++  G    W  G     C     +++ K GFL+  G   PLFVSEFGI+Q   S+ +  
Sbjct  274   SWYGGID--WGAG---NACGKFRDKVKWKAGFLLDKGF--PLFVSEFGIDQTTTSDKEKS  326

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEF  1299
             ++ C L ++A+ D+DW++WAL GSYYLR+G    DE +G  TT+W   RNP FL++L F
Sbjct  327   YIDCFLGWMAETDVDWALWALTGSYYLRDGARRADEHFGALTTDWILARNPYFLARLPF  385



>gb|KDO82152.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=414

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 234/390 (60%), Gaps = 13/390 (3%)
 Frame = +1

Query  568   MMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNEL  747
             M++LDNH+SKP WCC++ DGN FFG  YF+PD W++GL  +A IF     VVG+SLRNEL
Sbjct  1     MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNEL  60

Query  748   RGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvY  927
             RGP QNV  WY+Y++ GA+A++ ANP +LVI+SGL++D D  F++ +         K+V+
Sbjct  61    RGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQ-AVNLTFTGKLVF  119

Query  928   ETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDS  1107
             E H Y FT+GQ  AW+ G  N+VC  +   +    GFL+  G   PLFVSEFG +  G++
Sbjct  120   EAHWYGFTDGQ--AWVDGNPNQVCGRVVDNVMRLSGFLLEQG--WPLFVSEFGADLRGNN  175

Query  1108  EADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLS  1287
               DNR+L C     A+LD DW++W L GSYYLREG  G +E YG+F  NW  +RN +FL 
Sbjct  176   VNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLE  235

Query  1288  KLEFLQQKLQDPMSSEP-TYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKP  1458
             ++  LQ   + P   E   ++++YHP +G C   +   D + +  C+  S        K 
Sbjct  236   RISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT-ESEAWSYTPHKT  294

Query  1459  IHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSS  1638
             I + G+  CL       P  L  IC D  S TW + S+S   L++K DNG  +CLD DSS
Sbjct  295   ISLKGAYFCLQAKHVGKPAKLGIICTDCGS-TWEIISDSKMHLSSKADNGTTVCLDVDSS  353

Query  1639  YSPSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
                +TI+T  C  L      +P +QWFKL+
Sbjct  354   ---NTIVTNTCKCLSRDKTCDPASQWFKLV  380



>ref|NP_001047320.1| Os02g0596200 [Oryza sativa Japonica Group]
 dbj|BAD16839.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAD21617.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF09234.1| Os02g0596200 [Oryza sativa Japonica Group]
Length=449

 Score =   309 bits (791),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 226/330 (68%), Gaps = 10/330 (3%)
 Frame = +1

Query  232   RWIMDDQSG-ERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYM  408
             RWI+DD++G  RVKLAC +W  HLEP++ EGL  +P+  I+  V+++GFNCVRLT+   +
Sbjct  32    RWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVASLGFNCVRLTYPIAL  91

Query  409   FTR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
              T    +++TV +S    GL  A++G+ +NNP LL L L+++ +AVV+ +G  G+M++LD
Sbjct  92    ATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRAVVDSLGESGVMVILD  151

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NHVS+P WCCAD DGN FFG  +FDPD W++GL  +A +F   P VVG+SLRNELRGP Q
Sbjct  152   NHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPNVVGMSLRNELRGPRQ  211

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkk---kvvYET  933
             N D WY+Y++ GA+A++ ANP  LVI+ GL YD D  FL  RP+ +        K+V+E 
Sbjct  212   NADDWYRYMQMGAEAVHAANPAALVIMGGLGYDTDLSFLAARPVDVSFAAAERGKLVFEL  271

Query  934   HRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEA  1113
             H Y+F +  ++AW     N+VC  + R +  + GFL+  G   PLF+SEFG +  G S  
Sbjct  272   HWYSFAD--ARAWESEDANEVCGRVARGVARRGGFLLDAGF--PLFLSEFGADTRGGSRK  327

Query  1114  DNRHLPCMLSYLADLDLDWSVWALQGSYYL  1203
             D+R+LPC  +  A+LDLDW++WALQGSY L
Sbjct  328   DDRYLPCAAAVAAELDLDWALWALQGSYAL  357



>gb|EPS61076.1| hypothetical protein M569_13724, partial [Genlisea aurea]
Length=411

 Score =   307 bits (787),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 172/405 (42%), Positives = 240/405 (59%), Gaps = 14/405 (3%)
 Frame = +1

Query  532   KAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDT  711
             +AVV  + R+ +M++LDNH SKP WCC++ DGN FFG  YFDP  W++GL  VA  F  T
Sbjct  1     QAVVASLSRNNVMIILDNHTSKPGWCCSNWDGNGFFGDKYFDPTLWIKGLTRVAATFNAT  60

Query  712   PMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERP  891
               VVG+SLRNELRG  QN   WY Y++KGA+A++ ANPN+LVI+SGL YD D  FL  R 
Sbjct  61    QNVVGMSLRNELRGIRQNTIGWYWYMKKGAEAVHAANPNVLVILSGLRYDRDLSFLLHR-  119

Query  892   lklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLF  1071
                     K+VYE H Y F++G+  AW KG  N+VC  +  +   K GFL+  G   PLF
Sbjct  120   QIKLTFSHKLVYELHWYGFSDGE--AWAKGNPNQVCGQLVGDAMSKGGFLLDQGY--PLF  175

Query  1072  VSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTT  1251
             +SEFG+   G +  DNR+L C + + A+ DLDW++W L GSYYLREG  G +ETYG+++ 
Sbjct  176   LSEFGVEMSGTNVNDNRYLNCFMGWAAEQDLDWALWTLAGSYYLREGVVGYNETYGVYSF  235

Query  1252  NWTALRNPNFLSKLEFLQQKLQDPMSSE-PTYQLLYHPLSGRCARVVG--DQIHMSDCSG  1422
             +W  +RN   LSK+  LQ   + P   E P +++L+HP +G C +     D + +  C  
Sbjct  236   DWNQIRNGTILSKIASLQYPFRGPGYEEVPVHKVLFHPSTGLCVKRASLLDALALGPCVE  295

Query  1423  ASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGD  1602
             A       + K + + G+  CL       P  LS IC DGQ+  W   S+S   L+   +
Sbjct  296   AEAWSNTTE-KTLTVDGTPFCLEADESGKPAKLSVIC-DGQNTKWETISDSKMHLSATLE  353

Query  1603  NGLVLCLDFDSSYSPSTILTRKCVGLEEGDMR-NPQTQWFKLIAS  1734
             +G  +CL  DS    + I+T  C  L++ +   +P  QWFK+I S
Sbjct  354   DGSKVCLSIDSD---NNIITDSCKCLDDTNSTCDPGNQWFKIIDS  395



>gb|AFW62835.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=380

 Score =   306 bits (784),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 161/365 (44%), Positives = 224/365 (61%), Gaps = 24/365 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D  +G RVKLAC +W  HLE ++ EGL R+P+  I+  + +MGFNCVRLT+   + 
Sbjct  36    RWIVD-PAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIVSMGFNCVRLTYPIALV  94

Query  412   TR--YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    + +TV QS    GL E + G+                +AVV  +G   +M++LDN
Sbjct  95    TNASLSVLTVRQSLLANGLAETVGGV----------------EAVVNALGEKNVMVILDN  138

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             HVS P WCC++ DGN FFG   FDP+ W+ GL  +A IF D P VVG+SLRNELRGP QN
Sbjct  139   HVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPNVVGMSLRNELRGPRQN  198

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklk-mmkkkvvYETHRY  942
                WY Y+++GA+A++ A+P  LVI+ GLSYD D  FL  R + +    + K+V+E H Y
Sbjct  199   PQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFLAARQVGVSFAAENKLVFEVHWY  258

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++  ++AW     N+VC    R+   + GFL+  G   PLF+SEFG +  G    DNR
Sbjct  259   SFSD--ARAWETESANEVCGRAARDFARRGGFLLARGF--PLFLSEFGADSRGGDPKDNR  314

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
               PC  +  A+ D+DW+ WALQGSY LR+G  G DE YG+   +W+  RN   L +++ L
Sbjct  315   FFPCAAAVAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQAL  374

Query  1303  QQKLQ  1317
             Q+ LQ
Sbjct  375   QRPLQ  379



>gb|KHN29015.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=826

 Score =   316 bits (810),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 255/408 (63%), Gaps = 13/408 (3%)
 Frame = +1

Query  526   ARKAVVEEIGRHGIMMVLDNHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFK  705
               +AVV+ +G + +M++LDNH+++P WCC++ DGN FFG  +F+PD+W+ GL  +A +F 
Sbjct  406   GHQAVVKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKFFNPDQWILGLTKMATLFN  465

Query  706   DTPMVVGVSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKE  885
                 VVG++LRNELRGP QNV+ WYKY+ KGA+AI+ ANP++LVI+SGL+YD D  F+++
Sbjct  466   GVTNVVGMNLRNELRGPKQNVNDWYKYMVKGAEAIHAANPDVLVILSGLNYDKDLSFIQK  525

Query  886   RPlklkmmkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGP  1065
             RP      K K+VYE H YAFT+GQ  AW+ G  N+VC  +   M    GFLV  G   P
Sbjct  526   RP-VSLTFKGKLVYEAHWYAFTDGQ--AWVNGNPNQVCGQVAGNMMRTSGFLVNQG--WP  580

Query  1066  LFVSEFGINQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMF  1245
             LF+SEFG +  G +   NR+L C L+  A+LDLDW++W L GSYY R+G  G +E YG+ 
Sbjct  581   LFISEFGGDLRGTNVNHNRYLNCFLALAAELDLDWALWTLVGSYYFRQGVIGMEEFYGIL  640

Query  1246  TTNWTALRNPNFLSKLEFLQQKLQDP-MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDC  1416
             + +W  +RN  FL+++  LQ   + P ++    Y+L++HPL+G C   + + D++ +  C
Sbjct  641   SWDWIQVRNTTFLNRISALQLPFRGPGITRGNPYKLIFHPLTGLCVIRKSLLDRLTLGPC  700

Query  1417  SGASRCIQEADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANK  1596
                S   +    K + + G+  C+    E +P TL  +C+D  S  W + S+S   L++K
Sbjct  701   Y-LSDGWKYTPQKILSIKGTYFCMQAESEGMPATLGIMCSDPNSR-WEMISDSKLHLSSK  758

Query  1597  GDNGLVLCLDFDSSYSPSTILTRKCVGLEEGDMRNPQTQWFKLIASNT  1740
               +   +CLD D +   + I+T  C  L +    +P +QWFKLI S +
Sbjct  759   LSDDSNVCLDVDDN---NNIVTNACKCLSKDRTCDPSSQWFKLIDSGS  803



>emb|CDY40992.1| BnaA02g27820D [Brassica napus]
Length=418

 Score =   302 bits (774),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/385 (42%), Positives = 239/385 (62%), Gaps = 32/385 (8%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI++++ G+RVKLAC +W  HL+ ++ EGL ++PL  ++  +  MGFNCVRLTW   + 
Sbjct  34    RWIINEK-GQRVKLACVNWPAHLQLVVAEGLSKQPLDAVSKKIMAMGFNCVRLTWPLDLA  92

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  LGL++ I+G  + NP+++ L L++A K+VV  +G H +M+VLD
Sbjct  93    TNETLATNVTVRQSFQSLGLSDDIAGFQTKNPSMIDLPLIEAYKSVVTTLGNHNLMVVLD  152

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++KP WCC  +D N FFG  +F+P  W+ GL  +A +FKD   VVG+SLRNELRGP Q
Sbjct  153   NHLTKPGWCCRFNDSNGFFGDTFFEPGSWIAGLTKIATLFKDASYVVGMSLRNELRGPRQ  212

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
             NVD W+KY+++GA+A++ ANPN+LVI+SGL+YD D  F++ RP+ L   +K V +E H+Y
Sbjct  213   NVDDWFKYMQQGAEAVHGANPNVLVILSGLTYDTDLSFVRSRPVTLTFSRKLV-FEIHQY  271

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +     +  W     N  C DI + +++  GF +      P+F+SEFGI+  G S   NR
Sbjct  272   SIP--YTNIWSSKNPNDACGDILKILDDGVGFNLP---EFPVFLSEFGIDVRGVSVVQNR  326

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             +  C+L                      EG  G  + YG+  ++W ++RN +FL +L  +
Sbjct  327   NFGCLL----------------------EGVVGMIDYYGVLDSDWISVRNNSFLQRLSLI  364

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRC  1377
             Q +LQ P        L++HPLSG C
Sbjct  365   QSQLQGPDPQPKVNNLVFHPLSGLC  389



>ref|XP_006400209.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
 gb|ESQ41662.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
Length=488

 Score =   293 bits (749),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 180/508 (35%), Positives = 282/508 (56%), Gaps = 60/508 (12%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL ++PL  I+  + +MGFNCVRLTW   + 
Sbjct  32    RWIVDEK-GQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTWPLDLM  90

Query  412   TRYA---NMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T      N+TV QSF  L L E + G+ ++NP +L+L++  A + VV  +G++G+M++LD
Sbjct  91    TNDTLAHNVTVKQSFEGLKLFEDVLGIQTHNPKILNLSIFRAFQEVVSNLGQNGVMVILD  150

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC+D+D ++FFG   FDP  W +GL+ +A +F++   VVG+SLRNE RG   
Sbjct  151   NHLTTPGWCCSDNDLDAFFGYPNFDPLVWAKGLSKMAFLFRNATNVVGMSLRNEPRGTRD  210

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               D+W++++ KGA+A++ ANP LLVI+SG+ YD +  FL++R        +K+V+E H Y
Sbjct  211   YPDLWFRFMPKGAEAVHAANPKLLVILSGIDYDTNLSFLRDR-FFNVSFTEKLVFELHWY  269

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G   AW K   N  C  I  ++    GFL+  G   PL +SEFG  + G   + NR
Sbjct  270   SFSDG-GGAWAKHNSNDFCAKIIEKVTHNGGFLIERG--FPLILSEFGTEESGVDVSGNR  326

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A+ DLDW+VWAL G YYLR G                             L
Sbjct  327   YMNCLVAWAAENDLDWAVWALTGDYYLRNGPG---------------------------L  359

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARV----VGDQIHMSDCSGAS-RCIQEADGKPIHM  1467
             Q K            L++HPL+G C           + +  C  +        +G     
Sbjct  360   QHK-----------NLIFHPLTGLCVTNNPSDNSPTLRLGPCPKSEPSTFNPKEGNLWIN  408

Query  1468  IGSLKCLAVVGEDLPLTLSTICND-GQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYS  1644
                ++   V G+ + L + ++C+  GQ       S +   L+ K  NGL+LCLD D    
Sbjct  409   KMCVQAPNVAGQKVKLGVGSMCSKLGQ------ISATKMHLSFKTSNGLLLCLDVDE--R  460

Query  1645  PSTILTRKCVGLEEGDMRNPQTQWFKLI  1728
              ++++   C  L +    +P +QWFK++
Sbjct  461   DNSVVANPCKCLTKDASCDPASQWFKVL  488



>ref|XP_006584934.1| PREDICTED: uncharacterized protein LOC100811735 [Glycine max]
Length=337

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 214/342 (63%), Gaps = 9/342 (3%)
 Frame = +1

Query  727   VSLRNELRGPLQNVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkm  906
             + LRNELRG  QN   WYKY+ +GA  I++ NP+ +VIISGL++D D  FLK++PL L  
Sbjct  1     MDLRNELRGSRQNHHDWYKYMTQGANTIHDINPDFIVIISGLAFDNDLSFLKKKPLDLNF  60

Query  907   mkkkvvYETHRYAFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFG  1086
               K V YE+H Y+ + G +  W   P+N +C+   + + ++  FL+ G NP PL VSEFG
Sbjct  61    PHKIV-YESHIYSVS-GDTHRWRVQPVNWICNATIQLLHQQSSFLLSGKNPAPLLVSEFG  118

Query  1087  INQMGDSEADNRHLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTAL  1266
              +  G S ADN +LPC++SY A +DLDWS+WA QGSYY R+GK G  E+Y +   +W + 
Sbjct  119   YDMTGGSFADNMYLPCIVSYFASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMDDDWKSY  178

Query  1267  RNPNFLSKLEFLQQKLQDPMSSEPTYQLLYHPLSGRCARVVGD-QIHMSDCSGASRCIQE  1443
             R+PNF  K E LQ+ +QDP S+     +++HPL+G CA V    ++ M DC   S    E
Sbjct  179   RDPNFTQKFELLQRMVQDPTSNVSKSNIIFHPLTGYCAHVNNSKELVMGDCKSNSLWSYE  238

Query  1444  ADGKPIHMIGSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCL  1623
              DG PI ++ S KCL  VGE LP +LS  C   QS +W   S +   LA    +G +LCL
Sbjct  239   GDGSPIRLMNSAKCLKAVGERLPPSLSEDCLSPQS-SWKTVSMTGLHLATFDKDGDLLCL  297

Query  1624  DFDSSYSPSTILTRKCVGLEEGD---MRNPQTQWFKLIASNT  1740
             + DS  + S I+T KC+ + + D   + NPQ+QWFKL+++N 
Sbjct  298   EKDS--NSSKIVTSKCICISDDDSSCLDNPQSQWFKLVSTNV  337



>ref|XP_010248706.1| PREDICTED: uncharacterized protein LOC104591538 isoform X2 [Nelumbo 
nucifera]
Length=538

 Score =   293 bits (750),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 189/506 (37%), Positives = 284/506 (56%), Gaps = 36/506 (7%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D   G RVKLAC +W  HLE M+P+GL RR L  I+  + ++GFNCV+LTW  +M 
Sbjct  37    RWIVDGD-GHRVKLACVNWGAHLEAMVPDGLSRRSLDMISKEIISLGFNCVQLTWPQFMV  95

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
                  A++TV QSF +LGL E+I G+  NNP+LL L LV A +AVV+ +    +M++LDN
Sbjct  96    NDESLASVTVRQSFKNLGLLESIVGIQVNNPSLLDLPLVSAYQAVVDNLAEKNLMVILDN  155

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
              +SKP W    H  N F G  YFD D W++GL   A IF  T  VVG+SL NE  G  QN
Sbjct  156   RISKPGW----HHSN-FNGDKYFDTDLWIRGLTRTATIFNHTINVVGMSLSNEFEGNKQN  210

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V+ WY+Y++KGA+A++ A+PN+LVI+  L+YD DF F  ++P       +K+V+  H   
Sbjct  211   VNNWYRYMQKGAEAVHAASPNVLVILYELNYDEDFAFFAKQP-MNLPFTRKLVFGVHWSG  269

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
             F++   KAW  G LN++C ++  ++  +  F++  G   PLF+S+F  +  G +  D R 
Sbjct  270   FSD--EKAWETGDLNQLCGNVVDKLMMEGQFVL--GEGWPLFLSDFRPDLRGGNVNDIRF  325

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C+L   A+ DLDW++              G DE YG+  + W    N + + ++  LQ
Sbjct  326   LNCLLGVAAEKDLDWAL------------GTGIDEAYGLLNSEWFGTGNASPMKRVSLLQ  373

Query  1306  QKLQDP---MSSEPTYQLLYHPLSGRCA--RVVGDQIHMSDCSGASRCIQEADGKPIHMI  1470
                  P   ++  P +++++HP +G C   + V + + +  C   S        K + + 
Sbjct  374   SPFLGPDDLLNVRP-HEMIFHPSTGLCVLRKSVIEPLKLGSCV-ESESWAYTPQKTLVVK  431

Query  1471  GSLKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPS  1650
             G+  CL   G   P  L  ICND  S  W L S++   L++K  +G  +CLD DSS   +
Sbjct  432   GTYFCLQADGVGKPAKLGIICNDPGS-KWDLISDTKMHLSSKLADGSSVCLDVDSS---N  487

Query  1651  TILTRKCVGLEEGDMRNPQTQWFKLI  1728
             +I+T  C         +P +QWFK++
Sbjct  488   SIITNPCKCSSGAPNCDPTSQWFKIV  513



>ref|XP_010453833.1| PREDICTED: uncharacterized protein LOC104735704 [Camelina sativa]
Length=486

 Score =   291 bits (746),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 181/502 (36%), Positives = 277/502 (55%), Gaps = 48/502 (10%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D++ G+RVKLAC +W  HL+P + EGL ++PL  I+  + +MGFNCVRLTW   + 
Sbjct  30    RWIVDEK-GQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCVRLTWPLDLM  88

Query  412   TR---YANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLD  582
             T       +TV QSF  L L E + G+ ++NP +L+L L++A + VV  +G++G+M++LD
Sbjct  89    TNDTLALKVTVKQSFESLKLFEDVRGIQTHNPKILNLPLLNAFQEVVSNLGQNGVMVILD  148

Query  583   NHVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQ  762
             NH++ P WCC ++D ++FFG   FDP  W  GL+ +A +FK    VVG+SLRNE RG   
Sbjct  149   NHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGMSLRNEPRGTRD  208

Query  763   NVDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRY  942
               D+W++++ +GA+A++ ANP LLVI+SG+ +D +  FL++R         K+V+E H Y
Sbjct  209   YPDLWFRHMPQGAEAVHAANPKLLVILSGIDFDTNLSFLRDR-FFNVSFTDKLVFELHWY  267

Query  943   AFTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNR  1122
             +F++G   +W K   N  C  I  ++    GFLV  G   PL +SEFG N+ G   + NR
Sbjct  268   SFSDG-GDSWKKYNSNDFCAKIISKVTHNGGFLV--GRGFPLILSEFGTNEGGGDISGNR  324

Query  1123  HLPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFL  1302
             ++ C++++ A  DLDW+VWAL G YYLR G                 L++ N L      
Sbjct  325   YMNCLVAWAAQNDLDWAVWALTGDYYLRNGP---------------GLQSKNVLFHPSSG  369

Query  1303  QQKLQDPMSSEPTYQLLYHPLSGRCARVVGDQIHMSDCSGASRCIQEADGKPIHMIGSLK  1482
                  +P    PT +L   P +  CA    + I   +      C+Q              
Sbjct  370   LCVTNNPSDKSPTLRLGPCPKADTCAFNTNEGILWVN----KMCVQTP------------  413

Query  1483  CLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTILT  1662
               +  G+ + L + T C    S    +A+  M   + K  NGL+LCLD D     ++I+ 
Sbjct  414   --SFAGQKVELGVGTNC----SKLGQIAATKM-HWSFKTSNGLLLCLDVDE--RDNSIVV  464

Query  1663  RKCVGLEEGDMRNPQTQWFKLI  1728
               C  L +    +P +QWFK++
Sbjct  465   NPCKCLTKDGSCDPASQWFKVL  486



>ref|XP_002284895.1| PREDICTED: uncharacterized protein LOC100253729 [Vitis vinifera]
Length=512

 Score =   292 bits (748),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 197/506 (39%), Positives = 286/506 (57%), Gaps = 46/506 (9%)
 Frame = +1

Query  232   RWIMDDQSGERVKLACASWAGHLEPMLPEGLDRRPLSQIATHVSTMGFNCVRLTWATYMF  411
             RWI+D + G RVKLAC +W  H E  + EGL   P+  I+  ++++GFNCVRLT   ++ 
Sbjct  36    RWIVD-EDGARVKLACVNWPSHQEAAVAEGLSNHPVDLISKRIASLGFNCVRLTLPLFLA  94

Query  412   T--RYANMTVVQSFGDLGLTEAISGLAsnnpnllslnlVDARKAVVEEIGRHGIMMVLDN  585
             T    A++TV+QSF  LGL E+++G  +NNP++L L L  A +AVV  +  + +M++LD+
Sbjct  95    TDQSLASLTVIQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLADNNMMVILDS  154

Query  586   HVSKPMWCCADHDGNSFFGSVYFDPDEWLQGLAIVANIFKDTPMVVGVSLRNELRGPLQN  765
             H S+P +    HD N  FG  +F+PD W++GL  +A +F   P VVG+SLRNELR P QN
Sbjct  155   HFSEPSF----HD-NGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGMSLRNELRCPNQN  209

Query  766   VDVWYKYVEKGAKAINNANPNLLVIISGLSYDLDFRFLKERPlklkmmkkkvvYETHRYA  945
             V  WY+Y++KGA+A+++ANP++LVIISGLS   D  FL  +         K+V E H + 
Sbjct  210   VKDWYRYMQKGAEAVHSANPDVLVIISGLSDGTDLSFLLNQ-QLELTFTGKLVLEMHWHG  268

Query  946   FTEGQSKAWMKGPLNKVCHDITREMEEKEGFLVRGGNPGPLFVSEFGINQMGDSEADNRH  1125
                G  +A      NKVC  +   +  + G L++ G P  +FVSE G++       DNRH
Sbjct  269   SRVG--RAGETSNPNKVCGRVVDSIMRRGGVLLQQGWP-LMFVSELGVD-------DNRH  318

Query  1126  LPCMLSYLADLDLDWSVWALQGSYYLREGKHGPDETYGMFTTNWTALRNPNFLSKLEFLQ  1305
             L C     A+LD DW++W L+             ET G+   NW    N +F  ++  LQ
Sbjct  319   LNCFFGLAAELDFDWALWTLE-------------ETNGLM--NW----NSSFFQRISALQ  359

Query  1306  QKLQDP-MSSEPTYQLLYHPLSGRCA-RVVGDQ-IHMSDCSGASRCIQEADGKPIHMIGS  1476
               LQ P +S    +++++HP +G C  R  G + + +  C+  S        K + + G+
Sbjct  360   SPLQGPDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCT-KSEAWGYTPQKLLTVKGT  418

Query  1477  LKCLAVVGEDLPLTLSTICNDGQSNTWSLASNSMFQLANKGDNGLVLCLDFDSSYSPSTI  1656
               CL  VG   P  LS IC    SN W   S+S   L+ K  +G  +CLD DSS   STI
Sbjct  419   YFCLQAVGLGKPAKLSIICTKPGSN-WENISDSKMYLSTKLGDGTRVCLDVDSS---STI  474

Query  1657  LTRKCVGLEEGDMRNPQTQWFKLIAS  1734
             +T  C  L  GDM +P +QWFK++ S
Sbjct  475   VTDACKCLGRGDMCDPGSQWFKVVDS  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5802995907544