BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11536_g1_i1 len=2018 path=[53:0-2017]

Length=2018
                                                                      Score     E

ref|XP_011089887.1|  PREDICTED: MLO-like protein 6                      734   0.0      
emb|CDP07138.1|  unnamed protein product                                734   0.0      
ref|XP_009603532.1|  PREDICTED: MLO-like protein 6                      728   0.0      
ref|XP_010104115.1|  MLO-like protein 6                                 727   0.0      
ref|XP_009801961.1|  PREDICTED: MLO-like protein 6                      727   0.0      
ref|XP_006343449.1|  PREDICTED: MLO-like protein 6-like                 721   0.0      
gb|EYU18859.1|  hypothetical protein MIMGU_mgv1a003503mg                718   0.0      
gb|AGV68799.1|  MLO1                                                    714   0.0      
ref|XP_010253610.1|  PREDICTED: MLO-like protein 6 isoform X1           711   0.0      
gb|AFW98801.1|  MLO protein 1                                           709   0.0      
emb|CDP06724.1|  unnamed protein product                                708   0.0      
ref|NP_001268013.1|  MLO11 protein                                      708   0.0      
ref|XP_007204981.1|  hypothetical protein PRUPE_ppa003207mg             707   0.0      
ref|XP_010264735.1|  PREDICTED: MLO-like protein 6 isoform X1           707   0.0      
ref|XP_004148785.1|  PREDICTED: MLO-like protein 6-like                 706   0.0      
ref|XP_004309423.1|  PREDICTED: MLO-like protein 6-like                 706   0.0      
ref|XP_004240581.1|  PREDICTED: MLO-like protein 6                      706   0.0      
ref|XP_009596416.1|  PREDICTED: MLO-like protein 6                      705   0.0      
ref|XP_008225371.1|  PREDICTED: MLO-like protein 6                      702   0.0      
gb|AAX31277.1|  MLO1                                                    702   0.0      Capsicum annuum
ref|XP_008796803.1|  PREDICTED: MLO-like protein 6                      702   0.0      
ref|XP_002314276.1|  hypothetical protein POPTR_0009s01710g             701   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011044385.1|  PREDICTED: MLO-like protein 6 isoform X2           700   0.0      
ref|XP_006340147.1|  PREDICTED: MLO-like protein 6-like                 699   0.0      
ref|XP_008463924.1|  PREDICTED: MLO-like protein 6 isoform X1           699   0.0      
gb|KGN47314.1|  hypothetical protein Csa_6G292430                       699   0.0      
ref|XP_007015436.1|  Seven transmembrane MLO family protein isofo...    699   0.0      
ref|XP_008463775.1|  PREDICTED: MLO-like protein 6                      697   0.0      
ref|XP_004163384.1|  PREDICTED: MLO-like protein 6-like                 696   0.0      
ref|XP_010032020.1|  PREDICTED: MLO-like protein 6                      696   0.0      
ref|XP_003540745.1|  PREDICTED: MLO-like protein 6-like isoform X1      695   0.0      
ref|XP_002282216.1|  PREDICTED: MLO-like protein 6                      694   0.0      Vitis vinifera
ref|XP_009777573.1|  PREDICTED: MLO-like protein 6                      694   0.0      
ref|XP_009335054.1|  PREDICTED: MLO-like protein 6                      693   0.0      
ref|XP_008796805.1|  PREDICTED: MLO-like protein 6                      693   0.0      
ref|XP_006850616.1|  hypothetical protein AMTR_s00034p00158070          692   0.0      
ref|XP_007027290.1|  Seven transmembrane MLO family protein             691   0.0      
emb|CBI16290.3|  unnamed protein product                                694   0.0      
ref|XP_010905123.1|  PREDICTED: MLO-like protein 6                      688   0.0      
ref|XP_009347038.1|  PREDICTED: MLO-like protein 6                      687   0.0      
ref|XP_002526372.1|  Protein MLO, putative                              687   0.0      Ricinus communis
ref|XP_009411538.1|  PREDICTED: MLO-like protein 6                      685   0.0      
ref|XP_010046751.1|  PREDICTED: MLO-like protein 6                      684   0.0      
ref|XP_003538050.1|  PREDICTED: MLO-like protein 6-like                 684   0.0      
ref|XP_010905121.1|  PREDICTED: MLO-like protein 6                      682   0.0      
ref|XP_008243901.1|  PREDICTED: MLO-like protein 6                      678   0.0      
ref|XP_007208289.1|  hypothetical protein PRUPE_ppa003437mg             677   0.0      
ref|XP_010313404.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    676   0.0      
ref|XP_004304413.1|  PREDICTED: MLO-like protein 6-like                 675   0.0      
emb|CAN64133.1|  hypothetical protein VITISV_032771                     675   0.0      Vitis vinifera
gb|AGV68800.1|  MLO3                                                    675   0.0      
ref|XP_009342695.1|  PREDICTED: MLO-like protein 6 isoform X1           674   0.0      
gb|KCW88826.1|  hypothetical protein EUGRSUZ_A01164                     672   0.0      
ref|XP_009342698.1|  PREDICTED: MLO-like protein 6 isoform X2           670   0.0      
ref|XP_010043720.1|  PREDICTED: MLO-like protein 6 isoform X1           670   0.0      
gb|AFW98802.1|  MLO protein 2                                           664   0.0      
ref|XP_008369779.1|  PREDICTED: MLO-like protein 6 isoform X2           663   0.0      
ref|XP_007150219.1|  hypothetical protein PHAVU_005G136700g             659   0.0      
ref|XP_003539406.1|  PREDICTED: MLO-like protein 6-like                 657   0.0      
ref|XP_009358149.1|  PREDICTED: MLO-like protein 6                      653   0.0      
ref|XP_008369778.1|  PREDICTED: MLO-like protein 6 isoform X1           653   0.0      
ref|XP_006424615.1|  hypothetical protein CICLE_v10028092mg             649   0.0      
ref|XP_007132193.1|  hypothetical protein PHAVU_011G073800g             646   0.0      
ref|XP_009395303.1|  PREDICTED: MLO-like protein 6                      647   0.0      
ref|NP_001268008.1|  MLO7 protein                                       642   0.0      
ref|XP_010558749.1|  PREDICTED: MLO-like protein 6                      642   0.0      
gb|KDO48443.1|  hypothetical protein CISIN_1g008391mg                   640   0.0      
ref|XP_004142393.1|  PREDICTED: MLO-like protein 6-like                 640   0.0      
ref|NP_001284458.1|  MLO-like protein 12                                639   0.0      
emb|CBI31482.3|  unnamed protein product                                637   0.0      
gb|ACO07297.1|  MLO1                                                    638   0.0      Pisum sativum [garden pea]
ref|XP_004157520.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    637   0.0      
ref|XP_008806842.1|  PREDICTED: MLO-like protein 6                      634   0.0      
ref|XP_009385958.1|  PREDICTED: MLO-like protein 6                      633   0.0      
emb|CDO99726.1|  unnamed protein product                                631   0.0      
ref|XP_003597192.1|  MLO-like protein                                   632   0.0      
ref|XP_004487134.1|  PREDICTED: MLO-like protein 6-like                 632   0.0      
gb|ADV40949.1|  MLO1                                                    629   0.0      
ref|XP_003539407.1|  PREDICTED: MLO-like protein 6-like                 628   0.0      
ref|XP_007150221.1|  hypothetical protein PHAVU_005G136800g             624   0.0      
ref|NP_176350.1|  MLO-like protein 6                                    625   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302048.1|  hypothetical protein CARUB_v10020030mg             624   0.0      
ref|XP_008338448.1|  PREDICTED: MLO-like protein 6                      622   0.0      
ref|XP_002886534.1|  hypothetical protein ARALYDRAFT_315221             623   0.0      
gb|KHN25048.1|  MLO-like protein 6                                      622   0.0      
ref|XP_002312021.2|  MLO-like protein 12                                622   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010547373.1|  PREDICTED: MLO-like protein 6                      620   0.0      
ref|XP_011013684.1|  PREDICTED: MLO-like protein 12                     617   0.0      
ref|XP_010934812.1|  PREDICTED: MLO-like protein 2                      620   0.0      
ref|XP_011040971.1|  PREDICTED: MLO-like protein 6                      620   0.0      
ref|XP_006417368.1|  hypothetical protein EUTSA_v10007208mg             619   0.0      
ref|XP_011044384.1|  PREDICTED: MLO-like protein 6 isoform X1           618   0.0      
ref|XP_010430162.1|  PREDICTED: MLO-like protein 6 isoform X1           621   0.0      
ref|XP_010473362.1|  PREDICTED: MLO-like protein 6 isoform X1           618   0.0      
ref|XP_007009792.1|  Seven transmembrane MLO family protein             617   0.0      
ref|XP_010418123.1|  PREDICTED: MLO-like protein 6                      617   0.0      
ref|XP_007015437.1|  Seven transmembrane MLO family protein isofo...    614   0.0      
ref|XP_011004622.1|  PREDICTED: MLO-like protein 6                      612   0.0      
ref|XP_006307103.1|  hypothetical protein CARUB_v10008691mg             615   0.0      
ref|XP_011031756.1|  PREDICTED: MLO-like protein 6                      614   0.0      
ref|NP_565902.1|  protein MILDEW RESISTANCE LOCUS O 12                  614   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY47582.1|  BnaA01g22680D                                          613   0.0      
ref|XP_009133342.1|  PREDICTED: MLO-like protein 12 isoform X1          614   0.0      
ref|XP_004515994.1|  PREDICTED: MLO-like protein 2-like                 612   0.0      
ref|XP_009104728.1|  PREDICTED: MLO-like protein 6                      613   0.0      
ref|XP_006411145.1|  hypothetical protein EUTSA_v10016436mg             612   0.0      
ref|XP_002881634.1|  hypothetical protein ARALYDRAFT_903160             612   0.0      
ref|XP_002533246.1|  Protein MLO, putative                              612   0.0      Ricinus communis
ref|XP_010505587.1|  PREDICTED: MLO-like protein 12 isoform X2          612   0.0      
ref|XP_010412940.1|  PREDICTED: MLO-like protein 12                     609   0.0      
ref|XP_010509062.1|  PREDICTED: MLO-like protein 12                     611   0.0      
ref|XP_010505586.1|  PREDICTED: MLO-like protein 12 isoform X1          611   0.0      
ref|XP_011077127.1|  PREDICTED: MLO-like protein 12                     607   0.0      
emb|CDY26348.1|  BnaA03g60240D                                          611   0.0      
ref|XP_009124631.1|  PREDICTED: MLO-like protein 6                      610   0.0      
ref|NP_172598.1|  MLO-like protein 2                                    609   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436274.1|  hypothetical protein CICLE_v10031130mg             608   0.0      
gb|KFK36813.1|  hypothetical protein AALP_AA4G174800                    609   0.0      
ref|XP_002892636.1|  hypothetical protein ARALYDRAFT_471266             608   0.0      
emb|CDY15021.1|  BnaCnng04240D                                          608   0.0      
ref|XP_009133345.1|  PREDICTED: MLO-like protein 12                     608   0.0      
ref|XP_006293900.1|  hypothetical protein CARUB_v10022893mg             607   0.0      
gb|AGV68801.1|  MLO4                                                    607   0.0      
ref|XP_007151752.1|  hypothetical protein PHAVU_004G071700g             606   0.0      
ref|XP_009133347.1|  PREDICTED: MLO-like protein 12                     604   0.0      
ref|XP_009113127.1|  PREDICTED: MLO-like protein 6                      604   0.0      
ref|XP_002315295.2|  hypothetical protein POPTR_0010s22730g             603   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003548912.1|  PREDICTED: MLO-like protein 12-like isoform X1     601   0.0      
ref|XP_009141792.1|  PREDICTED: MLO-like protein 12                     600   0.0      
ref|XP_008233336.1|  PREDICTED: MLO-like protein 6                      599   0.0      
ref|XP_006391995.1|  hypothetical protein EUTSA_v10023372mg             599   0.0      
gb|AFH68055.1|  seven transmembrane calmodulin binding protein          597   0.0      
ref|XP_002322867.1|  hypothetical protein POPTR_0016s08940g             595   0.0      Populus trichocarpa [western balsam poplar]
gb|KFK35674.1|  hypothetical protein AALP_AA4G022500                    598   0.0      
ref|NP_001288934.1|  MLO-like protein 2                                 597   0.0      
ref|XP_010458517.1|  PREDICTED: MLO-like protein 2                      597   0.0      
ref|XP_006592218.1|  PREDICTED: MLO-like protein 6-like isoform X2      590   0.0      
ref|XP_010492667.1|  PREDICTED: MLO-like protein 2                      595   0.0      
gb|AIT98397.1|  MLO1                                                    593   0.0      
gb|KFK40693.1|  hypothetical protein AALP_AA2G029100                    594   0.0      
gb|KHN05728.1|  MLO-like protein 6                                      591   0.0      
ref|XP_010476039.1|  PREDICTED: MLO-like protein 2 isoform X1           592   0.0      
ref|XP_011089323.1|  PREDICTED: MLO-like protein 6                      590   0.0      
ref|XP_010430163.1|  PREDICTED: MLO-like protein 6 isoform X2           593   0.0      
gb|KHN13369.1|  MLO-like protein 12                                     589   0.0      
ref|XP_010476040.1|  PREDICTED: MLO-like protein 2 isoform X2           588   0.0      
gb|KDP25722.1|  hypothetical protein JCGZ_23943                         587   0.0      
ref|NP_001268005.1|  MLO6 protein                                       587   0.0      
ref|XP_007150220.1|  hypothetical protein PHAVU_005G136700g             580   0.0      
emb|CBI31481.3|  unnamed protein product                                583   0.0      
ref|XP_009378090.1|  PREDICTED: MLO-like protein 6                      584   0.0      
gb|AFM35696.1|  Mlo                                                     582   0.0      
emb|CDY07075.1|  BnaA04g22400D                                          583   0.0      
ref|XP_010264736.1|  PREDICTED: MLO-like protein 6 isoform X2           576   0.0      
ref|XP_010476041.1|  PREDICTED: MLO-like protein 2 isoform X3           580   0.0      
ref|XP_009782286.1|  PREDICTED: MLO-like protein 6 isoform X1           579   0.0      
emb|CDY14402.1|  BnaC03g21930D                                          580   0.0      
gb|KHN00832.1|  MLO-like protein 6                                      579   0.0      
ref|XP_003555433.1|  PREDICTED: MLO-like protein 12-like isoform X1     579   0.0      
ref|XP_003519926.1|  PREDICTED: MLO-like protein 12-like                579   0.0      
ref|XP_003548913.1|  PREDICTED: MLO-like protein 12-like                578   0.0      
ref|XP_010534417.1|  PREDICTED: MLO-like protein 12                     578   0.0      
ref|XP_009595993.1|  PREDICTED: MLO-like protein 6 isoform X1           576   0.0      
ref|XP_007218951.1|  hypothetical protein PRUPE_ppa003466mg             577   0.0      
gb|AIT98395.1|  MLO1                                                    574   0.0      
emb|CDY03836.1|  BnaC01g29530D                                          571   0.0      
gb|AIT98396.1|  MLO1                                                    572   0.0      
ref|XP_009148458.1|  PREDICTED: MLO-like protein 2                      574   0.0      
gb|AAX77015.1|  MLO1                                                    572   0.0      Lotus japonicus
gb|AFW98803.1|  MLO protein 3                                           570   0.0      
ref|XP_008365656.1|  PREDICTED: MLO-like protein 6                      567   0.0      
ref|XP_009333712.1|  PREDICTED: MLO-like protein 6                      563   0.0      
gb|KHN17123.1|  MLO-like protein 6                                      563   0.0      
gb|KHN00604.1|  MLO-like protein 12                                     563   0.0      
ref|XP_006356488.1|  PREDICTED: MLO-like protein 6-like                 561   0.0      
ref|NP_001234814.1|  MLO1 protein                                       561   0.0      
ref|XP_010032208.1|  PREDICTED: MLO-like protein 2 isoform X2           562   0.0      
ref|XP_010032207.1|  PREDICTED: MLO-like protein 2 isoform X1           562   0.0      
gb|KHN13370.1|  MLO-like protein 12                                     562   0.0      
ref|XP_004235223.1|  PREDICTED: MLO-like protein 2 isoform X1           560   0.0      
ref|XP_008463927.1|  PREDICTED: MLO-like protein 6 isoform X2           556   0.0      
emb|CDY20991.1|  BnaA08g25340D                                          559   0.0      
ref|XP_007151753.1|  hypothetical protein PHAVU_004G071800g             559   0.0      
ref|XP_010107562.1|  MLO-like protein 12                                564   0.0      
ref|XP_009110727.1|  PREDICTED: MLO-like protein 2                      557   0.0      
gb|AEC12478.1|  membrane protein                                        557   0.0      
gb|AFW98804.1|  MLO protein 4                                           556   0.0      
ref|XP_008387612.1|  PREDICTED: MLO-like protein 6 isoform X2           548   0.0      
ref|XP_010492678.1|  PREDICTED: MLO-like protein 2                      552   0.0      
ref|XP_007143692.1|  hypothetical protein PHAVU_007G093600g             550   0.0      
ref|XP_004149543.1|  PREDICTED: MLO-like protein 6-like                 545   0.0      
ref|NP_001185281.1|  MLO-like protein 6                                 544   0.0      
ref|XP_006595457.1|  PREDICTED: MLO-like protein 6-like                 543   0.0      
ref|XP_010043721.1|  PREDICTED: MLO-like protein 6 isoform X2           536   0.0      
ref|XP_010068861.1|  PREDICTED: MLO-like protein 2                      540   0.0      
ref|XP_010473363.1|  PREDICTED: MLO-like protein 6 isoform X2           534   3e-180   
dbj|BAF00789.1|  membrane protein Mlo12                                 534   5e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133344.1|  PREDICTED: MLO-like protein 12 isoform X2          533   8e-179   
dbj|BAJ34622.1|  unnamed protein product                                530   3e-178   
emb|CDY07669.1|  BnaA03g18420D                                          524   6e-176   
ref|XP_010917470.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    524   1e-174   
gb|EYU41617.1|  hypothetical protein MIMGU_mgv1a0045332mg               515   1e-174   
ref|XP_006485875.1|  PREDICTED: MLO-like protein 12-like                516   2e-174   
gb|KDO48444.1|  hypothetical protein CISIN_1g008391mg                   516   2e-174   
ref|NP_001185282.1|  MLO-like protein 6                                 518   1e-173   
emb|CDY07665.1|  BnaA03g18460D                                          518   2e-173   
emb|CDY14401.1|  BnaC03g21940D                                          516   7e-173   
ref|XP_010658319.1|  PREDICTED: MLO7 protein isoform X1                 506   4e-171   
ref|XP_006488133.1|  PREDICTED: MLO-like protein 6-like isoform X2      506   2e-170   
emb|CDX97946.1|  BnaA06g06970D                                          510   3e-170   
gb|KHN33781.1|  MLO protein like 1                                      510   5e-170   
emb|CDY57371.1|  BnaCnng31840D                                          504   4e-169   
gb|KEH25655.1|  seven transmembrane MLO family protein                  500   4e-168   
ref|XP_007135967.1|  hypothetical protein PHAVU_009G006800g             505   4e-168   
emb|CDY19353.1|  BnaC05g08620D                                          504   1e-167   
gb|KHN20094.1|  MLO protein like 1                                      503   2e-167   
ref|XP_004500844.1|  PREDICTED: MLO protein homolog 1-like              503   4e-167   
ref|XP_003527634.1|  PREDICTED: MLO protein homolog 1-like              501   1e-166   
emb|CDY12904.1|  BnaA09g13700D                                          499   2e-165   
ref|XP_008228898.1|  PREDICTED: MLO protein homolog 1-like              498   2e-165   
ref|NP_001105660.1|  barley mlo defense gene homolog1                   495   3e-164   Zea mays [maize]
ref|XP_008786739.1|  PREDICTED: MLO protein homolog 1                   494   4e-164   
ref|XP_011074078.1|  PREDICTED: MLO protein homolog 1-like              494   1e-163   
ref|XP_007210822.1|  hypothetical protein PRUPE_ppa020311mg             494   1e-163   
ref|XP_004985865.1|  PREDICTED: MLO protein homolog 1-like              493   2e-163   
ref|XP_009372684.1|  PREDICTED: MLO protein homolog 1-like              493   3e-163   
ref|XP_006599405.1|  PREDICTED: MLO-like protein 12-like isoform X2     487   5e-163   
ref|XP_008237952.1|  PREDICTED: MLO protein homolog 1-like              491   2e-162   
ref|XP_002273002.1|  PREDICTED: MLO protein homolog 1-like              490   3e-162   Vitis vinifera
ref|NP_001117268.1|  MLO-like protein 2                                 484   8e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855670.1|  hypothetical protein AMTR_s00044p00123510          489   9e-162   
ref|XP_010918343.1|  PREDICTED: MLO protein homolog 1                   486   8e-161   
gb|EYU36580.1|  hypothetical protein MIMGU_mgv1a020678mg                486   1e-160   
ref|XP_002510708.1|  Protein MLO, putative                              485   3e-160   Ricinus communis
ref|XP_003603854.1|  MLO protein-like protein                           483   2e-159   
emb|CBI40746.3|  unnamed protein product                                481   3e-159   
ref|XP_002519555.1|  calmodulin binding protein, putative               478   6e-159   Ricinus communis
ref|XP_008387611.1|  PREDICTED: MLO-like protein 6 isoform X1           473   1e-157   
ref|XP_003558907.1|  PREDICTED: protein MLO-like                        474   6e-156   
ref|XP_010318227.1|  PREDICTED: MLO-like protein 2 isoform X2           468   3e-155   
ref|XP_010256542.1|  PREDICTED: MLO-like protein 9                      471   3e-155   
emb|CDP01770.1|  unnamed protein product                                471   5e-155   
ref|XP_010663996.1|  PREDICTED: MLO-like protein 9                      470   8e-155   
ref|XP_010270524.1|  PREDICTED: MLO-like protein 9                      471   8e-155   
ref|XP_010319697.1|  PREDICTED: MLO1 protein isoform X1                 465   1e-154   
ref|XP_010260351.1|  PREDICTED: MLO-like protein 12 isoform X1          468   2e-154   
ref|XP_002465934.1|  hypothetical protein SORBIDRAFT_01g048500          469   5e-154   Sorghum bicolor [broomcorn]
emb|CDP06355.1|  unnamed protein product                                469   7e-154   
ref|NP_001048845.1|  Os03g0129100                                       465   1e-152   Oryza sativa Japonica Group [Japonica rice]
gb|KDO85189.1|  hypothetical protein CISIN_1g041242mg                   465   1e-152   
gb|AAK94907.1|AF384030_1  seven transmembrane protein MLO2              465   2e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_007046462.1|  Seven transmembrane MLO family protein             465   3e-152   
ref|XP_006435410.1|  hypothetical protein CICLE_v10003446mg             464   3e-152   
ref|XP_009418888.1|  PREDICTED: MLO-like protein 9                      464   8e-152   
emb|CBI40748.3|  unnamed protein product                                461   1e-151   
ref|XP_006649324.1|  PREDICTED: MLO protein homolog 1-like              462   4e-151   
ref|XP_006606236.1|  PREDICTED: MLO-like protein 12-like isoform X2     455   5e-151   
gb|EYU45068.1|  hypothetical protein MIMGU_mgv1a009898mg                452   7e-151   
ref|XP_010064953.1|  PREDICTED: MLO protein homolog 1-like              459   3e-150   
ref|XP_011034835.1|  PREDICTED: MLO protein homolog 1-like              460   3e-150   
gb|AAK72963.1|AF388195_1  Mlo                                           459   4e-150   Oryza sativa [red rice]
gb|KHG22053.1|  MLO-like protein 8                                      459   5e-150   
ref|XP_004144292.1|  PREDICTED: MLO-like protein 5-like                 458   7e-150   
ref|XP_010064954.1|  PREDICTED: MLO-like protein 9                      458   1e-149   
emb|CDP07140.1|  unnamed protein product                                458   1e-149   
ref|XP_009772716.1|  PREDICTED: MLO-like protein 10                     457   2e-149   
ref|XP_004146181.1|  PREDICTED: MLO-like protein 8-like                 457   2e-149   
gb|AHF52923.1|  Mlo protein                                             457   3e-149   
ref|XP_009782288.1|  PREDICTED: MLO-like protein 6 isoform X3           450   3e-149   
ref|XP_004301626.1|  PREDICTED: MLO protein homolog 1-like              457   3e-149   
ref|XP_008448445.1|  PREDICTED: MLO-like protein 10 isoform X1          457   4e-149   
ref|XP_009790030.1|  PREDICTED: MLO-like protein 8                      456   5e-149   
gb|AHF52924.1|  Mlo protein                                             456   7e-149   
ref|XP_009595994.1|  PREDICTED: MLO-like protein 6 isoform X2           449   9e-149   
ref|XP_009619517.1|  PREDICTED: MLO-like protein 8                      455   1e-148   
gb|KCW70337.1|  hypothetical protein EUGRSUZ_F03580                     455   2e-148   
ref|XP_009601752.1|  PREDICTED: MLO-like protein 8                      454   2e-148   
ref|XP_002276608.1|  PREDICTED: MLO-like protein 10                     455   2e-148   Vitis vinifera
ref|XP_004232584.1|  PREDICTED: MLO-like protein 8                      454   4e-148   
ref|XP_007025524.1|  Seven transmembrane MLO family protein             451   1e-147   
ref|XP_002282198.1|  PREDICTED: MLO-like protein 3 isoform X1           452   2e-147   
ref|XP_010264740.1|  PREDICTED: MLO-like protein 3                      452   3e-147   
ref|XP_007015440.1|  MLO, putative                                      450   5e-147   
ref|XP_006424617.1|  hypothetical protein CICLE_v10028153mg             450   8e-147   
gb|AAN17391.1|  Putative OsMlo-h1                                       450   2e-146   
ref|XP_008464826.1|  PREDICTED: MLO-like protein 9                      449   3e-146   
ref|XP_004253244.1|  PREDICTED: MLO-like protein 9                      448   5e-146   
gb|KDP43787.1|  hypothetical protein JCGZ_22414                         449   6e-146   
ref|XP_006366655.1|  PREDICTED: MLO-like protein 8-like isoform X1      448   6e-146   
ref|XP_006836488.1|  hypothetical protein AMTR_s00108p00111960          447   8e-146   
ref|XP_009386660.1|  PREDICTED: MLO-like protein 9                      448   1e-145   
ref|XP_011034832.1|  PREDICTED: MLO-like protein 9 isoform X1           447   1e-145   
ref|XP_009390750.1|  PREDICTED: MLO-like protein 9 isoform X1           447   2e-145   
ref|XP_008440929.1|  PREDICTED: MLO-like protein 8                      447   3e-145   
ref|XP_004169166.1|  PREDICTED: MLO-like protein 8-like                 446   4e-145   
ref|XP_010043719.1|  PREDICTED: MLO-like protein 3                      446   4e-145   
gb|KFK31027.1|  hypothetical protein AALP_AA6G058600                    443   8e-145   
ref|XP_010253607.1|  PREDICTED: MLO-like protein 3                      445   9e-145   
ref|XP_007204311.1|  hypothetical protein PRUPE_ppa003435mg             446   1e-144   
gb|KEH36350.1|  seven transmembrane MLO family protein                  442   2e-144   
ref|XP_011022136.1|  PREDICTED: MLO-like protein 8                      445   2e-144   
ref|NP_565416.1|  MLO-like protein 8                                    446   2e-144   
ref|XP_009395397.1|  PREDICTED: MLO-like protein 9                      444   2e-144   
ref|XP_009369784.1|  PREDICTED: MLO-like protein 8                      444   3e-144   
sp|O49873.1|MLOH1_HORVU  RecName: Full=MLO protein homolog 1            443   4e-144   
ref|XP_006296403.1|  hypothetical protein CARUB_v10025579mg             441   5e-144   
sp|A2YD22.2|MLOH1_ORYSI  RecName: Full=MLO protein homolog 1; Alt...    442   5e-144   
ref|XP_003523524.1|  PREDICTED: MLO-like protein 5-like                 442   6e-144   
ref|XP_010476042.1|  PREDICTED: MLO-like protein 2 isoform X4           438   7e-144   
ref|XP_003517123.1|  PREDICTED: MLO-like protein 8-like isoform 1       444   1e-143   
ref|XP_010935416.1|  PREDICTED: MLO-like protein 9                      442   2e-143   
sp|Q0DC45.2|MLOH1_ORYSJ  RecName: Full=MLO protein homolog 1; Alt...    441   2e-143   
ref|XP_004134822.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    442   2e-143   
ref|XP_004509461.1|  PREDICTED: MLO-like protein 10-like                442   2e-143   
gb|AAK53798.1|AF369566_1  membrane protein Mlo5                         440   2e-143   
ref|XP_009390757.1|  PREDICTED: MLO-like protein 9 isoform X2           441   2e-143   
ref|XP_002306989.1|  hypothetical protein POPTR_0005s27570g             441   2e-143   
ref|XP_006425252.1|  hypothetical protein CICLE_v10025242mg             442   3e-143   
ref|XP_008242102.1|  PREDICTED: MLO-like protein 8                      442   3e-143   
ref|XP_011089886.1|  PREDICTED: MLO-like protein 3                      440   4e-143   
gb|EEC80635.1|  hypothetical protein OsI_23017                          439   6e-143   
ref|XP_007158026.1|  hypothetical protein PHAVU_002G117900g             442   9e-143   
ref|XP_011098015.1|  PREDICTED: MLO-like protein 10 isoform X1          440   1e-142   
ref|NP_180923.1|  MLO-like protein 5                                    438   1e-142   
ref|XP_003527633.1|  PREDICTED: MLO-like protein 5-like                 439   1e-142   
ref|XP_010111165.1|  MLO-like protein 6                                 439   1e-142   
gb|EEE65742.1|  hypothetical protein OsJ_21392                          439   1e-142   
ref|XP_004512433.1|  PREDICTED: MLO-like protein 10-like                439   2e-142   
ref|NP_001057664.1|  Os06g0486300                                       438   2e-142   
ref|XP_006381474.1|  hypothetical protein POPTR_0006s13170g             438   3e-142   
gb|KHG28669.1|  MLO-like protein 12                                     437   3e-142   
ref|XP_009359622.1|  PREDICTED: MLO-like protein 8                      439   5e-142   
ref|XP_010413828.1|  PREDICTED: MLO-like protein 5                      436   5e-142   
ref|XP_011041289.1|  PREDICTED: MLO protein homolog 1-like              438   6e-142   
ref|XP_010245561.1|  PREDICTED: MLO-like protein 12                     436   7e-142   
ref|XP_010319698.1|  PREDICTED: MLO1 protein isoform X2                 431   7e-142   
gb|KHG26183.1|  MLO-like protein 12                                     436   8e-142   
ref|XP_002301905.2|  hypothetical protein POPTR_0002s00800g             437   9e-142   
ref|XP_010033601.1|  PREDICTED: MLO-like protein 8                      437   9e-142   
ref|XP_009342675.1|  PREDICTED: MLO-like protein 3                      437   1e-141   
ref|XP_006473920.1|  PREDICTED: MLO-like protein 9-like                 437   1e-141   
ref|XP_008804580.1|  PREDICTED: MLO-like protein 9 isoform X1           437   2e-141   
ref|XP_011027760.1|  PREDICTED: MLO-like protein 12                     433   2e-141   
ref|XP_010539025.1|  PREDICTED: MLO-like protein 9                      435   2e-141   
ref|XP_006467107.1|  PREDICTED: MLO-like protein 10-like                437   3e-141   
ref|XP_002275360.2|  PREDICTED: MLO-like protein 3                      434   3e-141   
ref|XP_006599251.1|  PREDICTED: MLO-like protein 8-like                 437   3e-141   
ref|XP_008380968.1|  PREDICTED: MLO-like protein 3                      436   4e-141   
gb|KHN35943.1|  MLO-like protein 8                                      436   4e-141   
ref|XP_008379649.1|  PREDICTED: MLO-like protein 8                      436   5e-141   
ref|XP_007135969.1|  hypothetical protein PHAVU_009G007000g             435   5e-141   
ref|XP_010680631.1|  PREDICTED: MLO-like protein 10 isoform X1          435   6e-141   
ref|XP_002307201.1|  hypothetical protein POPTR_0005s10210g             436   6e-141   
ref|XP_010057357.1|  PREDICTED: MLO-like protein 6                      434   7e-141   
ref|XP_006410510.1|  hypothetical protein EUTSA_v10016533mg             434   7e-141   
ref|XP_002310695.2|  MLO-like protein 8                                 436   8e-141   
ref|XP_006356610.1|  PREDICTED: MLO-like protein 5-like                 434   1e-140   
ref|XP_010469445.1|  PREDICTED: MLO-like protein 5                      432   2e-140   
ref|XP_004287711.1|  PREDICTED: MLO-like protein 8-like                 435   2e-140   
gb|KHN12501.1|  MLO-like protein 8                                      434   3e-140   
ref|XP_010029568.1|  PREDICTED: MLO-like protein 10                     434   3e-140   
ref|XP_007018107.1|  Seven transmembrane MLO family protein             434   3e-140   
ref|XP_002886115.1|  hypothetical protein ARALYDRAFT_480631             434   3e-140   
gb|KHG27081.1|  MLO-like protein 3                                      432   4e-140   
ref|XP_003537693.1|  PREDICTED: MLO-like protein 8-like                 435   4e-140   
ref|XP_010656958.1|  PREDICTED: MLO-like protein 9 isoform X1           433   5e-140   
ref|XP_010686828.1|  PREDICTED: MLO-like protein 9                      431   7e-140   
ref|XP_006299646.1|  hypothetical protein CARUB_v10015833mg             434   8e-140   
ref|NP_001268082.1|  MLO-like protein 9                                 432   8e-140   
ref|XP_008239391.1|  PREDICTED: MLO-like protein 3                      432   1e-139   
ref|XP_007027288.1|  Seven transmembrane MLO family protein, puta...    432   1e-139   
ref|XP_002305106.2|  hypothetical protein POPTR_0004s04960g             429   1e-139   
gb|EMS47417.1|  Protein MLO                                             431   1e-139   
ref|XP_010509851.1|  PREDICTED: MLO-like protein 5                      429   2e-139   
ref|XP_010489376.1|  PREDICTED: MLO-like protein 8                      433   2e-139   
ref|XP_010514988.1|  PREDICTED: MLO-like protein 8                      432   4e-139   
ref|XP_010906858.1|  PREDICTED: MLO-like protein 10                     426   5e-139   
ref|XP_002310696.2|  hypothetical protein POPTR_0007s08570g             430   6e-139   
gb|KCW56485.1|  hypothetical protein EUGRSUZ_I02212                     430   1e-138   
ref|XP_003534232.1|  PREDICTED: MLO-like protein 10-like isoform X1     430   1e-138   
ref|XP_006435412.1|  hypothetical protein CICLE_v10000748mg             429   1e-138   
gb|AAK60566.1|AF384144_1  MLo protein                                   428   2e-138   
gb|KHN08481.1|  MLO-like protein 6                                      427   2e-138   
emb|CDP07269.1|  unnamed protein product                                428   3e-138   
ref|XP_007211108.1|  hypothetical protein PRUPE_ppa024488mg             426   4e-138   
ref|XP_010467520.1|  PREDICTED: MLO-like protein 8                      429   5e-138   
ref|XP_006364311.1|  PREDICTED: MLO-like protein 12-like                426   6e-138   
gb|AES95366.2|  seven transmembrane MLO family protein                  428   7e-138   
emb|CBI21912.3|  unnamed protein product                                427   7e-138   
gb|ACV31920.1|  Mlo protein                                             427   7e-138   
ref|XP_008349735.1|  PREDICTED: MLO protein homolog 1-like              427   8e-138   
ref|XP_007156260.1|  hypothetical protein PHAVU_003G271300g             428   9e-138   
ref|XP_002879463.1|  hypothetical protein ARALYDRAFT_482315             425   9e-138   
ref|XP_008225160.1|  PREDICTED: MLO-like protein 12                     425   1e-137   
gb|EMT06538.1|  Protein MLO                                             426   1e-137   
ref|XP_009141335.1|  PREDICTED: MLO-like protein 5                      425   2e-137   
gb|AAK94904.1|AF361932_1  seven transmembrane-spanning protein          426   2e-137   
ref|XP_004304412.1|  PREDICTED: MLO-like protein 3-like                 426   2e-137   
ref|XP_007211843.1|  hypothetical protein PRUPE_ppa004687mg             424   2e-137   
ref|XP_009382074.1|  PREDICTED: MLO-like protein 9                      426   2e-137   
ref|XP_010530986.1|  PREDICTED: MLO-like protein 8                      427   2e-137   
gb|EYU39586.1|  hypothetical protein MIMGU_mgv1a020874mg                420   3e-137   
gb|ACV31921.1|  Mlo protein                                             424   5e-137   
ref|XP_010099632.1|  MLO-like protein 12                                420   6e-137   
ref|NP_001105170.1|  barley mlo defense gene homolog6                   423   8e-137   
ref|XP_003612408.1|  Mlo family protein                                 425   9e-137   
ref|XP_010030836.1|  PREDICTED: MLO protein homolog 1-like              424   1e-136   
ref|XP_010550512.1|  PREDICTED: MLO-like protein 10 isoform X2          422   1e-136   
ref|XP_008237943.1|  PREDICTED: MLO-like protein 9                      422   1e-136   
ref|XP_003629098.1|  MLO-like protein                                   425   1e-136   
gb|KFK40125.1|  hypothetical protein AALP_AA3G333500                    425   2e-136   
ref|XP_006307459.1|  hypothetical protein CARUB_v10009086mg             421   2e-136   
ref|XP_008647383.1|  PREDICTED: uncharacterized protein LOC100193...    421   2e-136   
ref|XP_010523625.1|  PREDICTED: MLO-like protein 9                      422   2e-136   
ref|XP_004245231.1|  PREDICTED: MLO-like protein 9                      422   2e-136   
dbj|BAJ34234.1|  unnamed protein product                                424   3e-136   
ref|XP_010253612.1|  PREDICTED: MLO-like protein 6 isoform X2           415   3e-136   
gb|EYU36197.1|  hypothetical protein MIMGU_mgv1a003903mg                422   6e-136   
gb|AAK60567.1|AF384145_1  MLo1 protein                                  421   7e-136   
ref|XP_010466376.1|  PREDICTED: MLO-like protein 10                     422   8e-136   
emb|CBI30622.3|  unnamed protein product                                420   9e-136   
gb|KGN49000.1|  hypothetical protein Csa_6G509690                       421   1e-135   
gb|AFW69614.1|  hypothetical protein ZEAMMB73_948296                    423   1e-135   
ref|XP_010548198.1|  PREDICTED: MLO-like protein 8                      422   1e-135   
ref|XP_010484707.1|  PREDICTED: MLO-like protein 10                     422   1e-135   
ref|XP_008383677.1|  PREDICTED: MLO-like protein 12                     419   2e-135   
ref|XP_008225351.1|  PREDICTED: MLO-like protein 3 isoform X1           421   2e-135   
ref|XP_004978312.1|  PREDICTED: MLO-like protein 5-like                 421   2e-135   
ref|XP_010270522.1|  PREDICTED: MLO-like protein 9 isoform X1           420   2e-135   
ref|XP_006654121.1|  PREDICTED: MLO-like protein 5-like                 421   2e-135   
gb|ADV29809.1|  MLO1 protein                                            421   2e-135   
ref|XP_011001234.1|  PREDICTED: MLO-like protein 12                     420   2e-135   
ref|NP_001105168.1|  barley mlo defense gene homolog2                   421   3e-135   
ref|XP_010260350.1|  PREDICTED: MLO-like protein 12 isoform X2          421   3e-135   
emb|CDP07267.1|  unnamed protein product                                419   5e-135   
emb|CDY30363.1|  BnaA09g09140D                                          421   5e-135   
ref|XP_009112431.1|  PREDICTED: MLO-like protein 8                      421   6e-135   
ref|XP_004147296.1|  PREDICTED: MLO-like protein 3-like                 421   6e-135   
ref|NP_001267908.1|  MLO-like protein 6-like                            418   7e-135   
emb|CDY26810.1|  BnaC09g09370D                                          421   7e-135   
ref|NP_201398.1|  MLO-like protein 10                                   419   1e-134   
emb|CDY24339.1|  BnaA07g02640D                                          420   1e-134   
ref|XP_008463703.1|  PREDICTED: MLO-like protein 3                      419   2e-134   
ref|XP_009121111.1|  PREDICTED: MLO-like protein 8                      419   3e-134   
ref|XP_008373392.1|  PREDICTED: MLO-like protein 9                      416   3e-134   
emb|CDY20802.1|  BnaC07g06510D                                          419   4e-134   
ref|XP_006377427.1|  hypothetical protein POPTR_0011s05820g             416   4e-134   
ref|XP_006473919.1|  PREDICTED: MLO protein homolog 1-like              415   5e-134   
ref|XP_004163965.1|  PREDICTED: MLO-like protein 3-like                 418   5e-134   
gb|EAY79378.1|  hypothetical protein OsI_34504                          418   6e-134   
ref|XP_010444861.1|  PREDICTED: MLO-like protein 10                     417   6e-134   
ref|XP_006409301.1|  hypothetical protein EUTSA_v10022612mg             418   6e-134   
ref|XP_009352843.1|  PREDICTED: MLO-like protein 6                      416   7e-134   
ref|XP_010039224.1|  PREDICTED: MLO-like protein 3                      418   9e-134   
ref|XP_011003713.1|  PREDICTED: MLO-like protein 3 isoform X1           416   1e-133   
ref|XP_009586729.1|  PREDICTED: MLO-like protein 9                      416   1e-133   
ref|XP_002865092.1|  hypothetical protein ARALYDRAFT_497027             417   1e-133   
ref|XP_009601693.1|  PREDICTED: MLO-like protein 3                      414   1e-133   
ref|XP_004240662.1|  PREDICTED: MLO-like protein 3                      414   2e-133   
ref|XP_002439069.1|  hypothetical protein SORBIDRAFT_10g031010          414   2e-133   
ref|XP_006343450.1|  PREDICTED: MLO-like protein 3-like                 413   3e-133   
ref|XP_007206665.1|  hypothetical protein PRUPE_ppa022847mg             414   7e-133   
ref|XP_004293900.1|  PREDICTED: MLO-like protein 12-like                414   7e-133   
ref|XP_002884057.1|  ATMLO7/MLO7                                        414   8e-133   
ref|XP_009779293.1|  PREDICTED: MLO-like protein 9                      413   1e-132   
ref|XP_011047854.1|  PREDICTED: MLO-like protein 3                      413   1e-132   
ref|XP_003574266.1|  PREDICTED: MLO-like protein 9                      414   1e-132   
ref|XP_010680632.1|  PREDICTED: MLO-like protein 10 isoform X2          413   1e-132   
gb|KEH36351.1|  seven transmembrane MLO family protein                  412   2e-132   
sp|P93766.1|MLO_HORVU  RecName: Full=Protein MLO                        413   2e-132   
ref|XP_006662559.1|  PREDICTED: MLO-like protein 9-like                 414   2e-132   
ref|XP_009372611.1|  PREDICTED: MLO-like protein 9                      411   2e-132   
ref|NP_179335.3|  MLO-like protein 7                                    412   3e-132   
ref|XP_010467513.1|  PREDICTED: MLO-like protein 7                      412   4e-132   
ref|XP_011014773.1|  PREDICTED: MLO-like protein 10 isoform X1          413   6e-132   
ref|XP_002522497.1|  Protein MLO, putative                              411   6e-132   
ref|XP_006393785.1|  hypothetical protein EUTSA_v10003913mg             412   6e-132   
ref|XP_010489369.1|  PREDICTED: MLO-like protein 7                      411   8e-132   
ref|XP_007207371.1|  hypothetical protein PRUPE_ppa004621mg             409   1e-131   
gb|KFK29153.1|  hypothetical protein AALP_AA7G095800                    408   1e-131   
ref|XP_003603856.1|  MLO-like protein                                   410   2e-131   
ref|XP_006281817.1|  hypothetical protein CARUB_v10028002mg             411   2e-131   
ref|XP_002465008.1|  hypothetical protein SORBIDRAFT_01g030400          411   2e-131   
ref|XP_006303812.1|  hypothetical protein CARUB_v10012285mg             407   4e-131   
ref|XP_008439801.1|  PREDICTED: MLO-like protein 6                      409   4e-131   
ref|XP_002893934.1|  hypothetical protein ARALYDRAFT_473744             406   8e-131   
ref|XP_008385390.1|  PREDICTED: MLO-like protein 6                      402   1e-130   
ref|XP_007043715.1|  MLO-like protein 9, putative                       410   1e-130   
gb|EYU28022.1|  hypothetical protein MIMGU_mgv1a019894mg                406   1e-130   
ref|NP_174980.3|  MLO-like protein 9                                    405   1e-130   
ref|XP_006377424.1|  hypothetical protein POPTR_0011s05790g             407   2e-130   
gb|AAG51314.1|AC025815_1  Mlo-like protein                              405   2e-130   
ref|XP_006467720.1|  PREDICTED: MLO-like protein 12-like                406   2e-130   
ref|XP_010550511.1|  PREDICTED: MLO-like protein 10 isoform X1          407   3e-130   
ref|XP_003520647.1|  PREDICTED: MLO-like protein 3-like                 405   3e-130   
ref|XP_009335051.1|  PREDICTED: MLO-like protein 3 isoform X1           407   4e-130   
ref|XP_006449419.1|  hypothetical protein CICLE_v10015069mg             405   4e-130   
ref|XP_008338387.1|  PREDICTED: MLO-like protein 3                      407   6e-130   
ref|XP_011094743.1|  PREDICTED: MLO-like protein 3                      408   7e-130   
ref|XP_010478983.1|  PREDICTED: MLO-like protein 9                      403   1e-129   



>ref|XP_011089887.1| PREDICTED: MLO-like protein 6 [Sesamum indicum]
Length=587

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/522 (75%), Positives = 446/522 (85%), Gaps = 7/522 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLE+TPTWAVA VCFVLVAISIVIE++IHLIGK L+ ++K+ALYEALEK+K+
Sbjct  1     MAGASGGRSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKHKRALYEALEKLKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICISK++G +WHPC + +E  KY  +   G+ +  +   
Sbjct  61    ELMLLGFISLLLTVGQGPISDICISKAVGATWHPCSKKQEGKKYPAEEDLGEDNRRKLLM  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             +      +E  G S RRILA GGTDKCA +G VPF+S+DGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   V------EEDGGGSFRRILAAGGTDKCAAKGKVPFVSSDGIHQLHIFIFVLAVFHVLYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A G  KMRKWKAWE ET+T EYQF+HDPERFRFAR+TSFGRRHLSFWS++P LLWIV
Sbjct  175   LTMALGGAKMRKWKAWEKETRTAEYQFSHDPERFRFARETSFGRRHLSFWSKTPLLLWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS  +FDFQ+YI+RSLEEDFKVVVGISPPIW
Sbjct  235   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHASFDFQKYIRRSLEEDFKVVVGISPPIW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  SYLWLPF+PL+IILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  295   FFAVLFLLFNTHGWYSYLWLPFVPLIIILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSCFHE  ED+VIRI+MG+
Sbjct  355   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSCFHEHVEDIVIRITMGV  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TA+K ++Q +HS   TP+
Sbjct  415   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTAKKHIKQNKHSAPTTPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEI-DSVGASPARDIEDNLPW  1793
             SS P TP HG SPIHLL++YKSE+ DS+  SP +   D   W
Sbjct  475   SSHPATPSHGMSPIHLLRHYKSEMTDSLQTSPRKSNYDMDNW  516



>emb|CDP07138.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/564 (70%), Positives = 449/564 (80%), Gaps = 47/564 (8%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVA VCFVLVAISI+IE+++HLIGK L+ ++K++LYEALEKIK+
Sbjct  1     MAGGGGGRSLEQTPTWAVAVVCFVLVAISILIEHILHLIGKWLKSKHKRSLYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I KICISK +G +WHPC++ +E +                  
Sbjct  61    ELMLLGFISLLLTVGQGPITKICISKEVGATWHPCNKKQEANL-----------------  103

Query  591   lllAFADDEYSGESH--------------RRILAGGGTDKCAKEGMVPFISADGIHQLHI  728
                    D++SG SH              RRILA GG DKC  +G V F+S DGIHQLHI
Sbjct  104   -------DQHSGVSHGEDGRRRLLSDDGARRILASGGADKCEAKGKVSFVSTDGIHQLHI  156

Query  729   FIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRH  908
             FIFVLA+FHVLYCI+T A GR KM  WKAWE ETKT EYQF+HDPERFRFAR+TSFGRRH
Sbjct  157   FIFVLAVFHVLYCILTYALGRAKMSSWKAWEKETKTAEYQFSHDPERFRFARETSFGRRH  216

Query  909   LSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLE  1088
             LSFWSR+PFLLWIVCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS  NFDFQ+YI RSLE
Sbjct  217   LSFWSRTPFLLWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHANFDFQKYINRSLE  276

Query  1089  EDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRI  1268
             EDFKVVVGISPPIWLFAVIFLLFNTHG  SYLWLPF+PLVIILLVGTKLQVIITKMGLRI
Sbjct  277   EDFKVVVGISPPIWLFAVIFLLFNTHGWYSYLWLPFVPLVIILLVGTKLQVIITKMGLRI  336

Query  1269  QERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFH  1448
             QERGEVVKG PVVQP DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGL+SCFH
Sbjct  337   QERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLRSCFH  396

Query  1449  EKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARK  1628
             E  ED++IRISMG+LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA ALK+WH TA+K
Sbjct  397   EHLEDIIIRISMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALKNWHHTAKK  456

Query  1629  QLRQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW-----  1793
              +++ +HSG  +P+SSR  TP H  SP+HLL+ YKSE+DS+  SP +   D   W     
Sbjct  457   HIKESKHSGLASPISSRAATPSHHLSPVHLLRRYKSELDSLQTSPRKSNFDVEQWDTESP  516

Query  1794  ----FNQRRDNNVDQPAEENRNEL  1853
                 F+Q   ++V     ++  EL
Sbjct  517   SPSQFHQGSIDHVSSSQHQHNIEL  540



>ref|XP_009603532.1| PREDICTED: MLO-like protein 6 [Nicotiana tomentosiformis]
Length=597

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/527 (75%), Positives = 451/527 (86%), Gaps = 7/527 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG GGGRSLE+TPTWAVAAVCFVLVAISIVIE++IHLIGK  + + K+AL+EALEKIKA
Sbjct  1     MAGSGGGRSLEQTPTWAVAAVCFVLVAISIVIEHIIHLIGKWFKSKKKRALFEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  IC+S+ +GNSWHPC + +EED   G+  + +    + RR
Sbjct  61    ELMLLGFISLLLTVGQSPISNICVSEKIGNSWHPCSKQKEEDIIKGEDINSEDSSEQHRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL  A    +G S RRILAGGG DKCA +G VPF+SADGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   RLLMAA----AGGSVRRILAGGGEDKCAAKGKVPFVSADGIHQLHIFIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR WK+WE+ETKT EY FTHDPERFRF R+TSFGRRHLSFW+++P LLWI+
Sbjct  177   LTLALGNAKMRSWKSWENETKTAEYHFTHDPERFRFTRETSFGRRHLSFWTKNPVLLWII  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQS   FDF++YIKRSLEEDFKVVVGISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHHKFDFRKYIKRSLEEDFKVVVGISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRI ERGEVVKG PVVQ
Sbjct  297   FLAVLFLLFNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGLRIHERGEVVKGVPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSC+H+ TED+VIRISMG+
Sbjct  357   PGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSCYHDHTEDIVIRISMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLR-QKRHSGSVTP  1667
             LIQ+LCSYVTLPLYALVTQMGSNMKPTIFNE+VA ALK+WH TA+K ++ Q +HS +VTP
Sbjct  417   LIQILCSYVTLPLYALVTQMGSNMKPTIFNEKVATALKNWHHTAKKHIKDQSKHSNTVTP  476

Query  1668  LSSRPGTPLHGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLP-WFNQ  1802
             +SSRPGTP HG SP+HLL+ +Y+S++ S+  SP R   D+   W N+
Sbjct  477   MSSRPGTPSHGMSPVHLLRSHYRSDVGSLQNSPRRSNYDHADHWDNE  523



>ref|XP_010104115.1| MLO-like protein 6 [Morus notabilis]
 gb|EXB98556.1| MLO-like protein 6 [Morus notabilis]
Length=585

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/539 (73%), Positives = 453/539 (84%), Gaps = 10/539 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLE+TPTWAVA VCFVLV ISIVIE++IHLIG+ L+K++K+AL+E+LEK+K+
Sbjct  1     MAGASGGRSLEQTPTWAVAVVCFVLVFISIVIEHIIHLIGEWLKKKHKRALFESLEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ+ I  ICIS+ +  +WHPC + +E+D Y  +T      E   RR
Sbjct  61    ELMLLGFISLLLTVGQTLISNICISEKVAATWHPCSKDQEKDLYKNETDHESDHESNGRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL A      SG S RR+LA  GTDKCA++G VPF+S+DGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   LLAALE----SGGSFRRVLASAGTDKCAEKGQVPFVSSDGIHQLHIFIFVLAIFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT+A GR KMR+WK WE ET+T+EYQF+HDPERFRFARDTSFGRRHLSFW+++PFL+WIV
Sbjct  177   ITMALGRAKMRRWKKWEKETRTVEYQFSHDPERFRFARDTSFGRRHLSFWTKTPFLMWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQRFDFQKYINRSLEEDFKVVVGISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  297   FFAVVFLLFNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFG++SCFHE TEDLVIRI+MG+
Sbjct  357   PGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGIRSCFHEHTEDLVIRITMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TA+K ++Q R +GSVTPL
Sbjct  417   LIQFLCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTAKKHVKQSR-TGSVTPL  475

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRN  1847
             SSR  TP H TSPIHLL+ Y+SE+DS+  SP R   D   W     D +   P+   ++
Sbjct  476   SSRSATPSHHTSPIHLLRNYRSEMDSLQNSPRRTYLDAERW-----DTDSPSPSHPQQH  529



>ref|XP_009801961.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=597

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/527 (75%), Positives = 452/527 (86%), Gaps = 7/527 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVAAVCFVLVAISIVIE++IHLIGK  + +NK+AL+EALEKIKA
Sbjct  1     MAGGGGGRSLEQTPTWAVAAVCFVLVAISIVIEHIIHLIGKWFKSKNKRALFEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  IC+S+ +GNSWHPC + +EED   G+  + +    + RR
Sbjct  61    ELMLLGFISLLLTVGQSPISNICVSEKIGNSWHPCSKKKEEDIIKGEDTNSEDSSEQHRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL  A    +G   RRILAGGG DKCA +G V F+SADGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   RLLMAA----AGGGVRRILAGGGEDKCAAKGKVAFVSADGIHQLHIFIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR WK+WE+ETKT EY+FTHDPERFRF R+TSFGRRHLSFW+++P LLWI+
Sbjct  177   LTLALGNAKMRSWKSWENETKTAEYRFTHDPERFRFTRETSFGRRHLSFWTKNPVLLWII  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQS   FDF++YIKRSLEEDFKVVVGISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHHKFDFRKYIKRSLEEDFKVVVGISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRI ERGEVVKG PVVQ
Sbjct  297   FLAVLFLLFNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGLRIHERGEVVKGVPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSC+H+ TED+VIRISMG+
Sbjct  357   PGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSCYHDHTEDIVIRISMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLR-QKRHSGSVTP  1667
             LIQ+LCSYVTLPLYALVTQMGSNMKPTIFNE+VA ALK+WH TA+K ++ Q +HS +VTP
Sbjct  417   LIQILCSYVTLPLYALVTQMGSNMKPTIFNEKVATALKNWHHTAKKHIKDQSKHSNTVTP  476

Query  1668  LSSRPGTPLHGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLP-WFNQ  1802
             +SSRPGTP HG SPIHLL+ +Y S++ S+  SP R   D++  W N+
Sbjct  477   MSSRPGTPSHGMSPIHLLRGHYMSDMGSLQNSPRRSNFDHVDHWDNE  523



>ref|XP_006343449.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=589

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/568 (70%), Positives = 460/568 (81%), Gaps = 17/568 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVA VCFVLVAISIVIE++IHLIGK L+ +NK ALYE+LEKIKA
Sbjct  1     MAGGGGGRSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKNKSALYESLEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  IC+S+ +GNSWHPC + EE++    D+            
Sbjct  61    ELMLLGFISLLLTVGQSPISNICVSEKIGNSWHPCSKEEEDNIISEDSSSEQHRRRLLM-  119

Query  591   lllAFADDEYSGESHRRILA-GGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                     E +G   RRILA GGG DKCA +G VPF+SADGIHQLHIFIFVLA+FHVLYC
Sbjct  120   --------EAAGGGVRRILAGGGGDDKCAAKGKVPFVSADGIHQLHIFIFVLAVFHVLYC  171

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I TLA GR KMR WK+WE+ETKT EY+F+HDPERFRF R+TSFGRRHLSFW+++P LLWI
Sbjct  172   ITTLALGRAKMRSWKSWENETKTAEYEFSHDPERFRFTRETSFGRRHLSFWTKNPILLWI  231

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLRHGFI AHLAPQS   FDF++YIKRSLEEDFKVVVGISPPI
Sbjct  232   VCFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHQKFDFRKYIKRSLEEDFKVVVGISPPI  291

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W  AV+FLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRI ERGEVVKG PVV
Sbjct  292   WFLAVLFLLFNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGLRIHERGEVVKGVPVV  351

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             QP D LFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSC+H+ TED+VIRI+MG
Sbjct  352   QPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSCYHDHTEDIVIRITMG  411

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLR-QKRHSGSVT  1664
             +LIQ+LCSYVTLPLYALVTQMGSNMK TIFNERVA ALK+WH TA+K ++ Q +HS  VT
Sbjct  412   VLIQILCSYVTLPLYALVTQMGSNMKSTIFNERVATALKNWHHTAKKHVKDQSKHSNPVT  471

Query  1665  PLSSRPGTPL-HGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLPWFNQRRDNN---VDQP  1829
             P+SSRPGTP  HG SP+HLL+ +Y+S++ S+  SP R   D   W N+   +      + 
Sbjct  472   PMSSRPGTPSHHGMSPVHLLRGHYRSDMGSLQNSPRRSNYDVDHWDNEGSPSPSRFYQEA  531

Query  1830  AEENRNELQ-REIEMESAEFSFENKREI  1910
             A+ + +++Q  +++ ES E    N  ++
Sbjct  532   ADGSLHQIQLGQLDHESQEVIGPNSSQV  559



>gb|EYU18859.1| hypothetical protein MIMGU_mgv1a003503mg [Erythranthe guttata]
Length=581

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/547 (71%), Positives = 443/547 (81%), Gaps = 23/547 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVA VCFVLV++SIVIEY+IHLIGK L+ ++K+ALYEALEK+K+
Sbjct  1     MAGGGGGRSLEQTPTWAVAVVCFVLVSVSIVIEYIIHLIGKWLKSKHKRALYEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  ICIS+ +G +WHPC + +E+  Y       +        
Sbjct  61    ELMLLGFISLLLTVGQSPISDICISEEVGATWHPCSKKQEKYYYKDPVLGDESRRKLLTA  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                        G S RR LA  GTD CA +G V F+SAD IHQLHIFIFVLA+FHVLYCI
Sbjct  121   ----------GGGSLRRNLAAAGTDNCAAKGKVAFVSADAIHQLHIFIFVLAIFHVLYCI  170

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR+WKAWE ET+T EYQF+HDPERFRFAR+TSFGRRHLSFWS++P L+WIV
Sbjct  171   LTMALGRAKMRRWKAWERETRTAEYQFSHDPERFRFARETSFGRRHLSFWSKTPILMWIV  230

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  231   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHAKFDFQKYINRSLEEDFKVVVGISPPIW  290

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  291   FFAVLFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  350

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSCFHEK ED++IRISMG+
Sbjct  351   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSCFHEKVEDIIIRISMGV  410

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKR---HSGSV  1661
             +IQ+LCSYVTLPLYALVTQMGS+MKPTIFNERVA ALK+WH TA+K ++Q +   HSG  
Sbjct  411   IIQILCSYVTLPLYALVTQMGSSMKPTIFNERVAAALKNWHHTAKKHIKQAKHHQHSGPT  470

Query  1662  TPLSSRPGTPLHGTSPIHLLQYYKSE---IDSVGASPARDIEDNLPWFNQRRDNNVDQPA  1832
             TP+SSRP TP  G SP+HLL++++SE    +S   SP  DI+ +       R   V  P 
Sbjct  471   TPMSSRPATPSTGMSPVHLLRHHRSETETFESPTKSPNHDIDVD-------RWITVGPPP  523

Query  1833  EENRNEL  1853
               N  EL
Sbjct  524   PNNHIEL  530



>gb|AGV68799.1| MLO1 [Prunus armeniaca]
Length=591

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/599 (66%), Positives = 456/599 (76%), Gaps = 47/599 (8%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA    GRSLE+TPTWAVA VCFVLV +SI+IE++I L+ K L+K++K+ALYEALEK+K+
Sbjct  1     MAAATSGRSLEQTPTWAVAVVCFVLVLVSIIIEHLIELVAKWLKKKHKRALYEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ LGN+WHPC + +E         D +    R   
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISEKLGNTWHPCGKKQETKMNKDTEHDEETPSRRLLS  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L         S    RR+LA  GTDKCA +G VPFISADGIHQLHIFIFVLA+FH+LYCI
Sbjct  121   LF------NQSDVGVRRVLAAAGTDKCAPKGKVPFISADGIHQLHIFIFVLAVFHILYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WK WE ET+T EYQF+HDPERFRFARDTSFGRRHLSFW+++PFL+WIV
Sbjct  175   LTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSFWTQTPFLMWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  235   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQKFNFQKYINRSLEEDFKVVVGISPPIW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             LFAVIFLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  295   LFAVIFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE  ED++IR+SMG+
Sbjct  355   PGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHIEDIIIRVSMGI  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++  +  GSVTP+
Sbjct  415   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTARKHIKHNK--GSVTPM  472

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR--------DIEDNLPWFNQRRD-----  1811
             SSRP TP H  SPIHLL+ Y+SE+DS   SP R        D E   P  +   D     
Sbjct  473   SSRPATPSHHMSPIHLLRNYRSEVDSFYNSPRRSNFEGERWDTESASPSHHLHVDGTSSS  532

Query  1812  -------NNVDQPAEENRNE------------------LQREIEM-ESAEFSFENKREI  1910
                     NV+   + + NE                  +Q EI M ++ +FSF+N++ I
Sbjct  533   HHHQIELGNVEHEKDVDVNEPNSVHAAPTTPTTNQPARIQHEINMGQTKDFSFDNRQSI  591



>ref|XP_010253610.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=581

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/589 (66%), Positives = 457/589 (78%), Gaps = 42/589 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG GGGRSLEETPTWAVA VCF+LV IS++IE++IHLIGK L  ++K+ALYEALEKIK+
Sbjct  1     MAGAGGGRSLEETPTWAVAVVCFLLVLISVIIEHIIHLIGKWLTAKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICI + +G +WHPC           +    +      RR
Sbjct  61    ELMLLGFISLLLTVGQGIISEICIPEKVGRTWHPC-------SKKQEEAKEEESSEEHRR  113

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LLA  D   S  S RR+LAGGGTDKCA++G VPF+SADGIHQLHIFIFVLA+FHVLYCI
Sbjct  114   RLLAIPD---SVGSVRRVLAGGGTDKCAEKGKVPFVSADGIHQLHIFIFVLAVFHVLYCI  170

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT+  GR KMR+WKAWE ET+T+EYQFTHDPERFRFARDTSFGRRHL+FWS++P LLWI+
Sbjct  171   ITMVLGRAKMRRWKAWEKETRTVEYQFTHDPERFRFARDTSFGRRHLNFWSKTPVLLWII  230

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHL+PQ+   F+FQ+YI RSLEEDFKVVVGISP IW
Sbjct  231   CFFRQFVRSVPKVDYLTLRHGFIMAHLSPQTHAQFNFQKYINRSLEEDFKVVVGISPTIW  290

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  SYLWLPF+PL+I+LLVGTKLQVIITKMGL+IQ+RGEVVKG PVV+
Sbjct  291   FFAVVFLLFNTHGWYSYLWLPFVPLIIVLLVGTKLQVIITKMGLKIQDRGEVVKGVPVVE  350

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLIHFVLFQNAFQLAFFAW W+EFG+KSCFHE TED+VI+I+MG+
Sbjct  351   PGDDLFWFNRPRLILYLIHFVLFQNAFQLAFFAWTWFEFGMKSCFHEHTEDVVIKITMGV  410

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ LCSYVTLPLYALVTQMGS MKPTIFNERVA AL+ WH TARKQ++Q + SG+ TP+
Sbjct  411   IIQFLCSYVTLPLYALVTQMGSTMKPTIFNERVAIALRKWHHTARKQIKQNQKSGTATPM  470

Query  1671  SSRPGTPLHGTSPIHLLQYY-KSEIDSVGASPARDIEDNLPW-------------FNQRR  1808
              SRP TP HG SP+ LLQ   +S+ DSV  SP     DN  W             + +R 
Sbjct  471   PSRPTTPRHGFSPVSLLQNQRRSDDDSVQTSPRFSNFDNEQWEGEDTPSPSYHYHYGERS  530

Query  1809  DN-----------NVDQPAEENRN-------ELQREIEMESAEFSFENK  1901
              +           +  QP    ++         Q EI+M+S +FSF  +
Sbjct  531   SHQNYFDHHEHRLDEQQPDAYEQSPPPPPPIRTQHEIDMDSVDFSFAKR  579



>gb|AFW98801.1| MLO protein 1 [Rosa multiflora]
Length=592

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/514 (75%), Positives = 437/514 (85%), Gaps = 7/514 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA    GRSLE+TPTWAVA VCFVLV +SI+IEY+I LI K L++++K+AL+EALEKIK+
Sbjct  1     MAASTSGRSLEQTPTWAVAVVCFVLVLVSIIIEYIIELIAKWLKRKHKRALFEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICISK +GN+WHPC +     K      + +       R
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISKKVGNTWHPCSK-----KQEDKIVEEEEKVESPSR  115

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LLA  +  Y G S RR+LA  GTDKCA +G VPFISADGIHQLHIFIFVLA+FHVLYCI
Sbjct  116   KLLAAFESGYGGGSARRVLAAAGTDKCAAKGKVPFISADGIHQLHIFIFVLAVFHVLYCI  175

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WK WE ET+T EYQF+HDPERFRFARDTSFGRRHLS+W+++PFL+WIV
Sbjct  176   LTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSYWTKTPFLMWIV  235

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  236   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQKFNFQKYINRSLEEDFKVVVGISPPIW  295

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVVKGTPVVQ
Sbjct  296   GFAVVFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVKGTPVVQ  355

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE TED++IR+SMG+
Sbjct  356   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHTEDIIIRVSMGV  415

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TA+K ++Q +  GSVTP+
Sbjct  416   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTAKKHIKQNK--GSVTPM  473

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARD  1772
             SSRPGTP H  SPIHLL++Y+SE+DS   SP R 
Sbjct  474   SSRPGTPSHHASPIHLLRHYRSEVDSFHTSPRRS  507



>emb|CDP06724.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/519 (74%), Positives = 428/519 (82%), Gaps = 8/519 (2%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
               GGGRSLEETPTWAVA VCFVLVA+SI+IE VIHLI K L KRN++AL EALEKIK+EL
Sbjct  2     AAGGGRSLEETPTWAVAVVCFVLVALSIIIECVIHLIEKWLTKRNRRALCEALEKIKSEL  61

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGF+SLLLT+GQ  I +ICISKSLGN+WHPC++     +           E    R L
Sbjct  62    MLLGFMSLLLTIGQGPISEICISKSLGNTWHPCNK----KQEHSRHDIDADKEASGHRRL  117

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
             LAF +  Y     RR+LA  G DK +  G VPF+S+DGIHQLHIFIFVLA+FHVLYCI T
Sbjct  118   LAFPESSYG---QRRVLAAAGYDK-SLLGKVPFVSSDGIHQLHIFIFVLAVFHVLYCITT  173

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
              A G  KMR WKAWE ET+T EYQF  DPERFRFARDTSFGRRHLSFWS S  LLW V F
Sbjct  174   YALGTAKMRMWKAWEMETRTSEYQFAQDPERFRFARDTSFGRRHLSFWSHSTILLWTVSF  233

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQFVRSVPKVDY+TLR+GFIIAHLAPQ+Q NFDFQQYIKRSLEEDFKVVVGISP IWLF
Sbjct  234   FRQFVRSVPKVDYLTLRYGFIIAHLAPQNQANFDFQQYIKRSLEEDFKVVVGISPLIWLF  293

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+FLLFNTHG +SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVV+GTP+VQPA
Sbjct  294   AVLFLLFNTHGWQSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVQGTPLVQPA  353

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             DDLFWFNRPR++LYLIHFVLFQNAFQLA F W+WYE+G +SCFHE T+D+ I ISMG+LI
Sbjct  354   DDLFWFNRPRVLLYLIHFVLFQNAFQLALFVWSWYEYGFQSCFHENTKDVAIGISMGVLI  413

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             Q+LCSYVTLPLYALVTQMGS MKPTIFN+ VAKAL +WHQTARK ++QK HS SV P+SS
Sbjct  414   QILCSYVTLPLYALVTQMGSTMKPTIFNKNVAKALHTWHQTARKHIKQKCHSDSVGPVSS  473

Query  1677  RPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
             +P TPL GTSP+HLL YYK+EIDSV  S      +  PW
Sbjct  474   QPSTPLQGTSPVHLLHYYKNEIDSVETSSRISSYNTQPW  512



>ref|NP_001268013.1| MLO11 protein [Vitis vinifera]
 gb|ACF25910.1| MLO-like protein 3 [Vitis vinifera]
 emb|CBI32709.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/594 (66%), Positives = 451/594 (76%), Gaps = 51/594 (9%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA G   RSLE+TPTWAVA VCFVLV ISI+IEY++HLIGK L KRNK+ALYEALEKIK+
Sbjct  1     MAKGSKDRSLEQTPTWAVAVVCFVLVLISIIIEYILHLIGKWLTKRNKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ TI  ICIS+ +  +WHPC + +E      +   G         
Sbjct  61    ELMLLGFISLLLTVGQGTIAGICISEKIAATWHPCGKKQEIKYVSNEEDYGKRR------  114

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                   +   S  S+RR+LA  G DKC  EG VPF+S  GIHQLHIFIFVLA+FHVLYCI
Sbjct  115   ----LLEISDSDGSNRRVLAAAGDDKCG-EGKVPFVSNYGIHQLHIFIFVLAVFHVLYCI  169

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITLA GR KMRKWKAWE ET+T EY+F +DPERFRFARDTSFGRRHL  WS SP LLWIV
Sbjct  170   ITLALGRAKMRKWKAWEMETRTAEYRFANDPERFRFARDTSFGRRHLHSWSTSPVLLWIV  229

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFIIAHLAP+S   FDFQ+YIKRSLEEDFKVVVGISP IW
Sbjct  230   CFFRQFVRSVPKVDYLTLRHGFIIAHLAPESHTRFDFQKYIKRSLEEDFKVVVGISPIIW  289

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL+IIL+VGTKLQVIITKMGLRIQERGEVVKGTPVV+
Sbjct  290   FCAVLFLLFNTHGWHSYLWLPFIPLIIILMVGTKLQVIITKMGLRIQERGEVVKGTPVVE  349

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFN+PRL+LYLI+FVLFQNAFQ+AFFAW WYEFGLKSCFHE+ ED+VIRISMG+
Sbjct  350   PGDDLFWFNQPRLILYLINFVLFQNAFQVAFFAWTWYEFGLKSCFHERIEDVVIRISMGV  409

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS MKPTIFN+RVAKAL++WH  ARK ++Q + S +VTP+
Sbjct  410   IVQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAKALRNWHHAARKHIKQSKQSSAVTPV  469

Query  1671  --------SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDN-------------L  1787
                     SSRPGTPLHG SP+HLL++++SE+DSV  SP     DN             +
Sbjct  470   SSRAGTPFSSRPGTPLHGMSPVHLLRHHRSELDSVQTSPRMSNFDNEGPETDEYRHREDI  529

Query  1788  PWFNQRRDNNVDQPAEENR----------------NELQREIEMESAEFSFENK  1901
              W    R+     P EE R                +  Q EI+++  +FSF+ +
Sbjct  530   SWSEHHRNPG---PEEEGRDTNHRILTRTMPAPQADNAQHEIDIQPMDFSFDKR  580



>ref|XP_007204981.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
 gb|EMJ06180.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
Length=593

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/599 (65%), Positives = 454/599 (76%), Gaps = 45/599 (8%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA    GRSLE+TPTWAVA VCFVLV ISI+IE++I L+ K L+K++K+AL+EALEK+K+
Sbjct  1     MAAATSGRSLEQTPTWAVAVVCFVLVLISIIIEHLIELVAKWLKKKHKRALHEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ LGN+WHPC + +E         + D +   RR 
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISEKLGNTWHPCGKKQETKMNKDKDTEHDDETPSRRL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L L    D       RR+LA  GTDKCA +G VPFISADGIHQLHIFIFVLA+FH+LYCI
Sbjct  121   LSLFNQSDV----GVRRVLAAAGTDKCAAKGKVPFISADGIHQLHIFIFVLAVFHILYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WK WE ET+T EYQF+HDPERFRFARDTSFGRRHLS+W+++P L+WIV
Sbjct  177   LTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSYWTQTPLLMWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQKFNFQKYINRSLEEDFKVVVGISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAVIFLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMG+RIQERGEVVKG PVVQ
Sbjct  297   FFAVIFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGIRIQERGEVVKGVPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE  ED++IR+SMG+
Sbjct  357   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHIEDIIIRVSMGI  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++  +  GSVTP+
Sbjct  417   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTARKHIKHNK--GSVTPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR--------DIEDNLPW-----------  1793
             SSRP TP H  SPIHLL+ Y+SE+DS   SP R        D E   P            
Sbjct  475   SSRPATPSHHMSPIHLLRNYRSEVDSFYNSPRRSNFEGERWDTESPSPSHRLHVDGTSSS  534

Query  1794  ---------FNQRRDNNVDQPAE----------ENRNELQREIEM-ESAEFSFENKREI  1910
                          RD +V++P                  Q EI M  + +FSF+N++ I
Sbjct  535   HHHQIELGNVEHERDVDVNEPNSVHAAPTTTITSQLARTQHEISMGRTKDFSFDNRQSI  593



>ref|XP_010264735.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=578

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/585 (69%), Positives = 457/585 (78%), Gaps = 41/585 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG GGGRSLEETPTWAVA VCFVLVAISI+IE++IHLIGK L KR+K+ALYE+LEKIK+
Sbjct  1     MAGDGGGRSLEETPTWAVATVCFVLVAISIIIEHIIHLIGKWLTKRHKRALYESLEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICI KS+GNSWHPC++   +++   D      D     R
Sbjct  61    ELMLLGFISLLLTVGQGLISEICIPKSVGNSWHPCNK---KEEAKLDAEKESDDPEEHHR  117

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL  AD   SG S RR+LA GGTDKCA +G VPF+S++GIHQLHIFIFVLA+FHVLYCI
Sbjct  118   RLLMIAD---SGGSFRRVLAAGGTDKCAAKGKVPFVSSEGIHQLHIFIFVLAVFHVLYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT+A GRLKMR+WKAWE ETKT+EYQF+HDPERFRFAR+TSFGRRHLSFWS++P LLWIV
Sbjct  175   ITMALGRLKMRRWKAWERETKTIEYQFSHDPERFRFARETSFGRRHLSFWSKTPALLWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQS   FDFQ+YI RSLEEDFKVVVGISP +W
Sbjct  235   CFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHTQFDFQKYINRSLEEDFKVVVGISPTVW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTH   SYLWLPF+PL+IILL+GTKLQV+ITKMGLRIQERGEVVKG PVV+
Sbjct  295   FFAVLFLLLNTHDWHSYLWLPFLPLIIILLLGTKLQVVITKMGLRIQERGEVVKGVPVVE  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLIHFVLFQNAFQLAF  W WYEFG KSCFHE TEDLVIRISMG+
Sbjct  355   PGDDLFWFNRPRLILYLIHFVLFQNAFQLAFLVWTWYEFGRKSCFHEHTEDLVIRISMGV  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRH--SGSVT  1664
             L+Q+LCSYVTLPLYALVTQMGS+M+PTIFNERVA AL++WH  ARK L+Q  H  SGSVT
Sbjct  415   LVQILCSYVTLPLYALVTQMGSSMRPTIFNERVATALRNWHHRARKHLKQNGHGRSGSVT  474

Query  1665  PLSSRPGTPLHGTSPIHLL--QYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAE-  1835
             P+SSRP TP HG SP+HLL   +     DS+  SP     DN     QR       P+  
Sbjct  475   PISSRPTTPRHGFSPVHLLLNTHRSDHADSIHTSPRFSNLDN----EQREGEGTPSPSSY  530

Query  1836  -----------ENRNELQRE---------------IEMESAEFSF  1892
                        ++R   + E               IEM SA+FSF
Sbjct  531   HHHHHERWLGGQDREAHEAEATTPPTAPPVHTQHVIEMSSADFSF  575



>ref|XP_004148785.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 ref|XP_004168500.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 gb|KGN64744.1| hypothetical protein Csa_1G085890 [Cucumis sativus]
Length=582

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/554 (69%), Positives = 442/554 (80%), Gaps = 14/554 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GG+SLE+TPTWAVA VCFVL+ ISI IEY +HLIG  L+KR+K+AL+EALEKIK+
Sbjct  1     MAGAAGGKSLEQTPTWAVAVVCFVLLVISIFIEYSLHLIGHWLKKRHKRALFEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICI + +  +WHPC +  E++         +     RRR
Sbjct  61    ELMLLGFISLLLTVGQGPITEICIPQHVAATWHPCTKEREDEMNKEVEKSVEHLGLNRRR  120

Query  591   lllAFADDEYSGESHRRIL-AGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
             LL        +GES RR L A GG DKCA +G   FISADGIHQLHIFIFVLA+FHVLYC
Sbjct  121   LLHL----LGNGESFRRSLAAAGGEDKCAAKGKASFISADGIHQLHIFIFVLAVFHVLYC  176

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             ++T A  R KMR WK WE ETKT EYQF+HDPERFRFARDTSFGRRHLSFW+++P L+WI
Sbjct  177   VLTYALARAKMRSWKTWEKETKTAEYQFSHDPERFRFARDTSFGRRHLSFWTKNPALMWI  236

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPI
Sbjct  237   VCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHTQFDFQKYINRSLEEDFKVVVGISPPI  296

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W FAV+FLL NTHG R+YLWLPFIPL+I+LL+GTKLQVIITKM LRIQERGEVVKG PVV
Sbjct  297   WFFAVLFLLSNTHGWRAYLWLPFIPLIILLLIGTKLQVIITKMALRIQERGEVVKGVPVV  356

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P DDLFWFNRPRL+LYLI+FVLFQNAFQ+AFFAW WYEFGL SCFHE  ED+VIRISMG
Sbjct  357   EPGDDLFWFNRPRLILYLINFVLFQNAFQVAFFAWTWYEFGLNSCFHEHIEDVVIRISMG  416

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             +L+Q+LCSYVTLPLYALVTQMGS MKPTIFNERVA+AL++W+ +ARK ++  R  GSVTP
Sbjct  417   VLVQILCSYVTLPLYALVTQMGSTMKPTIFNERVAEALRNWYHSARKHIKHNR--GSVTP  474

Query  1668  LSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAE--EN  1841
             +SSRP TP H  SP+HLL++YKSE+DS   SP R      P+   R DN+   P+   + 
Sbjct  475   MSSRPATPTHSMSPVHLLRHYKSEVDSFHTSPRRS-----PFDTDRWDNDSPSPSRHVDG  529

Query  1842  RNELQREIEMESAE  1883
              +  Q  +EM   E
Sbjct  530   SSSSQPHVEMGGYE  543



>ref|XP_004309423.1| PREDICTED: MLO-like protein 6-like [Fragaria vesca subsp. vesca]
Length=590

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/557 (69%), Positives = 451/557 (81%), Gaps = 18/557 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA    GRSLE+TPTWAVA VCFVLV ISI+IE+++ LIGK L+ ++K+AL+EALEK+K+
Sbjct  1     MAASTSGRSLEQTPTWAVAVVCFVLVLISIIIEHILELIGKWLKNKHKRALFEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ +GN+WHPC       K      + + +     R
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISEKVGNTWHPCS------KKQEVKIEEEEEVESPSR  114

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LLA  +  Y G + RR+LA  GTDKCA +G VPFISADGIHQLHIFIFVLA+FHVLYCI
Sbjct  115   RLLAAFESGYGGGNVRRVLAAAGTDKCAAKGKVPFISADGIHQLHIFIFVLAIFHVLYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WK WE ET+T EYQF+HDPERFRFARDTSFGRRHLS+W+++PFL+WIV
Sbjct  175   LTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSYWTKTPFLMWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  235   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQQFNFQKYINRSLEEDFKVVVGISPPIW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAVIFLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVVKGTPVVQ
Sbjct  295   CFAVIFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVKGTPVVQ  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE  ED++IR+SMG+
Sbjct  355   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHIEDIIIRVSMGV  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL+ WH TA+K ++Q +  GSVTP+
Sbjct  415   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRKWHHTAKKHIKQNK--GSVTPM  472

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENR--  1844
             SSRPGTP H  SPIHLL++Y+SE+DS   SP R   D      QR + +   P+      
Sbjct  473   SSRPGTPSHHASPIHLLRHYRSEVDSFHTSPRRSNFD----VEQRYETDSPSPSHHLHID  528

Query  1845  ----NELQREIEMESAE  1883
                 ++ Q ++E+ + E
Sbjct  529   GSFSHQHQHQVELGNVE  545



>ref|XP_004240581.1| PREDICTED: MLO-like protein 6 [Solanum lycopersicum]
Length=591

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/521 (73%), Positives = 435/521 (83%), Gaps = 12/521 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLE+TPTWAVA VCFVLVAISIVIE++IHLIGK L+ +NK ALYEALEKIKAELMLLGF
Sbjct  9     RSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKNKSALYEALEKIKAELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTVGQS I  IC+S+ LGNSWHPC + EE+     +    +    R          
Sbjct  69    ISLLLTVGQSPISNICVSEKLGNSWHPCSKKEEDSSIISEDSLSEQHRRRLLM-------  121

Query  612   DEYSGESHRRILA-GGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
              + +G   RRILA GGG DKCA +G VPF+SADGIHQLHIFIFVLA+FHVLYC+ TLA G
Sbjct  122   -DAAGGGVRRILAGGGGDDKCAAKGKVPFVSADGIHQLHIFIFVLAVFHVLYCVTTLALG  180

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
             R KMR WK+WE+ETKT EY+F+HDPERFRF R+TSFGRRHLSFW+++P LLWIVCFFRQF
Sbjct  181   RAKMRSWKSWENETKTAEYEFSHDPERFRFTRETSFGRRHLSFWTKNPVLLWIVCFFRQF  240

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
             VRSVPKVDY+TLRHGFI AHLAPQS   FDF++YIKRSLEEDFKVVVGISPPIW  AV+F
Sbjct  241   VRSVPKVDYLTLRHGFITAHLAPQSHQKFDFRKYIKRSLEEDFKVVVGISPPIWFLAVLF  300

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             LLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRI ERGEVVKG PVVQP D LF
Sbjct  301   LLFNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGLRIHERGEVVKGVPVVQPGDHLF  360

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSC+H+ TED+VIRI+MG+LIQ+LC
Sbjct  361   WFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSCYHDHTEDIVIRITMGVLIQILC  420

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLR-QKRHSGSVTPLSSRPG  1685
             SYVTLPLYALVTQMGSNMK TIFNERVA ALK+WH TA+K ++ Q +HS  VTP+SSRPG
Sbjct  421   SYVTLPLYALVTQMGSNMKSTIFNERVATALKNWHHTAKKHVKDQSKHSNPVTPMSSRPG  480

Query  1686  TPL-HGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLPWFNQ  1802
             TP  HG SP+HLL+ +Y+S++ S+  SP R   D   W N+
Sbjct  481   TPSHHGMSPVHLLRGHYRSDMGSLQNSPRRSNYDFDHWDNE  521



>ref|XP_009596416.1| PREDICTED: MLO-like protein 6 [Nicotiana tomentosiformis]
Length=597

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/560 (69%), Positives = 446/560 (80%), Gaps = 27/560 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVA VCF LVAISIVIE++IHLIGK L+ ++K ALYEALEKIK+
Sbjct  1     MAGGGGGRSLEQTPTWAVAVVCFALVAISIVIEFIIHLIGKWLKSKHKNALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  IC+S+ + ++WHPC + +E +KY                
Sbjct  61    ELMLLGFISLLLTVGQDPISNICVSEKIASTWHPCSKQKEAEKYNVAKEAEGHRRRLLT-  119

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                  ADD       RR LA  GTDKCA +G V F+SADGIHQLHIFIFVLA+FHV YCI
Sbjct  120   -----ADD----GGVRRSLAAVGTDKCAAKGKVAFVSADGIHQLHIFIFVLAIFHVFYCI  170

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA GR KM +WKAWE ET+T EYQF HDPERFRFARDTSFGRRHLSFW+++P LLWIV
Sbjct  171   TTLALGRAKMSRWKAWEKETRTAEYQFAHDPERFRFARDTSFGRRHLSFWTKNPVLLWIV  230

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS + FDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  231   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHVKFDFQKYIKRSLEEDFKVVVSISPPIW  290

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  291   FLAVLFLLFNTHGWYSYLWLPFIPLLVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  350

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSCFH+ TED+VIR++MG+
Sbjct  351   PGDDLFWFNRPRLLLYLINFVLFQNAFQLAFFAWTWYEFGLKSCFHDHTEDIVIRMTMGV  410

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ-KRHSGSVTP  1667
             LIQ+LCSYVTLPLYALVTQMGS+MKPTIFNERVA ALK+WH TA+K +++  +HS +VTP
Sbjct  411   LIQILCSYVTLPLYALVTQMGSSMKPTIFNERVATALKNWHHTAKKHVKEINKHSNTVTP  470

Query  1668  LSSRPGTPLHGTSPIHLLQ--YYKSEIDSVGASPARDIEDNLPW----------FNQRRD  1811
             +SSRP TP HG SP+HLL+  + +S++D    SP R   +   W          FNQ R+
Sbjct  471   MSSRPTTPSHGMSPVHLLRGNHLRSDMDD---SPRRSNYNVDHWDTEGSPSPTRFNQGRE  527

Query  1812  NNVDQPAEENRNELQREIEM  1871
              +   P   N+     +I++
Sbjct  528   GS-PSPTRFNQGGDGHQIQI  546



>ref|XP_008225371.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=591

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/599 (65%), Positives = 450/599 (75%), Gaps = 47/599 (8%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA    GRSLE+TPTWAVA VCFVLV +SI+IE++I L+ K L+K++K+ALYEA+EK+K+
Sbjct  1     MAAATSGRSLEQTPTWAVAVVCFVLVLVSIIIEHLIELVAKWLKKKHKRALYEAVEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ LGN+WHPC + +E         D +    R   
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISEKLGNTWHPCGKKQETKMNKDTEHDEETPSRRLLS  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L         S    RR+LA  GTD CA +G VPFISADGIHQLHIFIFVLA+FH+LYCI
Sbjct  121   LF------NQSDVGVRRVLAAAGTDNCAPKGKVPFISADGIHQLHIFIFVLAVFHILYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WK WE ET+T EYQF+HDPERFRFARDTSFGRRHLSFW+++PFL+WIV
Sbjct  175   LTMALGRAKMRSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSFWTQTPFLMWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHL+PQS   F+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  235   CFFRQFVRSVPKVDYLTLRHGFIMAHLSPQSHQKFNFQKYINRSLEEDFKVVVGISPPIW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAVIFLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  295   FFAVIFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE  ED++IR+SMG+
Sbjct  355   PGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHIEDIIIRVSMGI  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++  +  G VTP+
Sbjct  415   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTARKHIKHNK--GPVTPM  472

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR--------DIEDNLPWFN---------  1799
             SSRP TP H  SPIHLL+ Y+SE+DS   SP R        D E   P  +         
Sbjct  473   SSRPATPSHHMSPIHLLRNYRSEVDSFYNSPRRSNFEGERWDTESPSPSHHLHVDGTSAS  532

Query  1800  -----------QRRDNNVDQP----------AEENRNELQREIEM-ESAEFSFENKREI  1910
                          RD +V++P          A       Q EI M  + +FSF+ ++ I
Sbjct  533   HHHQIELGNVEHERDVDVNEPNSVHAAPITTATNQLARTQHEINMGRTKDFSFDKRQSI  591



>gb|AAX31277.1| MLO1 [Capsicum annuum]
Length=587

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/515 (73%), Positives = 428/515 (83%), Gaps = 13/515 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVA VCF LVAIS+VIE++IHLIGK L+ + K+ALYEALEKIK+
Sbjct  1     MAGGGGGRSLEQTPTWAVAVVCFALVAISVVIEFIIHLIGKWLKSKQKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  IC+S+ + ++WHPC + +E +     + D +G   R   
Sbjct  61    ELMLLGFISLLLTVGQDPISNICVSEKIASTWHPCTKQKENEINKEKSDDLEGHRRRLLT  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                       S    RR+LA  GTDKCA +G V F+SADGIHQLHIFIFVLALFH+ YCI
Sbjct  121   A---------SDGGVRRVLAAVGTDKCADKGKVAFVSADGIHQLHIFIFVLALFHIFYCI  171

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA GR KM  WKAWE+ET+T EYQFT+DPERFRFARDTSFGRRHLSFW+++  LLWIV
Sbjct  172   TTLALGRAKMSSWKAWENETRTAEYQFTNDPERFRFARDTSFGRRHLSFWTKNSVLLWIV  231

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQSQ+NFDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  232   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSQINFDFQKYIKRSLEEDFKVVVSISPPIW  291

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL +ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  292   FLAVLFLLFNTHGWYSYLWLPFIPLFVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  351

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSCFH+KTED+VIR++MG+
Sbjct  352   PGDDLFWFNRPRLLLYLINFVLFQNAFQLAFFAWTWYEFGLKSCFHDKTEDIVIRMTMGV  411

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ--KRHSGSVT  1664
             LIQ+LCSYVTLPLYALVTQMGS+MKPTIFNERVA AL+ WH  A+K +++  K HS   T
Sbjct  412   LIQILCSYVTLPLYALVTQMGSSMKPTIFNERVATALRKWHHGAKKHIKEINKHHSNPAT  471

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR  1769
             P+SSRP TP HG SP+HLL+  ++    +  SP R
Sbjct  472   PMSSRPTTPTHGMSPVHLLRGIRTS--DMDVSPQR  504



>ref|XP_008796803.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=596

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/521 (74%), Positives = 432/521 (83%), Gaps = 7/521 (1%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGGG   RSLEETPTWAVAAVCFVLV ISI IE+ IHLIGK L+KR+++ALYEALEKI
Sbjct  1     MAGGGGANDRSLEETPTWAVAAVCFVLVIISIFIEHGIHLIGKWLKKRHQRALYEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K+ELML+GFISLLLTV Q  I KIC+ KS+GNSWHPC   +E    G    D +   G  
Sbjct  61    KSELMLMGFISLLLTVSQGLISKICVPKSVGNSWHPCRPEDEAATTGTGDDDSEDLHGTT  120

Query  585   rrlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
              R LL       S    RRILAGGG D+CA +  VPFIS++GIHQLHIFIFVLA+ HVLY
Sbjct  121   GRRLL----HTESSTIFRRILAGGGNDECAAQDKVPFISSEGIHQLHIFIFVLAVSHVLY  176

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CIIT+A GRLKMR WK WE ETKT+EYQF+HDP+RFRFARDTSFGRRHL FWS+SP L+W
Sbjct  177   CIITMALGRLKMRSWKGWELETKTIEYQFSHDPDRFRFARDTSFGRRHLDFWSKSPILIW  236

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF+RSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YIKRSLEEDFKVVVGISP 
Sbjct  237   IVCFFRQFLRSVPKVDYLTLRHGFIMAHLAPQSSTKFNFQKYIKRSLEEDFKVVVGISPT  296

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW FAVIFLL NTH   SYLWLPFIPL+IILLVGTKLQVIITKM +RI ERG+VVKG PV
Sbjct  297   IWFFAVIFLLLNTHDWHSYLWLPFIPLIIILLVGTKLQVIITKMAIRIMERGDVVKGIPV  356

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP DDLFWFN P L+LYLIHFVLFQNAFQLAFFAW+W EFGL SCFH+  ED+ IRISM
Sbjct  357   VQPTDDLFWFNHPGLLLYLIHFVLFQNAFQLAFFAWSWSEFGLPSCFHKNIEDINIRISM  416

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+LIQVLCSYVTLPLYALVTQMGSNMKPTIF+ERVA AL+ WH TARK L++ R S SVT
Sbjct  417   GVLIQVLCSYVTLPLYALVTQMGSNMKPTIFSERVATALRKWHDTARKHLKESRRSSSVT  476

Query  1665  PLS-SRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDN  1784
             PLS SRP TP HG SP+HLL++Y+SE+DS+ ASP R   D+
Sbjct  477   PLSTSRPATPTHGLSPVHLLRHYRSEVDSLQASPRRSTIDD  517



>ref|XP_002314276.1| hypothetical protein POPTR_0009s01710g [Populus trichocarpa]
 gb|EEE88231.1| hypothetical protein POPTR_0009s01710g [Populus trichocarpa]
Length=620

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/584 (67%), Positives = 463/584 (79%), Gaps = 30/584 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV++SI+IE++IHLI K L K+ KKALYEALEKIK+
Sbjct  1     MAGGSAGRSLEQTPTWAVAVVCFVLVSVSIIIEFIIHLIAKWLTKKRKKALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  ICISK  G +WHPC++ EE    G +       E RR+ 
Sbjct  61    ELMLLGFISLLLTVGQSPISNICISKKAGATWHPCNKKEEAKLNGTENIKETDYENRRKL  120

Query  591   lllAFADDEYSGESHRRILAGG-GTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                  +  + +GES RR+LA G  TDKCA +G VPF+S+DGIHQLHIFIFVLA+FH+LYC
Sbjct  121   ----LSISDSAGESLRRVLAAGESTDKCAAKGKVPFVSSDGIHQLHIFIFVLAIFHILYC  176

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I+T+A GR KM+ WK WE ET+T EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WI
Sbjct  177   ILTMALGRAKMKSWKRWEKETRTAEYQFSHDPERFRFARETSFGRRHLSFWTKTPVLIWI  236

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPI
Sbjct  237   VCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHTKFDFQKYINRSLEEDFKVVVGISPPI  296

Query  1128  WLFAVIFLLFNTHGTR------------------SYlwlpfiplviillvGTKLQVIITK  1253
             W FAVIFLLFNTHG +                  SYLWLPFIPL+II+LVGTKLQVIITK
Sbjct  297   WFFAVIFLLFNTHGPKSRVNSLTKEAASFCAGWYSYLWLPFIPLIIIVLVGTKLQVIITK  356

Query  1254  MGLRIQERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGL  1433
             MGLRIQERGEVVKG PVVQP DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEFG+
Sbjct  357   MGLRIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFGI  416

Query  1434  KSCFHEKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWH  1613
             KSCFHE  ED+VIR+SMG+LI++LCSYVTLPLYALVTQMGS+MKPTIFNERVA AL++WH
Sbjct  417   KSCFHEHVEDIVIRVSMGVLIEILCSYVTLPLYALVTQMGSSMKPTIFNERVATALRNWH  476

Query  1614  QTARKQLRQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
              TA+KQ+++ + S SVTP+SSRP TP   TSPIHLL++Y+ EIDS+  SP R   D   W
Sbjct  477   HTAKKQIKRNKGSVSVTPMSSRPTTPSRHTSPIHLLRHYRGEIDSLHTSPGRSNFDVEHW  536

Query  1794  FNQ-----RRDNNVDQPAEENRNELQREIEMESAEFSFENKREI  1910
               +        N   + +  +R+  Q+++E+ S     E+ ++I
Sbjct  537   ETESPSPSHHPNYAGEGSSSHRH--QQQLELASVAGYVEDDKDI  578



>ref|XP_011044385.1| PREDICTED: MLO-like protein 6 isoform X2 [Populus euphratica]
Length=611

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/523 (73%), Positives = 445/523 (85%), Gaps = 9/523 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV++SI+IE++IHLI K L K+ K+ALYEALEKIK+
Sbjct  1     MAGGSAGRSLEQTPTWAVAVVCFVLVSVSIIIEFIIHLIAKWLTKKRKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQSTI  ICISK  G +WHPC++ EE    G +T + D +  R+  
Sbjct  61    ELMLLGFISLLLTVGQSTISNICISKKAGATWHPCNKKEEAKLNGENTKETDNENSRKLL  120

Query  591   lllAFADDEYSGESHRRILAGG-GTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
              + A       GES RR+LA G  TDKCA +G VPF+S+DGIHQLHIFIFVLA+FH+LYC
Sbjct  121   SISA-------GESLRRVLAAGDSTDKCAAKGKVPFVSSDGIHQLHIFIFVLAIFHILYC  173

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I+T+A GR KM+ WK WE ET+T EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WI
Sbjct  174   ILTMALGRAKMKSWKRWEKETRTAEYQFSHDPERFRFARETSFGRRHLSFWTKTPVLIWI  233

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPI
Sbjct  234   VCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHAKFDFQKYINRSLEEDFKVVVGISPPI  293

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W FAV+FLLFNTHG  SY+WLPFIPL+II+LVGTKLQVIITKMGLRIQERGEV+KG PVV
Sbjct  294   WFFAVVFLLFNTHGWYSYIWLPFIPLIIIVLVGTKLQVIITKMGLRIQERGEVLKGVPVV  353

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             QP DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEFG+KSCFHE  ED+VIR+SMG
Sbjct  354   QPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFGIKSCFHEHLEDIVIRVSMG  413

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             +LI++LCSYVTLPLYALVTQMG++MKPTIFNERVA AL++WH TA+KQ+++ + S SVTP
Sbjct  414   VLIEILCSYVTLPLYALVTQMGTSMKPTIFNERVATALRNWHHTAKKQIKRNKGSVSVTP  473

Query  1668  LSSRPGTPLHGTSPIHLLQYYK-SEIDSVGASPARDIEDNLPW  1793
             +SSRP TP   TSP+HLL+YY+  EIDS+  SP R   D   W
Sbjct  474   MSSRPTTPSRHTSPVHLLRYYRGGEIDSLHTSPRRSNFDVEHW  516



>ref|XP_006340147.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=587

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/515 (73%), Positives = 431/515 (84%), Gaps = 13/515 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVA VCFVLVAISIVIE++IHLIGK L+ ++K+ALYEALEKIKA
Sbjct  1     MAGGGGGRSLEQTPTWAVAVVCFVLVAISIVIEFIIHLIGKWLKSKHKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  IC+S+ + ++WHPC + +E +     +GD +G   R   
Sbjct  61    ELMLLGFISLLLTVGQDPISNICVSEKIASTWHPCSKQKEAEMNKYISGDLEGHRRRLLT  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                  ADD       RR+LA  GTDKCA +G V F+SADGIHQLHIFIFVLA+FHV YC+
Sbjct  121   -----ADD----GGVRRVLAAAGTDKCADKGRVAFVSADGIHQLHIFIFVLAIFHVFYCV  171

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA GR KM +WK WE ET+T EYQF+HDPERFRFARDTSFGRRHLSFW+++  LLWIV
Sbjct  172   TTLALGRAKMSRWKTWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSFWTKNSVLLWIV  231

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQS ++FDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  232   CFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHISFDFQKYIKRSLEEDFKVVVSISPPIW  291

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  292   FLAVLFLLFNTHGWYSYLWLPFIPLLVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  351

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+L+LI+FVLFQNAFQLAFFAW WYEFGLKSCFH+ TED+VIR++MG+
Sbjct  352   PGDDLFWFNRPRLLLFLINFVLFQNAFQLAFFAWTWYEFGLKSCFHDHTEDIVIRMTMGV  411

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ--KRHSGSVT  1664
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL+ WH +A+K +++  K+HS   T
Sbjct  412   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRKWHHSAKKHIKEINKQHSNPTT  471

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR  1769
             P+SSRP TP HG SP+HLL+  ++    +  SP R
Sbjct  472   PMSSRPATPSHGMSPVHLLRGIRTS--DMDVSPRR  504



>ref|XP_008463924.1| PREDICTED: MLO-like protein 6 isoform X1 [Cucumis melo]
Length=592

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/593 (66%), Positives = 457/593 (77%), Gaps = 41/593 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGG GRSLEETPTWAVAAVCFVLV ISI+IE+++HLIGK L+K++K+ALYEALEKIK+
Sbjct  1     MAGGGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  +CI   +  +WHPC     + +          D    RR
Sbjct  61    ELMLLGFISLLLTVGQSLITNVCIPPDVAATWHPCS---PQREEELTKEADLVDSDHNRR  117

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LLA      +    R + A GGTDKCA +G VPF+S  GIHQLHIFIFVLA+FHVLYC+
Sbjct  118   KLLATVSHHVNATFRRSLAAAGGTDKCAAKGKVPFVSEGGIHQLHIFIFVLAVFHVLYCV  177

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR WK+WE ET+T+EYQF+HDPERFRFARDTSFGRRHLSFW++SPFL+WIV
Sbjct  178   LTLALGNAKMRSWKSWEKETRTVEYQFSHDPERFRFARDTSFGRRHLSFWTKSPFLIWIV  237

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGF++AHLAP S   FDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  238   CFFRQFVRSVPKVDYLTLRHGFVMAHLAPHSDQKFDFQKYIKRSLEEDFKVVVSISPPIW  297

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNT+G R+YLWLPF+PL+I+LLVGTKLQVIITKM LRIQERGEVVKG PVV+
Sbjct  298   FFAVLFLLFNTNGWRAYLWLPFVPLIIVLLVGTKLQVIITKMALRIQERGEVVKGVPVVE  357

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW W EFG+KSCFHE TEDLVIRI+MG+
Sbjct  358   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSCFHEHTEDLVIRITMGV  417

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             L+Q+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++Q R  GS+TP+
Sbjct  418   LVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTARKHIKQNR--GSMTPM  475

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW----------FNQRR----  1808
             SSRP TP H  SP+HLL++Y+SE+DSV  SP R   D   W          F++R     
Sbjct  476   SSRPATPSHHLSPVHLLRHYRSELDSVHTSPRRSNFDTDQWDPESPSPSHHFHRRPHPGD  535

Query  1809  ---------------DNNVDQPAEENR-------NELQREIEMESAEFSFENK  1901
                            D +VD P  +         N  Q +I++ S EFSF+ +
Sbjct  536   GSISNHHRDVEAGDLDADVDSPQPDRTTQSMNPINIEQHQIDVGSNEFSFDRR  588



>gb|KGN47314.1| hypothetical protein Csa_6G292430 [Cucumis sativus]
Length=593

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/521 (72%), Positives = 433/521 (83%), Gaps = 6/521 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGG GRSLEETPTWAVAAVCFVLV ISI+IE+++HLIGK L+K++K+ALYEALEKIK+
Sbjct  1     MAGGGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  +CI   +  +WHPC    EE+              R+  
Sbjct  61    ELMLLGFISLLLTVGQSLITNVCIPPDVAATWHPCSPQREEELTKEADLVDSDQNRRKLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              L    +  +     R + A GGTDKCA +G VPF+S  GIHQLHIFIFVLA+FHVLYC+
Sbjct  121   ALSHHVNATFR----RSLAAAGGTDKCAAKGKVPFVSEGGIHQLHIFIFVLAVFHVLYCV  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR WK+WE ET+T+EYQF+HDPERFRFARDTSFGRRHLSFW++SPFL+WIV
Sbjct  177   LTLALGNAKMRSWKSWEKETRTVEYQFSHDPERFRFARDTSFGRRHLSFWTKSPFLIWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGF++AHLAP S   FDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFVMAHLAPHSDQKFDFQKYIKRSLEEDFKVVVSISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG R+YLWLPF+PL+I+LLVGTKLQVIITKM LRIQERGEVVKG PVV+
Sbjct  297   FFAVLFLLFNTHGWRAYLWLPFVPLIIVLLVGTKLQVIITKMALRIQERGEVVKGVPVVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW W EFG+KSCFHE TEDLVIRI+MG+
Sbjct  357   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSCFHEHTEDLVIRITMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             L+Q+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++Q R  GS+TP+
Sbjct  417   LVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTARKHIKQNR--GSMTPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
             SSRP TP H  SP+HLL++Y+SE+DSV  SP R   D   W
Sbjct  475   SSRPATPSHHLSPVHLLRHYRSELDSVHTSPRRSNFDTDQW  515



>ref|XP_007015436.1| Seven transmembrane MLO family protein isoform 1 [Theobroma cacao]
 gb|EOY33055.1| Seven transmembrane MLO family protein isoform 1 [Theobroma cacao]
Length=580

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/589 (66%), Positives = 454/589 (77%), Gaps = 38/589 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLEETPTWAVA VCFVLV ISI+IE++IH+IGK L+K++K+AL+EALEK+K+
Sbjct  1     MAGGGGGRSLEETPTWAVAVVCFVLVLISIIIEHIIHMIGKWLRKKHKRALFEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ +G++WHPC++ +EE            +  R   
Sbjct  61    ELMLLGFISLLLTVGQGVISDICISEKVGSTWHPCNKKQEEKTNEDVEDTDYENRRRLLT  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             +         SG   RR LAG   DKCA +G VPF+S+DGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   VSD-------SGGVFRRSLAGASEDKCAAKGKVPFVSSDGIHQLHIFIFVLAVFHVLYCI  173

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WK WE ET+T+EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WIV
Sbjct  174   LTMALGRAKMRSWKRWEKETRTIEYQFSHDPERFRFARETSFGRRHLSFWTKNPVLMWIV  233

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  234   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSQTQFDFQKYINRSLEEDFKVVVGISPPIW  293

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  294   FLAVLFLLLNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  353

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+L+LI+FVLFQNAFQLAFFAW W+EFGLKSCFHE  ED+VIRISMG+
Sbjct  354   PGDDLFWFNRPRLVLFLINFVLFQNAFQLAFFAWTWFEFGLKSCFHEHVEDVVIRISMGV  413

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             L+Q+LCSYVTLPLYALVTQMGSNMKPTIFNERVA AL+ WH TA+K ++Q + SG  TP 
Sbjct  414   LVQILCSYVTLPLYALVTQMGSNMKPTIFNERVATALRKWHHTAKKHIKQNKGSG--TPF  471

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW-------------------  1793
             SSRP TP H TSP+HLL+ Y+SE+DS+ ASP R   D   W                   
Sbjct  472   SSRPNTPSHHTSPVHLLRNYRSEMDSLHASPRRSNFDIEHWDTDSPSPSHPNYGDGSSSH  531

Query  1794  ----------FNQRRDNNVDQPAEENRNELQREIEMESAEFSFENKREI  1910
                        +  RD   +  + E     Q EI +   EFSF+ +  +
Sbjct  532   HHNFMAEQVQLDYDRDVVNEPSSSEQHERTQHEINIGPKEFSFDRRTSV  580



>ref|XP_008463775.1| PREDICTED: MLO-like protein 6 [Cucumis melo]
Length=580

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/553 (68%), Positives = 436/553 (79%), Gaps = 14/553 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GG+SLE+TPTWAVA VCFVL+ +SI IEY +HLIG  L+KR+K+AL+EALEKIK+
Sbjct  1     MAGAAGGKSLEQTPTWAVAVVCFVLLVVSIFIEYSLHLIGHWLKKRHKRALFEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICI + +  +WHPC +  E++               RRR
Sbjct  61    ELMLLGFISLLLTVGQGPITEICIPQHVAATWHPCTKEREDEMNKEMEKSVQHLGHNRRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL    +    G   R + A GG DKCA +G   FISA+GIHQLHIFIFVLA+FHVLYC+
Sbjct  121   LLHLVGN---GGSFRRSLAAAGGADKCAAKGKASFISAEGIHQLHIFIFVLAVFHVLYCV  177

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T A  R KMR WK WE ETKT EYQF+HDPERFRFARDTSFGRRHLSFW+++P  +WIV
Sbjct  178   LTYALARAKMRSWKTWEKETKTAEYQFSHDPERFRFARDTSFGRRHLSFWTKNPAFMWIV  237

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  238   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHTQFDFQKYINRSLEEDFKVVVGISPPIW  297

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG R+YLWLPFIPL+I+LLVGTKLQVIITKM LRIQERGEVVKG PVV+
Sbjct  298   FFAVLFLLSNTHGWRAYLWLPFIPLIILLLVGTKLQVIITKMALRIQERGEVVKGVPVVE  357

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQ+AFFAW WYEFGL SCFHE  ED+VIRISMG+
Sbjct  358   PGDDLFWFNRPRLILYLINFVLFQNAFQVAFFAWTWYEFGLNSCFHEHIEDVVIRISMGV  417

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             L+Q+LCSYVTLPLYALVTQMGS MKPTIFNERVA+AL++W+ +ARK ++  R  GSVTP+
Sbjct  418   LVQILCSYVTLPLYALVTQMGSTMKPTIFNERVAEALRNWYHSARKHIKHNR--GSVTPM  475

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAE--ENR  1844
             SSRP TP H  SP+HLL++YKSE+DS   SP R   D       R DN+   P+   +  
Sbjct  476   SSRPATPTHSMSPVHLLRHYKSEVDSFHTSPRRFDTD-------RWDNDSPSPSRHVDGS  528

Query  1845  NELQREIEMESAE  1883
             +  Q  +EM   E
Sbjct  529   SSSQPHVEMGGYE  541



>ref|XP_004163384.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
Length=593

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/521 (72%), Positives = 432/521 (83%), Gaps = 6/521 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGG GRSLEETPTWAVAAVCFVLV ISI+IE+++HLIGK L+K++K+ALYEALEKIK+
Sbjct  1     MAGGGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  +CI   +  +WHPC    EE+              R+  
Sbjct  61    ELMLLGFISLLLTVGQSLITNVCIPPDVAATWHPCSPQREEELTKEADLVDSDQNRRKLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              L    +  +     R + A GGTDKCA +G VPF+S  GIHQLHIFIFVLA+FHVLYC+
Sbjct  121   ALSHHVNATFR----RSLAAAGGTDKCAAKGKVPFVSEGGIHQLHIFIFVLAVFHVLYCV  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR WK+WE ET+T+EYQF+HDPE FRFARDTSFGRRHLSFW++SPFL+WIV
Sbjct  177   LTLALGNAKMRSWKSWEKETRTVEYQFSHDPEGFRFARDTSFGRRHLSFWTKSPFLIWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGF++AHLAP S   FDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFVMAHLAPHSDQKFDFQKYIKRSLEEDFKVVVSISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG R+YLWLPF+PL+I+LLVGTKLQVIITKM LRIQERGEVVKG PVV+
Sbjct  297   FFAVLFLLFNTHGWRAYLWLPFVPLIIVLLVGTKLQVIITKMALRIQERGEVVKGVPVVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW W EFG+KSCFHE TEDLVIRI+MG+
Sbjct  357   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSCFHEHTEDLVIRITMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             L+Q+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++Q R  GS+TP+
Sbjct  417   LVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTARKHIKQNR--GSMTPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
             SSRP TP H  SP+HLL++Y+SE+DSV  SP R   D   W
Sbjct  475   SSRPATPSHHLSPVHLLRHYRSELDSVHTSPRRSNFDTDQW  515



>ref|XP_010032020.1| PREDICTED: MLO-like protein 6 [Eucalyptus grandis]
 gb|KCW51405.1| hypothetical protein EUGRSUZ_J00942 [Eucalyptus grandis]
Length=583

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/586 (65%), Positives = 452/586 (77%), Gaps = 36/586 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLE+TPTWAVA VCFVLV +SI+IE++IHLIG+ L+K++K ALYEALEKIK+
Sbjct  1     MAGDSGGRSLEQTPTWAVAVVCFVLVLVSIIIEHIIHLIGQWLKKKHKTALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS  +  +WHPC +      +        G    + +
Sbjct  61    ELMLLGFISLLLTVGQGLISNICISSEVAATWHPCGK-----SHEQMKNKSQGPPDDKSK  115

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                  A  ++ G   RR+LAG   DKCA +G VPF+SADGIHQLHIFIFVLA+FH+LYCI
Sbjct  116   DRKLLALSDFPGGGVRRVLAGATYDKCAAKGKVPFVSADGIHQLHIFIFVLAVFHILYCI  175

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WKAWE ET+T EYQF+HDPERFRFAR+TSFGRRH+SFW+++P L+WIV
Sbjct  176   LTMALGRAKMRSWKAWEKETRTTEYQFSHDPERFRFARETSFGRRHMSFWTKTPVLMWIV  235

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQS + FDFQ+YIKRSLEEDFKVVVGISPPIW
Sbjct  236   CFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHVKFDFQKYIKRSLEEDFKVVVGISPPIW  295

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERG+VVKG PVV+
Sbjct  296   FFAVLFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGQVVKGVPVVE  355

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFF W  YEFG+KSCFHE TED +IRISMG+
Sbjct  356   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFVWTSYEFGIKSCFHEHTEDRIIRISMGV  415

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH +A+K ++Q +  GSVTP+
Sbjct  416   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHSAKKHIKQNK--GSVTPM  473

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASP--------ARDIEDNLPWFNQR-------  1805
             SSRP TP H  SP+HLL++Y+SE+DS+  SP          D E   P    +       
Sbjct  474   SSRPATPSHHMSPVHLLRHYRSEMDSMHTSPRLSNFDVDQHDNESPSPTHLHQGEGSSFH  533

Query  1806  RDNNVDQ--------------PAEENRNELQREIEMESAEFSFENK  1901
              + N +Q              P   +R + + EI++   +FSFE K
Sbjct  534   NNPNTEQGAVDRERAVQLASIPQPTSRVQHEIEIDIVPKDFSFETK  579



>ref|XP_003540745.1| PREDICTED: MLO-like protein 6-like isoform X1 [Glycine max]
Length=577

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/550 (67%), Positives = 439/550 (80%), Gaps = 22/550 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG GGR+LEETPTWAV+AVCFVL+ ISI IE++IHLIGK L+K++++ALYE+LEKIK+
Sbjct  1     MAGGSGGRNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICIS+ +  +WHPCD     +    ++ +          
Sbjct  61    ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCDDSSNHESDSEESENRTNSRRLLAA  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                 +  D+ +    RR+LAGGG DKC  EG VPF+S+DGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   F---YGSDDVNP---RRVLAGGGADKCP-EGKVPFVSSDGIHQLHIFIFVLAVFHVLYCI  173

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              T+A GR KM++WK WE ETKT EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WIV
Sbjct  174   FTMALGRAKMKRWKRWEEETKTTEYQFSHDPERFRFARETSFGRRHLSFWTKNPVLIWIV  233

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVP VDY+TLRHGFI+AHLAPQS   FDF++YIKRSL+EDFKVVVGISPP W
Sbjct  234   CFFRQFVRSVPNVDYLTLRHGFIMAHLAPQSHSKFDFRKYIKRSLDEDFKVVVGISPPFW  293

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  SYLWLPFIPL+IILLVGTKLQVIIT+MGL+IQ+RGEV+KG P+VQ
Sbjct  294   FFAVLFLLLNTHGWYSYLWLPFIPLIIILLVGTKLQVIITEMGLKIQQRGEVLKGVPLVQ  353

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRP L+LYLI+FVLFQNAFQLAFFAW+  +FG+KSCFH  TED+VIRI+MG+
Sbjct  354   PGDHLFWFNRPGLILYLINFVLFQNAFQLAFFAWSALQFGIKSCFHSHTEDVVIRITMGV  413

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKR---HSGSV  1661
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA  L++WHQTA+K +RQ R    S S 
Sbjct  414   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVALGLRNWHQTAKKHIRQNRVGPLSLSG  473

Query  1662  TPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEEN  1841
             TP SSRP TP H  SP+HL +YY+SEIDS   SP R   D         DNN+D P+   
Sbjct  474   TPTSSRPTTPSHNLSPVHLFRYYRSEIDSFPTSPQRSNLD---------DNNMDSPSPSY  524

Query  1842  RNELQREIEM  1871
              +    E+EM
Sbjct  525   SHH---ELEM  531



>ref|XP_002282216.1| PREDICTED: MLO-like protein 6 [Vitis vinifera]
Length=587

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/590 (66%), Positives = 453/590 (77%), Gaps = 39/590 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLE+TPTWAVA VCFVLV ISI+IEY+IHL GK L+K++K+ALYEALEK+K+
Sbjct  1     MAGATGGRSLEQTPTWAVAVVCFVLVLISIIIEYIIHLTGKWLKKKHKRALYEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICISKS+  +WHPC + EEE     +  D + D  R+  
Sbjct  61    ELMLLGFISLLLTVGQGLISTICISKSVAATWHPCSKSEEEKSTTTEESDTESDNRRKLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              +  F      G   RR+LA  G DKC+ +G  PF+S+D IHQLHIFIFVLA+FHVLYCI
Sbjct  121   SISGF------GGGSRRVLAAAGEDKCSAKGQAPFVSSDAIHQLHIFIFVLAIFHVLYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR+WKAWE ET+T+EYQF+HDPERFRFAR+TSFGRRHLSFW+ +PFL+WIV
Sbjct  175   LTLALGTAKMRRWKAWEKETRTVEYQFSHDPERFRFARETSFGRRHLSFWTNTPFLIWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  235   CFFRQFVRSVPKVDYFTLRHGFIMAHLAPQSHAKFDFQKYINRSLEEDFKVVVGISPPIW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  295   FFAVLFLLLNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
               DDLFWFNRPRL+LYLIHFVLFQNAFQLAFFAW WYEFG KSCF+  TED+VIRISMG+
Sbjct  355   LGDDLFWFNRPRLVLYLIHFVLFQNAFQLAFFAWTWYEFGFKSCFYAHTEDVVIRISMGV  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKPTIF+ERVA AL++WH TA+K ++  +HSG  TP+
Sbjct  415   IIQILCSYVTLPLYALVTQMGSTMKPTIFHERVATALRNWHHTAKKNIKHNKHSGLATPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW-------------------  1793
             SSRP TP  GTSP +LL+YY+S++DS+ ASP R   D   W                   
Sbjct  475   SSRPTTPSRGTSPAYLLRYYRSDMDSLQASPRRSNLDMEHWETDGSPSPSHPHHGDGSSS  534

Query  1794  -FNQ-------RRDNNVDQPAEENRNEL------QREIEMESAEFSFENK  1901
               NQ         D ++  P+      L      Q EI++   EFSF+ +
Sbjct  535   HHNQLHQGTSLEHDRDISAPSSSQVVPLPQPTLHQHEIDVVRKEFSFDRR  584



>ref|XP_009777573.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=608

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/520 (72%), Positives = 429/520 (83%), Gaps = 15/520 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLE+TPTWAVA VCF LVAISIVIE++IHLIGK L+ ++K ALYEALEKIK+ELMLLGF
Sbjct  12    RSLEQTPTWAVAVVCFALVAISIVIEFIIHLIGKWLKSKHKNALYEALEKIKSELMLLGF  71

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTVGQ  I  IC+S+ + ++WHPC + +E +KY                     AD
Sbjct  72    ISLLLTVGQDPISNICVSEKIASTWHPCSKQKEAEKYNVPVEAEGHRRRLLTA-----AD  126

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D       RRILA  GTDKCA +G V F+SADGIHQLHIFIFVLA+FHV YCI TLA GR
Sbjct  127   D----GGVRRILAAVGTDKCADKGKVAFVSADGIHQLHIFIFVLAIFHVFYCITTLALGR  182

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM +WKAWE ET+T EYQF HDPERFRFARDTSFGRRHLSFW+++P LLWIVCFFRQFV
Sbjct  183   AKMSRWKAWEKETRTAEYQFAHDPERFRFARDTSFGRRHLSFWTKNPVLLWIVCFFRQFV  242

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
             RSVPKVDY+TLRHGFI+AHLAPQS + FDFQ+YIKRSLEEDFKVVVGISPPIW  AV+FL
Sbjct  243   RSVPKVDYLTLRHGFIMAHLAPQSHVKFDFQKYIKRSLEEDFKVVVGISPPIWFLAVLFL  302

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             LFNTHG  SYLWLPFIPL +ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQP DDLFW
Sbjct  303   LFNTHGWYSYLWLPFIPLFVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQPGDDLFW  362

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRPRL+LYLI+FVLFQNAFQLAFFAW WYEFGLKSCFH+ TED+VIR++MG+LIQ+LCS
Sbjct  363   FNRPRLLLYLINFVLFQNAFQLAFFAWTWYEFGLKSCFHDHTEDIVIRMTMGVLIQILCS  422

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ-KRHSGSVTPLSSRPGT  1688
             YVTLPLYALVTQMGS+MK TIFNERVA ALK+WH TA+K +++  +HS +VTP+SSRP T
Sbjct  423   YVTLPLYALVTQMGSSMKSTIFNERVATALKNWHHTAKKHVKEINKHSNTVTPMSSRPTT  482

Query  1689  PLHGTSPIHLLQ--YYKSEIDSVGASPARDIEDNLPWFNQ  1802
             P HG SP+HLL+  +++SE+D    SP R   +   W N+
Sbjct  483   PSHGMSPVHLLRGNHWRSEMDD---SPRRSNYNVDHWDNE  519



>ref|XP_009335054.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=597

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/547 (70%), Positives = 444/547 (81%), Gaps = 6/547 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA    GRSLE+TPTWAVA VCFVLV ISI+IE++I LI K L+K++K ALYEALEKIK+
Sbjct  1     MAAATSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKSALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ +GN+WHPC + +E      +  +   +   R+ 
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISQKIGNTWHPCGKKQEYKLNKEEDLEYVDETPSRKL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L L    +E  G S RR+LA  GTDKC+ +G VPFISADGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   LSLF---NETGGGS-RRVLAAAGTDKCSAKGKVPFISADGIHQLHIFIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KM  WK WE ET+T EYQF+HDPERFRFARDTSFGRRH+S+W+++PFL+WIV
Sbjct  177   LTMALGRAKMGSWKRWEKETRTAEYQFSHDPERFRFARDTSFGRRHMSYWTKTPFLMWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS  NF+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHQNFNFQKYINRSLEEDFKVVVGISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAVIFLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQE GEVVKG PVVQ
Sbjct  297   FFAVIFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQESGEVVKGLPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE TED++IR+SMG+
Sbjct  357   PGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHTEDVIIRVSMGI  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++Q +  GSVTP+
Sbjct  417   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTARKHIKQNK--GSVTPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNE  1850
             SSRP TP H TSP +LL+ Y+SE+DS  ASP R   +   W N+    +     +   + 
Sbjct  475   SSRPATPSHHTSPAYLLRNYRSEVDSFHASPRRSNFEGERWANESPSPSHHLHVDGTSSS  534

Query  1851  LQREIEM  1871
                 IEM
Sbjct  535   YHHHIEM  541



>ref|XP_008796805.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=596

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/516 (74%), Positives = 429/516 (83%), Gaps = 7/516 (1%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGGG   RSLE+T TWAVAAVCFVLV ISI IE+  HLIGK L+KR+K+ALYEALEKI
Sbjct  1     MAGGGGANDRSLEDTSTWAVAAVCFVLVIISIFIEHGFHLIGKWLKKRHKRALYEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K+ELML+GFISLLLTV Q  I KIC+ KS+GNSWHPC   +E    G    D +   G  
Sbjct  61    KSELMLMGFISLLLTVSQGLISKICVPKSVGNSWHPCRPEDEAATTGTGDDDSEDLHGTT  120

Query  585   rrlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
              R LL       S    RRILAGGG D+CA +  VPFIS+ GIHQLH+FIFVLA+ HVLY
Sbjct  121   GRRLL----HTESSTIFRRILAGGGNDECAAQDKVPFISSKGIHQLHMFIFVLAVSHVLY  176

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CIIT+A GRLKMR+WK WE ETKT+EYQF+HDP+RFRFARDTSFGRRHL FWS+SP L+W
Sbjct  177   CIITMALGRLKMRRWKGWELETKTIEYQFSHDPDRFRFARDTSFGRRHLDFWSKSPILIW  236

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF+RSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YIKRSLEEDFKVVVGISP 
Sbjct  237   IVCFFRQFLRSVPKVDYLTLRHGFIMAHLAPQSSTKFNFQKYIKRSLEEDFKVVVGISPT  296

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AVIFLL NTH   SYLWLPFIPL+IILLVGTKLQVIITKM +RI ERG+VVKG PV
Sbjct  297   IWFSAVIFLLLNTHDWHSYLWLPFIPLIIILLVGTKLQVIITKMAIRIMERGDVVKGIPV  356

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP DDLFWFNRP L+L+LIHFVLFQNAFQLAFFAW+W EFGL SCFH+  ED++IRISM
Sbjct  357   VQPTDDLFWFNRPGLLLHLIHFVLFQNAFQLAFFAWSWSEFGLPSCFHKNIEDIIIRISM  416

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+LIQVLCSYVTLPLYALVTQMGSNMKPTIF+ERVA AL+ WH TARK L++ R S SVT
Sbjct  417   GVLIQVLCSYVTLPLYALVTQMGSNMKPTIFSERVATALRKWHDTARKHLKESRRSSSVT  476

Query  1665  PLS-SRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR  1769
             PLS SRP TP HG SP+HLL++Y+SE+DS+ ASP R
Sbjct  477   PLSTSRPATPTHGLSPVHLLRHYRSEVDSLQASPRR  512



>ref|XP_006850616.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
 gb|ERN12197.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
Length=600

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/518 (71%), Positives = 431/518 (83%), Gaps = 7/518 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  G RSLEETPTWAVA VCFV+V +SI+IE+ IHL+GK L KR+K+ALYEALEKIKA
Sbjct  1     MAGASGSRSLEETPTWAVAVVCFVMVLVSILIEHAIHLVGKWLTKRHKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ TI +ICISKS+G+S  PC ++++    G    +   D+     
Sbjct  61    ELMLLGFISLLLTIGQDTISRICISKSMGDSLLPCRKNDQSINGGEHVSESGDDDEGSSN  120

Query  591   lllAFADD-EYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
               L + DD +    S RR+LAG   DKC+ +G VP IS DG HQLHIFIFVLA+FHVLYC
Sbjct  121   RRLLWLDDFDQPHPSLRRVLAGSKYDKCSPQGKVPLISYDGTHQLHIFIFVLAVFHVLYC  180

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I T+A GRLKM++WK WE ETKT+EYQ++HDPERFRFAR+TSFGRRHL+FW++SP L+WI
Sbjct  181   ISTMALGRLKMKRWKKWEQETKTIEYQWSHDPERFRFARETSFGRRHLNFWTKSPILIWI  240

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDF +YIKRSLEEDFKVVVGISP I
Sbjct  241   VCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSSTKFDFHKYIKRSLEEDFKVVVGISPII  300

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W FAV+FLLFNTHG  SYLWLPFIPL+IILLVGTKLQV+ITKMGL+IQ+RG+VVKG PVV
Sbjct  301   WFFAVVFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVVITKMGLKIQDRGDVVKGVPVV  360

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             QP D LFWFN+PRL+LYLIHFVLFQNAFQLAFF W WYEFGL+SCFH+  ED++IRISMG
Sbjct  361   QPTDKLFWFNQPRLILYLIHFVLFQNAFQLAFFTWTWYEFGLRSCFHKHLEDVIIRISMG  420

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             +LIQ LCSYVTLPLYALVTQMGSNMK T+F++RVA AL+ WH TA+K +++ R S SVTP
Sbjct  421   VLIQFLCSYVTLPLYALVTQMGSNMKTTVFDDRVAAALRKWHHTAKKHIKEGRKSASVTP  480

Query  1668  LSSRPGTPLH------GTSPIHLLQYYKSEIDSVGASP  1763
              SSRPGTPLH      G SP+HLL++YKSE+DS   SP
Sbjct  481   FSSRPGTPLHPSAGGEGLSPVHLLRHYKSELDSSHVSP  518



>ref|XP_007027290.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY07792.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=564

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/567 (66%), Positives = 439/567 (77%), Gaps = 16/567 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA   G RSLE+TPTWAVAAVCFVL+ ISI+IE+VIHLIG  L+KR+K+AL EALEKIK+
Sbjct  1     MAAKEGSRSLEQTPTWAVAAVCFVLILISIIIEHVIHLIGMWLKKRHKRALCEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML GF+SLLLTVGQ  +  ICISK+LG +WHPC ++ +E +   +       + +  R
Sbjct  61    ELMLFGFMSLLLTVGQGVVSDICISKALGATWHPCSKN-QESESDKNEDKSSDSDEKHLR  119

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL F D   SG   RR+LA  G DKCA +G VPF+S DGI QLHIFIF+LA+ HVLYC+
Sbjct  120   RLLTFQD---SGGGGRRVLAAAGYDKCAAKGQVPFVSTDGIDQLHIFIFLLAISHVLYCV  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITLA GR KMRKWK WE ET+T++YQF+HDPERFRF RDT+FGRRHLSFWSR+P LLW+V
Sbjct  177   ITLALGRAKMRKWKTWEMETRTVDYQFSHDPERFRFTRDTTFGRRHLSFWSRAPVLLWVV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF RSVPKVDY+TLR+GFIIAHLAPQS+  FDFQ+YIKRSLEEDFKVVVGI+P IW
Sbjct  237   CFFRQFFRSVPKVDYLTLRYGFIIAHLAPQSETKFDFQKYIKRSLEEDFKVVVGINPIIW  296

Query  1131  LFAVIFLLFNTH---GTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
              FAV+FLLFNTH   GT SYLWLPF+PL+IILLVGTKL V+IT MGLRIQ RGEVVKGTP
Sbjct  297   FFAVLFLLFNTHDGTGTYSYLWLPFLPLIIILLVGTKLLVVITNMGLRIQARGEVVKGTP  356

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRIS  1481
             VVQP +D FWFNRP L+LYLIHFVLFQNAFQLAF  W  YEF LKSCFHEK  D++IR S
Sbjct  357   VVQPGNDHFWFNRPHLLLYLIHFVLFQNAFQLAFLVWTLYEFSLKSCFHEKRGDIIIRTS  416

Query  1482  MGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSV  1661
             MG+LIQ+LCSYVTLPLYALVTQMGS MKPTIFNER+A AL++WHQ A+K +   +HSG++
Sbjct  417   MGMLIQILCSYVTLPLYALVTQMGSTMKPTIFNERIANALRNWHQEAKKHIEHNQHSGTM  476

Query  1662  TPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEEN  1841
             TP SSR  TP  G +P+HLL  ++ E DS   SP      N  W  +  D    Q AE+ 
Sbjct  477   TPFSSRSDTPSRGVTPLHLLHNHRGEADSSQTSPRGSNFGNEGWEIEGPDRG--QVAEQK  534

Query  1842  R-------NELQREIEMESAEFSFENK  1901
                     N  Q EIE+E  +FSF+ +
Sbjct  535   HKATNKVDNPSQHEIEIEPYDFSFDQR  561



>emb|CBI16290.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/521 (73%), Positives = 434/521 (83%), Gaps = 6/521 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLE+TPTWAVA VCFVLV ISI+IEY+IHL GK L+K++K+ALYEALEK+K+
Sbjct  1     MAGATGGRSLEQTPTWAVAVVCFVLVLISIIIEYIIHLTGKWLKKKHKRALYEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICISKS+  +WHPC + EEE     +  D + D  R+  
Sbjct  61    ELMLLGFISLLLTVGQGLISTICISKSVAATWHPCSKSEEEKSTTTEESDTESDNRRKLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              +  F      G   RR+LA  G DKC+ +G  PF+S+D IHQLHIFIFVLA+FHVLYCI
Sbjct  121   SISGF------GGGSRRVLAAAGEDKCSAKGQAPFVSSDAIHQLHIFIFVLAIFHVLYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR+WKAWE ET+T+EYQF+HDPERFRFAR+TSFGRRHLSFW+ +PFL+WIV
Sbjct  175   LTLALGTAKMRRWKAWEKETRTVEYQFSHDPERFRFARETSFGRRHLSFWTNTPFLIWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  235   CFFRQFVRSVPKVDYFTLRHGFIMAHLAPQSHAKFDFQKYINRSLEEDFKVVVGISPPIW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  295   FFAVLFLLLNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
               DDLFWFNRPRL+LYLIHFVLFQNAFQLAFFAW WYEFG KSCF+  TED+VIRISMG+
Sbjct  355   LGDDLFWFNRPRLVLYLIHFVLFQNAFQLAFFAWTWYEFGFKSCFYAHTEDVVIRISMGV  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKPTIF+ERVA AL++WH TA+K ++  +HSG  TP+
Sbjct  415   IIQILCSYVTLPLYALVTQMGSTMKPTIFHERVATALRNWHHTAKKNIKHNKHSGLATPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
             SSRP TP  GTSP +LL+YY+S++DS+ ASP R   D   W
Sbjct  475   SSRPTTPSRGTSPAYLLRYYRSDMDSLQASPRRSNLDMEHW  515



>ref|XP_010905123.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
Length=587

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/524 (73%), Positives = 439/524 (84%), Gaps = 7/524 (1%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGGG   RSLEET TWAVA VC VLV+ISI+IE+ IHLIGK L+KR+K+ LYEALEKI
Sbjct  1     MAGGGGANDRSLEETSTWAVAVVCLVLVSISIIIEHAIHLIGKWLKKRHKRPLYEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K+ELMLLGFISLLLTV Q  I KIC+ +S+GNSWHPC R EE      D  D   D    
Sbjct  61    KSELMLLGFISLLLTVSQGLISKICVPQSVGNSWHPCKREEEATAASTDDDDDSKDFHGT  120

Query  585   rrlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
                 L + +   S    RRILAGGGTD+CA +G VPF+S+DGIHQLHIFIFVLA+ HV Y
Sbjct  121   AGRRLLYTE---SSTIFRRILAGGGTDECAPKGKVPFVSSDGIHQLHIFIFVLAVSHVFY  177

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI T+A GRLKMR+WKAWE ETKT+EYQF+HDP+RFR ARDTSFGRRHLSFWS+SP L+W
Sbjct  178   CISTMALGRLKMRRWKAWELETKTVEYQFSHDPDRFRLARDTSFGRRHLSFWSKSPILIW  237

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF+RSV KVDY TLRHGF++AHLAPQS   F+FQ+YIKRSLEE+FKVVVGISP 
Sbjct  238   IVCFFRQFLRSVRKVDYWTLRHGFVMAHLAPQSSTKFNFQKYIKRSLEEEFKVVVGISPT  297

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW FAV+FLLFNTHG RSYLWLPF+PL+IILLVGTKLQVIITKM +RI ERG+VVKG P+
Sbjct  298   IWFFAVLFLLFNTHGMRSYLWLPFVPLIIILLVGTKLQVIITKMAVRIMERGDVVKGIPI  357

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             V+P DDLFWFNRP L+LYLIHFVLFQNAFQLAFFAW+W+EFG  SCFH++ ED++IRISM
Sbjct  358   VKPTDDLFWFNRPGLLLYLIHFVLFQNAFQLAFFAWSWFEFGYPSCFHKRIEDIIIRISM  417

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+LIQVLCSYVTLPLYALVTQMGSNMKPTIF++RVA AL+ WH TARK L++ R S SVT
Sbjct  418   GVLIQVLCSYVTLPLYALVTQMGSNMKPTIFSDRVATALRKWHNTARKHLKENRRSSSVT  477

Query  1665  PLS-SRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLP  1790
             PLS SRP TP+HG SP+HLL++Y+SE+DS+ ASP R  I+D  P
Sbjct  478   PLSTSRPATPIHGLSPVHLLRHYRSEVDSLQASPRRYTIDDEQP  521



>ref|XP_009347038.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=587

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/524 (73%), Positives = 440/524 (84%), Gaps = 6/524 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG   GRSLE+TPTWAVA VCFVLV ISI+IE++I LI K L+K++K+ALYEALEKIK+
Sbjct  1     MAGATSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ +GN+WHPC + ++E+K   +      DE   RR
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISQKIGNTWHPCGK-KQENKLNKEENVEHEDEIPGRR  119

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL  F +   +G   RR+LA   TDKCA +G V FISADGIHQLHIFIFVLA+FHVLYCI
Sbjct  120   LLSLFNE---TGGGARRVLAAASTDKCAAKGKVSFISADGIHQLHIFIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR WK WE ET+T EYQF+HDPERFRFARDTSFGRRH+S+W+++P L+W+V
Sbjct  177   LTMALGRAKMRSWKRWEKETRTDEYQFSHDPERFRFARDTSFGRRHMSYWTKTPLLMWMV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHKKFNFQKYINRSLEEDFKVVVGISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAVIFLLFNTHG  SYLWLPF+PL+IILLVGTKLQVIITKMGLRIQERGEVVKG  VVQ
Sbjct  297   FFAVIFLLFNTHGWYSYLWLPFVPLIIILLVGTKLQVIITKMGLRIQERGEVVKGLLVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE TED++IR+SMG+
Sbjct  357   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHTEDVIIRVSMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++Q +  GSVTP+
Sbjct  417   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTARKHIKQNK--GSVTPM  474

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQ  1802
             SSRP TP H  SP+HLL+ Y+SE+DS   SP +   +   W N+
Sbjct  475   SSRPATPSHHMSPVHLLRNYRSEVDSFHTSPRKSNLEGERWANE  518



>ref|XP_002526372.1| Protein MLO, putative [Ricinus communis]
 gb|EEF36043.1| Protein MLO, putative [Ricinus communis]
Length=594

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/506 (76%), Positives = 442/506 (87%), Gaps = 7/506 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLEETPTWAVA VCFVLV ISI+IEY+IHLIGK L+K++K+ALYEALEKIK+
Sbjct  1     MAGGGGGRSLEETPTWAVAIVCFVLVLISIIIEYIIHLIGKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I KICI +S+G++WHPC + +EE++          ++   RR
Sbjct  61    ELMLLGFISLLLTVGQGVISKICIPESVGSTWHPCSK-KEEEEIDKSEETQTSEDYENRR  119

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL  +D   SG   RR LAG  TD+C  EG VPF+S+DGIHQLHIFIFVLA+FHVLYC+
Sbjct  120   RLLMISD---SGGRFRRFLAGETTDQCG-EGKVPFMSSDGIHQLHIFIFVLAVFHVLYCV  175

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KMR+WK+WE ET+T EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WIV
Sbjct  176   LTMALGRAKMRRWKSWEKETRTAEYQFSHDPERFRFARETSFGRRHLSFWTKTPVLIWIV  235

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS M FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  236   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHMKFDFQKYINRSLEEDFKVVVGISPPIW  295

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV FLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKM LRIQERGEVVKG PVVQ
Sbjct  296   FFAVFFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMALRIQERGEVVKGVPVVQ  355

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+W EFGLKSCFHE +ED++IRISMG+
Sbjct  356   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWKEFGLKSCFHEHSEDIIIRISMGV  415

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS+MKPTIFNERVA AL++WH TA+K ++Q +  GSVTP+
Sbjct  416   LIQILCSYVTLPLYALVTQMGSSMKPTIFNERVAAALRNWHHTAKKHIKQNK--GSVTPM  473

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDS  1748
             SSRP TP H  SP+HLL++Y+SE+DS
Sbjct  474   SSRPATPSHHMSPVHLLRHYRSEMDS  499



>ref|XP_009411538.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
 ref|XP_009411539.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/569 (67%), Positives = 445/569 (78%), Gaps = 15/569 (3%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGG    R+LE TPTWAVA VC VLV ISI+IE+VI L+GK L+KR++KALYE+LEKI
Sbjct  1     MAGGGSSSSRTLEVTPTWAVAVVCLVLVLISIIIEHVIDLVGKWLKKRHRKALYESLEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K+ELML+GFISLLLTVGQS I KIC+ KS+G+SWHPC                DG     
Sbjct  61    KSELMLMGFISLLLTVGQSLISKICVPKSVGDSWHPCK-----PGDESAATSADGHSQDS  115

Query  585   rrlllAFADDEYSGESHRRILAGGG-TDKCAKEGMVPFISADGIHQLHIFIFVLALFHVL  761
                      D  S    RRILAGGG +DKCA +G VP IS DGIHQLHIFIFVLA+ H+L
Sbjct  116   STTGRRLLQDSVSAGVFRRILAGGGGSDKCAAKGKVPLISTDGIHQLHIFIFVLAVSHIL  175

Query  762   YCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLL  941
             YCI T+A GRLKMR+WKAWE ETKT EYQF+HDP RFRFAR+TSFGRRHLSFWS+SP L+
Sbjct  176   YCISTMALGRLKMRRWKAWELETKTAEYQFSHDPARFRFARETSFGRRHLSFWSKSPILI  235

Query  942   WIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISP  1121
             WIVCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YIKRSL+EDFKVVVGISP
Sbjct  236   WIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSSTKFNFQKYIKRSLDEDFKVVVGISP  295

Query  1122  PIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
              IW FA+IFLL NTHG  S LWLPFIPL +ILLVGTKLQVIIT+M + I ERG+VVKG P
Sbjct  296   TIWFFALIFLLTNTHGWHSNLWLPFIPLFVILLVGTKLQVIITRMAVNIMERGDVVKGVP  355

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRIS  1481
             +VQPADDLFWFNRPRL+L+LIHFVLFQNAFQL F AW+WYEFG  SCFH+  ED++IRIS
Sbjct  356   IVQPADDLFWFNRPRLLLFLIHFVLFQNAFQLGFLAWSWYEFGYPSCFHQNIEDIIIRIS  415

Query  1482  MGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSV  1661
             +G+LIQVLCSYVTLPLYALVTQMGSNMKPTIF+ERVA AL+ WHQ A+K L++ R SGSV
Sbjct  416   LGILIQVLCSYVTLPLYALVTQMGSNMKPTIFDERVATALRKWHQLAKKHLKENRRSGSV  475

Query  1662  TPLS-SRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVD-QP-A  1832
             +PLS SR  TP HG SP+HLL Y +SE+DSV  SP R + D+ P    R++  ++ QP  
Sbjct  476   SPLSTSRTATPRHGWSPVHLLHYNRSELDSVQNSPGRYLTDDDPDVEGRQEELMEGQPEV  535

Query  1833  EENRNE----LQREIEMESAEFSFENKRE  1907
             EEN  E    +   ++  +  FSF+ +R 
Sbjct  536   EENHGEARLPVAHGVDAHATSFSFDQRRS  564



>ref|XP_010046751.1| PREDICTED: MLO-like protein 6 [Eucalyptus grandis]
Length=569

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/568 (69%), Positives = 455/568 (80%), Gaps = 13/568 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  G SLE+TPTWAVA VCFVLV ISI+IEY+IHLIGK L KR+KKALYEALEKIK+
Sbjct  1     MAGGTAGGSLEQTPTWAVAVVCFVLVLISIIIEYIIHLIGKWLTKRHKKALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISL+LTVGQ  I  ICIS+SLG++WHPC    E      D  D D D+G RRR
Sbjct  61    ELMLLGFISLMLTVGQGPISGICISESLGSTWHPCSHKLESKLNTDDQEDEDADDGGRRR  120

Query  591   lllAFADDEYS-GESHRRILAGGGT--DKCAKEGMVPFISADGIHQLHIFIFVLALFHVL  761
             LLL+ +D   + G  + R         DKC+ +G VPF+S DGIHQLHIFIFVLA+FHVL
Sbjct  121   LLLSLSDTTQAFGHQNARRGLAAAAGYDKCSSKGKVPFVSKDGIHQLHIFIFVLAVFHVL  180

Query  762   YCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLL  941
             YCIITLA G  KMRKWKAWE ETKT++YQ  HDPERFRFARDTSFGRRHL+FWS S  LL
Sbjct  181   YCIITLALGSAKMRKWKAWEEETKTIDYQSAHDPERFRFARDTSFGRRHLNFWSHSTILL  240

Query  942   WIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISP  1121
             WIVCFFRQFVRSVPKVDY+TLRHGF+IAHL PQS + FDFQ+YIKR+LEEDF VVVGISP
Sbjct  241   WIVCFFRQFVRSVPKVDYLTLRHGFVIAHLGPQSHVKFDFQKYIKRTLEEDFLVVVGISP  300

Query  1122  PIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
              IWLFA+ FLL NTHG+ SYLWLPF+PL+IILLVGTKLQVIITKMGL IQE+G++VKGTP
Sbjct  301   IIWLFAIFFLLSNTHGSYSYLWLPFLPLIIILLVGTKLQVIITKMGLSIQEKGQIVKGTP  360

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRIS  1481
             VV+P DDLFWFNRPR++LYLIHFVLFQNAFQLAFFAW WYEFGL+SCFHEK +D++IRIS
Sbjct  361   VVKPGDDLFWFNRPRILLYLIHFVLFQNAFQLAFFAWTWYEFGLRSCFHEKLQDVIIRIS  420

Query  1482  MGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSV  1661
             MG+LIQ+LCSYVTLPLYALVTQMGSNMKPTIFN+RVA AL++WH++A+K L+Q R  GSV
Sbjct  421   MGVLIQILCSYVTLPLYALVTQMGSNMKPTIFNDRVANALRNWHRSAKKHLKQNR--GSV  478

Query  1662  TPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEEN  1841
             TP SSRPGTP  G SP+HLLQ+YKS +DSV  +P      N  W    +++   +  +  
Sbjct  479   TPFSSRPGTPSRGMSPVHLLQHYKSALDSVQTTPRTSNFGNEGWETDGQNSPSRRKEDRG  538

Query  1842  RNEL--------QREIEMESAEFSFENK  1901
               E+        Q EI   S +FSFEN+
Sbjct  539   DTEMRVQHAIQVQHEIGTCSVDFSFENR  566



>ref|XP_003538050.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=576

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/581 (66%), Positives = 455/581 (78%), Gaps = 37/581 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG GGR+LEETPTWAV+AVCFVL+ ISI+IE++IHLIGK L+K++K ALYE+LEKIK+
Sbjct  1     MAGGSGGRNLEETPTWAVSAVCFVLILISIIIEHIIHLIGKWLKKKHKTALYESLEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICIS+ +  +WHPCD      +   +  +       RR 
Sbjct  61    ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCDDSSSIHESDTEESENVNGTNSRRL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L   +  D+ +    RR+LAGGGTDKC +EG VPF+S+DGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   LAAFYGSDDVNP---RRVLAGGGTDKC-REGKVPFVSSDGIHQLHIFIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A GR KM++WK WE ETKT EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WIV
Sbjct  177   LTMALGRAKMKRWKRWEEETKTPEYQFSHDPERFRFARETSFGRRHLSFWTKNPVLMWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDF++YIKRSL+EDFKVVVGISPP W
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHSKFDFRKYIKRSLDEDFKVVVGISPPFW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  SYLWLPFIPL+IILLVGTKLQVIIT+MGLRIQ+RGEV+KG P+VQ
Sbjct  297   FFAVLFLLLNTHGWYSYLWLPFIPLIIILLVGTKLQVIITEMGLRIQQRGEVLKGVPLVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRP L+LYLI+FVLFQNAFQLAFFAW+  +FG+KSCFH  TED+VIRI+MG+
Sbjct  357   PGDHLFWFNRPGLILYLINFVLFQNAFQLAFFAWSALQFGIKSCFHSHTEDVVIRITMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKR---HSGSV  1661
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFN+RVA AL++WHQTA+K +RQ R    S S 
Sbjct  417   LIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAVALRNWHQTAKKHIRQNRVGPLSLSG  476

Query  1662  TPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQP----  1829
             TP SSRP TP H  SP+HLL+YY+SEIDS  ASP R   D         DNN+D P    
Sbjct  477   TPTSSRPTTPSHHLSPVHLLRYYRSEIDSFPASPRRSNFD---------DNNMDSPSPSY  527

Query  1830  ----------------AEENRNELQREI-EMESAEFSFENK  1901
                             A +N      EI  + S EFSF+ +
Sbjct  528   SLHQLPPQTTATTNDSANDNNATTHHEIVVVHSKEFSFDKR  568



>ref|XP_010905121.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
 ref|XP_010905122.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
Length=579

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/513 (73%), Positives = 423/513 (82%), Gaps = 11/513 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFVLV +SI+IE+ IHLIGK L KR+K+ALYEALEKIK+ELMLLGF
Sbjct  9     RSLEETPTWAVAVVCFVLVIVSIIIEHFIHLIGKWLTKRHKRALYEALEKIKSELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I KIC+ KS+G+SWHPC   EE    G D  DG            +   
Sbjct  69    ISLLLTVVQGLISKICVPKSVGDSWHPCRPEEEASITGKDDDDGTTGRRLLYTESSSIV-  127

Query  612   DEYSGESHRRILAGGG-TDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
                     RRILAGGG TDKCA EG  PFIS+ GI+QLH+FIFVLA+FHVLYCI T+A G
Sbjct  128   --------RRILAGGGGTDKCAAEGKDPFISSVGINQLHMFIFVLAVFHVLYCISTMALG  179

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
             +LKMR+WKAWE ETKT+EYQF+HDP+RFR ARDTSFGRRHLSFWS+SP L+WIVCFFRQF
Sbjct  180   KLKMRRWKAWELETKTVEYQFSHDPDRFRLARDTSFGRRHLSFWSKSPILIWIVCFFRQF  239

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
             +RSVPKVDY+TLRHGFI+AHLAPQS M F+FQ+YIKRSLEEDFKVVV ISP IW FAV+F
Sbjct  240   LRSVPKVDYLTLRHGFIMAHLAPQSSMKFNFQKYIKRSLEEDFKVVVQISPTIWFFAVLF  299

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             LLFNTH   SYLWLPFIPL+ ILLVGTKLQVIITKM +RI ERG+VVKG PVV P DDLF
Sbjct  300   LLFNTHDWNSYLWLPFIPLLAILLVGTKLQVIITKMAVRIMERGDVVKGIPVVHPTDDLF  359

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WFNRPRL+L+LIHFVLFQNAFQLAFFAW+W EFG  SCFH++ ED++IRISMG+LIQVLC
Sbjct  360   WFNRPRLLLFLIHFVLFQNAFQLAFFAWSWLEFGFPSCFHKRIEDIIIRISMGVLIQVLC  419

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLS-SRPG  1685
             SYVTLPLYALVTQMGSNMKPTIF++RVA AL+ WH+TARK L++ R S S TPLS SRP 
Sbjct  420   SYVTLPLYALVTQMGSNMKPTIFSDRVATALRKWHETARKHLKENRRSTSATPLSTSRPA  479

Query  1686  TPLHGTSPIHLLQYYKSEIDSVGASPARDIEDN  1784
             TP HG SP+  L+ Y+SE+DS+ ASP R   D+
Sbjct  480   TPTHGLSPVPFLRRYRSEVDSLQASPRRHTTDD  512



>ref|XP_008243901.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=579

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/584 (67%), Positives = 457/584 (78%), Gaps = 42/584 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLEETPTWAVA VCFVLV ISI+IEYVIHLIGK L +++K+ALYEALEKIK+
Sbjct  1     MAGGKEGRSLEETPTWAVAIVCFVLVLISILIEYVIHLIGKWLTRKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G +WHPC + EE D     +   DG + RR  
Sbjct  61    ELMLLGFLSLLLTVGQGPISDICISKAVGATWHPCSKKEEIDDDKDKSSSSDGGDRRRLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                       +G   RR+LA  G DKCA +  VPF+S  GIHQLHI IFVLA+FHVLYCI
Sbjct  121   --------SVAGAGARRVLAAAGKDKCAAKNKVPFVSFYGIHQLHILIFVLAVFHVLYCI  172

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITL  GR KMR+WK WESET+T +YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIV
Sbjct  173   ITLVLGRAKMRRWKIWESETRTADYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIV  232

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFIIAHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISP IW
Sbjct  233   CFFRQFVRSVPKVDYLTLRHGFIIAHLAPQSQAKFDFQKYINRSLEEDFKVVVGISPTIW  292

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FL+ NTHG+RSYLWLPF+PL++ILLVGTKLQVIITKMGL+++ERGEVVKGTP+V+
Sbjct  293   FFAVVFLMSNTHGSRSYLWLPFLPLIMILLVGTKLQVIITKMGLKLKERGEVVKGTPLVE  352

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFN PRL+L+LIHFVLFQNAFQLAFFAW WYEFGLKSCFHEK ED+++R+SMG+
Sbjct  353   PGDHLFWFNNPRLILHLIHFVLFQNAFQLAFFAWTWYEFGLKSCFHEKLEDVILRVSMGV  412

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKPTIFN+RVA A+K WH +A+K L+  ++S      
Sbjct  413   IIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIKKWHLSAKKHLKHNKNSP-----  467

Query  1671  SSRPGTPLHGTSPIHLLQYYKSE--IDSV--------------GASPARDIEDNLPWFNQ  1802
             +S PGTPLH  SP+HLL++Y+SE  +DSV               +SP+   +D+L W NQ
Sbjct  468   TSVPGTPLHSMSPVHLLRHYQSEHDVDSVHTLQRMSYFDADGPNSSPSPH-QDDLSWSNQ  526

Query  1803  RRDNNVDQ--PAEENR--NEL--------QREIEMESAEFSFEN  1898
              R +  ++   A E+   N L        Q EI++ SAEF+FE 
Sbjct  527   GRSHGQEEEISAHESNAVNNLIAGYGSRSQHEIQIHSAEFTFEK  570



>ref|XP_007208289.1| hypothetical protein PRUPE_ppa003437mg [Prunus persica]
 gb|EMJ09488.1| hypothetical protein PRUPE_ppa003437mg [Prunus persica]
Length=574

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/584 (66%), Positives = 454/584 (78%), Gaps = 42/584 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLEETPTWAVA VCFVLV ISI+IEYVIHLIGK L +++K+ALYEALEKIK+
Sbjct  1     MAGGKEGRSLEETPTWAVALVCFVLVLISILIEYVIHLIGKWLTRKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G +WHPC + EE D     +   DG + RR  
Sbjct  61    ELMLLGFLSLLLTVGQGPISDICISKAVGATWHPCSKKEEIDDDKDKSSSSDGGDRRRLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                       +G   RR+LA  G DKCA +  VPF+S  GIHQLHI IFVLA+FHVLYCI
Sbjct  121   --------SVAGAGARRVLAAAGKDKCAAKNKVPFVSFYGIHQLHILIFVLAVFHVLYCI  172

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITL  GR KMR+WK WESET+T +YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIV
Sbjct  173   ITLVLGRAKMRRWKIWESETRTADYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIV  232

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFIIAHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISP IW
Sbjct  233   CFFRQFVRSVPKVDYLTLRHGFIIAHLAPQSQAKFDFQKYINRSLEEDFKVVVGISPTIW  292

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FL+ NTHG+RSYLWLPF+PL++ILLVGTKLQVIITKMGL+++ERGEVVKGTP+V+
Sbjct  293   FFAVVFLMSNTHGSRSYLWLPFLPLIMILLVGTKLQVIITKMGLKLKERGEVVKGTPLVE  352

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFN PRL+LYLIHFVLFQNAFQLAFFAW WYEFGLKSCFHEK ED+++R+SMG+
Sbjct  353   PGDHLFWFNNPRLILYLIHFVLFQNAFQLAFFAWTWYEFGLKSCFHEKLEDVILRVSMGV  412

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKPTIFN+RVA A+K WH +A+K L+  ++S      
Sbjct  413   IIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIKKWHLSAKKHLKHNKNSP-----  467

Query  1671  SSRPGTPLHGTSPIHLLQYYKSE----------------IDSVGASPARDIEDNLPWFNQ  1802
             +S PGTPLH  SP+HLL++Y+SE                 D   +SP+   +D+L W NQ
Sbjct  468   TSVPGTPLHSMSPVHLLRHYQSEHDVDSAHTLQRMSYFDADGPNSSPSPH-QDDLSWSNQ  526

Query  1803  RRDNNVDQ--PAEENR--NEL--------QREIEMESAEFSFEN  1898
              R +  ++   A E+   N L        Q EI++ SAEF+FE 
Sbjct  527   GRSHGQEEEISAHESNAMNNLKAGYGSRSQHEIQIHSAEFTFEK  570



>ref|XP_010313404.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6 [Solanum lycopersicum]
Length=561

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/568 (66%), Positives = 441/568 (78%), Gaps = 22/568 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGRSLE+TPTWAVA VCF LVAISIVIE +IHLIGK L+ ++K+ALYEALEKIKA
Sbjct  1     MAGGGGGRSLEQTPTWAVALVCFALVAISIVIELIIHLIGKWLKSKHKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  IC+S+ + ++WHPC + +E +     +GD +G   R   
Sbjct  61    ELMLLGFISLLLTVGQDPISNICVSEKIASTWHPCSKQKEAEMNKYISGDLEGHRRRLFT  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                  ADD       RR+LA  GTDKCA +G V F+SADGIHQLHIFIFVLA+FHV YC+
Sbjct  121   -----ADD----GGVRRVLAAAGTDKCADKGKVAFVSADGIHQLHIFIFVLAIFHVFYCV  171

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA GR KM +WK WE ET+T EYQF+HDPERFRFARDTSFGRRHLSFW+++  LLWIV
Sbjct  172   TTLALGRAKMSRWKIWEKETRTAEYQFSHDPERFRFARDTSFGRRHLSFWTKNSVLLWIV  231

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI  +      +N      IKRSLEEDFKVVV ISPPIW
Sbjct  232   CFFRQFVRSVPKVDYLTLRHGFITVNTXXIININXXXXXXIKRSLEEDFKVVVSISPPIW  291

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMGLRIQERGEVVKG PVVQ
Sbjct  292   FLAVLFLLFNTHGWYSYLWLPFIPLLVILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQ  351

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+L+LI+FVLFQNAFQLAFFAW WYEFGLKSCFH++TED+VIR++MG+
Sbjct  352   PGDDLFWFNRPRLLLFLINFVLFQNAFQLAFFAWTWYEFGLKSCFHDQTEDIVIRMTMGV  411

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ--KRHSGSVT  1664
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL+ WH +A+K +++  K+HS   T
Sbjct  412   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAMALRKWHHSAKKHIKEINKQHSNPTT  471

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFN-------QRRDNNVD  1823
             P+SSRP TP HG SP+HLL+  ++    VG  P R   +N+  ++        R D+ V 
Sbjct  472   PMSSRPPTPSHGMSPVHLLRGIRTSDMDVG--PRRSSYNNIDHWDIEGSPSPNRHDSEVH  529

Query  1824  QPA-EENRNELQREIEM-ESAEFSFENK  1901
             +P   E     Q EI +  S +FSF+ +
Sbjct  530   EPNLSEIEAREQYEINIARSRDFSFDKR  557



>ref|XP_004304413.1| PREDICTED: MLO-like protein 6-like [Fragaria vesca subsp. vesca]
Length=573

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/577 (65%), Positives = 445/577 (77%), Gaps = 30/577 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA  G  RSLE+TPTWAVA VCF+LV +SI+IEY++HLIGK L+++NK+ALYEALEKIKA
Sbjct  1     MAAAGKERSLEQTPTWAVAVVCFILVLVSIIIEYILHLIGKWLERKNKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISKS+G +WHPC + +E      D      +      
Sbjct  61    ELMLLGFLSLLLTVGQGPISDICISKSVGATWHPCSKKQEPVYAKEDGESTSSESDDDSG  120

Query  591   lllAFADD-EYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                  +     SG++ RR+LA  G DKC  +G VPF+S  GIHQLHI IFVLA+ HVLYC
Sbjct  121   RRRLLSVVLSSSGKNARRVLAAAGYDKCGAKGKVPFVSFYGIHQLHILIFVLAVSHVLYC  180

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             IITL  GR KMRKWK WE ET+T +YQF+HDPERFRFARDTSFGRRHLSFWSRSP LLWI
Sbjct  181   IITLVLGRAKMRKWKTWELETRTADYQFSHDPERFRFARDTSFGRRHLSFWSRSPILLWI  240

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLR+GFI AHLAPQSQ  FDFQ+YI RS+EEDFKVVVGISP I
Sbjct  241   VCFFRQFVRSVPKVDYLTLRNGFIFAHLAPQSQTKFDFQKYINRSVEEDFKVVVGISPVI  300

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             WLFAV+FLL NTHG+ SYL+LPFIPLV+ILLVGTKLQVIITKMGL+IQERGEVVKGTP+V
Sbjct  301   WLFAVLFLLSNTHGSWSYLYLPFIPLVMILLVGTKLQVIITKMGLKIQERGEVVKGTPLV  360

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P D LFWFN PRL+L++IHFVLFQNAFQLAFFAW WYEFGLKSCFH+K ED+V+RI+MG
Sbjct  361   EPGDHLFWFNSPRLILHIIHFVLFQNAFQLAFFAWTWYEFGLKSCFHDKMEDVVLRITMG  420

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             ++IQ+LCSYVTLPLYALVTQMGS MKPTIFN+RVA A++ WH  A+K ++Q +HS     
Sbjct  421   VVIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIRKWHHAAKKHVKQSKHSVP---  477

Query  1668  LSSRPGTPLHGTSPIHLLQYYKSEID----------------SVGASPARDIEDNLPWFN  1799
              +S PGTPLHG SP+HLL++Y SE+D                    SP+    D++PW N
Sbjct  478   -TSAPGTPLHGMSPVHLLRHYHSELDMDSMQTLPRMSYAEREGPNESPSHHDTDDVPWSN  536

Query  1800  QRRD---------NNVDQPAEENRNELQREIEMESAE  1883
             Q ++         N+V+ P     N++Q EI++ + +
Sbjct  537   QGQEEEISAHYQPNSVNNPPPGYGNQIQHEIQIHTKD  573



>emb|CAN64133.1| hypothetical protein VITISV_032771 [Vitis vinifera]
Length=569

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/594 (64%), Positives = 439/594 (74%), Gaps = 65/594 (11%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA G   RSLE+TPTWAVA VCFVLV ISI+IEY++HLIGK L KRNK+ALYEALEKIK+
Sbjct  1     MAKGSKDRSLEQTPTWAVAVVCFVLVLISIIIEYILHLIGKWLTKRNKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ TI  ICIS+ +  +WHPC + +E      +   G         
Sbjct  61    ELMLLGFISLLLTVGQGTIAGICISEKIAATWHPCGKKQEIKYVSNEEDYGKRR------  114

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                   +   S  S+RR+LA  G DKC  EG VPF+S  GIHQLHIFIFVLA+FH     
Sbjct  115   ----LLEISDSDGSNRRVLAAAGDDKCG-EGKVPFVSNYGIHQLHIFIFVLAVFH-----  164

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
                      MRKWKAWE ET+T EY+F +DPERFRFARDTSFGRRHL  WS SP LLWIV
Sbjct  165   ---------MRKWKAWEMETRTAEYRFANDPERFRFARDTSFGRRHLHSWSTSPVLLWIV  215

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFIIAHLAP+S   FDFQ+YIKRSLEEDFKVVVGISP IW
Sbjct  216   CFFRQFVRSVPKVDYLTLRHGFIIAHLAPESHTRFDFQKYIKRSLEEDFKVVVGISPIIW  275

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL+IIL+VGTKLQVIITKMGLRIQERGEVVKGTPVV+
Sbjct  276   FCAVLFLLFNTHGWHSYLWLPFIPLIIILMVGTKLQVIITKMGLRIQERGEVVKGTPVVE  335

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFN+PRL+LYLI+FVLFQNAFQ+AFFAW WYEFGLKSCFHE+ ED+VIRISMG+
Sbjct  336   PGDDLFWFNQPRLILYLINFVLFQNAFQVAFFAWTWYEFGLKSCFHERIEDVVIRISMGV  395

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS MKPTIFN+RVAKAL++WH  ARK ++Q + S +VTP+
Sbjct  396   IVQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAKALRNWHHAARKHIKQSKQSSAVTPV  455

Query  1671  --------SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDN-------------L  1787
                     SSRPGTPLHG SP+HLL++++SE+DSV  SP     DN             +
Sbjct  456   SSRAGTPFSSRPGTPLHGMSPVHLLRHHRSELDSVQTSPRMSNFDNEGPETDEYRHREDI  515

Query  1788  PWFNQRRDNNVDQPAEENR----------------NELQREIEMESAEFSFENK  1901
              W    R+     P EE R                +  Q EI+++  +FSF+ +
Sbjct  516   SWSEHHRNPG---PEEEGRDTNHRILTRTMPAPQADNAQHEIDIQPMDFSFDKR  566



>gb|AGV68800.1| MLO3 [Prunus armeniaca]
Length=574

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/584 (66%), Positives = 457/584 (78%), Gaps = 42/584 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLEETPTWAVA VCFVLV ISI+IEYVIHLIGK L +++K+ALYEALEKIK+
Sbjct  1     MAGGKEGRSLEETPTWAVALVCFVLVLISILIEYVIHLIGKWLTRKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G +WHPC + EE D     +   DG + RR  
Sbjct  61    ELMLLGFLSLLLTVGQGPISDICISKAVGATWHPCSKKEEIDDDKDKSSSSDGGDRRRLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                       +G   RR+LA  G DKCA +  VPF+S  GIHQLHI IFVLA+FHVLYCI
Sbjct  121   --------SVAGAGARRVLAAAGKDKCAAKNKVPFVSFYGIHQLHILIFVLAVFHVLYCI  172

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITL  GR KMR+WK WESET+T +YQF+HDPERFRFARDTSFGRRHLS+WSRSP  LWIV
Sbjct  173   ITLVLGRAKMRRWKKWESETRTADYQFSHDPERFRFARDTSFGRRHLSYWSRSPISLWIV  232

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFIIAHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISP IW
Sbjct  233   CFFRQFVRSVPKVDYLTLRHGFIIAHLAPQSQAKFDFQKYINRSLEEDFKVVVGISPTIW  292

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FL+ NTHG+RSYLWLPF+PL++ILLVGTKLQVIITKMGL+++ERGEVVKGTP+V+
Sbjct  293   FFAVVFLVSNTHGSRSYLWLPFLPLIMILLVGTKLQVIITKMGLKLKERGEVVKGTPLVE  352

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFN PRL+L+LIHFVLFQNAFQLAFFAW WYEFGLKSCFHEK ED+++R+SMG+
Sbjct  353   PGDHLFWFNNPRLILHLIHFVLFQNAFQLAFFAWTWYEFGLKSCFHEKLEDVILRVSMGV  412

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKPTIFN+RVA A+K WH +A+K L+  ++S      
Sbjct  413   IIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIKKWHLSAKKHLKHNKNSP-----  467

Query  1671  SSRPGTPLHGTSPIHLLQYYKSE--IDSV--------------GASPARDIEDNLPWFNQ  1802
             +S PGTPLH  SP+HLL++Y+SE  +DSV               +SP+   +D+L W NQ
Sbjct  468   TSVPGTPLHSMSPVHLLRHYQSEHDVDSVHTLQRMSYFDADGPNSSPSPH-QDDLSWSNQ  526

Query  1803  RRDNNVDQ--PAEENR--NEL--------QREIEMESAEFSFEN  1898
              R +  ++   A E+   N L        Q EI++ SAEF+FE 
Sbjct  527   GRSHGQEEEISAHESNAVNNLIAGYGSRSQHEIQIHSAEFTFEK  570



>ref|XP_009342695.1| PREDICTED: MLO-like protein 6 isoform X1 [Pyrus x bretschneideri]
Length=578

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/583 (66%), Positives = 446/583 (77%), Gaps = 36/583 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV ISI+IEY IHLIGK L++RNK+ALYEALEKIK+
Sbjct  1     MAGGKKGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIGKWLKRRNKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G++WHPC + +E      +      D+  RRR
Sbjct  61    ELMLLGFLSLLLTVGQGPISNICISKAVGSTWHPCSKKQEVKSDKNEDKSSASDDNARRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL A  D    G   RR+LA  G DKCA +  VPF+S  GIHQLHI IFVLA+FHVLYCI
Sbjct  121   LLSAL-DSSGGG---RRVLAAAGYDKCAAKNKVPFVSYYGIHQLHILIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TL  GR KMRKWKAWE ETKT  YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIV
Sbjct  177   TTLVLGRAKMRKWKAWELETKTAAYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQSQ  FDFQ+YI R+LEEDFKVVVGISP IW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIAAHLAPQSQTKFDFQKYINRALEEDFKVVVGISPTIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             LFAV+FL+ NTHG+RSYLWLPF+PLV+IL+VGTKLQVIITKMGL++ ERGEVV+GTP+V+
Sbjct  297   LFAVLFLMSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLQLSERGEVVRGTPLVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFN PRL+LY+IHFVLFQNAF LAFFAW WYEFGLKSCFHEK ED+V+RISMG+
Sbjct  357   PGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSCFHEKLEDVVLRISMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKP IFN+RVA ALK WH TA+K L+ K  S      
Sbjct  417   IIQILCSYVTLPLYALVTQMGSTMKPIIFNDRVATALKKWHITAKKHLKHKNASP-----  471

Query  1671  SSRPGTPLHGTSPIHLLQYYKSE--IDSVGASPARDI------------EDNLPWFN---  1799
             +S PGTPLH  SP+HLL  Y+ E  IDS+  SP                +DNL W     
Sbjct  472   ASAPGTPLHSMSPVHLLHNYRYEQDIDSIRTSPRISYFDNEGSDSPFHHQDNLTWSQQGT  531

Query  1800  ----QRRDNNVDQPAEENR------NELQREIEMESAEFSFEN  1898
                 Q+++ +   P  E+       + +Q EI++ SA  +FE 
Sbjct  532   NMEGQKKEISAHGPNSESNALGAYGSIIQHEIQIHSAALTFEK  574



>gb|KCW88826.1| hypothetical protein EUGRSUZ_A01164 [Eucalyptus grandis]
Length=590

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/591 (67%), Positives = 456/591 (77%), Gaps = 34/591 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  G SLE+TPTWAVA VCFVLV ISI+IEY+IHLIGK L KR+KKALYEALEKIK+
Sbjct  1     MAGGTAGGSLEQTPTWAVAVVCFVLVLISIIIEYIIHLIGKWLTKRHKKALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISL+LTVGQ  I  ICIS+SLG++WHPC    E      D  D D D+G RRR
Sbjct  61    ELMLLGFISLMLTVGQGPISGICISESLGSTWHPCSHKLESKLNTDDQEDEDADDGGRRR  120

Query  591   lllAFADDEYS-GESHRRILAGGGT--DKCAKE---------------------GMVPFI  698
             LLL+ +D   + G  + R         DKC+ +                     G VPF+
Sbjct  121   LLLSLSDTTQAFGHQNARRGLAAAAGYDKCSSKAIILFAFEKILPLIPFLWLLLGKVPFV  180

Query  699   SADGIHQLHIFIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRF  878
             S DGIHQLHIFIFVLA+FHVLYCIITLA G  KMRKWKAWE ETKT++YQ  HDPERFRF
Sbjct  181   SKDGIHQLHIFIFVLAVFHVLYCIITLALGSAKMRKWKAWEEETKTIDYQSAHDPERFRF  240

Query  879   ARDTSFGRRHLSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFD  1058
             ARDTSFGRRHL+FWS S  LLWIVCFFRQFVRSVPKVDY+TLRHGF+IAHL PQS + FD
Sbjct  241   ARDTSFGRRHLNFWSHSTILLWIVCFFRQFVRSVPKVDYLTLRHGFVIAHLGPQSHVKFD  300

Query  1059  FQQYIKRSLEEDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQ  1238
             FQ+YIKR+LEEDF VVVGISP IWLFA+ FLL NTHG+ SYLWLPF+PL+IILLVGTKLQ
Sbjct  301   FQKYIKRTLEEDFLVVVGISPIIWLFAIFFLLSNTHGSYSYLWLPFLPLIIILLVGTKLQ  360

Query  1239  VIITKMGLRIQERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawaw  1418
             VIITKMGL IQE+G++VKGTPVV+P DDLFWFNRPR++LYLIHFVLFQNAFQLAFFAW W
Sbjct  361   VIITKMGLSIQEKGQIVKGTPVVKPGDDLFWFNRPRILLYLIHFVLFQNAFQLAFFAWTW  420

Query  1419  YEFGLKSCFHEKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKA  1598
             YEFGL+SCFHEK +D++IRISMG+LIQ+LCSYVTLPLYALVTQMGSNMKPTIFN+RVA A
Sbjct  421   YEFGLRSCFHEKLQDVIIRISMGVLIQILCSYVTLPLYALVTQMGSNMKPTIFNDRVANA  480

Query  1599  LKSWHQTARKQLRQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIE  1778
             L++WH++A+K L+Q R  GSVTP SSRPGTP  G SP+HLLQ+YKS +DSV  +P     
Sbjct  481   LRNWHRSAKKHLKQNR--GSVTPFSSRPGTPSRGMSPVHLLQHYKSALDSVQTTPRTSNF  538

Query  1779  DNLPWFNQRRDNNVDQPAEENRNEL--------QREIEMESAEFSFENKRE  1907
              N  W    +++   +  +    E+        Q EI   S +FSFEN+ +
Sbjct  539   GNEGWETDGQNSPSRRKEDRGDTEMRVQHAIQVQHEIGTCSVDFSFENRTK  589



>ref|XP_009342698.1| PREDICTED: MLO-like protein 6 isoform X2 [Pyrus x bretschneideri]
Length=566

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/583 (64%), Positives = 433/583 (74%), Gaps = 48/583 (8%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV ISI+IEY IHLIGK L++RNK+ALYEALEKIK+
Sbjct  1     MAGGKKGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIGKWLKRRNKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G++WHPC + +E      +      D+  RRR
Sbjct  61    ELMLLGFLSLLLTVGQGPISNICISKAVGSTWHPCSKKQEVKSDKNEDKSSASDDNARRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL A  D    G   RR+LA  G DKCA +  VPF+S  GIHQLHI IFVLA+FHVLYCI
Sbjct  121   LLSAL-DSSGGG---RRVLAAAGYDKCAAKNKVPFVSYYGIHQLHILIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TL  GR KMRKWKAWE ETKT  YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIV
Sbjct  177   TTLVLGRAKMRKWKAWELETKTAAYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQSQ  FDFQ+YI R+LEEDFKVVVGISP IW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIAAHLAPQSQTKFDFQKYINRALEEDFKVVVGISPTIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             LFAV+FL+ NTHG+RSYLWLPF+PLV+IL+VGTKLQVIITKMGL++ ERGEVV+GTP+V+
Sbjct  297   LFAVLFLMSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLQLSERGEVVRGTPLVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFN PRL+LY+IHFV               YEFGLKSCFHEK ED+V+RISMG+
Sbjct  357   PGDHLFWFNNPRLLLYIIHFV------------LFQYEFGLKSCFHEKLEDVVLRISMGV  404

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKP IFN+RVA ALK WH TA+K L+ K  S      
Sbjct  405   IIQILCSYVTLPLYALVTQMGSTMKPIIFNDRVATALKKWHITAKKHLKHKNASP-----  459

Query  1671  SSRPGTPLHGTSPIHLLQYYKSE--IDSVGASPARDI------------EDNLPWFN---  1799
             +S PGTPLH  SP+HLL  Y+ E  IDS+  SP                +DNL W     
Sbjct  460   ASAPGTPLHSMSPVHLLHNYRYEQDIDSIRTSPRISYFDNEGSDSPFHHQDNLTWSQQGT  519

Query  1800  ----QRRDNNVDQPAEENR------NELQREIEMESAEFSFEN  1898
                 Q+++ +   P  E+       + +Q EI++ SA  +FE 
Sbjct  520   NMEGQKKEISAHGPNSESNALGAYGSIIQHEIQIHSAALTFEK  562



>ref|XP_010043720.1| PREDICTED: MLO-like protein 6 isoform X1 [Eucalyptus grandis]
 gb|KCW85717.1| hypothetical protein EUGRSUZ_B02482 [Eucalyptus grandis]
Length=579

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/521 (71%), Positives = 425/521 (82%), Gaps = 11/521 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLE+TPTWAVA VCFVLV +SI+IEY+IHLIG+ L+K++K+ALYEALEKIK+
Sbjct  1     MAGAAGGRSLEQTPTWAVAVVCFVLVLVSIIIEYIIHLIGQWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I KICI + +G +WHPC++ EEE+    ++  G         
Sbjct  61    ELMLLGFISLLLTVGQGPITKICIPQKVGATWHPCNKKEEEEGAEEESDAGRRRLLGMMG  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                        G S RR LA   T     EG VPFISADGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   ----------PGGSFRRALATATTTNQCAEGKVPFISADGIHQLHIFIFVLAVFHVLYCI  170

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A G+ KMR WKAWE+ET+T EYQF+HDP RFRF R+TSFG+RHL+FW+++P L+WIV
Sbjct  171   LTMALGQAKMRSWKAWETETRTAEYQFSHDPHRFRFTRETSFGKRHLNFWTKTPVLIWIV  230

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  231   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSQTKFDFQKYINRSLEEDFKVVVGISPPIW  290

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRI ERGEV+KG P+V 
Sbjct  291   FLAVLFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIHERGEVIKGVPLVH  350

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRP L+LYLI+FVLFQNAFQLAFFAW  YEFG KSCFH  TED+VIRI+MG+
Sbjct  351   PGDDLFWFNRPHLILYLINFVLFQNAFQLAFFAWTVYEFGFKSCFHAHTEDVVIRITMGV  410

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL+SWHQ+A+K ++Q + S SVTP+
Sbjct  411   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRSWHQSAKKHIKQNK-SSSVTPM  469

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
             SSRP TP H  SP+HLL++Y+ + DS   SP R   D   W
Sbjct  470   SSRPMTPSHHMSPVHLLRHYRVDRDSFHTSPRRSNVDADHW  510



>gb|AFW98802.1| MLO protein 2 [Rosa multiflora]
Length=588

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/583 (65%), Positives = 450/583 (77%), Gaps = 30/583 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLE+TPTWAVA VCF LV +SI+IE+++HLIGK L+++NK+AL EALEKIKA
Sbjct  1     MATATKERSLEQTPTWAVAVVCFFLVLVSIIIEHILHLIGKWLERKNKRALCEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISKS+G +WHPC + +E      D      +      
Sbjct  61    ELMLLGFLSLLLTVGQGPISDICISKSVGATWHPCSKQQETVYAEEDGESTSPESDDDSG  120

Query  591   lllAF-ADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                   A    SGES RR+LA  G DKC  +G VPF+S  GIHQLHI IFVLA+ HVLYC
Sbjct  121   RRRLLSAVLSSSGESARRVLAAAGYDKCGAQGKVPFVSFYGIHQLHILIFVLAVSHVLYC  180

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             IITL  GR KMR+WK WE ET+T++YQF+HDPERFRFARDTSFGRRHLSFWS+S  LLWI
Sbjct  181   IITLVLGRAKMRRWKKWELETRTVDYQFSHDPERFRFARDTSFGRRHLSFWSQSTILLWI  240

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLR+GFI AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISPPI
Sbjct  241   VCFFRQFVRSVPKVDYLTLRNGFIFAHLAPQSQTKFDFQKYINRSLEEDFKVVVGISPPI  300

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             WLFAV+FLL NTHG+RSYL+LPFIPLV+ILLVGTKLQVIITKMGL+IQERGEVVKGTP+V
Sbjct  301   WLFAVLFLLSNTHGSRSYLYLPFIPLVMILLVGTKLQVIITKMGLKIQERGEVVKGTPLV  360

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P D LFWFN PRL+L++IHFVLFQNAFQLAFFAW WYEFGLKSCFH+K ED+V+RI+MG
Sbjct  361   EPGDHLFWFNNPRLILHIIHFVLFQNAFQLAFFAWTWYEFGLKSCFHDKLEDVVLRITMG  420

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             ++IQ+LCSYVTLPLYALVTQMGS MKPTIFN+RVA A++ WH  A+K ++Q +HS    P
Sbjct  421   VIIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIRKWHHAAKKHVKQSKHS---VP  477

Query  1668  LSSRPGTPLHGTSPIHLLQYYKSEID----------------SVGASPARDIEDNLPWFN  1799
              S+ PGTPLHG SP+HLL++Y+SE D                    SP+R   D++PW N
Sbjct  478   TSA-PGTPLHGMSPVHLLRHYQSEQDVESMHTLPRMSYFESEGPNESPSRHDNDDVPWSN  536

Query  1800  QRRD---------NNVDQPAEENRNELQREIEMESAEFSFENK  1901
             Q ++         N+V+ P   + N +Q EI++ + +FSFE  
Sbjct  537   QGQEEEISAHYQPNSVNNPLPGHGNRIQHEIQIHTRDFSFEKN  579



>ref|XP_008369779.1| PREDICTED: MLO-like protein 6 isoform X2 [Malus domestica]
Length=579

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/582 (65%), Positives = 442/582 (76%), Gaps = 35/582 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV ISI+IEY IHLI K L KRNKKALYEALEKIKA
Sbjct  1     MAGGKEGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIAKWLTKRNKKALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G +WHPC +  E     G+    D D    RR
Sbjct  61    ELMLLGFLSLLLTVGQGPISNICISKAVGATWHPCSKKHEVKSDKGEENSSDSDNNAHRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL A  D    G   RR+LA GG DKCA +  VPF+S  G+HQLHI IFVLA+FHVLYCI
Sbjct  121   LLSAL-DSNGGG---RRVLAAGGYDKCAAKNKVPFVSFYGVHQLHILIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TL  GR KMR+WK WE ET+T +YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIV
Sbjct  177   TTLVLGRAKMRRWKIWELETQTADYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF RSVPKVDY+TLRHGFI AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISP +W
Sbjct  237   CFFRQFFRSVPKVDYLTLRHGFIAAHLAPQSQTKFDFQKYINRSLEEDFKVVVGISPTLW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             LF+V+FL+ NTHG+RSYLWLPF+PLV+IL+VGTKLQVIITKMGL++ ERGEVVKGTP+V+
Sbjct  297   LFSVLFLMSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEVVKGTPLVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFN PRL+LY+IHFVLFQNAF LAFFAW WYEFGLKSCFHEK ED+V+RISMG+
Sbjct  357   PGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSCFHEKLEDVVLRISMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKP IFN+RVA ALK WH  A+K +   +H+ + +P 
Sbjct  417   VIQILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWHIAAKKHI---KHNKNASPA  473

Query  1671  SSRPGTPLHGTSPIHLLQYYKSE--------------IDSVGASPARDIEDNLPWFNQ--  1802
              + PGTP H  SP+HLL+ Y+SE               D+ G+      +D+L W  Q  
Sbjct  474   GA-PGTPSHAMSPVHLLRNYQSEQDTESFRTLPRMSYFDNEGSDSPFHHQDDLTWSQQGT  532

Query  1803  RRDNNVDQPAEENRNE-----------LQREIEMESAEFSFE  1895
              R    ++ +   RN            +Q EI+++SA+ +FE
Sbjct  533   NRQGQEEEISAHGRNSESNALGGYGSIIQHEIQVQSAKLTFE  574



>ref|XP_007150219.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
 gb|ESW22213.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
Length=551

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/575 (63%), Positives = 435/575 (76%), Gaps = 48/575 (8%)
 Frame = +3

Query  246   GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLL  425
             GGRSLEETPTWAVA VCFVL+ ISIVI+++ HLIGK L+K++K+ALYE+LEKIK+ELMLL
Sbjct  2     GGRSLEETPTWAVAVVCFVLLTISIVIDHIFHLIGKWLKKKHKRALYESLEKIKSELMLL  61

Query  426   GFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAF  605
             GFISLLLTVGQS I +ICIS+ +  ++HPC                   +  RR L   F
Sbjct  62    GFISLLLTVGQSVISRICISEKVAGTFHPCTH---------------KTDHTRRLLPELF  106

Query  606   ADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
               D    ++ RRILA GGTDKCA +G VPF+S++GIHQLHIFIFVLA+FHVLYCI+TLA 
Sbjct  107   RSDH--NQNLRRILAAGGTDKCAAQGKVPFVSSEGIHQLHIFIFVLAVFHVLYCILTLAL  164

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             GR KMR+WK WE ETKT +YQF+HDPERFRFAR+TSFGRRHLSFW++   L+WI+CFFRQ
Sbjct  165   GRAKMRRWKRWEEETKTAQYQFSHDPERFRFARETSFGRRHLSFWTQHTILVWIICFFRQ  224

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             FVRSVPKVDY+TLRHGF++AHL PQS+  FDF+QYIKRSLEEDFKVVV ISPPIW   V+
Sbjct  225   FVRSVPKVDYLTLRHGFMMAHLGPQSRHKFDFRQYIKRSLEEDFKVVVEISPPIWFITVL  284

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
             FLLF+THG  SYLWLPF PL+I+LLVGTKLQVIITKMG RIQERGEVVKG P+VQP DDL
Sbjct  285   FLLFHTHGWYSYLWLPFAPLIIVLLVGTKLQVIITKMGQRIQERGEVVKGMPLVQPGDDL  344

Query  1326  FWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVL  1505
             FWFN+PRL+LYL++FVLFQNAFQLA+F+W   +FG+KSCFH +TED+VI+ISMG+ +Q L
Sbjct  345   FWFNKPRLILYLVNFVLFQNAFQLAYFSWTAVQFGMKSCFHSQTEDVVIKISMGVFVQFL  404

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH  A+K ++Q+        L SRP 
Sbjct  405   CSYVTLPLYALVTQMGSTMKPTIFNERVAMALRNWHHAAKKHVKQQNRR-----LQSRPT  459

Query  1686  TPLHGTSPIHLLQYYKSEID------------SVGASPARDIEDNLPWFNQRRDNNVDQP  1829
             TP H TS  HLL+   SEID             +  SP+  + D+     +    ++D  
Sbjct  460   TPNHSTSQAHLLRRCHSEIDIYPTDSEAHHPYEMDLSPSSKVHDHEV---EMEMGHLDHG  516

Query  1830  AEENRNEL----------QREIEMESA-EFSFENK  1901
               E+ NEL          Q EI +E   EFSF+N+
Sbjct  517   PLEDVNELNSALAGSGVTQHEINIEHGKEFSFDNR  551



>ref|XP_003539406.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=575

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/577 (63%), Positives = 441/577 (76%), Gaps = 26/577 (5%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
             GG GGR+L+ETPTWA+A VCFVL++ISI IE++ H+IGK  ++++K+ALYE+LEKIK+EL
Sbjct  2     GGSGGRNLDETPTWAIAVVCFVLLSISITIEHIFHVIGKWFKQKHKRALYESLEKIKSEL  61

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVGQ  I +ICIS+ +  ++HPC     +        D D   GRR    
Sbjct  62    MLLGFISLLLTVGQGLISRICISEKVAGTFHPCSTKRVKHSTPPLDHDDDETNGRRLLAA  121

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
             +  +DDE    SHRRILA G  DKCA +G VPF+S++ IHQLHIFIFVLA+FHVLYCI+T
Sbjct  122   ILSSDDE----SHRRILALGARDKCAAQGKVPFVSSEAIHQLHIFIFVLAVFHVLYCILT  177

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
             LA GR KMR+WK WE ETKT EYQF+HDPERFRFAR+TSFGRRHLSFW+++  L+WIVCF
Sbjct  178   LALGRAKMRRWKRWEVETKTAEYQFSHDPERFRFARETSFGRRHLSFWTQNTVLVWIVCF  237

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQFV+SVPKVDY+TLRHGF++AHL PQS   F+F++YIKRSLEEDFKVVV ISPPIW  
Sbjct  238   FRQFVQSVPKVDYLTLRHGFMMAHLGPQSHQKFNFRKYIKRSLEEDFKVVVEISPPIWFI  297

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
              V+FLLFNTHG  SYLWLPF PL+I+LLVGTKLQVIITKMG RIQ+RGEVVKG P+VQP 
Sbjct  298   TVLFLLFNTHGWYSYLWLPFAPLIIVLLVGTKLQVIITKMGQRIQQRGEVVKGVPLVQPG  357

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             DDLFWFN+PRL+LYLI+FVLFQNAFQLAFF+WA  +F +KSCFH + + +VIRISMG+ +
Sbjct  358   DDLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSCFHSQKQGVVIRISMGIFV  417

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             Q LCSYVTLPLYALVTQMGS MKPTIFN+RVA AL+ WH TA+K ++Q R     TP S+
Sbjct  418   QFLCSYVTLPLYALVTQMGSTMKPTIFNKRVATALRKWHHTAKKNVKQNRGLRLQTPSST  477

Query  1677  RPGTPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLPW----------------FNQR  1805
             RP TP H  S ++ L+ Y SE+    +SP R D E NL +                 +Q 
Sbjct  478   RPTTPNHPKSQVNFLRRYHSEMAPYPSSPIRFDFEANLSYEVNATSSSIHHHEMEMGHQA  537

Query  1806  RDN--NVDQPAEE--NRNELQREIEMESA-EFSFENK  1901
              D+   VD+P+      +  QREI++E   EFSF+NK
Sbjct  538   YDHAEKVDEPSSTLVGLSLPQREIDIEHGKEFSFDNK  574



>ref|XP_009358149.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=579

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/584 (65%), Positives = 441/584 (76%), Gaps = 39/584 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV ISI+IEY IHLI K L KRNK+ALYEALEKIKA
Sbjct  1     MAGGKEGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIAKWLTKRNKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G +WHPC +  E     G+    D D   RRR
Sbjct  61    ELMLLGFLSLLLTVGQGPISNICISKAVGATWHPCSKKHEVKSDKGEDKSSDSDNNARRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL A  D    G   RR+LA  G DKCA +  VPF+S  G+HQLHI IFVLA+FHVLYCI
Sbjct  121   LLSAL-DSNGGG---RRVLAASGYDKCAAKNKVPFVSFYGVHQLHILIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TL  GR KMR+WK WE ETKT +YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIV
Sbjct  177   TTLVLGRAKMRRWKIWELETKTADYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF RSVPKVDY+TLRHGFI AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISP +W
Sbjct  237   CFFRQFFRSVPKVDYLTLRHGFIAAHLAPQSQTKFDFQKYINRSLEEDFKVVVGISPTLW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             LF+V+FL+ NTHG+RSYLWLPF+PLV+IL+VGTKLQVIITKMGL++ ERGEVVKGTP+V+
Sbjct  297   LFSVLFLMSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEVVKGTPLVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFN PRL+LY+IHFVLFQNAF LAFFAW WYEFGLKSCFH+K ED+V+RISMG+
Sbjct  357   PGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSCFHDKLEDVVLRISMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSYVTLPLYALVTQMGS MKP IFN+RVA ALK WH TA+K +   +H+ + +P 
Sbjct  417   VIQILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWHITAKKHI---KHNKNASPA  473

Query  1671  SSRPGTPLHGTSPIHLLQYYKSE--------------IDSVGASPARDIEDNLPWFNQRR  1808
             S+  GT  H  SP+HLL+ Y+SE               D+ G+      +D+L W  Q  
Sbjct  474   SA-SGTSSHAMSPVHLLRNYQSEQDTESVRTLPRMSYFDNEGSDSPFHHQDDLTWSQQ--  530

Query  1809  DNNVDQPAEE--------NRNEL-------QREIEMESAEFSFE  1895
               N+    EE          N L       Q EI+++SA+ +FE
Sbjct  531   GTNLQGQEEEISAHGHNLESNALGGYGSIIQHEIQVQSAKLTFE  574



>ref|XP_008369778.1| PREDICTED: MLO-like protein 6 isoform X1 [Malus domestica]
Length=587

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/590 (64%), Positives = 441/590 (75%), Gaps = 43/590 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV ISI+IEY IHLI K L KRNKKALYEALEKIKA
Sbjct  1     MAGGKEGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIAKWLTKRNKKALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G +WHPC +  E     G+    D D    RR
Sbjct  61    ELMLLGFLSLLLTVGQGPISNICISKAVGATWHPCSKKHEVKSDKGEENSSDSDNNAHRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL A  D    G   RR+LA GG DKCA +  VPF+S  G+HQLHI IFVLA+FHVLYCI
Sbjct  121   LLSAL-DSNGGG---RRVLAAGGYDKCAAKNKVPFVSFYGVHQLHILIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHD--------PERFRFARDTSFGRRHLSFWSR  926
              TL  GR KMR+WK WE ET+T +YQF+H         PERFRFARDTSFGRRHLSFWSR
Sbjct  177   TTLVLGRAKMRRWKIWELETQTADYQFSHGLLPSVFTHPERFRFARDTSFGRRHLSFWSR  236

Query  927   SPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVV  1106
             SP  LWIVCFFRQF RSVPKVDY+TLRHGFI AHLAPQSQ  FDFQ+YI RSLEEDFKVV
Sbjct  237   SPISLWIVCFFRQFFRSVPKVDYLTLRHGFIAAHLAPQSQTKFDFQKYINRSLEEDFKVV  296

Query  1107  VGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEV  1286
             VGISP +WLF+V+FL+ NTHG+RSYLWLPF+PLV+IL+VGTKLQVIITKMGL++ ERGEV
Sbjct  297   VGISPTLWLFSVLFLMSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEV  356

Query  1287  VKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDL  1466
             VKGTP+V+P D LFWFN PRL+LY+IHFVLFQNAF LAFFAW WYEFGLKSCFHEK ED+
Sbjct  357   VKGTPLVEPGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSCFHEKLEDV  416

Query  1467  VIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKR  1646
             V+RISMG++IQ+LCSYVTLPLYALVTQMGS MKP IFN+RVA ALK WH  A+K +   +
Sbjct  417   VLRISMGVVIQILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWHIAAKKHI---K  473

Query  1647  HSGSVTPLSSRPGTPLHGTSPIHLLQYYKSE--------------IDSVGASPARDIEDN  1784
             H+ + +P  + PGTP H  SP+HLL+ Y+SE               D+ G+      +D+
Sbjct  474   HNKNASPAGA-PGTPSHAMSPVHLLRNYQSEQDTESFRTLPRMSYFDNEGSDSPFHHQDD  532

Query  1785  LPWFNQ--RRDNNVDQPAEENRNE-----------LQREIEMESAEFSFE  1895
             L W  Q   R    ++ +   RN            +Q EI+++SA+ +FE
Sbjct  533   LTWSQQGTNRQGQEEEISAHGRNSESNALGGYGSIIQHEIQVQSAKLTFE  582



>ref|XP_006424615.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 ref|XP_006424616.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 ref|XP_006488132.1| PREDICTED: MLO-like protein 6-like isoform X1 [Citrus sinensis]
 gb|ESR37855.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 gb|ESR37856.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
Length=576

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/519 (71%), Positives = 430/519 (83%), Gaps = 3/519 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLEETPTWAVA VCFVLV ISI+IE++IHLIGK L K++K+ALYEALEKIK+
Sbjct  1     MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV  S I KICI +S+ N+WHPCD+  E +                 R
Sbjct  61    ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDKEREAELNNEKETTEQETTEHENR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
               L  A     G   R + AG  TDKC+K G VPF+S DG+HQLHIFIFVLALFHVLY I
Sbjct  121   RRLLAAVAASGGSIRRALAAGSTTDKCSK-GKVPFVSEDGLHQLHIFIFVLALFHVLYSI  179

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A  R KM+KWK WE ET+T+EYQF+HDPERFRFAR+TSFGRRHLS W+++P L+WIV
Sbjct  180   LTMALSRAKMKKWKKWEKETRTIEYQFSHDPERFRFARETSFGRRHLSSWTKTPVLIWIV  239

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGF+ AHLAPQS   F+FQ+YI RSLEEDFKVVVGISP IW
Sbjct  240   CFFRQFVRSVPKVDYLTLRHGFVTAHLAPQSHTQFNFQKYINRSLEEDFKVVVGISPLIW  299

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  +YLWLPFIPL++ILLVGTKLQVIITKMG+RIQERGEV+KG PVVQ
Sbjct  300   FFAVVFLLFNTHGWYAYLWLPFIPLIVILLVGTKLQVIITKMGIRIQERGEVLKGVPVVQ  359

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
               DDLFWF++PRL+LYLI+FVLFQNAFQLAFFAW+W+EFG++SCFHE TED+VIRI+MG+
Sbjct  360   LGDDLFWFSQPRLILYLINFVLFQNAFQLAFFAWSWFEFGIESCFHEHTEDIVIRITMGV  419

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGSNMKPTIFNERVA ALK+WH TA+K ++Q +  GSVTPL
Sbjct  420   LIQILCSYVTLPLYALVTQMGSNMKPTIFNERVAAALKNWHHTAKKHIKQNK--GSVTPL  477

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNL  1787
             SSRP TP +  SP+HLL++Y+ E+DSV  SP R +E  L
Sbjct  478   SSRPSTPSYNMSPVHLLRHYRGEMDSVQTSPRRSMEQYL  516



>ref|XP_007132193.1| hypothetical protein PHAVU_011G073800g [Phaseolus vulgaris]
 gb|ESW04187.1| hypothetical protein PHAVU_011G073800g [Phaseolus vulgaris]
Length=566

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/591 (63%), Positives = 451/591 (76%), Gaps = 67/591 (11%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
              GGGGR+LEETPTWAV+ VCFVL+ ISI+IE++IHLIG+ L+K+ K+ALYE+LEKIK+EL
Sbjct  2     AGGGGRNLEETPTWAVSTVCFVLIFISIIIEHIIHLIGQWLKKKRKRALYESLEKIKSEL  61

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGF+SLLLTVGQ  + +ICIS+ + ++WHPC                           
Sbjct  62    MLLGFLSLLLTVGQGLVSRICISEKIASTWHPCS--------------------------  95

Query  597   lAFADDEYSGESH--------------------RRILAGGGTDKCAKEGMVPFISADGIH  716
                ADD +S ES                     RR+LAGGG+DKC  EG VPF+S++GIH
Sbjct  96    ---ADDTHSEESGQGTNSRRLLAAFHGSNDVNPRRVLAGGGSDKCG-EGKVPFVSSEGIH  151

Query  717   QLHIFIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSF  896
             QLHIFIFVL +FHVLYCI+T+A GR KM++WK WE ETKT EYQF+HDPERFRFAR+TSF
Sbjct  152   QLHIFIFVLTVFHVLYCILTMALGRAKMKRWKRWEEETKTPEYQFSHDPERFRFARETSF  211

Query  897   GRRHLSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIK  1076
             GRRHLSFW+++P L+WIVCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDF++YIK
Sbjct  212   GRRHLSFWTKNPVLMWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHSKFDFRKYIK  271

Query  1077  RSLEEDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKM  1256
             RSL+EDFKVVVGISPP WLFAV+FLL NTHG+ SYLWLPFIPL+IILLVGTKLQVIIT+M
Sbjct  272   RSLDEDFKVVVGISPPFWLFAVLFLLLNTHGSYSYLWLPFIPLIIILLVGTKLQVIITEM  331

Query  1257  GLRIQERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLK  1436
             GLRIQ+RGE++KG P+VQP D LFWFN+P L+LYLI+FVLFQNAFQLAFF+W+  +FG+K
Sbjct  332   GLRIQQRGEILKGVPLVQPGDYLFWFNKPGLILYLINFVLFQNAFQLAFFSWSVLQFGIK  391

Query  1437  SCFHEKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQ  1616
             SCFH  TED+VIRI+MG+LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA+AL++WHQ
Sbjct  392   SCFHAHTEDVVIRITMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAEALRNWHQ  451

Query  1617  TARKQLRQKR---HSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR------  1769
             TA+KQ+RQ R    S SVTP+SSRP TP H  SP+HLL+YY+SEIDS   SP R      
Sbjct  452   TAKKQIRQNRVGPLSLSVTPMSSRPTTPSHNMSPVHLLRYYRSEIDSFPTSPRRSNVDGD  511

Query  1770  -----DIEDNLPWFNQRRDNNVDQPAEENRNELQREI--EMESAEFSFENK  1901
                  D+E   P ++   +  +    +   N    EI     + EFSF+ +
Sbjct  512   HTQPWDVESPSPSYSH-HEMEMGHTNDPTTNTTHHEIVPAANTREFSFDKR  561



>ref|XP_009395303.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=584

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/508 (68%), Positives = 404/508 (80%), Gaps = 29/508 (6%)
 Frame = +3

Query  231   MAGGG-GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIK  407
             MAGGG GGR+LE+T TWAVA VCF LV IS+ IE+ IHLI K L+K +K+AL EALEKIK
Sbjct  1     MAGGGAGGRTLEQTSTWAVATVCFALVIISVAIEHGIHLITKWLEKHHKRALQEALEKIK  60

Query  408   AELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrr  587
             +ELMLLGF+SLLLTVGQS I +IC+  S+G+SWHPC                        
Sbjct  61    SELMLLGFVSLLLTVGQSAISEICVPTSVGDSWHPCKME---------------------  99

Query  588   rlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                     D+ S +  R +    G DKC+K   + FISADG+HQLHIFIFVLA+ H++YC
Sbjct  100   ------VHDDSSTDHSRHLSGRSGPDKCSKRNKISFISADGLHQLHIFIFVLAISHIIYC  153

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I T+A GRLKM+ WK+WE ETKT EYQF+HDP+RFRFAR+TSFGRRHLSFWS+SP L+WI
Sbjct  154   ISTMALGRLKMKHWKSWELETKTAEYQFSHDPDRFRFARETSFGRRHLSFWSKSPALIWI  213

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
              CFFRQFV S+PKVDY+TLR+GFIIAHLAPQS   FDF++YIKRSL+EDFKVVVGISP +
Sbjct  214   ACFFRQFVISLPKVDYLTLRNGFIIAHLAPQSSSKFDFRKYIKRSLDEDFKVVVGISPAL  273

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W FAVIFLLFNTHG  S+LWLPF+PL+IILLVGTKLQVII +M  RI ERG+V+KG PVV
Sbjct  274   WFFAVIFLLFNTHGWHSFLWLPFVPLIIILLVGTKLQVIIIRMAQRIMERGDVIKGVPVV  333

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
              P DDLFWF RPRLMLYLIHFVLFQNAFQLAF AW+WYEFG  SCFH++ ED+++R+SMG
Sbjct  334   HPTDDLFWFRRPRLMLYLIHFVLFQNAFQLAFLAWSWYEFGFPSCFHKRVEDIIVRLSMG  393

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVA AL+ WHQTARK LR+ R SGSVTP
Sbjct  394   LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVATALRKWHQTARKNLRENRKSGSVTP  453

Query  1668  LS-SRPGTPLHGTSPIHLLQYYKSEIDS  1748
             LS SR  TP +  + ++ LQ+  S+++S
Sbjct  454   LSTSRSTTPKNSFAQVYRLQHLPSDLES  481



>ref|NP_001268008.1| MLO7 protein [Vitis vinifera]
 gb|ACF25914.1| MLO-like protein 17 [Vitis vinifera]
Length=539

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/551 (64%), Positives = 417/551 (76%), Gaps = 50/551 (9%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLEETPTWAVA VCFVL+A+SI IE++ HLIG  L+ R+++ALYE+LEKIKA
Sbjct  1     MADELEERSLEETPTWAVAVVCFVLLAVSIFIEHIFHLIGSRLKGRHRRALYESLEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+ Q  I KICISKS+G++WHPC +                       
Sbjct  61    ELMLLGFISLLLTILQDYISKICISKSVGSTWHPCKKE----------------------  98

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                                +    + C+ EG VP +S+ GIHQLHIFIFVLALFHV+YC+
Sbjct  99    -------------------SKDFKNTCS-EGKVPLVSSYGIHQLHIFIFVLALFHVIYCV  138

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA GR KMR+WKAWE +TKT+EYQ++HDPERFRFARDTSFGRRHL+FWSRSP LLWIV
Sbjct  139   ATLALGRTKMRRWKAWEDQTKTIEYQYSHDPERFRFARDTSFGRRHLNFWSRSPVLLWIV  198

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF RSV  VDY+TLRHGFI+AHL+P S+  FDF+ YIKRSLEEDFKVVV ISP IW
Sbjct  199   CFFRQFFRSVNNVDYLTLRHGFIMAHLSPGSETKFDFRNYIKRSLEEDFKVVVSISPVIW  258

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NTHG  SYLWLPFIPLVIILLVGTKLQVIITK+GLRI ERG+VVKGTPVV+
Sbjct  259   FCAVLFLLTNTHGWYSYLWLPFIPLVIILLVGTKLQVIITKLGLRIAERGDVVKGTPVVE  318

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             PA+DLFWFNRP L+L+LI+FVLF NAFQLAFFAW+ YEFGL+SC+H+KTED+ IRISMG+
Sbjct  319   PANDLFWFNRPHLILFLINFVLFLNAFQLAFFAWSTYEFGLQSCYHQKTEDIAIRISMGV  378

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             + QVLCSYVTLPLYALVTQMGS M+PTIFNERVA AL+SWHQ ARK  +  RHS  V+P 
Sbjct  379   ITQVLCSYVTLPLYALVTQMGSTMRPTIFNERVATALRSWHQAARKHTKHGRHSNGVSPQ  438

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNE  1850
             SSRP TP +G SP+HLLQ Y +    +  SP R   DN  W+ +        P +++ +E
Sbjct  439   SSRPATPSYGMSPVHLLQGYHNHTPDM--SPRRSNLDN-EWYGE----GAGSPGKKDDDE  491

Query  1851  LQREIEMESAE  1883
              ++E + ES E
Sbjct  492   HEKE-KFESRE  501



>ref|XP_010558749.1| PREDICTED: MLO-like protein 6 [Tarenaya hassleriana]
Length=573

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/573 (62%), Positives = 433/573 (76%), Gaps = 22/573 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISI+IE++IH IG   +K++KKALYEALEK+KA
Sbjct  1     MAEKVKERTLEETSTWAVAVVCFVLLLISIIIEHLIHKIGAWFKKKHKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ  I  ICIS+S+ ++WHPC R E E KYG      D +E    R
Sbjct  61    ELMLMGFISLLLTIGQGPISGICISESVASTWHPCSRAEAEKKYGKKDKGKDNEEETTSR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL  A+        RR LA  G DKCA +G V F+SA GIHQLHIFIFVLA+ HV+YCI
Sbjct  121   RLLELAESYIP----RRSLATKGYDKCADKGKVAFVSAYGIHQLHIFIFVLAVCHVVYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT A G+ KMR+WK WE ETKT+EYQ+++DPERFRFARDTSFGRRHL+FWS++   LWIV
Sbjct  177   ITYALGKTKMRRWKKWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNFWSKTTVTLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV +VDY+TLRHGFI+AHLAP S+  FDF++YI+RSLEEDF VVVGISP IW
Sbjct  237   CFFRQFFGSVTRVDYLTLRHGFIMAHLAPGSETRFDFRKYIQRSLEEDFNVVVGISPVIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NTHG  SYLWLPFIPLV+IL+VGTKLQVIITK+GL+IQE+G+VVKG PVVQ
Sbjct  297   FIAVLFLLTNTHGINSYLWLPFIPLVVILIVGTKLQVIITKLGLQIQEKGDVVKGAPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE T D++IR+ MG+
Sbjct  357   PGDDLFWFGRPRFILFLIHVVLFTNAFQLAFFAWSTYEFNLKNCFHESTVDVIIRVVMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALK+WH TA+KQ +  +HS S TP 
Sbjct  417   IVQILCSYVTLPLYALVTQMGSTMKPTVFNERVAVALKNWHHTAKKQSKHSKHSNSTTPF  476

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEI-DSVGASPARDIEDNLPWFNQRRD-------NNVDQ  1826
             SSRP TP  GTSPIHLL  +++   +S+ ASP+    D   W + + +       NN D+
Sbjct  477   SSRPTTPTRGTSPIHLLSNFQNRSHESLSASPSPRHSDFDQWDHHQEEAETSTHHNNNDE  536

Query  1827  PAEENRN----------ELQREIEMESAEFSFE  1895
              +E+  +            Q EI +   +FSF+
Sbjct  537   SSEQRPDVALPPGPGPIRTQHEISINVRDFSFK  569



>gb|KDO48443.1| hypothetical protein CISIN_1g008391mg [Citrus sinensis]
Length=567

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/550 (66%), Positives = 419/550 (76%), Gaps = 18/550 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVAAV FVL+A+S+VIE++IH+IGK L  R+KKAL+EA+EK+KAELMLLGF
Sbjct  9     RTLEETPTWAVAAVFFVLIAVSVVIEHLIHIIGKWLNNRHKKALFEAVEKVKAELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I  IC+SKS+ NSWHPC           +      D    RR LL+F D
Sbjct  69    ISLLLTVLQEPISGICVSKSVANSWHPC-------TDKLEKDAYSSDNKESRRRLLSFLD  121

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
                   S RR LA  G DKCA EG V F+SA GIHQLHIFIFVLA+FHVLYC+ TLA GR
Sbjct  122   S--GTASTRRSLATKGYDKCADEGKVAFVSAYGIHQLHIFIFVLAVFHVLYCLFTLALGR  179

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWKAWE+ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWIVCFFRQF+
Sbjct  180   TKMKKWKAWENETKTIEYQYYNDPERFRFARDTSFGRRHLNIWSKSSISLWIVCFFRQFL  239

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV K+DY TLRHGFI+AHLAP S+  FDFQ+YI RSLEEDFK VVGI+P +W  A +FL
Sbjct  240   GSVNKIDYHTLRHGFIMAHLAPGSETKFDFQKYISRSLEEDFKDVVGITPILWFIATLFL  299

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  +YLWLPFIPL IILLVG KLQVIITK+GLRIQERG+VVKG PVVQP DDLFW
Sbjct  300   LTNTHGWFAYLWLPFIPLFIILLVGAKLQVIITKLGLRIQERGDVVKGAPVVQPGDDLFW  359

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLFQNAFQLAFF+W+ YEF LKSCFH+KTED+ IRISMG+LIQ+LCS
Sbjct  360   FGRPRFILFLIHLVLFQNAFQLAFFSWSTYEFALKSCFHKKTEDIAIRISMGVLIQILCS  419

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKPTIFN+RVA ALK+WH  A+K  +Q R SGS TP+SSRP TP
Sbjct  420   YVTLPLYALVTQMGSTMKPTIFNDRVAAALKNWHHIAKKHTKQGRLSGSNTPMSSRPQTP  479

Query  1692  LHGTSPIHLLQYY-KSEIDSVGASPARDIEDNLPWFNQRRDNNVDQP---AEENRNELQ-  1856
              HG SP+HLL  Y  S   S       D E+ +      R+   + P   AE +  E+  
Sbjct  480   THGMSPVHLLHNYPNSSYHSNFEHEHWDPENQIRSPRHHREIMNESPPHYAESSEQEVAA  539

Query  1857  ----REIEME  1874
                 R+IEM+
Sbjct  540   LEEPRQIEMQ  549



>ref|XP_004142393.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 gb|KGN52283.1| hypothetical protein Csa_5G623470 [Cucumis sativus]
Length=574

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/550 (65%), Positives = 411/550 (75%), Gaps = 20/550 (4%)
 Frame = +3

Query  240   GGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELM  419
             G   R+LE+T TWAVA VCF LV ISI IE+VIHL GK L+KR+K AL EALEK+KAELM
Sbjct  5     GTEQRTLEDTSTWAVAVVCFFLVVISIFIEHVIHLTGKWLEKRHKPALVEALEKVKAELM  64

Query  420   LLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlll  599
             LLGFISLLLT+GQ  + +IC+SK L  +W PC               G       R  LL
Sbjct  65    LLGFISLLLTIGQDAVTQICVSKELAATWLPC---------AARAKTGVKVAKNSRLRLL  115

Query  600   AFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITL  779
              F D +Y     RRILA  G D CAK G + F+SA GIHQLHIFIFVLA+FHVLYCIITL
Sbjct  116   EFLDPDYGS---RRILASKGDDACAKRGQLAFVSAYGIHQLHIFIFVLAVFHVLYCIITL  172

Query  780   AFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFF  959
             AFGR KM KWKAWE ETKT+EYQ+ +DP RFRFARDT+FGRRHLSFWSR+P  LWIVCFF
Sbjct  173   AFGRTKMSKWKAWEDETKTIEYQYYNDPARFRFARDTTFGRRHLSFWSRTPISLWIVCFF  232

Query  960   RQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFA  1139
             RQF  SV KVDYMTLRHGFI+AHLAP S++ FDF +YI RSLE+DFKVVVGISP +WLFA
Sbjct  233   RQFFGSVTKVDYMTLRHGFIVAHLAPGSEVKFDFHKYISRSLEDDFKVVVGISPAMWLFA  292

Query  1140  VIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPAD  1319
             V+F+L NT+G  SYLWLPFI L+IILLVGTKL VIIT MGL IQERG VVKG PVVQP D
Sbjct  293   VLFILTNTNGWYSYLWLPFISLIIILLVGTKLHVIITHMGLTIQERGHVVKGVPVVQPRD  352

Query  1320  DLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQ  1499
             DLFWF RP+L+L+LIHFVLF NAFQLAFFAW  Y F    CFH++ ED+VIR+SMG++IQ
Sbjct  353   DLFWFGRPQLILFLIHFVLFMNAFQLAFFAWTTYAFKWMGCFHQRVEDIVIRLSMGVIIQ  412

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSR  1679
             VLCSYVTLPLYALVTQMGSNM+PTIFN+RVA ALK+WH +A+K ++Q R+  S +P SSR
Sbjct  413   VLCSYVTLPLYALVTQMGSNMRPTIFNDRVATALKNWHHSAKKNMKQHRNPDSTSPFSSR  472

Query  1680  PGTPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLPWFNQ-----RRDNNVDQPAEEN  1841
             P TP HG SPIHLL  ++    S   S A  D  + LP  +        DN+ DQ  +E 
Sbjct  473   PATPTHGMSPIHLLHKHQHGSTSPRLSDAEPDRWEELPPSSHHSRAPHHDNHQDQ--QEQ  530

Query  1842  RNELQREIEM  1871
                + RE EM
Sbjct  531   SETIIREQEM  540



>ref|NP_001284458.1| MLO-like protein 12 [Cucumis melo]
 gb|ACX55084.1| Mlo1 [Cucumis melo]
Length=570

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/547 (65%), Positives = 410/547 (75%), Gaps = 18/547 (3%)
 Frame = +3

Query  240   GGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELM  419
             G   R+LE+T TWAVA VCF LV ISI IE+VIHL GK L+K++K AL EALEK+KAELM
Sbjct  5     GTEQRTLEDTSTWAVAVVCFFLVVISIFIEHVIHLTGKWLEKKHKPALVEALEKVKAELM  64

Query  420   LLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlll  599
             LLGFISLLLTVGQ  + +IC+SK L  +W PC               G       R  LL
Sbjct  65    LLGFISLLLTVGQDAVTQICVSKELAATWLPC---------AARAKAGVKVAKNSRLRLL  115

Query  600   AFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITL  779
              F D +Y     RRILA  G D CAK G + F+SA GIHQLHIFIFVLA+FHVLYCIITL
Sbjct  116   EFLDPDYGS---RRILASKGDDACAKRGQLAFVSAYGIHQLHIFIFVLAVFHVLYCIITL  172

Query  780   AFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFF  959
             AFGR KM KWKAWE ETKT+EYQ+ +DP RFRFARDT+FGRRHLSFWSR+P  LWIVCFF
Sbjct  173   AFGRTKMSKWKAWEDETKTIEYQYYNDPARFRFARDTTFGRRHLSFWSRTPISLWIVCFF  232

Query  960   RQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFA  1139
             RQF  SV KVDYMTLRHGFI+AHLAP  ++ FDF +YI RSLE+DFKVVVGISP +WLFA
Sbjct  233   RQFFGSVTKVDYMTLRHGFIVAHLAPGGEVKFDFHKYISRSLEDDFKVVVGISPAMWLFA  292

Query  1140  VIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPAD  1319
             V+F+L NT+G  SYLWLPFI L IILLVGTKL VIIT MGL IQERG VVKG PVVQP D
Sbjct  293   VLFILTNTNGWYSYLWLPFISLFIILLVGTKLHVIITHMGLTIQERGHVVKGVPVVQPRD  352

Query  1320  DLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQ  1499
             DLFWF RP+L+L+LIHFVLF NAFQLAFFAW  Y F  + CFH++ ED+ IR+SMG++IQ
Sbjct  353   DLFWFGRPQLILFLIHFVLFMNAFQLAFFAWTTYAFTWRGCFHQRIEDIAIRLSMGVIIQ  412

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSR  1679
             VLCSYVTLPLYALVTQMGSNM+PTIFN+RVA ALK+WH +A+K ++Q R+  S +P SSR
Sbjct  413   VLCSYVTLPLYALVTQMGSNMRPTIFNDRVATALKNWHHSAKKNMKQHRNPDSTSPFSSR  472

Query  1680  PGTPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLP--WFNQRRDNNVDQPAEENRNE  1850
             P TP HG SPIHLL  ++    S   S A  D  + LP    + R  +N DQ   + ++E
Sbjct  473   PTTPTHGMSPIHLLHKHQHGSTSPRLSDAEPDQWEELPPSSHHNRAHDNQDQ---QEQSE  529

Query  1851  LQREIEM  1871
               RE EM
Sbjct  530   TSREQEM  536



>emb|CBI31482.3| unnamed protein product [Vitis vinifera]
Length=539

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/551 (64%), Positives = 417/551 (76%), Gaps = 50/551 (9%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLEETPTWAVA VCFVL+A+SI IE++ HLIG  L+ R+++ALYE+LEKIKA
Sbjct  1     MADELEERSLEETPTWAVAVVCFVLLAVSIFIEHIFHLIGSWLKGRHRRALYESLEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLG ISLLLT+ Q  I KICIS+S+G++WHPC +  ++                   
Sbjct  61    ELMLLGVISLLLTILQDYISKICISESVGSTWHPCKKETKDF------------------  102

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                                     + C+ EG VP +S+ GIHQLHIFIFVLALFHV+YC+
Sbjct  103   -----------------------KNTCS-EGKVPLVSSYGIHQLHIFIFVLALFHVIYCV  138

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA GR KMR+WKAWE +TKT+EYQ++HDPERFRFARDTSFGRRHL+FWSRSP LLWIV
Sbjct  139   ATLALGRTKMRRWKAWEDQTKTIEYQYSHDPERFRFARDTSFGRRHLNFWSRSPVLLWIV  198

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF RSV  VDY+TLRHGFI+AHL+P S+  FDF+ YIKRSLEEDFKVVV ISP IW
Sbjct  199   CFFRQFFRSVNNVDYLTLRHGFIMAHLSPGSETKFDFRNYIKRSLEEDFKVVVSISPVIW  258

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NTHG  SYLWLPFIPLVIILLVGTKLQVIITK+GLRI ERG+VVKGTPVV+
Sbjct  259   FCAVLFLLTNTHGWYSYLWLPFIPLVIILLVGTKLQVIITKLGLRIAERGDVVKGTPVVE  318

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             PA+DLFWFNRP L+L+LI+FVLF NAFQLAFFAW+ YEFGL+SC+H+KTED+ IRISMG+
Sbjct  319   PANDLFWFNRPHLILFLINFVLFLNAFQLAFFAWSTYEFGLQSCYHQKTEDIAIRISMGV  378

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             + QVLCSYVTLPLYALVTQMGS M+PTIFNERVA AL+SWHQ ARK  +  RHS  V+P 
Sbjct  379   ITQVLCSYVTLPLYALVTQMGSTMRPTIFNERVATALRSWHQAARKHTKHGRHSNGVSPQ  438

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNE  1850
             SSRP TP +G SP+HLLQ Y +    +  SP R   DN  W+ +        P +++ +E
Sbjct  439   SSRPATPSYGMSPVHLLQGYHNHTPDM--SPRRSNLDN-EWYGE----GAGSPGKKDDDE  491

Query  1851  LQREIEMESAE  1883
              ++E + ES E
Sbjct  492   HEKE-KFESRE  501



>gb|ACO07297.1| MLO1 [Pisum sativum]
 gb|AGJ01118.1| MLO1 protein [Pisum sativum subsp. sativum]
Length=574

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/550 (63%), Positives = 408/550 (74%), Gaps = 14/550 (3%)
 Frame = +3

Query  240   GGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELM  419
             G   R+LEETPTWAVA VC VL+A+SI+IE++IH+IGK L+KRNK ALYEALEKIK ELM
Sbjct  5     GVKERTLEETPTWAVAVVCLVLLAVSILIEHIIHVIGKWLKKRNKNALYEALEKIKGELM  64

Query  420   LLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlll  599
             LLGFISLLLTV Q  I KIC+S+ +G++WHPC     + K   D          R+ L  
Sbjct  65    LLGFISLLLTVFQDNISKICVSQKIGSTWHPCSTSNTKAKAKSDESLDYKTNNDRKLL--  122

Query  600   AFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITL  779
                  EY     RRILA  G DKC  +G V  +SA GIHQLHIFIFVLALFH+L CIITL
Sbjct  123   -----EYFDPIPRRILATKGYDKCFDKGQVALVSAYGIHQLHIFIFVLALFHILQCIITL  177

Query  780   AFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFF  959
               GR+KMRKWK WE ET+T+EYQF +DPERFRFARDT+FGRRHLS W++SP LLWIV FF
Sbjct  178   TLGRIKMRKWKTWEDETRTVEYQFYNDPERFRFARDTTFGRRHLSMWAQSPILLWIVSFF  237

Query  960   RQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFA  1139
             RQF  S+ +VDYM LRHGFI+AHL P     FDFQ+YI RS+EEDFKVVVGISP IWLF 
Sbjct  238   RQFFGSISRVDYMALRHGFIMAHLPPGHDAQFDFQKYISRSIEEDFKVVVGISPTIWLFT  297

Query  1140  VIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPAD  1319
             V+FLL NTHG  SY WLPF+PL++ILLVG KLQ+IITKMGLRIQ+RGEV+KG PVV+P D
Sbjct  298   VLFLLTNTHGWYSYYWLPFLPLIVILLVGAKLQMIITKMGLRIQDRGEVIKGAPVVEPGD  357

Query  1320  DLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQ  1499
              LFWFNRP L+L+ IH VLFQNAFQLAFFAW+ YEF + SCFH+ T D VIRI++G++IQ
Sbjct  358   HLFWFNRPHLLLFTIHLVLFQNAFQLAFFAWSTYEFSITSCFHKTTADSVIRITVGVVIQ  417

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSR  1679
              LCSYVTLPLYALVTQMGS MKPTIFNERVA ALK+WH TA+KQ++Q  HS + TP SSR
Sbjct  418   TLCSYVTLPLYALVTQMGSTMKPTIFNERVATALKNWHHTAKKQVKQSNHSNNTTPYSSR  477

Query  1680  PGTPLHGTSPIHLLQYYKS-EIDSVGASPARDIEDNLPWFNQRRDNNVDQPAE-ENRNEL  1853
             P TP H  SP+HLL  + +   DS+  SP +    N  W     D   + P    N    
Sbjct  478   PSTPTHAMSPVHLLHRHTAGNSDSLQTSPEKSDYKNEQW-----DIEGEGPTSLRNDQTG  532

Query  1854  QREIEMESAE  1883
             Q EI++   E
Sbjct  533   QHEIQIAGVE  542



>ref|XP_004157520.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6-like [Cucumis 
sativus]
Length=574

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/550 (65%), Positives = 410/550 (75%), Gaps = 20/550 (4%)
 Frame = +3

Query  240   GGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELM  419
             G   R+LE+T TWAVA VC  LV ISI IE+VIHL GK L+KR+K AL EALEK+KAELM
Sbjct  5     GTEQRTLEDTSTWAVAVVCXFLVVISIFIEHVIHLTGKWLEKRHKPALVEALEKVKAELM  64

Query  420   LLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlll  599
             LLGFISLLLT+GQ  + +IC+SK L  +W PC               G       R  LL
Sbjct  65    LLGFISLLLTIGQDAVTQICVSKELAATWLPC---------AARAKTGVKVAKNSRLRLL  115

Query  600   AFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITL  779
              F D +Y     RRILA  G D CAK G + F+SA GIHQLHIFIFVLA+FHVLYCIITL
Sbjct  116   EFLDPDYGS---RRILASKGDDACAKRGQLAFVSAYGIHQLHIFIFVLAVFHVLYCIITL  172

Query  780   AFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFF  959
             AFGR KM KWKAWE ETKT+EYQ+ +DP RFRFARDT+FGRRHLSFWSR+P  LWIVCFF
Sbjct  173   AFGRTKMSKWKAWEDETKTIEYQYYNDPARFRFARDTTFGRRHLSFWSRTPISLWIVCFF  232

Query  960   RQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFA  1139
             RQF  SV KVDYMTLRHGFI+AHLAP S++ FDF +YI RSLE+DFKVVVGISP +WLFA
Sbjct  233   RQFFGSVTKVDYMTLRHGFIVAHLAPGSEVKFDFHKYISRSLEDDFKVVVGISPAMWLFA  292

Query  1140  VIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPAD  1319
             V+F+L NT+G  SYLWLPFI L+IILLVGTKL VIIT MGL IQERG VVKG PVVQP D
Sbjct  293   VLFILTNTNGWYSYLWLPFISLIIILLVGTKLHVIITHMGLTIQERGHVVKGVPVVQPRD  352

Query  1320  DLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQ  1499
             DLFWF RP+L+L+LIHFVLF NAFQLAFFAW  Y F    CFH++ ED+VIR+SMG++IQ
Sbjct  353   DLFWFGRPQLILFLIHFVLFMNAFQLAFFAWTTYAFKWMGCFHQRVEDIVIRLSMGVIIQ  412

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSR  1679
             VLCSYVTLPLYALVTQMGSNM+PTIFN+RVA ALK+WH +A+K ++Q R+  S +P SSR
Sbjct  413   VLCSYVTLPLYALVTQMGSNMRPTIFNDRVATALKNWHHSAKKNMKQHRNPDSTSPFSSR  472

Query  1680  PGTPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLPWFNQ-----RRDNNVDQPAEEN  1841
             P TP HG SPIHLL  ++    S   S A  D  + LP  +        DN+ DQ  +E 
Sbjct  473   PATPTHGMSPIHLLHKHQHGSTSPRLSDAEPDRWEELPPSSHHSRAPHHDNHQDQ--QEQ  530

Query  1842  RNELQREIEM  1871
                + RE EM
Sbjct  531   SETIIREQEM  540



>ref|XP_008806842.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=611

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/541 (65%), Positives = 406/541 (75%), Gaps = 15/541 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             M  G  GR+LEET TWAVA +C VLV ISI IE+ IHL  K L+K +KKAL+EALEK+K+
Sbjct  1     MGTGESGRNLEETSTWAVAMICAVLVVISIAIEHGIHLASKWLKKHHKKALHEALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ TI  +C+ KS+ +SWHPC           D       E     
Sbjct  61    ELMLLGFVSLLLTVGQGTITDLCVPKSVAHSWHPCK------MEAPDAAGSGSHESSESN  114

Query  591   lllAFADDEYSGESHRRILAGGGT-DKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                       S  S RR+L+GG   DKCA +  V FISADG+HQLHIFIFVLA+FHVLYC
Sbjct  115   PGRRLLHHSESMASFRRVLSGGAEPDKCAAKNKVSFISADGLHQLHIFIFVLAVFHVLYC  174

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I T+A G LKMR WK+WE ET+T EYQF+HDP+RFR AR+TSFG RHL+FWS+SP L WI
Sbjct  175   ISTMALGSLKMRHWKSWELETRTAEYQFSHDPDRFRLARETSFGHRHLNFWSKSPILTWI  234

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDF+ YIKRSLEED KVVVGISPP+
Sbjct  235   VCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSSSKFDFRNYIKRSLEEDLKVVVGISPPL  294

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W FAV+FLLFNT G  SY W PFIPL+ ILLVGTKLQVII +M L+I ERG+VVKG PVV
Sbjct  295   WAFAVLFLLFNTRGWHSYQWHPFIPLITILLVGTKLQVIIIRMALQIMERGDVVKGVPVV  354

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
              P DDLFWF  PRLMLYLIHFVLFQNAFQLAFFAW+WYEFG  SCFH++ ED+V+R S G
Sbjct  355   HPTDDLFWFKCPRLMLYLIHFVLFQNAFQLAFFAWSWYEFGFPSCFHQRVEDIVVRFSTG  414

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             +LIQVLCSYVTLPLYALVTQMGSNM+PTIF+ERVA AL+ WH TARK L++ R SGS+TP
Sbjct  415   VLIQVLCSYVTLPLYALVTQMGSNMRPTIFSERVATALRKWHHTARKHLKENRQSGSLTP  474

Query  1668  LS-SRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENR  1844
             LS S P TP  G+S  +LL++ ++ +DS   S  R        FN+   N    P+  NR
Sbjct  475   LSTSMPATPTSGSSQTNLLRHLQN-LDSFQDSSNRCS------FNKEHFNIERSPSPSNR  527

Query  1845  N  1847
              
Sbjct  528   K  528



>ref|XP_009385958.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=596

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/512 (69%), Positives = 416/512 (81%), Gaps = 5/512 (1%)
 Frame = +3

Query  258   LEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFIS  437
             L ETPTWAVAAVC VLV +SI+IE +IH IGK L+K +K ALYEALEKIK+ELMLLGFIS
Sbjct  14    LVETPTWAVAAVCLVLVILSIIIEQIIHRIGKWLRKHHKSALYEALEKIKSELMLLGFIS  73

Query  438   LLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADDE  617
             LLLTV Q+ I +IC+S+S+GNSWHPC   EE    G D    +          L  + D 
Sbjct  74    LLLTVSQNLISEICVSESVGNSWHPCKASEEAVIAGDDEHRSEDSNENNNGRRLLQSAD-  132

Query  618   YSGESHRRILAGGG-TDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGRL  794
              S +  RRIL GGG TDKC+ +G VPFIS +GI+QLHIFIF LA+ H+LYC++T+A GRL
Sbjct  133   -STDRFRRILVGGGSTDKCSAKGKVPFISTEGINQLHIFIFALAVSHILYCVVTMALGRL  191

Query  795   KMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFVR  974
             KMR+WK+WE ET+T EYQF+HDP+RFRFARDTSFGRRHL+FWS+S  L+WIVCF RQFV 
Sbjct  192   KMRRWKSWELETETAEYQFSHDPDRFRFARDTSFGRRHLNFWSKSHVLVWIVCFIRQFVS  251

Query  975   SVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFLL  1154
             SV KVDY+TLRHGFIIAHLAPQS   F+FQ+YIKRSLEEDFKVVVGISP IW  AV FLL
Sbjct  252   SVSKVDYLTLRHGFIIAHLAPQSSSKFNFQKYIKRSLEEDFKVVVGISPTIWFIAVCFLL  311

Query  1155  FNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFWF  1334
             FNTHG RS LWLPFIPL++IL+VGTKLQVIITKM ++I ERG+VVKG PVV+P D LFWF
Sbjct  312   FNTHGWRSSLWLPFIPLIVILMVGTKLQVIITKMAIQIMERGDVVKGVPVVRPGDKLFWF  371

Query  1335  NRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCSY  1514
             NRP L+L+LIHFVLFQNAFQLAFFAW+WYEFG  SCFH+  ED+VIRISMG+LIQVLCSY
Sbjct  372   NRPGLLLFLIHFVLFQNAFQLAFFAWSWYEFGYPSCFHKSIEDIVIRISMGVLIQVLCSY  431

Query  1515  VTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP--LSSRPGT  1688
             VTLPLYALVTQMGSN+KPTIFNERVA AL+ WH TARK+L++ R S SVTP   +SRP T
Sbjct  432   VTLPLYALVTQMGSNLKPTIFNERVATALRKWHHTARKRLKENRRSASVTPSLSTSRPAT  491

Query  1689  PLHGTSPIHLLQYYKSEIDSVGASPARDIEDN  1784
             P H  SP+H+LQY+ +E +S+  SP +   D+
Sbjct  492   PTHRLSPLHVLQYHHNEAESLQNSPKKFTMDD  523



>emb|CDO99726.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/537 (63%), Positives = 403/537 (75%), Gaps = 40/537 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG     +L+ETPTWAVA +CF+LVAISI++E++IHL+   L+K+ K+AL++ALEKIKA
Sbjct  1     MAGESKELTLQETPTWAVAVICFILVAISIMVEFLIHLLASWLKKKRKQALHDALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q  I KICI KS G SWHPC                         
Sbjct  61    ELMLLGFISLLLTVVQDPISKICIPKSAGRSWHPCRE-----------------------  97

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                   +DE  GE           + C  +G    +S  G+H+LHIFIF+LA FHVLYCI
Sbjct  98    ------NDELDGEKF--------INPCQAKGKSQLVSEKGLHELHIFIFMLAAFHVLYCI  143

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TL  GRLKMR WKAWE ETKTLEY + +DP+RFRFARDTSFGRRHL FWS+SP LLWIV
Sbjct  144   TTLGLGRLKMRVWKAWEDETKTLEYTYHNDPDRFRFARDTSFGRRHLHFWSKSPILLWIV  203

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+ LRHGFIIAHLAPQ+   FDF+ YIKRSLEEDFKVVVGISP IW
Sbjct  204   CFFRQFFASVTKVDYVALRHGFIIAHLAPQNHTTFDFRSYIKRSLEEDFKVVVGISPIIW  263

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             LFAV+FL+ NTHG  SYLWLPFIPL +ILLVGTKLQVIITKMGLRIQERG+VVKGTPVV+
Sbjct  264   LFAVLFLMSNTHGWHSYLWLPFIPLAVILLVGTKLQVIITKMGLRIQERGDVVKGTPVVE  323

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
               D LFWFNRPRL+LYLI FVLFQNAFQ+AFFA+ WY++G+ SCFH+  +D+ IR+S+G+
Sbjct  324   TGDHLFWFNRPRLLLYLIQFVLFQNAFQMAFFAFTWYKYGVPSCFHKGPKDIAIRLSVGI  383

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             + QVLCSYVTLPLYALVTQMG+ MKP IF+E+V+ ALKSWH+TA+K +++ R SGS TP 
Sbjct  384   VTQVLCSYVTLPLYALVTQMGTTMKPVIFDEKVSSALKSWHKTAKKNIKEDRKSGSTTPF  443

Query  1671  SSRPGTPLHGTSPIHLLQYYKS---EIDSVGASPARDIEDNLPWFNQRRDNNVDQPA  1832
             SSRPGTPLHG SP+HLLQ ++    + DS+ A+P     DN  W ++   N  D  A
Sbjct  444   SSRPGTPLHGMSPVHLLQGFRCSTVDDDSLQATPRGSNSDNEIWDHEALHNADDNAA  500



>ref|XP_003597192.1| MLO-like protein [Medicago truncatula]
 gb|ABD33062.1| Mlo-related protein [Medicago truncatula]
 gb|AES67443.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=593

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/506 (67%), Positives = 412/506 (81%), Gaps = 4/506 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSL ETPTWAVA VCFV+++ISI IE++ H+I K L+K++K ALYE+LEKIK+
Sbjct  1     MAGGSVGRSLTETPTWAVAVVCFVILSISIFIEHIFHIIEKWLKKKHKSALYESLEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVG+  I +ICIS+ +  +WHPC  +   +    +  D +    RR  
Sbjct  61    ELMLLGFISLLLTVGEGLISRICISEKVAATWHPCSNNANIESDDEELIDHETGGSRRLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
               L  +     G++H RILAGGG DKCA+EG V F+SA  IHQLHIFIFVLA+FH+LYCI
Sbjct  121   AALLASQ----GDNHHRILAGGGGDKCAEEGKVAFVSAGAIHQLHIFIFVLAVFHILYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA GR KMR+WK WE  TKT EYQF+HDPERFRFA +TSFGRRHLSFW+++P L+WIV
Sbjct  177   LTLALGRAKMRRWKRWEEATKTPEYQFSHDPERFRFANETSFGRRHLSFWTKNPVLIWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVP+VDY+TLRHGF++AHLAPQS + FDF+QYIKR LEEDFKVVVGISPPIW
Sbjct  237   CFFRQFVRSVPEVDYLTLRHGFMMAHLAPQSHLKFDFRQYIKRCLEEDFKVVVGISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
                V FLLF+THG  SYLWLPF+PL+I+LLVGTKLQVIIT+MGLRIQ++G VVKG PVVQ
Sbjct  297   FITVFFLLFHTHGWHSYLWLPFLPLIIVLLVGTKLQVIITQMGLRIQKQGMVVKGEPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFN+PRL+L+LI+FVLFQNAFQLAFF+W   +FG+ SC++ + + +VIRI MG+
Sbjct  357   PRDDLFWFNKPRLILFLINFVLFQNAFQLAFFSWTALQFGVTSCYNSRKDGVVIRICMGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
              +Q+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++  R SGS TP 
Sbjct  417   FVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTARKNIKHNRGSGSQTPF  476

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDS  1748
             SSR  TP    SP  +L++Y++++D+
Sbjct  477   SSRSITPARSMSPAQILRHYRNQMDT  502



>ref|XP_004487134.1| PREDICTED: MLO-like protein 6-like [Cicer arietinum]
Length=590

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/547 (64%), Positives = 431/547 (79%), Gaps = 9/547 (2%)
 Frame = +3

Query  243   GGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELML  422
              GGRSL ETPTWAVA VCFV+++ISI+IE++ H+IGK L+ ++K ALYE+LEKIK+ELML
Sbjct  2     AGGRSLTETPTWAVAVVCFVILSISIIIEHIFHIIGKWLKNKHKSALYESLEKIKSELML  61

Query  423   LGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllA  602
             LGFISLLLT+G+  I KICIS+ +  +WHPC  + E +       + +    R    LLA
Sbjct  62    LGFISLLLTIGEGLISKICISEKVAATWHPCTNNAERNSDDHQPIEHETGGRRLLAALLA  121

Query  603   FADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLA  782
               +     ++ RRILA GG DKCA +G V F+S++GIHQLHIFIFVLA+FHVLYCI+TLA
Sbjct  122   SQN-----KNSRRILAAGGIDKCAAQGKVAFVSSEGIHQLHIFIFVLAVFHVLYCILTLA  176

Query  783   FGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFR  962
              GR KMR+WK WE ETKTLEYQF+HDPERFRFA +TSFGRRHLSFW+++P L+WIVCFFR
Sbjct  177   LGRAKMRRWKRWEEETKTLEYQFSHDPERFRFASETSFGRRHLSFWTKNPVLIWIVCFFR  236

Query  963   QFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAV  1142
             QFVRSVP+VDY+TLRHGF++AHLAPQS   FDF+ YIKR LEEDFKVVV ISPPIW   V
Sbjct  237   QFVRSVPEVDYLTLRHGFMMAHLAPQSHQKFDFRHYIKRCLEEDFKVVVEISPPIWFITV  296

Query  1143  IFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADD  1322
             +FLLF+THG  SYLWLPF+PL+I+LLVGTKLQVIIT+MGLRIQ++G VVKG PVVQP DD
Sbjct  297   LFLLFHTHGWHSYLWLPFVPLIIVLLVGTKLQVIITQMGLRIQKQGMVVKGEPVVQPGDD  356

Query  1323  LFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQV  1502
             LFWF++PRL+L+LI+FVLFQNAFQLAFF+W   +FGL SCF+ +TED+VIRISMG+ +Q+
Sbjct  357   LFWFSKPRLILHLINFVLFQNAFQLAFFSWTALQFGLTSCFNSRTEDVVIRISMGVFVQI  416

Query  1503  LCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRP  1682
             LCSYVTLPLYALVTQMGS MKP IFNERVA AL++WH TA+K ++Q R SG  +P+S+R 
Sbjct  417   LCSYVTLPLYALVTQMGSTMKPAIFNERVATALRNWHNTAKKHIKQNRGSGFQSPMSTRS  476

Query  1683  GTPLHGTSPIHLLQYYKSEIDS-VGASPAR-DIEDNLPW--FNQRRDNNVDQPAEENRNE  1850
              TP H  SP H+L+ Y SE D+    SP R + E   P+  ++    N V+  A  + + 
Sbjct  477   ITPAHSMSPAHILRPYHSETDTHPTTSPTRLNFETYNPYEAYSPSPSNKVEARATSSSSI  536

Query  1851  LQREIEM  1871
                E+EM
Sbjct  537   YFHEMEM  543



>gb|ADV40949.1| MLO1 [Medicago truncatula]
 gb|KEH25654.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=574

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/573 (60%), Positives = 417/573 (73%), Gaps = 30/573 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVA VCFVL+AISIVIE++IH IGK  +K+NK ALYEALEK+K ELML+GF
Sbjct  9     RTLEETPTWAVAVVCFVLLAISIVIEHIIHAIGKWFKKKNKNALYEALEKVKGELMLMGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I KICIS+ +G++WHPC   + +     +  + +  + +          
Sbjct  69    ISLLLTVFQDYISKICISEKVGSTWHPCSTPKTKTASNDENSESENHDRKLL--------  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              EY   + RRILA  G D+CA +G V  +SA GIH+LHIFIFVLA+FH+L CIITLA GR
Sbjct  121   -EYFDPNPRRILATKGYDQCADKGKVALVSAYGIHELHIFIFVLAIFHILQCIITLALGR  179

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMR+WK WE ET+T+EYQF +DPERFRFARDT+FGRRHLS W++SP  LWIVCFFRQF 
Sbjct  180   FKMRRWKKWEDETRTVEYQFYNDPERFRFARDTTFGRRHLSMWTKSPISLWIVCFFRQFF  239

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              S+ +VDY+ LRHGFI+AHLAP +   FDFQ+YI RSLE+DFKVVVGISP IW FAV+FL
Sbjct  240   GSISRVDYLALRHGFIMAHLAPGNDAEFDFQKYISRSLEKDFKVVVGISPTIWFFAVLFL  299

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  S  WLPF+PL+IILLVG KLQ+IITKMGLRIQ+RGEV+KG PVV+P D LFW
Sbjct  300   LTNTHGWYSSYWLPFLPLIIILLVGAKLQMIITKMGLRIQDRGEVIKGAPVVEPGDHLFW  359

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FN P L+L++IH VLFQNAFQLAFF+W+ YEF + SCFH  T D VIR+S+G+LIQ LCS
Sbjct  360   FNSPNLLLFIIHLVLFQNAFQLAFFSWSTYEFSINSCFHRTTADNVIRVSVGILIQFLCS  419

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKPTIFNER+A ALK WH TA+KQ++  +HS + TP SSR  TP
Sbjct  420   YVTLPLYALVTQMGSTMKPTIFNERLATALKKWHHTAKKQVKHNKHSNNTTPYSSRQSTP  479

Query  1692  LHGTSPIHLLQYYK-SEIDSVGASPARDIEDNLPW-----------FNQRRDNNVDQPAE  1835
              HG SP+HLL        DS+  SP     +N  W            NQ   + ++ P  
Sbjct  480   THGMSPVHLLHRQTFGNSDSLQTSPRTSNYENEQWDVEGGGSTSPRNNQTVASEIEIPIV  539

Query  1836  E--NRNELQREIEME------SAEFSFENKREI  1910
             E  +  EL   +  E      S +FSFE KR I
Sbjct  540   ESFSTTELPVSVRHEIGTTSSSKDFSFE-KRHI  571



>ref|XP_003539407.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=582

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/517 (66%), Positives = 414/517 (80%), Gaps = 10/517 (2%)
 Frame = +3

Query  246   GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLL  425
             GG++L+ETPTWAVA VCFVL++ISI+IE+++HLIGK L+K++K+AL EALEKIK+ELMLL
Sbjct  2     GGKTLQETPTWAVAVVCFVLLSISILIEHILHLIGKWLKKKHKRALCEALEKIKSELMLL  61

Query  426   GFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAF  605
             GFISLLLTVGQ  I +ICIS+ +  ++HPC +     KY     + +      RRLL AF
Sbjct  62    GFISLLLTVGQGLISRICISEKVAGTFHPCPK-----KYYKKKEESEHRTNNGRRLLAAF  116

Query  606   ADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
              D +   ++HRRILA GG D C   G VPF+S++GIHQLHIFIFVLA+FHVLYCI+TLA 
Sbjct  117   LDSD--NQNHRRILAAGGGDNCPP-GKVPFVSSEGIHQLHIFIFVLAVFHVLYCILTLAL  173

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             GR KMR+WK WE ETKT +YQF+HDPERFRFAR+TSFGRRHLSFW+++P LLWIVCFFRQ
Sbjct  174   GRAKMRRWKRWEEETKTAQYQFSHDPERFRFARETSFGRRHLSFWAQNPVLLWIVCFFRQ  233

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             FVRSVPKVDY+TLRHGF++AHL P S   FDF+QYIKRSLEEDFKVVV IS PIW   V+
Sbjct  234   FVRSVPKVDYLTLRHGFMMAHLGPHSHPKFDFRQYIKRSLEEDFKVVVEISTPIWFITVL  293

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
             FLL +T G  SY WLPF PL+I+LLVG KLQVIITKMG RIQ+RGEVVKG P+VQP DDL
Sbjct  294   FLLVHTDGWYSYYWLPFAPLIIVLLVGAKLQVIITKMGQRIQQRGEVVKGVPLVQPGDDL  353

Query  1326  FWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVL  1505
             FWFN+PRL LYLI+FVLFQNAFQLA+F+W   +FG+KSCFH +TED VI+++MG+L+Q L
Sbjct  354   FWFNKPRLTLYLINFVLFQNAFQLAYFSWTALQFGIKSCFHSQTEDAVIKVTMGVLVQFL  413

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMGS MKPTIFNERVA+AL++WH TA+K ++Q R     TP SS P 
Sbjct  414   CSYVTLPLYALVTQMGSTMKPTIFNERVARALRNWHHTAKKHVKQNRGLQLQTP-SSAPS  472

Query  1686  TPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLPW  1793
             TP    S  +LL+   SE+ +   SP R D E + P+
Sbjct  473   TPNQPKSQANLLRQCHSEMYTYPTSPIRFDSEAHHPY  509



>ref|XP_007150221.1| hypothetical protein PHAVU_005G136800g [Phaseolus vulgaris]
 gb|ESW22215.1| hypothetical protein PHAVU_005G136800g [Phaseolus vulgaris]
Length=560

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/521 (64%), Positives = 404/521 (78%), Gaps = 23/521 (4%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
             GG GGR+L+ETPTWAVA VCFVL+++SI+IEY+ +LIGK L++++K+ALYE+LEKIK+EL
Sbjct  2     GGNGGRNLDETPTWAVAVVCFVLLSVSIIIEYIFNLIGKWLKQKHKRALYESLEKIKSEL  61

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVGQ  I +ICIS+ +  ++HPC     +                     
Sbjct  62    MLLGFISLLLTVGQGLISRICISEKVAGTFHPCAHRRVKQNNTP----------------  105

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
                  DEY    H   L     DKCA +G VPF+S++ IHQLHIFIFVLA+FHVLYCI+T
Sbjct  106   -PLEHDEYRNNRHLLALE----DKCAPQGKVPFVSSEAIHQLHIFIFVLAVFHVLYCILT  160

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
              A GR KMR+WK WE ETKT EYQ +HDP+RFRFAR+TSFGRRHLSFW+++  L+WI+CF
Sbjct  161   HALGRAKMRRWKRWEVETKTPEYQVSHDPQRFRFARETSFGRRHLSFWTQNAVLVWIICF  220

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQFV SVPKVDY+TLRHGF++AHL P S   FDF +YIKRSLEEDFKVVV ISPPIW  
Sbjct  221   FRQFVHSVPKVDYLTLRHGFMMAHLGPHSHQKFDFGKYIKRSLEEDFKVVVEISPPIWFI  280

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
              V+FLLFNTHG  SYLWLPF PL+I+LLVGTKLQVIITKMG RIQERGEVVKG PVVQP 
Sbjct  281   TVLFLLFNTHGWYSYLWLPFAPLIIVLLVGTKLQVIITKMGQRIQERGEVVKGMPVVQPG  340

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             D LFWFN+PRL+LYLI+FVLFQNAFQLAFF+WA  +F +KSCF  + +D+VIRISMG+ +
Sbjct  341   DHLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSCFQSQKQDVVIRISMGIFV  400

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             Q LCSYVTLPLYALVTQMGS MK TIFNE+VA AL++WH TA+K +++KR   S +PLS+
Sbjct  401   QFLCSYVTLPLYALVTQMGSTMKATIFNEKVAMALRNWHHTAKKNVKEKRGVRSQSPLST  460

Query  1677  RPGTPLHG-TSPIHLLQYYKSEIDSVGASPAR-DIEDNLPW  1793
             RP TP     S  +LL+ Y SE+ +  +SP R D E +LP+
Sbjct  461   RPSTPQQQPKSQANLLRRYHSEMATYPSSPIRFDFEAHLPY  501



>ref|NP_176350.1| MLO-like protein 6 [Arabidopsis thaliana]
 sp|Q94KB7.2|MLO6_ARATH RecName: Full=MLO-like protein 6; Short=AtMlo6 [Arabidopsis thaliana]
 gb|AAD25552.1|AC005850_9 Highly Simlilar to Mlo proteins [Arabidopsis thaliana]
 gb|AAK53799.2|AF369567_1 membrane protein Mlo6 [Arabidopsis thaliana]
 gb|AEE33851.1| MLO-like protein 6 [Arabidopsis thaliana]
Length=583

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/558 (62%), Positives = 415/558 (74%), Gaps = 19/558 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     ++LEET TWAVA VCFVL+ ISIVIE +IH IG   +K+NKKALYEALEK+KA
Sbjct  1     MADQVKEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKKKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ  I  ICI K++  S HPC   EE  KYG      + +E   RR
Sbjct  61    ELMLMGFISLLLTIGQGYISNICIPKNIAASMHPCSASEEARKYGKKDVPKEDEEENLRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL   D        RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+YCI
Sbjct  121   KLLQLVDSLIP----RRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHLSFWS+S   LWIV
Sbjct  177   VTYALGKTKMRRWKKWEEETKTIEYQYSHDPERFRFARDTSFGRRHLSFWSKSTITLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P IW
Sbjct  237   CFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPVIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  SYLWLPFIP ++IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+VQ
Sbjct  297   FIAVLFLLTNTNGLNSYLWLPFIPFIVILIVGTKLQVIITKLGLRIQEKGDVVKGTPLVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D  FWF RPR +L+LIH VLF NAFQLAFF W+ YEFGLK+CFHE   D++IRIS+GL
Sbjct  357   PGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNCFHESRVDVIIRISIGL  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             L+Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+K ++  R S S TP 
Sbjct  417   LVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKNIKHGRTSESTTPF  476

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNE  1850
             SSRP TP HG+SPIHLL+       +     +R ++++          N   P   + + 
Sbjct  477   SSRPTTPTHGSSPIHLLR-------NAPHKRSRSVDESFA--------NSFSPRNSDFDS  521

Query  1851  LQREIEMESAEFSFENKR  1904
                E + E+AE S  N R
Sbjct  522   WDPESQHETAETSNSNHR  539



>ref|XP_006302048.1| hypothetical protein CARUB_v10020030mg [Capsella rubella]
 gb|EOA34946.1| hypothetical protein CARUB_v10020030mg [Capsella rubella]
Length=592

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/551 (62%), Positives = 412/551 (75%), Gaps = 26/551 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     ++LEET TWAVA VCFVL+ ISIVIE +IH IG   + +NKKALYEALEK+KA
Sbjct  1     MAEQVKEKTLEETSTWAVAVVCFVLLLISIVIENLIHKIGSWFKNKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ  I  ICI K++  S HPC           +     G +   + 
Sbjct  61    ELMLMGFISLLLTIGQGYISNICIPKNIAASMHPCS--------AAEEARKYGKKLVPKV  112

Query  591   lllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                   DD+ S             RR LA  G DKCA++G V F+SA G+HQLHIFIFVL
Sbjct  113   QEDGGDDDDNSRRKLLQLVDSIIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVL  172

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWS  923
             A+ HV+YCI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWS
Sbjct  173   AVCHVIYCIVTYALGKTKMRRWKRWEQETKTIEYQYSHDPERFRFARDTSFGRRHLNFWS  232

Query  924   RSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKV  1103
             R+   LWIVCFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK 
Sbjct  233   RTTVTLWIVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKT  292

Query  1104  VVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGE  1283
             VV I+P IW  AV+FLL NT+G  SYLWLPFIP V+IL+VGTKLQVIITK+GLRIQE+G+
Sbjct  293   VVEINPVIWFVAVLFLLTNTNGLNSYLWLPFIPFVVILIVGTKLQVIITKLGLRIQEKGD  352

Query  1284  VVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTED  1463
             VVKGTP+VQP+D  FWF RPR +L+LIH VLF NAFQLAFF W+ YEFGLK+CFHE + D
Sbjct  353   VVKGTPLVQPSDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNCFHESSVD  412

Query  1464  LVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQK  1643
             ++IRIS+GL++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  
Sbjct  413   VIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVAIALKSWHHTAKKQIKHG  472

Query  1644  RHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDN--LPWFNQRRDNN  1817
             R S S TP SSRP TP HG+SPIHLL+       +V    +R ++DN      + RR+++
Sbjct  473   RTSESTTPFSSRPTTPTHGSSPIHLLR-------NVPHKRSRSVDDNSFANSMSPRRNSD  525

Query  1818  VDQPAEENRNE  1850
              D    E+++E
Sbjct  526   FDSWDPESQHE  536



>ref|XP_008338448.1| PREDICTED: MLO-like protein 6 [Malus domestica]
Length=560

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/524 (68%), Positives = 411/524 (78%), Gaps = 34/524 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG   GRSLE+TPTWAVA VCFVLV ISI+IE++I LI K L+K++K+ALYEALEKIK+
Sbjct  1     MAGATSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I  ICIS+ +GN+WHPC + +E      +  + +     RR 
Sbjct  61    ELMLLGFISLLLTVGQGPISNICISQKIGNTWHPCGKKQENKLNKEENVEYEDXIPGRRL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L L F +   +G   RR+LA   TDKCA +G V                           
Sbjct  121   LSL-FNE---TGGGARRVLAAASTDKCAAKGKV---------------------------  149

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              T+A GR KMR WK WE ET+T EYQF+HDPERFRFARDTSFGRRH+S+W+++PFL+WIV
Sbjct  150   -TMALGRAKMRSWKRWEKETRTDEYQFSHDPERFRFARDTSFGRRHMSYWTKTPFLMWIV  208

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   F+FQ+YI RSLEEDFKVVVGISPPIW
Sbjct  209   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHKKFNFQKYINRSLEEDFKVVVGISPPIW  268

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAVIFLLFNTHG  SYLWLPF+PL+IILLVGTKLQVIITKMGLRIQERGEVVKG  VVQ
Sbjct  269   FFAVIFLLFNTHGWYSYLWLPFVPLIIILLVGTKLQVIITKMGLRIQERGEVVKGLLVVQ  328

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEF LKSCFHE TED++IR+SMG+
Sbjct  329   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSCFHEHTEDVIIRVSMGV  388

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             LIQ+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TARK ++Q +  GSVTP+
Sbjct  389   LIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTARKHIKQNK--GSVTPM  446

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQ  1802
             SSRP TP H  SP+HLL+ Y+SE+DS   SP +   +   W N+
Sbjct  447   SSRPATPSHHMSPVHLLRNYRSEVDSFHTSPRKSNFEGERWANE  490



>ref|XP_002886534.1| hypothetical protein ARALYDRAFT_315221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62793.1| hypothetical protein ARALYDRAFT_315221 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/566 (61%), Positives = 411/566 (73%), Gaps = 30/566 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     ++LEET TWAVA VCFVL+ ISIVIE +IH +G   + +NKKALYEALEK+KA
Sbjct  1     MADQVKEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKLGSWFKSKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ  I  ICI K++  S HPC                  +E R+  
Sbjct  61    ELMLMGFISLLLTIGQGYISNICIPKNIAASMHPCS---------------ASEEARKYG  105

Query  591   lllAFADDEYSGESH-------------RRILAGGGTDKCAKEGMVPFISADGIHQLHIF  731
                A   D   GE+              RR LA  G DKCA++G V F+SA G+HQLHIF
Sbjct  106   KKDAAKKDGEDGENSRRKLLQLVDSLIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIF  165

Query  732   IFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHL  911
             IFVLA+ HV+YCI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL
Sbjct  166   IFVLAVCHVIYCIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHL  225

Query  912   SFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEE  1091
             +FWS+S   LWIVCFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEE
Sbjct  226   NFWSKSTITLWIVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEE  285

Query  1092  DFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQ  1271
             DFK +V I+P IW  AV+FLL NTHG  SYLWLPFIP V+IL+VGTKLQVIITK+GLRIQ
Sbjct  286   DFKTIVEINPVIWFIAVLFLLTNTHGLNSYLWLPFIPFVVILIVGTKLQVIITKLGLRIQ  345

Query  1272  ERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHE  1451
             E+G+VVKGTP+VQP D  FWF RPR +L+LIH VLF NAFQLAFFAW+ YEFGLK+CFHE
Sbjct  346   EKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFGLKNCFHE  405

Query  1452  KTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQ  1631
                D++IRIS+GL++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ
Sbjct  406   SRVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKQ  465

Query  1632  LRQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEID-SVGASPARDIEDNLPWFNQRR  1808
             ++  R S S TP SSRP TP HG+SPIHLL+    +   SV  S A  +      F+   
Sbjct  466   IKHGRTSESTTPFSSRPTTPTHGSSPIHLLRNAPHKRSRSVDESFANSMSPRNSDFDSWD  525

Query  1809  DNNVDQPAE-ENRNELQREIEMESAE  1883
               +  + AE  N N   R  E ES +
Sbjct  526   PESQHEAAETSNSNHCSRVREEESEK  551



>gb|KHN25048.1| MLO-like protein 6 [Glycine soja]
Length=577

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/517 (64%), Positives = 401/517 (78%), Gaps = 15/517 (3%)
 Frame = +3

Query  246   GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLL  425
             GG++L+ETPTWAVA VCFVL++ISI+IE+++HLIGK L+K++K+AL EALEKIK+ELMLL
Sbjct  2     GGKTLQETPTWAVAVVCFVLLSISILIEHILHLIGKWLKKKHKRALCEALEKIKSELMLL  61

Query  426   GFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAF  605
             GFISLLLTVGQ  I +ICIS+ +  ++HPC +     KY     + +      RRLL AF
Sbjct  62    GFISLLLTVGQGLISRICISEKVAGTFHPCPK-----KYYKKKEESEHRTNNGRRLLAAF  116

Query  606   ADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
              D +   ++HRRILA GG D C   G VPF+S++GIHQLHIFIFVLA+FHVLYCI+TLA 
Sbjct  117   LDSD--NQNHRRILAAGGGDNCPP-GKVPFVSSEGIHQLHIFIFVLAVFHVLYCILTLAL  173

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             GR KMR+WK WE ETKT EYQF+HDPERFRFAR+TSFGRRHLSFW+++P LLWIVCFFRQ
Sbjct  174   GRAKMRRWKRWEVETKTAEYQFSHDPERFRFARETSFGRRHLSFWAQNPVLLWIVCFFRQ  233

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             FVRSVPKVDY+TLRHGF++AHL P S   FDF+QYIKRSLEEDFKVVV IS PIW   V+
Sbjct  234   FVRSVPKVDYLTLRHGFMMAHLGPHSHPKFDFRQYIKRSLEEDFKVVVEISTPIWFITVL  293

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
             FLL +T G  SY WLPF PL+I+LLVG KLQVIITKMG RIQ+RGEVVKG P+VQP DDL
Sbjct  294   FLLVHTDGWYSYYWLPFAPLIIVLLVGAKLQVIITKMGQRIQQRGEVVKGVPLVQPGDDL  353

Query  1326  FWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVL  1505
             FWFN+PRL LYLI+F      F          +FG+KSCFH +TED VI+++MG+L+Q L
Sbjct  354   FWFNKPRLTLYLINFAFQLAYFSWTAL-----QFGIKSCFHSQTEDAVIKVTMGVLVQFL  408

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMGS MKPTIFNERVA+AL++WH TA+K ++Q R     TP SS P 
Sbjct  409   CSYVTLPLYALVTQMGSTMKPTIFNERVARALRNWHHTAKKHVKQNRGLQLQTP-SSAPS  467

Query  1686  TPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLPW  1793
             TP    S  +LL+   SE+ +   SP R D E + P+
Sbjct  468   TPNQPKSQANLLRQCHSEMYTYPTSPIRFDSEAHHPY  504



>ref|XP_002312021.2| MLO-like protein 12 [Populus trichocarpa]
 gb|EEE89388.2| MLO-like protein 12 [Populus trichocarpa]
Length=578

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/542 (64%), Positives = 411/542 (76%), Gaps = 15/542 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             M+      SLEETPTWAVA VCFVLVAISIVIE++IH++ K L+K++K AL EALEK+KA
Sbjct  1     MSSTTKAVSLEETPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKIALVEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISL LT+ Q  I  ICI KS+  +WHPCD      +      +   D    RR
Sbjct  61    ELMLMGFISLFLTILQGPISDICIPKSVAATWHPCD----AKQEEKAKAEKSSDSKDNRR  116

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL F D   SGESHRR LA    D C  EG V  +S+ GIHQLHIFIF+LA+ HVLYCI
Sbjct  117   GLLQFLD---SGESHRRFLASK-YDSCG-EGTVALVSSYGIHQLHIFIFMLAVVHVLYCI  171

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT   GR KMRKWK WE+ETKTLEYQ+ +DPERFRFARDTSFGRRH+  WS SP LLWIV
Sbjct  172   ITYFLGRTKMRKWKTWENETKTLEYQYHNDPERFRFARDTSFGRRHMQLWSNSPVLLWIV  231

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF+ SV KVDYMTLRHGFI AHLAP S+  FDFQ+YI RSL+EDFKVVVGISP IW
Sbjct  232   CFFRQFLGSVTKVDYMTLRHGFITAHLAPGSETRFDFQKYISRSLDEDFKVVVGISPIIW  291

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+ LL +THG  S+LWLPFIPLV+IL +GTKLQVIIT+MGLRIQERG+VVKG PVVQ
Sbjct  292   FMAVLLLLTDTHGWNSHLWLPFIPLVVILSIGTKLQVIITQMGLRIQERGDVVKGAPVVQ  351

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLFQNAFQ+AFF W+ YEF +KSC+H +TE +VIRI++G+
Sbjct  352   PGDDLFWFGRPRFLLFLIHLVLFQNAFQIAFFIWSVYEFSIKSCYHARTEAIVIRITLGV  411

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ++CSYVTLPLYALVTQMGS+M+PT+FN+RVA ALK+WH TA+KQ +  ++S S TP+
Sbjct  412   IIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKTWHHTAKKQSKHGKNSESHTPM  471

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEI--DSVGASPARDIEDNLPWFNQRRDNNVDQPAEENR  1844
             SSRP TP HG SP+HLL+ ++S    +S   SP     DN    N + D   +   +   
Sbjct  472   SSRPQTPSHGMSPVHLLRNHRSSTAPNSFPNSPRLSNHDN----NDQWDTEANSVHDYEL  527

Query  1845  NE  1850
             NE
Sbjct  528   NE  529



>ref|XP_010547373.1| PREDICTED: MLO-like protein 6 [Tarenaya hassleriana]
Length=553

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/561 (61%), Positives = 417/561 (74%), Gaps = 18/561 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIVIE++IH IG   +K++KKALYEALEK+KA
Sbjct  1     MAEQVKERTLEETSTWAVAVVCFVLLLISIVIEHLIHKIGSWFKKKHKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+ Q  I  ICIS+S+ ++WHPC   E   KYG    + + ++    R
Sbjct  61    ELMLMGFISLLLTITQGIISDICISQSVASTWHPCSTSEAAKKYGKQDAEKEEEDETSSR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL  A+        RR LA  G DKCA++G V F+SA GIHQLHIFIF LA+ HVLYCI
Sbjct  121   KLLQLAESYIP----RRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFALAVCHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             I  A G+ KMR+WK WE ETKT+EYQ+++DP+RFRFARDTSFGRRHLSFWS+S   LWIV
Sbjct  177   IIYALGKTKMRRWKKWEDETKTIEYQYSNDPDRFRFARDTSFGRRHLSFWSKSSITLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+TLRHGFI+AHLAP S+  FDF++YI+RSLEEDFK VVGISP IW
Sbjct  237   CFFRQFFGSVTKVDYLTLRHGFIVAHLAPGSETRFDFRKYIQRSLEEDFKEVVGISPVIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  SYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G+VVKG PVVQ
Sbjct  297   FIAVLFLLSNTNGLNSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKGDVVKGAPVVQ  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE TED++IR+  G+
Sbjct  357   PRDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESTEDVIIRLVTGV  416

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALK+WH+TARKQ +  RHS S TP 
Sbjct  417   IVQILCSYVTLPLYALVTQMGSTMKPTVFNERVAAALKNWHRTARKQTKHSRHSNSTTPF  476

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIED------NLPWFNQRRDNNVDQPA  1832
             SS P TP+          +    + S  ASP+R   D         + +     +V+ P 
Sbjct  477   SSWPTTPIGN--------FRNRRVASFPASPSRRSSDFEAETSTHHYSDSDERPDVELPP  528

Query  1833  EENRNELQREIEMESAEFSFE  1895
             E    + + EI +   +FSF+
Sbjct  529   EPESVQTRHEISINLTDFSFK  549



>ref|XP_011013684.1| PREDICTED: MLO-like protein 12 [Populus euphratica]
Length=478

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/510 (67%), Positives = 399/510 (78%), Gaps = 35/510 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             M      RSLEETPTWAVA VCFV+V ISI+IE++IHLIGK L KR K+ALYEALEKIK+
Sbjct  1     MVEAVKARSLEETPTWAVAVVCFVMVLISIIIEHIIHLIGKWLTKRRKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLT+GQ  I +IC+ KS+G +WHPC + E++                   
Sbjct  61    ELMLLGFMSLLLTIGQGPISEICVPKSVGATWHPCKKQEKDP------------------  102

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                  ++DE            GG+DKCAK+G V  +SADGI QLHIFIFVLA FHVL CI
Sbjct  103   -----SEDE-----------NGGSDKCAKKGKVSLVSADGITQLHIFIFVLAAFHVLCCI  146

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITL   R KMRKWK WE ET T  YQF+HDPERFRFAR+TSFGRRHL+FW+ SP LLWIV
Sbjct  147   ITLTLSRAKMRKWKKWEIETTTSNYQFSHDPERFRFARETSFGRRHLNFWTLSPILLWIV  206

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF+RSVPKVDY+TLRHGFI AHLAP+SQ+ FDFQ YIKRSLEEDFKVVVGISP IW
Sbjct  207   CFFRQFLRSVPKVDYLTLRHGFITAHLAPRSQIKFDFQTYIKRSLEEDFKVVVGISPTIW  266

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FA++FLLFNT+G  SYLWLPFIPL++IL V TKLQV+IT+MGLRIQ   +VV+GTPVVQ
Sbjct  267   FFAILFLLFNTYGWYSYLWLPFIPLIVILSVSTKLQVVITQMGLRIQGT-QVVQGTPVVQ  325

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFN PRL+LYLI+FVLFQNAFQ AF AW WYEFGLKSCFH+  EDL++RI+M  
Sbjct  326   PGDDLFWFNHPRLLLYLINFVLFQNAFQFAFLAWTWYEFGLKSCFHKYPEDLILRITMWA  385

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ  CSYVTLPLYALVTQMG+ M+PTIFNER+AKAL++WH TA++ ++Q RHSG+VTP 
Sbjct  386   IIQFFCSYVTLPLYALVTQMGTTMRPTIFNERLAKALRNWHHTAKQHVKQNRHSGTVTPA  445

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGAS  1760
             +S PGTP H  SP+H L  Y+ E   + AS
Sbjct  446   TSAPGTPSHTISPVHPLHDYRGESGGIQAS  475



>ref|XP_010934812.1| PREDICTED: MLO-like protein 2, partial [Elaeis guineensis]
Length=574

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/515 (66%), Positives = 399/515 (77%), Gaps = 10/515 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             M  G GGR+LEET TWA+A +C VLV ISI+IE+ IHL  K L+K + KAL EALEK+K+
Sbjct  1     MGAGEGGRNLEETSTWAIATICAVLVVISIIIEHGIHLSSKWLEKHHNKALREALEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I +IC+ KS+ +SWHPC +   +D        G    GRR  
Sbjct  61    ELMLLGFVSLLLTVGQGIITEICVPKSVADSWHPCKKEVHDDGGSKSHESGKSHAGRR--  118

Query  591   lllAFADDEYSGESHRRILAGG-GTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                    D  S  S RR+L+GG   DKCA E  VPFISADG+HQLHIFIFVLA+FH+LYC
Sbjct  119   ----LLHDSDSMASFRRVLSGGVEPDKCA-ENKVPFISADGLHQLHIFIFVLAVFHLLYC  173

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I T+A G LKMR+WK+WE ET+T EYQF+HDP+RFR ARDTSFG RHL+FWS+SP L WI
Sbjct  174   ITTMALGSLKMRRWKSWELETRTAEYQFSHDPDRFRLARDTSFGHRHLNFWSKSPILTWI  233

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFV SV KVDY+TLRHGFI+AHLAPQS   FDF+ YIKRSLEED K VVGISPP+
Sbjct  234   VCFFRQFVGSVQKVDYLTLRHGFIMAHLAPQSSSKFDFRNYIKRSLEEDMKAVVGISPPL  293

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W FAV+FLLFNTHG  SY W PFIPL+IILLVGTKLQVII KM  +I ERG+VVKG PVV
Sbjct  294   WSFAVLFLLFNTHGWHSYQWHPFIPLIIILLVGTKLQVIIIKMASQITERGDVVKGVPVV  353

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
              P DDLFWF  PR MLYLIHFVLFQNAFQLAFFAW+WYEFG  SCFH++ +D++IR SMG
Sbjct  354   HPTDDLFWFKCPRFMLYLIHFVLFQNAFQLAFFAWSWYEFGFPSCFHQRVDDIIIRFSMG  413

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             +LIQVLCSYVTLPLYALVTQMGSNM+PTIF++RVA AL+ WH TAR  L++    G  TP
Sbjct  414   VLIQVLCSYVTLPLYALVTQMGSNMRPTIFSDRVATALRKWHHTARNHLKENTQFGRTTP  473

Query  1668  LS-SRPGTPLHGTSPIHLLQYYKSEIDSVGASPAR  1769
             LS S P TP  G+S   LL++ + ++DS    P+R
Sbjct  474   LSTSTPNTPTSGSSRAKLLRHLQ-KLDSFQGMPSR  507



>ref|XP_011040971.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=581

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/542 (63%), Positives = 411/542 (76%), Gaps = 15/542 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA  G  +SLE+TPTWAVA VCFVLVAISIVIE++IH++ K L+K++K AL EALEK+KA
Sbjct  1     MASEGKAQSLEQTPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKTALVEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+ Q  I  ICI + +  +WHPC +++E++K               + 
Sbjct  61    ELMLMGFISLLLTILQGPISDICIPEDIAATWHPCSKNQEKEKVSESDDSDSSRRRLLQF  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L         SGESHRR+LA    DKCA++G V  +S+ GIHQLHIFIFVLA+ HVLYCI
Sbjct  121   LG--------SGESHRRVLA-SKYDKCAEKGKVALVSSYGIHQLHIFIFVLAVVHVLYCI  171

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT   GR KMRKWKAWE ETKTLEYQ+ +DPERFRFAR+TSFGRRHL  WS+S  LLWIV
Sbjct  172   ITYFLGRTKMRKWKAWEDETKTLEYQYHNDPERFRFARETSFGRRHLQLWSKSSILLWIV  231

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF+ SV KVDYMTLRHGFI+AHLAP S+  F+FQ+YI RSL+EDFKVVVGISP IW
Sbjct  232   CFFRQFLGSVTKVDYMTLRHGFIMAHLAPGSETRFNFQKYISRSLDEDFKVVVGISPIIW  291

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NTHG  S+ WLPFIPL+IILL+G KLQVIIT+MGLRIQERG+VVKG  VV 
Sbjct  292   FIAVLFLLTNTHGWNSHFWLPFIPLIIILLIGAKLQVIITQMGLRIQERGDVVKGALVVI  351

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLFQNAFQ+AFF W+ YEF + SC+H  TE +VIRI++G+
Sbjct  352   PGDDLFWFGRPRFLLFLIHLVLFQNAFQIAFFIWSVYEFTINSCYHAHTEAIVIRITLGV  411

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ++CSYVTLPLYALVTQMGS+M+PT+FN+RVA ALK+WH TA+KQ +  ++S S TP+
Sbjct  412   VIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTAKKQSKHGKNSESHTPM  471

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEI--DSVGASPARDIEDNLPWFNQRRDNNVDQPAEENR  1844
             SSRP TP HG SP+HLL  ++     DS   SP     DN    N + D   +   +   
Sbjct  472   SSRPQTPAHGMSPVHLLHNFRGSTAPDSFQNSPRHSYYDN----NDQWDPEANSVHDHEL  527

Query  1845  NE  1850
             NE
Sbjct  528   NE  529



>ref|XP_006417368.1| hypothetical protein EUTSA_v10007208mg [Eutrema salsugineum]
 gb|ESQ35721.1| hypothetical protein EUTSA_v10007208mg [Eutrema salsugineum]
Length=573

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/558 (62%), Positives = 417/558 (75%), Gaps = 10/558 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LE+T TWAVA VCFVL+ ISIV+E+ IH IG   ++++KKALYEALEK+KA
Sbjct  1     MADPVKERTLEQTSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKQKHKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+ Q+ I  ICIS+S+ +S HPC   EE  KYG        D+G +  
Sbjct  61    ELMLLGFISLLLTIAQTPISNICISESVASSMHPCSAEEEAKKYGKKDTGKKDDDGEKSG  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
               L     E      RR LA  G DKCA +G V F+SA GIHQLHIFIFVLA+ HV+YCI
Sbjct  121   RRLLLELAE--SYIPRRSLATKGYDKCADKGKVAFVSAYGIHQLHIFIFVLAVVHVIYCI  178

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T A G+ KMR+WK WE+ETKT+EYQ+++DPERFRFARDTSFGRRHLSFWS++   LWIV
Sbjct  179   VTYALGKTKMRRWKQWENETKTIEYQYSNDPERFRFARDTSFGRRHLSFWSKTSITLWIV  238

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+ LRHGFI AHLAP S+ +FDF++YI+RSLEEDFK VV ISP IW
Sbjct  239   CFFRQFFGSVTKVDYLALRHGFITAHLAPGSERSFDFRKYIQRSLEEDFKTVVEISPVIW  298

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G RSYLWLPFIPL++IL+VGTKLQVIITK+GLRIQE+G+VV+G PVVQ
Sbjct  299   FVAVLFLLTNTNGLRSYLWLPFIPLIVILIVGTKLQVIITKLGLRIQEKGDVVRGAPVVQ  358

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE   D+VIRI +G 
Sbjct  359   PGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVVIRIVVGA  418

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMG+ MKPT+F ERVA ALK+WH+TA+KQ +  RHS S TP 
Sbjct  419   VVQILCSYVTLPLYALVTQMGTTMKPTVFKERVATALKNWHRTAKKQTKHGRHSESTTPY  478

Query  1671  SSRPGTPLHGTSPIHLL-QYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRN  1847
             SSRP TP HG+SPIHLL  + K  ++S   SP+       P ++   D +     E  R 
Sbjct  479   SSRPTTPTHGSSPIHLLHNFNKRSVESFPNSPS-------PRYSDHHDGHQFWDPESQRQ  531

Query  1848  ELQREIEMESAEFSFENK  1901
             E +       ++ S E K
Sbjct  532   EAETSTHHSLSQESSEKK  549



>ref|XP_011044384.1| PREDICTED: MLO-like protein 6 isoform X1 [Populus euphratica]
Length=560

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/566 (63%), Positives = 429/566 (76%), Gaps = 55/566 (10%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV++SI+IE++IHLI K L K+ K+ALYEALEKIK+
Sbjct  1     MAGGSAGRSLEQTPTWAVAVVCFVLVSVSIIIEFIIHLIAKWLTKKRKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQSTI  ICISK  G +WHPC++ EE    G +T + D +  R+  
Sbjct  61    ELMLLGFISLLLTVGQSTISNICISKKAGATWHPCNKKEEAKLNGENTKETDNENSRKLL  120

Query  591   lllAFADDEYSGESHRRILAGG-GTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
              + A       GES RR+LA G  TDKCA                               
Sbjct  121   SISA-------GESLRRVLAAGDSTDKCAA------------------------------  143

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
                      KM+ WK WE ET+T EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WI
Sbjct  144   ---------KMKSWKRWEKETRTAEYQFSHDPERFRFARETSFGRRHLSFWTKTPVLIWI  194

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPI
Sbjct  195   VCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSHAKFDFQKYINRSLEEDFKVVVGISPPI  254

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W FAV+FLLFNTHG  SY+WLPFIPL+II+LVGTKLQVIITKMGLRIQERGEV+KG PVV
Sbjct  255   WFFAVVFLLFNTHGWYSYIWLPFIPLIIIVLVGTKLQVIITKMGLRIQERGEVLKGVPVV  314

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             QP DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW+WYEFG+KSCFHE  ED+VIR+SMG
Sbjct  315   QPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFGIKSCFHEHLEDIVIRVSMG  374

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             +LI++LCSYVTLPLYALVTQMG++MKPTIFNERVA AL++WH TA+KQ+++ + S SVTP
Sbjct  375   VLIEILCSYVTLPLYALVTQMGTSMKPTIFNERVATALRNWHHTAKKQIKRNKGSVSVTP  434

Query  1668  LSSRPGTPLHGTSPIHLLQYYK-SEIDSVGASPARDIEDNLPWFNQ-----RRDNNVDQP  1829
             +SSRP TP   TSP+HLL+YY+  EIDS+  SP R   D   W  +        N   + 
Sbjct  435   MSSRPTTPSRHTSPVHLLRYYRGGEIDSLHTSPRRSNFDVEHWETESPSPSHHPNYAGEG  494

Query  1830  AEENRNELQREIEMESAEFSFENKRE  1907
             +  +R+  Q+++E+ SA    E++++
Sbjct  495   SSTHRH--QQQLELASAAGYVEDEKD  518



>ref|XP_010430162.1| PREDICTED: MLO-like protein 6 isoform X1 [Camelina sativa]
Length=633

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/561 (60%), Positives = 406/561 (72%), Gaps = 26/561 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++LEET TWAVA VCFVL+ ISIVIE +IH IG   + +NKKALYEALEK+KAELML+GF
Sbjct  44    KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  103

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ  I  ICI K++  S HPC                        +      D
Sbjct  104   ISLLLTIGQGYISNICIPKNIAASMHPCS---------ASEEARKYGNKDVPKEEDGDND  154

Query  612   DEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             DE S             RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+Y
Sbjct  155   DENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIY  214

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHLSFWSR+   LW
Sbjct  215   CIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLSFWSRTTITLW  274

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P 
Sbjct  275   IVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPV  334

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G  SYLWLPFIP V+IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+
Sbjct  335   IWFVAVLFLLTNTNGLNSYLWLPFIPFVVILVVGTKLQVIITKLGLRIQEKGDVVKGTPL  394

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP D  FWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFHE + D++IRIS+
Sbjct  395   VQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFKLKNCFHESSVDVIIRISI  454

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             GL++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  R S S T
Sbjct  455   GLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKQMKHGRSSESTT  514

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLP-WFNQRRDNNVDQPAEEN  1841
             P SSRP TP HG+SPIHLL+       +V    +R  +D      + RR+++ D    E+
Sbjct  515   PFSSRPTTPTHGSSPIHLLR-------NVPHKRSRSFDDGFANSMSPRRNSDFDSWDPES  567

Query  1842  RNELQREIEMESAEFSFENKR  1904
             ++      E  +   S    R
Sbjct  568   QSPHHETAEASTNSVSNHRSR  588



>ref|XP_010473362.1| PREDICTED: MLO-like protein 6 isoform X1 [Camelina sativa]
Length=596

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/561 (60%), Positives = 408/561 (73%), Gaps = 26/561 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++LEET TWAVA VCFVL+ ISIVIE +IH IG   + +NKKALYEALEK+KAELML+GF
Sbjct  9     KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ  I  ICI K++  S HPC                   +    ++     D
Sbjct  69    ISLLLTIGQGYISNICIPKNIAASMHPCS---------PSEEARKYGKKDVPKVEDGEND  119

Query  612   DEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             DE S             RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+Y
Sbjct  120   DENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIY  179

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWSR+   LW
Sbjct  180   CIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWSRTTITLW  239

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P 
Sbjct  240   IVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPV  299

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G  SYLWLPFIP V+IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+
Sbjct  300   IWFVAVLFLLTNTNGLNSYLWLPFIPFVVILVVGTKLQVIITKLGLRIQEKGDVVKGTPL  359

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP D  FWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFHE + D++IRIS+
Sbjct  360   VQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFKLKNCFHESSVDVIIRISI  419

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             GL++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  R S S T
Sbjct  420   GLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKQMKHGRSSESTT  479

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLP-WFNQRRDNNVDQPAEEN  1841
             P SSRP TP HG+SPIHLL+       +V    +R  +D      + RR+++ D    E+
Sbjct  480   PFSSRPTTPTHGSSPIHLLR-------NVPHKRSRSFDDGFANSMSPRRNSDFDSWDPES  532

Query  1842  RNELQREIEMESAEFSFENKR  1904
             ++      E  +   S    R
Sbjct  533   QSPHHETAEASTNSVSNHRSR  553



>ref|XP_007009792.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY18602.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=574

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/550 (63%), Positives = 407/550 (74%), Gaps = 20/550 (4%)
 Frame = +3

Query  240   GGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELM  419
                 RSLE TPTWAVA VCFVLV ISI+IE+ IH++GK L+K++K ALYEALEK+KAELM
Sbjct  5     SNKARSLEYTPTWAVAVVCFVLVVISIIIEHAIHMVGKWLKKKHKPALYEALEKVKAELM  64

Query  420   LLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlll  599
             L+GFISLLLTV Q TI   CI +S+ N+WHPC +  E  K      +  G +      + 
Sbjct  65    LMGFISLLLTVAQGTISGFCIPESIANTWHPCGKKAETKKDSEKDSESTGRKLLEFSDVS  124

Query  600   AFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITL  779
               A         RR LA    D C  EG V F+S  GIHQLHIFIFVLA+ H+LYCIIT 
Sbjct  125   TVA---------RRSLASK-EDTCP-EGKVAFVSTYGIHQLHIFIFVLAISHILYCIITY  173

Query  780   AFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFF  959
             A GR KMRKWKAWE ET+T+EYQ+ +DPERFRFARDTSFGRRH++FWSRS   LWIVCFF
Sbjct  174   ALGRTKMRKWKAWEKETRTVEYQYYNDPERFRFARDTSFGRRHMNFWSRSTLSLWIVCFF  233

Query  960   RQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFA  1139
             RQF  SV KVDY+TLRHGFI AHLAP ++  FDFQ+YIKRSLEEDFKVVVGISP IW  A
Sbjct  234   RQFFGSVTKVDYLTLRHGFITAHLAPGNETKFDFQKYIKRSLEEDFKVVVGISPIIWFIA  293

Query  1140  VIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPAD  1319
             V+FLL  THG  SYLWLPF+PLVIIL+VGTKLQVIITK+GLRIQ+RG+VVKG PVVQP D
Sbjct  294   VLFLLAYTHGWYSYLWLPFLPLVIILMVGTKLQVIITKLGLRIQDRGDVVKGAPVVQPGD  353

Query  1320  DLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQ  1499
             DLFWF RPR +L+LIH VLF NAFQLAFF W+ YEF +KSC+HE  ED++IR+SMG++IQ
Sbjct  354   DLFWFGRPRFLLFLIHLVLFTNAFQLAFFVWSTYEFTIKSCYHEHLEDIIIRVSMGVIIQ  413

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSR  1679
              LCSYVTLPLYALVTQMG+NM+PTIFN+RVA ALKSWH TA+K  +  RHS + TP SSR
Sbjct  414   FLCSYVTLPLYALVTQMGTNMRPTIFNDRVAAALKSWHHTAKKHTKHSRHSENTTPFSSR  473

Query  1680  PGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNEL--  1853
             P TP HG SP+HLL  +   ++S   SP     +N  W       ++D P     N+   
Sbjct  474   PATPTHGMSPVHLLHNHPRSVESYHTSPRNSNLENDQW-------DLDSPRRRAINDSVH  526

Query  1854  QREIEMESAE  1883
              R++EM   +
Sbjct  527   DRQLEMREVD  536



>ref|XP_010418123.1| PREDICTED: MLO-like protein 6 [Camelina sativa]
Length=597

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/561 (60%), Positives = 408/561 (73%), Gaps = 26/561 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++LEET TWAVA VCFVL+ ISIVIE +IH IG   + +NKKALYEALEK+KAELML+GF
Sbjct  9     KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ  I  ICI K++  S HPC                   +    ++     D
Sbjct  69    ISLLLTIGQGYISNICIPKNIAASMHPCS---------PSEEARKYGKKDVPKVEDGEND  119

Query  612   DEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             DE S             RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+Y
Sbjct  120   DENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIY  179

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWSR+   LW
Sbjct  180   CIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWSRTTITLW  239

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P 
Sbjct  240   IVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPV  299

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G  SYLWLPFIP V+IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+
Sbjct  300   IWFVAVLFLLTNTNGLNSYLWLPFIPFVVILVVGTKLQVIITKLGLRIQEKGDVVKGTPL  359

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP D  FWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFHE + D++IRIS+
Sbjct  360   VQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFKLKNCFHESSVDVIIRISI  419

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             GL++Q+LCSYVTLPLYALVTQMGS MKPT+FNER+A ALKSWH TA+KQ++  R S S T
Sbjct  420   GLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERIATALKSWHHTAKKQMKHGRSSESTT  479

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLP-WFNQRRDNNVDQPAEEN  1841
             P SSRP TP HG+SPIHLL+       +V    +R  +D      + RR+++ D    E+
Sbjct  480   PFSSRPTTPTHGSSPIHLLR-------NVPHKRSRSFDDGFANSMSPRRNSDFDSWDPES  532

Query  1842  RNELQREIEMESAEFSFENKR  1904
             ++      E  +   S    R
Sbjct  533   QSPHHETAEASTNSVSNHRSR  553



>ref|XP_007015437.1| Seven transmembrane MLO family protein isoform 2 [Theobroma cacao]
 gb|EOY33056.1| Seven transmembrane MLO family protein isoform 2 [Theobroma cacao]
Length=519

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/528 (65%), Positives = 395/528 (75%), Gaps = 39/528 (7%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVGQ  I  ICIS+ +G++WHPC++ +EE            +  R   + 
Sbjct  1     MLLGFISLLLTVGQGVISDICISEKVGSTWHPCNKKQEEKTNEDVEDTDYENRRRLLTVS  60

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
                     SG   RR LAG   DKCA +G VPF+S+DGIHQLHIFIFVLA+FHVLYCI+T
Sbjct  61    D-------SGGVFRRSLAGASEDKCAAKGKVPFVSSDGIHQLHIFIFVLAVFHVLYCILT  113

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
             +A GR KMR WK WE ET+T+EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WIVCF
Sbjct  114   MALGRAKMRSWKRWEKETRTIEYQFSHDPERFRFARETSFGRRHLSFWTKNPVLMWIVCF  173

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGI-SPPIWL  1133
             FRQFVRSVPKVDY+TLRHGFI+AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGI SPPIW 
Sbjct  174   FRQFVRSVPKVDYLTLRHGFIMAHLAPQSQTQFDFQKYINRSLEEDFKVVVGISSPPIWF  233

Query  1134  FAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQP  1313
              AV+FLL NTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRIQERGEVVKG PVVQP
Sbjct  234   LAVLFLLLNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEVVKGVPVVQP  293

Query  1314  ADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLL  1493
              DDLFWFNRPRL+L+LI+FVLFQNAFQLAFFAW W+EFGLKSCFHE  ED+VIRISMG+L
Sbjct  294   GDDLFWFNRPRLVLFLINFVLFQNAFQLAFFAWTWFEFGLKSCFHEHVEDVVIRISMGVL  353

Query  1494  IQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLS  1673
             +Q+LCSYVTLPLYALVTQMGSNMKPTIFNERVA AL+ WH TA+K ++Q + SG  TP S
Sbjct  354   VQILCSYVTLPLYALVTQMGSNMKPTIFNERVATALRKWHHTAKKHIKQNKGSG--TPFS  411

Query  1674  SRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW--------------------  1793
             SRP TP H TSP+HLL+ Y+SE+DS+ ASP R   D   W                    
Sbjct  412   SRPNTPSHHTSPVHLLRNYRSEMDSLHASPRRSNFDIEHWDTDSPSPSHPNYGDGSSSHH  471

Query  1794  ---------FNQRRDNNVDQPAEENRNELQREIEMESAEFSFENKREI  1910
                       +  RD   +  + E     Q EI +   EFSF+ +  +
Sbjct  472   HNFMAEQVQLDYDRDVVNEPSSSEQHERTQHEINIGPKEFSFDRRTSV  519



>ref|XP_011004622.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=478

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/510 (66%), Positives = 397/510 (78%), Gaps = 35/510 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             M      RSLEETPTWAVA VCFV+V ISI+IE++IHLIGK L KR K+ALYEALEKIK+
Sbjct  1     MVEAVKARSLEETPTWAVAVVCFVMVLISIIIEHIIHLIGKWLTKRRKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLT+GQ  I +IC+ KS+G +WHPC + E++                   
Sbjct  61    ELMLLGFMSLLLTIGQGLISEICVPKSVGATWHPCKKQEKDP------------------  102

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                  ++DE            GG+D CAK+G V  +SADGI QLHIFIFVLA FHVL CI
Sbjct  103   -----SEDE-----------NGGSDMCAKKGKVSLVSADGITQLHIFIFVLAAFHVLCCI  146

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITL   R KMRKWK WE ET T  YQF+HDPERFRFAR+TSFGRRHL+FW+ SP LLWIV
Sbjct  147   ITLTLSRAKMRKWKKWEIETTTSNYQFSHDPERFRFARETSFGRRHLNFWTLSPILLWIV  206

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF+RSVPKVDY+TLRHGFI A LAP+SQ+ FDFQ YIKRSLEEDFKVVVGISP IW
Sbjct  207   CFFRQFLRSVPKVDYLTLRHGFITARLAPRSQIKFDFQTYIKRSLEEDFKVVVGISPTIW  266

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FA++FLLFNT+G  SYLWLPFIPL++IL V TKLQV+IT+MGLRIQ   +VV+GTPVVQ
Sbjct  267   FFAILFLLFNTYGWYSYLWLPFIPLIVILSVSTKLQVVITQMGLRIQGT-QVVQGTPVVQ  325

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFN PRL+LYLI+FVLFQNAFQ AF AW WYEFGLKSCFH+  EDL++RI+M  
Sbjct  326   PGDDLFWFNHPRLLLYLINFVLFQNAFQFAFLAWTWYEFGLKSCFHKYPEDLILRITMWA  385

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ  CSYVTLPLYALVTQMG+ M+PTIFNER+AKAL++WH TA++ ++Q RHSG+VTP 
Sbjct  386   IIQFFCSYVTLPLYALVTQMGTTMRPTIFNERLAKALRNWHHTAKQHVKQNRHSGTVTPA  445

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGAS  1760
             +S PGTP H  SP+H L  Y+ E   + AS
Sbjct  446   TSAPGTPSHTISPVHPLHDYRGESGGIQAS  475



>ref|XP_006307103.1| hypothetical protein CARUB_v10008691mg [Capsella rubella]
 gb|EOA40001.1| hypothetical protein CARUB_v10008691mg [Capsella rubella]
Length=578

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/523 (63%), Positives = 401/523 (77%), Gaps = 20/523 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E+ IH IG   +K++KKAL+EALEK+KA
Sbjct  1     MANQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFRKKHKKALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICIS+ + ++ HPC                   +    +
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISEQVASTMHPCS---------AAEEARKYHKKDPAK  111

Query  591   lllAFADDEYSG--------ESH--RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFV  740
                   D E SG        ES+  RR LA  G DKCA++G V F+SA GIHQLHIFIFV
Sbjct  112   KEHGDGDGEKSGRRLLLELAESYIPRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFV  171

Query  741   LALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFW  920
             LA+ HV+YCI+T A G+ KMR+WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHL+FW
Sbjct  172   LAVVHVIYCIVTYALGKTKMRRWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNFW  231

Query  921   SRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFK  1100
             S+S   LW+VCFFRQF  SV KVDY+ LRHGFI+AHLA  S+  FDF++YI+RSLEEDFK
Sbjct  232   SKSSVTLWVVCFFRQFFGSVTKVDYLALRHGFIMAHLAHGSESRFDFRKYIQRSLEEDFK  291

Query  1101  VVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERG  1280
              VV ISP IW  AV+FLL NT+G RSYLWLPFIPL++IL+VGTKLQVIITK+GLRIQE+G
Sbjct  292   TVVEISPVIWFVAVLFLLTNTNGLRSYLWLPFIPLIVILIVGTKLQVIITKLGLRIQEKG  351

Query  1281  EVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTE  1460
             +VV+G PVVQP DDLFWF +PR +L+LIH VLF NAFQLAFFAW+ YEF L++CFHE   
Sbjct  352   DVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLRNCFHESNA  411

Query  1461  DLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ  1640
             D+VIRI++G+++Q+LCSYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+ Q + 
Sbjct  412   DVVIRIAVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKSQTKH  471

Query  1641  KRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPA  1766
              RHS S TP SSRP TP HG+SPIHLL  + +  +DS   SP+
Sbjct  472   GRHSESNTPFSSRPTTPTHGSSPIHLLHNFNNRNVDSYPTSPS  514



>ref|XP_011031756.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
 ref|XP_011031757.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=577

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/529 (64%), Positives = 404/529 (76%), Gaps = 17/529 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             M+      SLEETPTWAVA VCFVLVAISIVIE++IH++ K L+K++K AL EALEK+KA
Sbjct  1     MSSTNKAVSLEETPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKIALVEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISL LT+ Q  I  ICI KS+  +WHPCD ++E+ K    +   D        
Sbjct  61    ELMLMGFISLFLTILQGPISDICIPKSVAATWHPCDGNQEKAKAEKSSDSKDNRRRLL--  118

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                 F D   SGESHRR LA    D C  EG V  +S+ GIHQLHIFIF+LA+ HVLYCI
Sbjct  119   ---QFLD---SGESHRRFLASK-YDTCG-EGKVALVSSYGIHQLHIFIFILAIVHVLYCI  170

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT   GR KMRKWK WE ETKTLEYQ+ +DPERFRFARDTSFGRRH+  WS+SP LLWIV
Sbjct  171   ITYFLGRTKMRKWKTWEDETKTLEYQYHNDPERFRFARDTSFGRRHMQLWSKSPVLLWIV  230

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF+ SV KVDYMTLRHGFI AHLAP S+  FDFQ+YI RSL+EDFKVVVGISP IW
Sbjct  231   CFFRQFLGSVTKVDYMTLRHGFITAHLAPGSEARFDFQKYISRSLDEDFKVVVGISPIIW  290

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+ LL +THG  S+LWLPFIPLV+IL +GTKLQVIIT+MGLRIQERGEVV+G PVVQ
Sbjct  291   FIAVLLLLTDTHGWNSHLWLPFIPLVVILSIGTKLQVIITQMGLRIQERGEVVRGAPVVQ  350

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLFQNAFQ+AFF W+ YEF +KSC+H  TE +VIRI++G+
Sbjct  351   PGDDLFWFGRPRFVLFLIHLVLFQNAFQIAFFIWSVYEFSIKSCYHAHTEAIVIRITLGV  410

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ++CSYVTLPLYALVTQMGS+M+PT+FN+RVA ALK+WH TA+KQ +  ++S S TP+
Sbjct  411   IIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTAKKQSKHGKNSESHTPM  470

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNN  1817
              SRP T  HG SP+HLL  ++S       S A +   N P F+   +N+
Sbjct  471   LSRPQTRSHGMSPVHLLSNHRS-------STAPNSFPNSPRFSNHNNND  512



>ref|NP_565902.1| protein MILDEW RESISTANCE LOCUS O 12 [Arabidopsis thaliana]
 sp|O80961.2|MLO12_ARATH RecName: Full=MLO-like protein 12; Short=AtMlo12; Short=AtMlo18 
[Arabidopsis thaliana]
 gb|AAK53805.1|AF369573_1 membrane protein Mlo12 [Arabidopsis thaliana]
 gb|AAC28997.2| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AEC09645.1| MLO-like protein [Arabidopsis thaliana]
Length=576

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/509 (66%), Positives = 399/509 (78%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFVL+ ISI+IEY +H IG   +K++KKAL EALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALSEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q+ + +ICI +++  +WHPC  H+E  KYG D  D               ++
Sbjct  66    ISLLLVVLQTPVSEICIPRNIAATWHPCSNHQEIAKYGKDYIDDGRKILEDFD-----SN  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FHVLYCIIT A G+
Sbjct  121   DFYSP---RRNLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSTFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLE+DF VVVGISP IW  AV+F+
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIERSLEQDFTVVVGISPLIWCIAVLFI  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPF+PL++IL+VG KLQ+II+K+GLRIQE+G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWDSYLWLPFLPLIVILIVGAKLQMIISKLGLRIQEKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI+MG+LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPHSSRPTTP  476

Query  1692  LHGTSPIHLLQYYKS----EIDSVGASPA  1766
              HG SP+HLL  Y +    +  S  ASP+
Sbjct  477   THGMSPVHLLHNYNNRSLDQQTSFTASPS  505



>emb|CDY47582.1| BnaA01g22680D [Brassica napus]
Length=556

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/543 (60%), Positives = 404/543 (74%), Gaps = 26/543 (5%)
 Frame = +3

Query  222   SEKMAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEK  401
             ++K+A     R+L++T TWAVA VCF L+ ISIVIE +IH +G   +++NKKALYEALEK
Sbjct  6     ADKVAEKVAERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGNWFKRKNKKALYEALEK  65

Query  402   IKAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegr  581
             +KAELML+GFISLLLT+GQ+ I +IC+S+S+  S  PC R          + +       
Sbjct  66    VKAELMLMGFISLLLTIGQNYISQICVSESVAASMRPCSR----------SEEEKKYPNT  115

Query  582   rrrlllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFI  734
             ++       D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFI
Sbjct  116   KKDTGKDLGDEENSGRKLLELVESFIPRRSLATKGYDKCAEKGQVAFVSSYGMHQLHIFI  175

Query  735   FVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLS  914
             FVLA+ HV+YCI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+
Sbjct  176   FVLAVCHVIYCILTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLN  235

Query  915   FWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEED  1094
             FWS+S   LWI CFFRQF  SV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEED
Sbjct  236   FWSKSTITLWIACFFRQFFGSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEED  295

Query  1095  FKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQE  1274
             FK +V ISP IW  AV+FLL NT+G  SY+W PFIPLV+IL+VGTKLQVIITK+GL IQE
Sbjct  296   FKTIVEISPVIWFVAVLFLLTNTNGLNSYVWQPFIPLVVILIVGTKLQVIITKLGLLIQE  355

Query  1275  RGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEK  1454
             +G++VKG P+VQP D LFWF RPR +L+L+H VLF NAFQLAFFAW  YEF LK+CFH+ 
Sbjct  356   KGDIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWTTYEFKLKNCFHKN  415

Query  1455  TEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQL  1634
             T D+VIRIS+G+++QVLCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ+
Sbjct  416   TVDVVIRISVGVIVQVLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAKKQM  475

Query  1635  RQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDN  1814
             +  R S S TP SSRP TP HG+SPIHLL        S   S A  +       + RR++
Sbjct  476   KHGRTSESTTPFSSRPATPTHGSSPIHLLHNVHKRSRSADESFANSM-------SPRRNS  528

Query  1815  NVD  1823
             + D
Sbjct  529   DFD  531



>ref|XP_009133342.1| PREDICTED: MLO-like protein 12 isoform X1 [Brassica rapa]
Length=602

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/509 (66%), Positives = 399/509 (78%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFVL+ ISI+IEY +H IG   +K++KKALYEALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALYEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q+ + +ICI + +  +WHPC  H+E  KYG D  D               ++
Sbjct  66    ISLLLVVLQTPVSQICIPEKIAATWHPCSSHQESTKYGKDYIDDGRKILEDYD-----SN  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FH+LYCIIT A G+
Sbjct  121   DFYSP---RRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHILYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWI CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNVWSKSSSTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDFKVVVGISP IW  AV+F+
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSGARFDFQKYIQRSLEEDFKVVVGISPVIWCIAVLFI  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY WLPF+PLV+IL+VG KLQVII+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWGSYFWLPFLPLVVILIVGAKLQVIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI+MG+LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN++VA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDKVANALKKWHHTAKKQTKHG-HSGSNTPHSSRPTTP  476

Query  1692  LHGTSPIHLLQYYKS----EIDSVGASPA  1766
              HG SP+HLL  Y++    +  S  ASP+
Sbjct  477   THGMSPVHLLHNYRNRSLDQQTSFTASPS  505



>ref|XP_004515994.1| PREDICTED: MLO-like protein 2-like [Cicer arietinum]
Length=559

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/567 (60%), Positives = 423/567 (75%), Gaps = 23/567 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEETPTWAVA VCFVL+AISI+IE++IH+IGK L+K++K  LYEALEK+KA
Sbjct  1     MAAQVYERTLEETPTWAVAVVCFVLLAISILIEHIIHVIGKWLKKKHKNGLYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q  I KICIS+ +GN+WHPC    ++ K    + + + D  +   
Sbjct  61    ELMLLGFISLLLTVFQDPISKICISQKVGNTWHPCSNPNKKSKSNETSENENNDRRKLL-  119

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                     EY     RRILA  G DKC  +G V  +SA GIH+LH+FIFVLA+FH+L CI
Sbjct  120   --------EYFDPIPRRILATKGYDKCVDKGKVALVSAYGIHELHVFIFVLAIFHILQCI  171

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITLA GR+KMR+WK WE ET+++EYQF +DPERFRFARDT+FGRRHLS WS+S   LWIV
Sbjct  172   ITLALGRIKMRRWKKWEDETRSVEYQFYNDPERFRFARDTTFGRRHLSMWSQSTISLWIV  231

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQF  S+ KVDY+ LRHGF++AHLAP +   FDFQ+YI RSLE+DFKVVVGISP IW
Sbjct  232   SFFRQFFGSINKVDYLALRHGFVMAHLAPGNDAQFDFQKYISRSLEKDFKVVVGISPTIW  291

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  S+ WLPFIPL+IILLVG KLQ+IITKMGLRIQ+ GE++KG P+V+
Sbjct  292   FFAVLFLLTNTHGWYSHYWLPFIPLIIILLVGVKLQMIITKMGLRIQDSGEIIKGAPLVE  351

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRP L+L+LIH VLFQNAFQLAFF+W+ YEF + SCFH+ T +++IR+++G+
Sbjct  352   PGDHLFWFNRPDLLLFLIHLVLFQNAFQLAFFSWSTYEFSVNSCFHKTTAEIIIRLTLGV  411

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ+LCSY TLPLYALVTQMGS MKPTIF+ERVA ALKSWH TA+K +++ +HS + TP 
Sbjct  412   VIQILCSYSTLPLYALVTQMGSTMKPTIFHERVATALKSWHNTAKKHVKESKHSNNTTPF  471

Query  1671  SSRPGTPLHGTSPIHLLQYYK-SEIDSVGASPARDIE------DNLPWFNQRRDNNVDQP  1829
             SSRP TP HG SP+HLL  +  S  DS+  S   + +       N P  N    + +  P
Sbjct  472   SSRPSTPTHGMSPVHLLHRHTVSSSDSLQTSNYENQQWDNVEGSNSPTINHTEAHEIRIP  531

Query  1830  AE---ENRNELQREIEMESAEFSFENK  1901
              E    NR+    EI + S +FSFE +
Sbjct  532   TELPVSNRH----EISISSKDFSFEKR  554



>ref|XP_009104728.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=595

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/543 (60%), Positives = 404/543 (74%), Gaps = 26/543 (5%)
 Frame = +3

Query  222   SEKMAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEK  401
             ++K+A     R+L++T TWAVA VCF L+ ISIVIE +IH +G   +++NKKALYEALEK
Sbjct  6     ADKVAEKVAERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGNWFKRKNKKALYEALEK  65

Query  402   IKAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegr  581
             +KAELML+GFISLLLT+GQ+ I +IC+S+S+  S  PC R          + +       
Sbjct  66    VKAELMLMGFISLLLTIGQNYISQICVSESVAASMRPCSR----------SEEEKKYPNT  115

Query  582   rrrlllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFI  734
             ++       D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFI
Sbjct  116   KKDTGKDLGDEENSGRKLLELVESFIPRRSLATKGYDKCAEKGQVAFVSSYGMHQLHIFI  175

Query  735   FVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLS  914
             FVLA+ HV+YCI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+
Sbjct  176   FVLAVCHVIYCILTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLN  235

Query  915   FWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEED  1094
             FWS+S   LWI CFFRQF  SV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEED
Sbjct  236   FWSKSTITLWIACFFRQFFGSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEED  295

Query  1095  FKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQE  1274
             FK +V ISP IW  AV+FLL NT+G  SY+W PFIPLV+IL+VGTKLQVIITK+GL IQE
Sbjct  296   FKTIVEISPVIWFVAVLFLLTNTNGLNSYVWQPFIPLVVILIVGTKLQVIITKLGLLIQE  355

Query  1275  RGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEK  1454
             +G++VKG P+VQP D LFWF RPR +L+L+H VLF NAFQLAFFAW  YEF LK+CFH+ 
Sbjct  356   KGDIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWTTYEFKLKNCFHKN  415

Query  1455  TEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQL  1634
             T D+VIRIS+G+++QVLCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ+
Sbjct  416   TVDVVIRISVGVIVQVLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAKKQM  475

Query  1635  RQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDN  1814
             +  R S S TP SSRP TP HG+SPIHLL        S   S A  +       + RR++
Sbjct  476   KHGRTSESTTPFSSRPATPTHGSSPIHLLHNVHKRSRSADESFANSM-------SPRRNS  528

Query  1815  NVD  1823
             + D
Sbjct  529   DFD  531



>ref|XP_006411145.1| hypothetical protein EUTSA_v10016436mg [Eutrema salsugineum]
 gb|ESQ52598.1| hypothetical protein EUTSA_v10016436mg [Eutrema salsugineum]
Length=576

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 401/509 (79%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFVL+ ISI+IEY +H IG   +K++KKALYEALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALYEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q+ + +ICI K +  +WHPC R +E DKYG D  D               ++
Sbjct  66    ISLLLVVLQTPVSEICIPKRVAATWHPCSRQQEIDKYGKDYIDDGRKILEDYD-----SN  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FH+LYCIIT A G+
Sbjct  121   DFYSP---RRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHILYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRH++ W++S F LW+ CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHMNVWTKSSFTLWLTCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI AHL   S   FDFQ+YI+RSLEEDFKVVVGISP IW  AV+FL
Sbjct  238   GSVTKVDYLTLRHGFITAHLPAGSAARFDFQKYIQRSLEEDFKVVVGISPVIWCIAVLFL  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPF+PL++IL+VG KLQ+II+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWDSYLWLPFLPLLVILIVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF L++CFH KTED+ IRI+MGLLIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHKTEDIAIRITMGLLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +  + SGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVASALKKWHHTAKKQTKHGQ-SGSNTPHSSRPATP  476

Query  1692  LHGTSPIHLLQ-YYKSEID---SVGASPA  1766
              HG SP+HLL  Y+   +D   S  ASP+
Sbjct  477   THGMSPVHLLHNYHNRGMDHQTSFTASPS  505



>ref|XP_002881634.1| hypothetical protein ARALYDRAFT_903160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57893.1| hypothetical protein ARALYDRAFT_903160 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/509 (66%), Positives = 398/509 (78%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFVL+ ISI+IEY +H +G   +K++KKAL EALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKHKKALSEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q+ + +ICI +++  +WHPC  H+E  KYG D  D               + 
Sbjct  66    ISLLLVVLQTPVSQICIPRNIAATWHPCSNHQEIAKYGKDYIDDGRKILEDFD-----SK  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FHVLYCIIT A G+
Sbjct  121   DFYSP---RRNLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSTFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLE+DF VVVGISP IW  AV+F+
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIERSLEQDFTVVVGISPLIWCIAVLFI  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPFIPL++IL+VG KLQ+II+K+GLRIQE+G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWDSYLWLPFIPLIVILIVGAKLQMIISKLGLRIQEKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI+MG+LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPHSSRPTTP  476

Query  1692  LHGTSPIHLLQYYKS----EIDSVGASPA  1766
              HG SP+HLL  Y +    +  S  ASP+
Sbjct  477   THGMSPVHLLHNYNNRSLDQQTSFTASPS  505



>ref|XP_002533246.1| Protein MLO, putative [Ricinus communis]
 gb|EEF29131.1| Protein MLO, putative [Ricinus communis]
Length=583

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/535 (63%), Positives = 411/535 (77%), Gaps = 9/535 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VC V++ IS++IE+ IH+I K  +K +K AL EALEKIKAELML+GF
Sbjct  9     RSLEETPTWAVAIVCLVMIVISVLIEHAIHMIEKWFKKIHKPALAEALEKIKAELMLMGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT  Q  I +ICIS+S+ ++WHPC++ +EE K   +  +   +  R  R L     
Sbjct  69    ISLLLTALQGPISEICISESVASTWHPCNKQQEETKAAAEEINASKNRRRLLRFL-----  123

Query  612   DEYSGESHRRILAG-GGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
             D  +GES RR LA   G D C   G VPF+SA GI QLH FIFVLA+ H+LYCIIT   G
Sbjct  124   DGSAGESTRRFLAAKSGADNCPS-GKVPFVSAYGIDQLHYFIFVLAVVHILYCIITYILG  182

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
              +KMRKWKAWE ETKT+EYQ+ +DPERFRFARDTSFGRRH++ WSRSP  +WIVCFFRQF
Sbjct  183   SIKMRKWKAWEDETKTIEYQYHNDPERFRFARDTSFGRRHMNLWSRSPVFVWIVCFFRQF  242

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
               SV KVDY+TLRHGFI AHLAP S+  FDFQ+YIKRSLE+DFKVVVGI+P IW  A + 
Sbjct  243   FGSVTKVDYLTLRHGFITAHLAPGSETKFDFQKYIKRSLEDDFKVVVGITPTIWFVACLL  302

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             LL +THG  +YLWLPFIPL+IIL++G KLQVIIT+MGLRIQERG+VVKG PVV+P DDLF
Sbjct  303   LLTSTHGWYAYLWLPFIPLIIILVIGAKLQVIITRMGLRIQERGDVVKGAPVVEPGDDLF  362

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WF RPRL+L+LIH  LFQNAFQLAFFAW+ ++ G KSC+H+KTED+VI+I+MG++IQVLC
Sbjct  363   WFGRPRLILFLIHLCLFQNAFQLAFFAWSVWKIGPKSCYHDKTEDIVIKITMGVIIQVLC  422

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGT  1688
             SYVTLPLYALVTQMGS+M+PTIFN+RVA ALK+WH TA+K  +  +HS + TP+SSRP T
Sbjct  423   SYVTLPLYALVTQMGSSMRPTIFNDRVAAALKNWHHTAKKHAKHSKHSENHTPMSSRPTT  482

Query  1689  PLHGTSPIHLLQYYK--SEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRN  1847
             P +G SP+HLL  Y+  +  DS  ASP         W  +  ++  +  A+E  N
Sbjct  483   PTYGMSPVHLLHNYRISTAPDSSQASPRNSNHGAENWDPEALNSVHNHEADEVEN  537



>ref|XP_010505587.1| PREDICTED: MLO-like protein 12 isoform X2 [Camelina sativa]
Length=576

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 394/509 (77%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWA+A VCFVL+ ISI+IEY +H I    +K++KKAL+EALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALHEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q  + +ICI K++  +WHPC   +E  KYG D  D                 
Sbjct  66    ISLLLVVLQDPVSQICIPKTVAKTWHPCSHEQEIAKYGKDYVDDGRKILEDF--------  117

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D     S RR LA  G DKCA +G V  +SA GIHQLHIFIFVLA+FHVLYCIIT A G+
Sbjct  118   DSTDFYSPRRSLATKGYDKCAAKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSTFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDFKVVVGISP IW  AV+FL
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIQRSLEEDFKVVVGISPLIWCIAVLFL  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPFIPL++IL+VG KLQ+II+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWNSYLWLPFIPLLVILVVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF L++CFH +TED+ IRISMG+LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHRTEDIAIRISMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPQSSRPTTP  476

Query  1692  LHGTSPIHLLQYYK-SEID---SVGASPA  1766
              HG SP+HLL  Y    ID   S  ASP+
Sbjct  477   THGMSPVHLLHNYNHRSIDQQTSFTASPS  505



>ref|XP_010412940.1| PREDICTED: MLO-like protein 12, partial [Camelina sativa]
Length=509

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/509 (66%), Positives = 391/509 (77%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWA+A VCFVL+ ISI+IEY +H I    +K++KKAL+EALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALHEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q  + +ICI K++  +WHPC   +E  KYG D  D                 
Sbjct  66    ISLLLVVLQDPVSQICIPKTVAKTWHPCSHEQEIAKYGKDYVDDGRKILEDF--------  117

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D     S RR LA  G DKCA +G V  +SA GIHQLHIFIFVLA+FHVLYCIIT A G+
Sbjct  118   DSTDFYSPRRSLATKGYDKCAAKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSSFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDFKVVVGISP IW  AV+FL
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIQRSLEEDFKVVVGISPLIWCIAVLFL  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPFIPL++IL+VG KLQ+II+K+GLRIQ++G VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWNSYLWLPFIPLLVILVVGAKLQMIISKLGLRIQDKGYVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF L++CFH KTED+ IRISMG LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHKTEDIAIRISMGGLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPQSSRPTTP  476

Query  1692  LHGTSPIHLLQYYK----SEIDSVGASPA  1766
              HG SP+HLL  Y      +  S  ASP+
Sbjct  477   THGMSPVHLLHNYNHRSLDQQTSFTASPS  505



>ref|XP_010509062.1| PREDICTED: MLO-like protein 12 [Camelina sativa]
Length=576

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/509 (66%), Positives = 391/509 (77%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWA+A VCFVL+ ISI+IEY +H I    +K++KKAL EALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALNEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q  + +ICI K++  +WHPC   +E  KYG D  D                 
Sbjct  66    ISLLLVVLQDPVSQICIPKTVAKTWHPCSHEQEIAKYGKDYVDDGRKILEDF--------  117

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D     S RR LA  G DKCA +G V  +SA GIHQLHIFIFVLA+FHVLYCIIT A G+
Sbjct  118   DSTDFYSPRRSLATKGYDKCAAKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSSFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDFKVVVGISP IW  AV+FL
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIQRSLEEDFKVVVGISPLIWCIAVLFL  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPFIPL++IL+VG KLQ+II+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWNSYLWLPFIPLLVILVVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF L++CFH KTED+ IRISMG+LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHKTEDIAIRISMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG+ M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTTMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPQSSRPTTP  476

Query  1692  LHGTSPIHLLQYYK----SEIDSVGASPA  1766
              HG SP+HLL  Y      +  S  ASP+
Sbjct  477   THGMSPVHLLHNYNHRSLDQQTSFTASPS  505



>ref|XP_010505586.1| PREDICTED: MLO-like protein 12 isoform X1 [Camelina sativa]
Length=576

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 394/509 (77%), Gaps = 13/509 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWA+A VCFVL+ ISI+IEY +H I    +K++KKAL+EALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALHEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q  + +ICI K++  +WHPC   +E  KYG D  D                 
Sbjct  66    ISLLLVVLQDPVSQICIPKTVAKTWHPCSHEQEIAKYGKDYVDDGRKILEDF--------  117

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D     S RR LA  G DKCA +G V  +SA GIHQLHIFIFVLA+FHVLYCIIT A G+
Sbjct  118   DSTDFYSPRRSLATKGYDKCAAKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSTFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDFKVVVGISP IW  AV+FL
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIQRSLEEDFKVVVGISPLIWCIAVLFL  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPFIPL++IL+VG KLQ+II+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWNSYLWLPFIPLLVILVVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF L++CFH +TED+ IRISMG+LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHRTEDIAIRISMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPQSSRPTTP  476

Query  1692  LHGTSPIHLLQYYK-SEID---SVGASPA  1766
              HG SP+HLL  Y    ID   S  ASP+
Sbjct  477   THGMSPVHLLHNYNHRSIDQQTSFTASPS  505



>ref|XP_011077127.1| PREDICTED: MLO-like protein 12 [Sesamum indicum]
Length=490

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/524 (64%), Positives = 399/524 (76%), Gaps = 39/524 (7%)
 Frame = +3

Query  240   GGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELM  419
              G  R L  TPTWAVA + F+L+AISI+IE +IH IG  L+K+ K +L+EAL+KIKAELM
Sbjct  2     AGKERPLVATPTWAVAVLFFILIAISILIEQLIHHIGSWLKKKRKPSLFEALDKIKAELM  61

Query  420   LLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlll  599
             LLGFISLLLTV Q  I +IC+ +S+G+SWHPC  +E +                      
Sbjct  62    LLGFISLLLTVTQDYIAEICVPRSVGHSWHPCRNYEGD----------------------  99

Query  600   AFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITL  779
                +D+Y              D C  +G V F+SA GIHQLHIFIFVLA+ H+LYC+IT 
Sbjct  100   ---NDDYD-------------DPCLIKGQVQFVSAYGIHQLHIFIFVLAVAHILYCVITY  143

Query  780   AFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFF  959
               GRLKMRKWK+WE+ETKT++YQ+ +DPERFRFARDTSFGRRHL FWS+SP LLWIVCFF
Sbjct  144   GLGRLKMRKWKSWENETKTIQYQYYNDPERFRFARDTSFGRRHLHFWSKSPLLLWIVCFF  203

Query  960   RQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFA  1139
             RQF+ SV KVDY+TLRHGFI AHL P SQ +FDF +YI RSLEEDFKVVVGISP IWL A
Sbjct  204   RQFLTSVAKVDYLTLRHGFITAHLTPHSQESFDFHKYISRSLEEDFKVVVGISPAIWLCA  263

Query  1140  VIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPAD  1319
             V+ LL NT+G  S+ WLPFIPL+IILLVG KLQVIITKMG+RI ERG+V+KGTPVVQP D
Sbjct  264   VLILLTNTNGWYSHFWLPFIPLIIILLVGAKLQVIITKMGIRILERGDVIKGTPVVQPGD  323

Query  1320  DLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQ  1499
             DLFWFNRP L+L+LIH VLFQNAFQLAFFAW+W++FG  SC+HE  EDLVIRI+MG+LIQ
Sbjct  324   DLFWFNRPGLILFLIHLVLFQNAFQLAFFAWSWWKFGYPSCYHENIEDLVIRIAMGVLIQ  383

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSR  1679
             VLCSYVTLPLYALVTQMG+NMKP IF+++VA AL+ WHQTA+KQLRQ R S S TP SSR
Sbjct  384   VLCSYVTLPLYALVTQMGTNMKPVIFSDQVASALRGWHQTAKKQLRQGRRSASTTPFSSR  443

Query  1680  PGTPLHG-TSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRR  1808
             P +PLHG TSP++LL+ +K   D+  ASP      N  W  + R
Sbjct  444   PASPLHGSTSPVYLLRGHKEYSDNNVASPRASNFSNEGWGGEGR  487



>emb|CDY26348.1| BnaA03g60240D [Brassica napus]
Length=591

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/540 (62%), Positives = 405/540 (75%), Gaps = 26/540 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+L++T TWAVA VCF L+ ISIVIE +IH +G   +++NKKALYEALEK+KA
Sbjct  1     MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGTCFKRKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I +ICIS+S+  S  PC + EE  +Y     D   DE     
Sbjct  61    ELMLMGFISLLLTIGQNYISQICISESIAASMRPCSKSEELQEYPPKNKDTGNDE-----  115

Query  591   lllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                   D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFIFVL
Sbjct  116   -----GDEETSGRKLLELVETFIPRRSLATKGYDKCAEKGKVAFVSSYGMHQLHIFIFVL  170

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWS  923
             A+ HV+YCI+T A G++KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWS
Sbjct  171   AVCHVIYCIVTYALGKIKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWS  230

Query  924   RSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKV  1103
             +S   LWI CFFRQF  SV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK 
Sbjct  231   KSTITLWIACFFRQFFGSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKT  290

Query  1104  VVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGE  1283
             +V ISP IW  AV+FLL  THG  SY W PFIPLV+IL+VGTKLQ+IITK+GL IQE+GE
Sbjct  291   IVEISPVIWFVAVLFLLTTTHGLNSYRWQPFIPLVVILIVGTKLQMIITKLGLLIQEKGE  350

Query  1284  VVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTED  1463
             +VKG P+VQP D LFWF RPR +L+L+H VLF NAFQLAFFAW+ YEFG+K+CFH+ T D
Sbjct  351   IVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWSTYEFGIKNCFHKSTVD  410

Query  1464  LVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQK  1643
             +VIRIS+GL++Q LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  
Sbjct  411   VVIRISIGLIVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAKKQIKHG  470

Query  1644  RHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVD  1823
             R S S TP SSRP TP HG+SPIHLL+       S   S A  +       + RR+++ D
Sbjct  471   RTSESTTPFSSRPATPTHGSSPIHLLRNVHKRSRSADESFANSL-------SPRRNSDFD  523



>ref|XP_009124631.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=590

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/540 (62%), Positives = 406/540 (75%), Gaps = 26/540 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+L++T TWAVA VCF L+ ISIVIE +IH +G   +++NKKALYEALEK+KA
Sbjct  1     MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGTCFKRKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I +ICIS+S+  S  PC + EE  +Y     D   DE     
Sbjct  61    ELMLMGFISLLLTIGQNYISQICISESIAASMRPCSKSEELQEYPPKNKDTGNDE-----  115

Query  591   lllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                   D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFIFVL
Sbjct  116   -----GDEETSGRKLLELVETFIPRRSLATKGYDKCAEKGKVAFVSSYGMHQLHIFIFVL  170

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWS  923
             A+ HV+YCI+T A G++KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWS
Sbjct  171   AVCHVIYCIVTYALGKIKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWS  230

Query  924   RSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKV  1103
             +S   LWI CFFRQF  SV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK 
Sbjct  231   KSTITLWIACFFRQFFGSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKT  290

Query  1104  VVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGE  1283
             +V ISP IW  AV+FLL  THG  SYLW PFIPLV+IL+VGTKLQ+IITK+GL IQE+GE
Sbjct  291   IVEISPVIWFVAVLFLLTTTHGLNSYLWQPFIPLVVILIVGTKLQMIITKLGLLIQEKGE  350

Query  1284  VVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTED  1463
             +VKG P+VQP D LFWF RPR +L+L+H VLF NAFQLAFFAW+ YEFG+K+CFH+ T D
Sbjct  351   IVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWSTYEFGIKNCFHKSTVD  410

Query  1464  LVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQK  1643
             +VIRIS+GL++Q LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  
Sbjct  411   VVIRISIGLIVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAKKQIKHG  470

Query  1644  RHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVD  1823
             R S S TP SSRP TP HG+SPIHLL+       S   S A  +       + RR+++ D
Sbjct  471   RTSESTTPFSSRPATPTHGSSPIHLLRNVHKRSRSADESFANSL-------SPRRNSDFD  523



>ref|NP_172598.1| MLO-like protein 2 [Arabidopsis thaliana]
 sp|Q9SXB6.1|MLO2_ARATH RecName: Full=MLO-like protein 2; Short=AtMlo2 [Arabidopsis thaliana]
 gb|AAD49991.1|AC007259_4 Highly similar to Mlo proteins [Arabidopsis thaliana]
 gb|AAK53795.1|AF369563_1 membrane protein Mlo2 [Arabidopsis thaliana]
 gb|AAM63648.1| Mlo protein, putative [Arabidopsis thaliana]
 dbj|BAE98591.1| Mlo like protein [Arabidopsis thaliana]
 gb|AEE28715.1| MLO-like protein 2 [Arabidopsis thaliana]
Length=573

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/513 (64%), Positives = 403/513 (79%), Gaps = 2/513 (0%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E+ IH IG   +K++K+AL+EALEK+KA
Sbjct  1     MADQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKQALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICIS+ + ++ HPC   EE  KYG        D    + 
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISQKVASTMHPCSAAEEAKKYGKKDAGKKDDGDGDKP  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                   +   S   HRR LA  G DKCA++G V F+SA GIHQLHIFIFVLA+ HV+YCI
Sbjct  121   GRRLLLELAES-YIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVVYCI  179

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T AFG++KMR WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHL+FWS++   LWIV
Sbjct  180   VTYAFGKIKMRTWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNFWSKTRVTLWIV  239

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+ LRHGFI+AH AP ++  FDF++YI+RSLE+DFK VV ISP IW
Sbjct  240   CFFRQFFGSVTKVDYLALRHGFIMAHFAPGNESRFDFRKYIQRSLEKDFKTVVEISPVIW  299

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL N++G RSYLWLPFIPLV+IL+VGTKL+VIITK+GLRIQE+G+VV+G PVVQ
Sbjct  300   FVAVLFLLTNSYGLRSYLWLPFIPLVVILIVGTKLEVIITKLGLRIQEKGDVVRGAPVVQ  359

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF +PR +L+LIH VLF NAFQLAFFAW+ YEF L +CFHE T D+VIR+ +G 
Sbjct  360   PGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNCFHESTADVVIRLVVGA  419

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS MKPT+FN+RVA ALK WH TA+ + +  RHSGS TP 
Sbjct  420   VVQILCSYVTLPLYALVTQMGSKMKPTVFNDRVATALKKWHHTAKNETKHGRHSGSNTPF  479

Query  1671  SSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPA  1766
             SSRP TP HG+SPIHLL  + +  +++  +SP+
Sbjct  480   SSRPTTPTHGSSPIHLLHNFNNRSVENYPSSPS  512



>ref|XP_006436274.1| hypothetical protein CICLE_v10031130mg [Citrus clementina]
 gb|ESR49514.1| hypothetical protein CICLE_v10031130mg [Citrus clementina]
Length=554

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/550 (63%), Positives = 406/550 (74%), Gaps = 31/550 (6%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVAAV FVL+A+S+VIE++IH+IGK L  R+KKAL+EA+EK+KA L     
Sbjct  9     RTLEETPTWAVAAVFFVLIAVSVVIEHLIHIIGKWLNNRHKKALFEAVEKVKAVL-----  63

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
                     Q  I  IC+SKS+ NSWHPC           +      D    RR LL+F D
Sbjct  64    --------QEPISGICVSKSVANSWHPC-------TDKLEKDAYSSDNKESRRRLLSFLD  108

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
                   S RR LA  G DKCA EG V F+SA GIHQLHIFIFVLA+FHVLYC+ TLA GR
Sbjct  109   S--GTASTRRSLATKGYDKCADEGKVAFVSAYGIHQLHIFIFVLAIFHVLYCLFTLALGR  166

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWKAWE+ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWIVCFFRQF+
Sbjct  167   TKMKKWKAWENETKTIEYQYYNDPERFRFARDTSFGRRHLNIWSKSSISLWIVCFFRQFL  226

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV K+DY TLRHGFI+AHLAP S+  FDFQ+YI RSLEEDFK VVGI+P +W  A +FL
Sbjct  227   GSVNKIDYHTLRHGFIMAHLAPGSETKFDFQKYISRSLEEDFKDVVGITPILWFIATLFL  286

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  +YLWLPFIPL IILLVG KLQVIITK+GLRIQERG+VVKG PVVQP DDLFW
Sbjct  287   LTNTHGWFAYLWLPFIPLFIILLVGAKLQVIITKLGLRIQERGDVVKGAPVVQPGDDLFW  346

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLFQNAFQLAFF+W+ YEF LKSCFH+KTED+ IRISMG+LIQ+LCS
Sbjct  347   FGRPRFILFLIHLVLFQNAFQLAFFSWSTYEFALKSCFHKKTEDIAIRISMGVLIQILCS  406

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKPTIFN+RVA ALK+WH  A+K  +Q R SGS TP+SSRP TP
Sbjct  407   YVTLPLYALVTQMGSTMKPTIFNDRVAAALKNWHHIAKKHTKQGRLSGSNTPMSSRPQTP  466

Query  1692  LHGTSPIHLLQYY-KSEIDSVGASPARDIEDNLPWFNQRRDNNVDQP---AEENRNELQ-  1856
              HG SP+HLL  Y  S   S       D E+ +      R+   + P   AE +  E+  
Sbjct  467   THGMSPVHLLHNYPNSSYHSNFEHEHWDPENQIRSPRHHREIMNESPPHYAESSEQEVAA  526

Query  1857  ----REIEME  1874
                 R+IEM+
Sbjct  527   LEEPRQIEMQ  536



>gb|KFK36813.1| hypothetical protein AALP_AA4G174800 [Arabis alpina]
Length=572

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/505 (65%), Positives = 395/505 (78%), Gaps = 10/505 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFVL+ ISI+IEY +H +G   +K+NKKALYEALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKNKKALYEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q+ + +ICI  S+  +WHPC R +E  KYG D  D               ++
Sbjct  66    ISLLLVVLQTPVSEICIPNSVAATWHPCSRAQELAKYGKDYVDDGRKILEDFD-----SN  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D YS    RR LA  G DKCA+ G V  +SA GIHQLHIFIFVLA+ H++YCI T   G+
Sbjct  121   DFYSP---RRSLATKGYDKCAENGKVALVSAYGIHQLHIFIFVLAVVHIIYCITTYFLGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWEKETKTIEYQYANDPERFRFARDTSFGRRHLNVWSKSTFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDF+VVVGISP IW  AV+F+
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSGARFDFQKYIQRSLEEDFQVVVGISPVIWCIAVLFI  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPF+PL++IL+VG KLQ+II+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWASYLWLPFLPLIVILIVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F +PR +L+LIH VLF NAFQLAFF W+ YEF L++CFH KTED+ IRISMG+LIQVLCS
Sbjct  358   FGKPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHKTEDIAIRISMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPQSSRPATP  476

Query  1692  LHGTSPIHLLQYYKSEIDSVGASPA  1766
              HG SP+HLL  +  +  +  ASP+
Sbjct  477   THGMSPVHLLHNHNRD-SNFAASPS  500



>ref|XP_002892636.1| hypothetical protein ARALYDRAFT_471266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68895.1| hypothetical protein ARALYDRAFT_471266 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/513 (64%), Positives = 402/513 (78%), Gaps = 4/513 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E+ IH IG   +K++K AL+EALEK+KA
Sbjct  1     MANQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKHALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ+ I  ICIS+ +  + HPC    E +KYG        D  +  R
Sbjct  61    ELMLLGFISLLLTVGQTPISNICISQKVAKTMHPCSAAAEAEKYGKKDTGKKEDGDKPGR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL    D Y    HRR LA  G DKCA++G V F+SA GIHQLHIFIFVLA+ HV+YCI
Sbjct  121   RLLLELADSYI---HRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVIYCI  177

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T AFG++KMR+WK+WE ETKT+EYQ+++DP+RFRFARDTSFGRRHL+FWS++   LW V
Sbjct  178   VTYAFGKIKMRRWKSWEEETKTIEYQYSNDPQRFRFARDTSFGRRHLNFWSKTSVTLWTV  237

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY  LRHGFI+AH AP ++  +DF++YI+RSLE+DFK VV ISP IW
Sbjct  238   CFFRQFFGSVTKVDYFALRHGFIMAHFAPGNESRYDFRKYIQRSLEKDFKTVVEISPVIW  297

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL N+HG RSYLWLPFIPLV+IL+VGTKL+VIITK+GLRIQE+G+VV+G PVVQ
Sbjct  298   FVAVLFLLTNSHGLRSYLWLPFIPLVVILIVGTKLEVIITKLGLRIQEKGDVVRGAPVVQ  357

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF +PR +L+LIH VLF NAFQLAFFAW+ YEF L +CFHE T D+VIR+ +G 
Sbjct  358   PGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNCFHESTADVVIRLVVGA  417

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS MKPT+FN+RVA ALK WH+TA+ + +  RHS S TP 
Sbjct  418   VVQILCSYVTLPLYALVTQMGSKMKPTVFNDRVATALKKWHRTAKSETKHGRHSESNTPF  477

Query  1671  SSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPA  1766
             SSRP TP HG+SPIHLL  + +  ++S   SP+
Sbjct  478   SSRPTTPTHGSSPIHLLHNFNNRSVESYPNSPS  510



>emb|CDY15021.1| BnaCnng04240D [Brassica napus]
Length=584

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/540 (62%), Positives = 405/540 (75%), Gaps = 26/540 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+L++T TWAVA VCF L+ ISIVIE +IH +G   +++NKKALYEALEK+KA
Sbjct  1     MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGTCFKRKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I +ICIS+S+  S  PC + EE  +Y     D   DE     
Sbjct  61    ELMLMGFISLLLTIGQNYISQICISESIAASMRPCSKSEELKEYPPKNKDTGNDE-----  115

Query  591   lllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                   D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFIFVL
Sbjct  116   -----GDEENSGRKLLELVESFIPRRSLATKGYDKCAEKGKVAFVSSYGMHQLHIFIFVL  170

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWS  923
             A+ HV+YCI+T A G++KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWS
Sbjct  171   AVCHVIYCIVTYALGKIKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWS  230

Query  924   RSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKV  1103
             +S   LWI CFFRQF  SV +VDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK 
Sbjct  231   KSTITLWIACFFRQFFGSVTRVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKT  290

Query  1104  VVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGE  1283
             +V ISP IW  AV+FLL  THG  SYLW PFIPLV+IL+VGTKLQVIITK+GL IQE+GE
Sbjct  291   IVEISPVIWFIAVLFLLTTTHGLNSYLWQPFIPLVVILIVGTKLQVIITKLGLLIQEKGE  350

Query  1284  VVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTED  1463
             +VKG P+VQP D LFWF RPR +L+L+H VLF NAFQLAFFAW+ YEFG+K+CFH+ T D
Sbjct  351   IVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWSTYEFGIKNCFHKSTVD  410

Query  1464  LVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQK  1643
             +VIRIS+GL++Q LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  
Sbjct  411   VVIRISIGLIVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAKKQIKHG  470

Query  1644  RHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVD  1823
             R S S TP SSRP TP H +SPIHLL+       S   S A  +       + RR+++ D
Sbjct  471   RTSESTTPFSSRPATPTHDSSPIHLLRNVHKRSRSADESFANSL-------SPRRNSDFD  523



>ref|XP_009133345.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=584

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/512 (64%), Positives = 399/512 (78%), Gaps = 16/512 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWA+A VCFV++ ISI+IEY +H IG   ++++KKALYEALEK+KAELMLLGF
Sbjct  6     RSLEETPTWALAVVCFVILFISIMIEYFLHFIGHWFKRKHKKALYEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V QS + +ICI + +  +WHPC R +E  KYG D  D   +            D
Sbjct  66    ISLLLVVLQSPVSQICIPERIAATWHPCSREQELAKYGKDYIDDGRE---------VLED  116

Query  612   DEYSG-ESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
              +++   S RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FH+LYCIIT A G
Sbjct  117   YDFNNFYSPRRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHILYCIITYALG  176

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
             + KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF
Sbjct  177   KTKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSSFTLWITCFFRQF  236

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
               SV KVDY+TLRHGFI+AH+   S+  FDFQ+YI+RSLEEDFK VVGISP IW  AV+F
Sbjct  237   FGSVTKVDYLTLRHGFIMAHMPAGSEARFDFQKYIQRSLEEDFKAVVGISPVIWCIAVLF  296

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             +L NTHG+ SY WLPFIPL +IL+VG KLQVII+K+GLRIQ++G+VVKG PVV+P DDLF
Sbjct  297   ILTNTHGSESYFWLPFIPLFVILIVGAKLQVIISKLGLRIQDKGDVVKGAPVVEPGDDLF  356

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WF RPR +L+L+H VLF NAFQLAFF W+ YEF LK+CFH KT D+ +RI+MG+LIQV+C
Sbjct  357   WFGRPRFILFLLHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTVDIALRITMGVLIQVVC  416

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGT  1688
             SY+TLPLYALVTQMG++M+PTIFN+RVA ALK WH+TA+KQ +    SGS TP SSRP T
Sbjct  417   SYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHKTAKKQSKHGT-SGSNTPHSSRPAT  475

Query  1689  PLHGTSPIHLLQYYKSEID-----SVGASPAR  1769
             P HG SP+HLL  +   +D     +  +SP R
Sbjct  476   PTHGMSPMHLLHSHNRSLDYQTSFTASSSPPR  507



>ref|XP_006293900.1| hypothetical protein CARUB_v10022893mg [Capsella rubella]
 gb|EOA26798.1| hypothetical protein CARUB_v10022893mg [Capsella rubella]
Length=577

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/551 (61%), Positives = 408/551 (74%), Gaps = 18/551 (3%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVA VCFVL+ ISI+IEY +H +G   +K++KKALYEALEK+KAELMLLGF
Sbjct  6     RTLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKHKKALYEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q  + +ICI + + ++WHPC  H+E  KYG D  D              F  
Sbjct  66    ISLLLVVLQDPVSQICIPRKVASTWHPCTHHQEMVKYGKDYVDDGRKILEDFDSTDVFGP  125

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
                     RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FH+LYCIIT A G+
Sbjct  126   --------RRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHILYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWI CFFRQF 
Sbjct  178   TKMKKWKSWEKETKTIEYQYANDPERFRFARDTSFGRRHLNMWSKSSVTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDF VVVGISP IW  AV+F+
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIQRSLEEDFTVVVGISPLIWCIAVLFI  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NT+G  SYLWLPFIPL++IL+VG KLQ+II+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTNGWASYLWLPFIPLLVILVVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPRL+L+LIH VLF NAFQLAFF W+ YEF L++CFH K ED+ IRI+MG+LIQV+CS
Sbjct  358   FGRPRLILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHKNEDIAIRITMGVLIQVICS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +  + SGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHGQ-SGSNTPHSSRPATP  476

Query  1692  LHGTSPIHLLQYY--KSEID---SVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQ  1856
              HG SP+HLL  Y  +S +D   S  ASP+     +            D   E   +  Q
Sbjct  477   THGMSPVHLLHNYHNRSSLDQQTSFTASPSPPRFSDYSGHGHGHHQFFD--PESQNHSYQ  534

Query  1857  REIEMESAEFS  1889
             REI    +EFS
Sbjct  535   REI--TDSEFS  543



>gb|AGV68801.1| MLO4 [Prunus armeniaca]
Length=571

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/552 (63%), Positives = 404/552 (73%), Gaps = 25/552 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLEETPTWAVA VCFVL+A+SI IE++IHLIGK L  ++K+AL EALEKIK+
Sbjct  1     MAELSKERSLEETPTWAVAVVCFVLLAVSIFIEHIIHLIGKWLTSKHKRALVEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q  I  ICI KS+G+SW PC +  +                    
Sbjct  61    ELMLLGFISLLLTVLQDYISDICIPKSIGDSWLPCSKEAQLKSENKGRKLLY--------  112

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                 F+D ++S   +RR LA  G D C+KEG V F+SA GIHQLHIFIFVLALFHVLYCI
Sbjct  113   ----FSDPDFS---YRRRLAVKGDDYCSKEGKVAFVSAYGIHQLHIFIFVLALFHVLYCI  165

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TL  GR KMRKWK WE ET+++E+Q+ +DPERFRFARDTSFG+RHL F  RSP  LWIV
Sbjct  166   LTLTLGRYKMRKWKVWEKETRSIEHQYYNDPERFRFARDTSFGQRHLKF--RSPLTLWIV  223

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQ  +SV +VDY+TLRHGFI+AH AP S+  FDF++YI RSLEEDFKVVV ISP IW
Sbjct  224   SFFRQLFQSVTRVDYLTLRHGFIMAHFAPDSETTFDFRKYISRSLEEDFKVVVEISPIIW  283

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  SY WLPFIPLVIILLVGTKLQVII+ MGLRIQERG+VVKG P+VQ
Sbjct  284   FSAVLFLLSNTYGWYSYFWLPFIPLVIILLVGTKLQVIISMMGLRIQERGDVVKGAPLVQ  343

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWF  PR ML+LIHFVLFQNAFQLAFFAW+ Y FG+KSCFHE+TED+VIRISMG+
Sbjct  344   PGDHLFWFGSPRFMLFLIHFVLFQNAFQLAFFAWSTYAFGIKSCFHERTEDIVIRISMGV  403

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ LCSYVTLPLYALVTQMGS MK T+FNE V  ALKSWH  A+K+ +   HS S TP 
Sbjct  404   IIQFLCSYVTLPLYALVTQMGSTMKRTVFNEEVVGALKSWHNKAKKRTKLSPHSHSNTPF  463

Query  1671  SSRPGTPLHG--TSPIHLL-QYYKSEIDSVGASPARDIEDNLPWFNQR-----RDNNVDQ  1826
             SS PGTP HG   SP+HLL ++ +S+ D    SP     +   W  +       +NN   
Sbjct  464   SSTPGTPSHGLRMSPVHLLHKHNRSDADGYYVSPRASNLELSNWETEGSSHSLNNNNAGP  523

Query  1827  PAEENRNELQRE  1862
                E   EL +E
Sbjct  524   SDPEEIRELDQE  535



>ref|XP_007151752.1| hypothetical protein PHAVU_004G071700g [Phaseolus vulgaris]
 gb|ESW23746.1| hypothetical protein PHAVU_004G071700g [Phaseolus vulgaris]
Length=573

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/574 (61%), Positives = 417/574 (73%), Gaps = 26/574 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEETPTWAVA VCF+L+A+SI IE++IH IGK  +K+ K AL+EALEK+K 
Sbjct  1     MANEVYERTLEETPTWAVAVVCFLLLAVSIAIEHLIHGIGKWFKKKQKNALFEALEKVKG  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELM+LGFISLLL+V Q  I KIC+S+ +  SWHPC   +       D  + D  +   R+
Sbjct  61    ELMVLGFISLLLSVLQDQISKICVSEEVAASWHPCANPKSSTATKTDEDESDDIQINSRK  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL  +          RRILA  G DKCA++G V F+SA GIHQLHIFIFVLA+FH+L CI
Sbjct  121   LLQLY------DSIPRRILATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAIFHILQCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             ITL  GR KMRKW+AWE+ETKT+EYQF +DPERFRFARDT+FGRRHL+ WS+S   LWIV
Sbjct  175   ITLGLGRTKMRKWRAWENETKTIEYQFYNDPERFRFARDTTFGRRHLNPWSQSTISLWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQF  S  KVDY+TLRHGFI AHLAP S   FDFQ+YI+RSLE+DFKVVVGISP IW
Sbjct  235   SFFRQFFGSATKVDYLTLRHGFITAHLAPGSDARFDFQKYIQRSLEKDFKVVVGISPVIW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  S  WLPFIP V+ILLVG KLQ+IITKMGLRI +RGEVVKG P+V+
Sbjct  295   FFAVLFLLTNTHGWYSSYWLPFIPFVVILLVGAKLQMIITKMGLRITDRGEVVKGAPLVE  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWFNRPRL+L+LIH VLFQNAFQLAFF+W+ YEF L SCFHE T D+ IR++MG+
Sbjct  355   PGDDLFWFNRPRLLLFLIHLVLFQNAFQLAFFSWSTYEFSLDSCFHETTADVAIRLTMGV  414

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQVLCSYVTLPLYALVTQMGS MKPTIFN+RVA ALK+WH TA+KQ++  + +   TP 
Sbjct  415   VIQVLCSYVTLPLYALVTQMGSTMKPTIFNQRVASALKNWHSTAKKQVKNSKQN---TPF  471

Query  1671  SSRPGTPLHGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLPW------------FNQRRD  1811
             SS+P TP +G SP+HLLQ +     DS   SP     +N  W              +   
Sbjct  472   SSKPSTPTYGMSPMHLLQKHLAGRSDSAQTSPRTSNYENEQWDVEGSPSTSNHAAAEETQ  531

Query  1812  NNVDQPAEENRNEL----QREIEMESAEFSFENK  1901
               V +P   +  E     Q EI + S+EFSFE +
Sbjct  532   MQVMEPGSSSAPEFPTSSQIEIRVSSSEFSFEKR  565



>ref|XP_009133347.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=575

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/579 (59%), Positives = 411/579 (71%), Gaps = 41/579 (7%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWA+AAVCFV++ ISI+IE  +H IG   +++NKKALYEALEK+KAELMLLGF
Sbjct  6     RSLEETPTWALAAVCFVILFISIMIECFLHFIGHWFKRKNKKALYEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V QS + +ICI + +  +WHPC   +E  KY  D  D               ++
Sbjct  66    ISLLLVVLQSPVSQICIPERIAATWHPCSSQQELAKYSKDYIDDGRKILEDYD-----SN  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D YS    RR LA  G DKCA+ G V  +SA GIHQLHIFIFVLA+FH+LYCIIT A G+
Sbjct  121   DFYSP---RRSLATKGYDKCAENGKVALVSAYGIHQLHIFIFVLAVFHILYCIITYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKTLEYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFRQF 
Sbjct  178   TKMKKWKSWEKETKTLEYQYANDPERFRFARDTSFGRRHLNIWSKSSFTLWITCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S+  FDFQ+YI+RSLEEDFK VVGISP IW  AV+F+
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSEARFDFQKYIQRSLEEDFKAVVGISPVIWCIAVLFI  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY WLPF+PL++IL+VG KLQVII+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWDSYFWLPFLPLLVILIVGAKLQVIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI+MG+LIQV+CS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMGVLIQVVCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMGS+M+PTIFN+RVA ALK WH TA+KQ +   +SGS TP SSRP TP
Sbjct  418   YITLPLYALVTQMGSSMRPTIFNDRVANALKKWHNTAKKQAKHG-NSGSNTPRSSRPTTP  476

Query  1692  LHGTSPIHLLQYYKSEID-------------------------------SVGASPARDIE  1778
              H  S  HLL      +D                               S   SP  DI 
Sbjct  477   KHNRSLDHLLHNRNRSLDHQTSFTASPSPPRLSDSGRHGHGPQHFFDPESQNVSPYSDIT  536

Query  1779  DNLPWFNQRRDNNVDQPAEENRNELQREIEMESAEFSFE  1895
             D      Q+   +V  P  E + E+   ++++  EF+F+
Sbjct  537   DFDNGNIQQPHADVASPVTEEK-EITEHVKIDLPEFTFK  574



>ref|XP_009113127.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=582

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/560 (59%), Positives = 407/560 (73%), Gaps = 22/560 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     ++L++T TWAVA VCF L+  SIVIE +IH +G   + +NKKALYEALEK+KA
Sbjct  1     MADKVDEKTLQQTSTWAVAVVCFFLLLFSIVIEKLIHKLGTWFKIKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I +ICIS+S+  S HPC   EE  KY     D          
Sbjct  61    ELMLMGFISLLLTIGQNYISQICISESIAASMHPCSESEEAKKYPPKKKDTKN-------  113

Query  591   lllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                   D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFIFVL
Sbjct  114   ------DEENSGRKLLELVQSYIPRRSLATKGYDKCAEKGKVAFVSSYGMHQLHIFIFVL  167

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWS  923
             A+ HV+YCI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWS
Sbjct  168   AVCHVIYCIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWS  227

Query  924   RSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKV  1103
             +S   LWIVCFFRQF  SV +VDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK 
Sbjct  228   KSTITLWIVCFFRQFFGSVTRVDYLTLRHGFIMAHLAPGSDGRFDFRKYIQRSLEEDFKT  287

Query  1104  VVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGE  1283
             +V ISP IW  AV+FLL NT+G  S+LW PFIPLV+IL+VGTKLQVIITK+GL IQE+G+
Sbjct  288   IVEISPVIWFVAVLFLLTNTNGLHSFLWQPFIPLVVILIVGTKLQVIITKLGLLIQEKGD  347

Query  1284  VVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTED  1463
             +VKG P+VQP D LFWF RPR +L+LIH VLF NAFQLAFFAW  YEF L++C+H+   D
Sbjct  348   IVKGMPLVQPGDHLFWFGRPRFILFLIHLVLFTNAFQLAFFAWTTYEFQLENCYHKTIVD  407

Query  1464  LVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQK  1643
             +VIRIS+G+++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  
Sbjct  408   VVIRISVGVIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKQIKHG  467

Query  1644  RHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVD  1823
             R SGS TP SSRP TP HG+SPIHLL+       S   S    +      F+  R     
Sbjct  468   RTSGSTTPFSSRPTTPTHGSSPIHLLRNVHKRSRSADESFVNTLSPRNSDFDSWRPEPQQ  527

Query  1824  QPAEENRNELQREIEMESAE  1883
             +P+  + N   R  E +S +
Sbjct  528   EPSSSSANHHSRFREEDSEK  547



>ref|XP_002315295.2| hypothetical protein POPTR_0010s22730g [Populus trichocarpa]
 gb|EEF01466.2| hypothetical protein POPTR_0010s22730g [Populus trichocarpa]
Length=577

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/553 (61%), Positives = 412/553 (75%), Gaps = 19/553 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA  G  +SLE+TPTWAVA VCFVLVAISIVIE++IH++ K L+K++K AL EALEK+KA
Sbjct  1     MASKGKAQSLEQTPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKPALVEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+ Q  I  ICI  ++  +WHPC +++E+ K        +      + 
Sbjct  61    ELMLMGFISLLLTILQGPISDICIPGNIAATWHPCSKNQEKKKVSEYDDSDNTRRRLLQF  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             L         SGESHRR LA    DKCA++G V  +S+ GIHQLHIFIFVLA+ HVLYCI
Sbjct  121   LG--------SGESHRRFLASK-YDKCAEKGKVALVSSYGIHQLHIFIFVLAVVHVLYCI  171

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT   GR KMRKWKAWE ETKTL      +PERFRFAR+TSFGRRHL  WS+S  LLWIV
Sbjct  172   ITYFIGRTKMRKWKAWEDETKTLAL----NPERFRFARETSFGRRHLQLWSKSSILLWIV  227

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDYMTLRHGFI+AHLAP S+  F+FQ+YI RSL+EDFKVVVGISP IW
Sbjct  228   CFFRQFFGSVTKVDYMTLRHGFIMAHLAPGSETRFNFQKYISRSLDEDFKVVVGISPIIW  287

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NTHG  S  WLPFIPL+IILL+G KLQVIIT+MGLRIQERG+VVKG  VV 
Sbjct  288   FTAVLFLLTNTHGWNSQFWLPFIPLIIILLIGAKLQVIITQMGLRIQERGDVVKGALVVI  347

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLFQNAFQ+AFF W+ YEF +KSC+H  TE +VIRI++G+
Sbjct  348   PGDDLFWFGRPRFLLFLIHLVLFQNAFQIAFFIWSVYEFTIKSCYHAHTEGIVIRITLGV  407

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ++CSYVTLPLYALVTQMGS+M+PT+FN+RVA ALK+WH TA+KQ +  ++S S TP+
Sbjct  408   VIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTAKKQSKHGKNSESHTPM  467

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEI--DSVGASPARDIEDNL----PWFNQRRDNNVDQPA  1832
             SSRP TP +G SP+HLL  ++     DS   SP     DN     P  N   D+ +++P 
Sbjct  468   SSRPQTPAYGMSPVHLLHNFRGSTAPDSFQNSPRHSYYDNNDQWDPEANSVHDHELNEPV  527

Query  1833  EENRNELQREIEM  1871
                  +++ ++++
Sbjct  528   HHGSPDVRDQVQV  540



>ref|XP_003548912.1| PREDICTED: MLO-like protein 12-like isoform X1 [Glycine max]
Length=571

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/514 (63%), Positives = 390/514 (76%), Gaps = 12/514 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLE+TPTWA A VCFVL+AISI+IE+VI  IGK  +K++K ALYE+LEK+K ELM+LGF
Sbjct  9     RSLEDTPTWAFAVVCFVLLAISIIIEHVIDAIGKWFKKKHKSALYESLEKVKGELMMLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             IS+LL V Q  + KICIS+++ ++WHPC   ++         D D +  +          
Sbjct  69    ISMLLVVFQGPLSKICISQNVASTWHPCSNPKKALSKSDGKSDSDTNGRKLL--------  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              EY     RR+LA  G DKCA +G V F+SA GIHQLHIFIF+LA+FH+L CIIT+A GR
Sbjct  121   -EYLDPIPRRVLAAKGYDKCADKGKVAFVSAYGIHQLHIFIFMLAVFHILQCIITIALGR  179

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMR+WK WE+ETKT+EYQF +DPERFR A+DT+FG+RHL+ WS+S   LWIV FFRQF 
Sbjct  180   TKMRRWKKWENETKTIEYQFYNDPERFRLAKDTTFGQRHLNTWSQSSISLWIVSFFRQFS  239

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY  LRHGFI AHLAP S   FDFQ+YIKRSL+EDFKVVVGISP IW FAV+FL
Sbjct  240   GSVKKVDYFALRHGFITAHLAPGSDARFDFQKYIKRSLDEDFKVVVGISPIIWFFAVLFL  299

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY WLPFIPL+ ILLVG KLQ+IITKMGLRIQ+RGEV+KG PVV+P DDLFW
Sbjct  300   LANTHGWYSYYWLPFIPLIAILLVGAKLQMIITKMGLRIQDRGEVLKGAPVVEPGDDLFW  359

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRPRL+L +IH V FQNAFQLA FAW+ YEF + SCFH+ T D +IR++MG++IQVLCS
Sbjct  360   FNRPRLLLSIIHLVFFQNAFQLAHFAWSTYEFSINSCFHKTTVDTIIRLTMGVVIQVLCS  419

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHS--GSVTPLSSRPG  1685
             YVTLPLYALV QMGS MKPTIFN+RVA ALK WH T++K ++ ++HS   +VTP SSR  
Sbjct  420   YVTLPLYALVAQMGSTMKPTIFNDRVAAALKKWHHTSKKHVKDRKHSEGNNVTPFSSRSS  479

Query  1686  TPLHGTSPIHLL-QYYKSEIDSVGASPARDIEDN  1784
             TP  G SPIHLL ++     DS   SP     +N
Sbjct  480   TPTFGMSPIHLLHRHLAGRSDSAQTSPRTSNYEN  513



>ref|XP_009141792.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=572

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/579 (59%), Positives = 414/579 (72%), Gaps = 42/579 (7%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFV++ ISI+IEY +H IG   +K++KKAL EALEK+KAELMLLGF
Sbjct  6     RSLEETPTWAVAVVCFVILFISILIEYFLHFIGHWFKKKHKKALCEALEKVKAELMLLGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLL V Q+ + +ICI      +WHPC R +E  KYG D  D               ++
Sbjct  66    ISLLLVVLQTPVSEICIPNRAAATWHPCSRAQELAKYGQDYIDDGRKILEDYD-----SN  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FHVLYCI T A G+
Sbjct  121   DFYSP---RRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHVLYCITTYALGK  177

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LW+ CFFRQF 
Sbjct  178   TKMKKWKSWEKETKTIEYQYANDPERFRFARDTSFGRRHLNVWSKSSVTLWMTCFFRQFF  237

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL   S+  FDFQ+YI+RSLEEDFKVVVGISP IW  AV+F+
Sbjct  238   GSVTKVDYLTLRHGFIMAHLPAGSEARFDFQKYIQRSLEEDFKVVVGISPLIWCIAVLFI  297

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPFIPL++IL+VG KLQVII+K+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  298   LTNTHGWASYLWLPFIPLLVILVVGAKLQVIISKLGLRIQDKGDVVKGAPVVEPGDDLFW  357

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI MG+LIQVLCS
Sbjct  358   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDITIRIVMGVLIQVLCS  417

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+K  +   HSGS TP  SRP TP
Sbjct  418   YITLPLYALVTQMGTSMRPTIFNDRVANALKKWHNTAKKHTKHG-HSGSNTP--SRPTTP  474

Query  1692  LHGTSPIHLL-QYYKSEID---SVGASPA--------------------------RDIED  1781
              HG SP+HLL  Y+   +D   S  ASP+                           +I D
Sbjct  475   THGMSPVHLLHNYHNRSLDQQTSFTASPSPPRFSDYGGQGHQRFFDPESQSVSCQHEITD  534

Query  1782  NLPWFNQRRDNNVDQPAEENRNELQREIEMESAEFSFEN  1898
             +    +Q    +   P  E R E+   + ++  EF+F+ 
Sbjct  535   SENTNSQHPHADTTSPVREER-EITEHVRVDLPEFTFKK  572



>ref|XP_008233336.1| PREDICTED: MLO-like protein 6 [Prunus mume]
 ref|XP_008233339.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=571

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/552 (62%), Positives = 409/552 (74%), Gaps = 25/552 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLEETPTWAVA VCFVL+A+SI IE++IHLIGK L  ++K+AL EALEKIK+
Sbjct  1     MAELSKERSLEETPTWAVAVVCFVLLAVSIFIEHIIHLIGKWLTSKHKRALVEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q  I  ICI KS+G+SW PC +                       
Sbjct  61    ELMLLGFISLLLTVLQDYISDICIPKSIGDSWLPCSKEARSKSENKGRKLLY--------  112

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                 F++ ++   S+RR LA  G D C+KEG V F+SA GIHQLHIFIFVLALFHVLYCI
Sbjct  113   ----FSNPDF---SYRRRLAVKGDDYCSKEGKVAFVSAYGIHQLHIFIFVLALFHVLYCI  165

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TL  GR KMRKWK WE ET+++E+Q+ +DPERFRFARDTSFG+RHL F  RSP  LWIV
Sbjct  166   LTLTLGRYKMRKWKVWEKETRSIEHQYYNDPERFRFARDTSFGQRHLKF--RSPLTLWIV  223

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQ  +SV +VDY+TLRHGFI+AHLAP S+  FDF++YI RSLEEDFKVVV ISP IW
Sbjct  224   SFFRQLFQSVTRVDYLTLRHGFIMAHLAPDSETTFDFRKYISRSLEEDFKVVVEISPIIW  283

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL N +G  SY WLPFIPLVIILLVGTKLQVII+ MGLRIQERG+VVKG P+VQ
Sbjct  284   FSAVLFLLSNAYGWYSYFWLPFIPLVIILLVGTKLQVIISMMGLRIQERGDVVKGAPLVQ  343

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWF  PR ML+LIHFVLFQNAFQLAFFAW+ Y FG+KSCFHE+ ED+VIRISMG+
Sbjct  344   PGDHLFWFGSPRYMLFLIHFVLFQNAFQLAFFAWSTYAFGIKSCFHERNEDIVIRISMGV  403

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q LCSYVTLPLYALVTQMGS MK T+FNE V +ALKSWH  A+K+ +   HS S TP 
Sbjct  404   IVQFLCSYVTLPLYALVTQMGSTMKRTVFNEEVVRALKSWHNKAKKKTKLGPHSHSNTPF  463

Query  1671  SSRPGTPLHG--TSPIHLL-QYYKSEIDSVGASP-ARDIEDN---LPWFNQRRDNNVDQP  1829
             SS PGTP  G   SP+HLL ++ +S+ D    SP A ++E +   +   +   +NN   P
Sbjct  464   SSTPGTPSQGLRMSPVHLLHKHNRSDADGYYVSPRASNLELSHWEIEGSSHSLNNNNAGP  523

Query  1830  AE-ENRNELQRE  1862
             ++ E   EL +E
Sbjct  524   SDPEEIRELDQE  535



>ref|XP_006391995.1| hypothetical protein EUTSA_v10023372mg [Eutrema salsugineum]
 gb|ESQ29281.1| hypothetical protein EUTSA_v10023372mg [Eutrema salsugineum]
Length=585

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/589 (56%), Positives = 411/589 (70%), Gaps = 51/589 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             + L++T TWAVA VCFVL+ ISIVIE +IH +G   +++NKKALYEALEK+KAELML+GF
Sbjct  8     KDLQQTSTWAVAVVCFVLLLISIVIEKLIHKVGTWFKRKNKKALYEALEKVKAELMLMGF  67

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLT+GQ+    ICISKS+  S HPC + E    YG      +              D
Sbjct  68    LSLLLTIGQNFTSNICISKSIAASMHPCSKEEAARIYGPKEDPRNDK-----------GD  116

Query  612   DEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             +E SG            RR LA  G DKCAK+G V F+SA G+HQLHIFIFVLA+ HV+Y
Sbjct  117   EENSGRKLLQLVDSFIPRRSLATKGYDKCAKKGQVAFVSAYGMHQLHIFIFVLAVCHVIY  176

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G  KM++WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWS+S  LLW
Sbjct  177   CIVTYALGNTKMKRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWSKSSILLW  236

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF  SV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V ISP 
Sbjct  237   IVCFFRQFFGSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEISPV  296

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G  SYLW P IP V+IL+VGTKLQVIITK+GL IQE+G+VVKG P+
Sbjct  297   IWFVAVLFLLSNTNGLSSYLWQPIIPFVVILIVGTKLQVIITKLGLLIQEKGDVVKGMPL  356

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             V+P D LFWF RPR +L+LIH VLF NAFQLAFFAW  YEF + +CFH+    ++IRIS+
Sbjct  357   VKPGDHLFWFGRPRFILFLIHLVLFSNAFQLAFFAWTTYEFKIDNCFHKNRAAVIIRISL  416

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+++Q+LCSYVTLPLYALVTQMGS MKPT+FN++VA ALKSWH  A+KQ++  R+S S T
Sbjct  417   GVIVQILCSYVTLPLYALVTQMGSKMKPTVFNKKVATALKSWHHKAKKQIKHGRNSESTT  476

Query  1665  PLSSRPGTPLHGTSPIHLLQYYK-------------------SEIDSVGASPARDIEDNL  1787
             P SSRP TP  G+SPIHLL+ +                    S+ DS    P  +   + 
Sbjct  477   PFSSRPTTPTRGSSPIHLLRNFHKRSRSADESFVNSLSSPRYSDFDSWEPEPQHEASSSA  536

Query  1788  PWFNQRRDNNVDQPA------------EENRNELQREIEMESAEFSFEN  1898
                ++ R+ + +  A            E+   +LQ EI +   +FSF+ 
Sbjct  537   YHHSRVREEDFENKASSSSVVELPSRPEQIPTQLQHEITISLRDFSFKK  585



>gb|AFH68055.1| seven transmembrane calmodulin binding protein [Capsicum annuum]
Length=528

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/562 (58%), Positives = 404/562 (72%), Gaps = 50/562 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RS+E TPTWAVA VCF+L+AISI IE ++H +G+ L K++KK LYEALEKIKAELMLLGF
Sbjct  5     RSMEATPTWAVAVVCFILLAISIFIEQIMHHLGEWLLKKHKKPLYEALEKIKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  +  +C+ KS+G SWHPC                              AD
Sbjct  65    ISLLLTVIQDPVSNLCVPKSVGYSWHPCK-----------------------------AD  95

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             ++   E           D C ++G V F S+  IHQLHIFIFVLA+ HVLYCI T A GR
Sbjct  96    EDVKSEY---------DDPCLQKGKVQFASSYAIHQLHIFIFVLAIAHVLYCIATFALGR  146

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             LKMRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRH+ FWS+SP +LWIVCFFRQF 
Sbjct  147   LKMRKWRAWEDETKTIEYQFYNDPERFRFARETSFGRRHMHFWSKSPVMLWIVCFFRQFF  206

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF++AHL PQ+Q NFDFQ YI R++++DFKVVVGISP +WLF V++ 
Sbjct  207   SSVAKVDYLTLRHGFMMAHLTPQNQENFDFQIYINRAVDKDFKVVVGISPALWLFTVLYF  266

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T G  SYLW+PF+PL+IILLVGTKLQ+IIT+MG+RI ERG++VKG PVV+  D LFW
Sbjct  267   LSTTDGVYSYLWVPFVPLIIILLVGTKLQMIITEMGVRISERGDIVKGVPVVEIGDHLFW  326

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+L+ I+FVLFQNAFQ+AFF W+W++FG  SCFH    DL IR++MG++IQV CS
Sbjct  327   FNRPGLVLFFINFVLFQNAFQVAFFVWSWWKFGFPSCFHRNAADLAIRLTMGVIIQVHCS  386

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS+MKP IF + VA AL+SWH TA+K++R  R S + TP+SSRP TP
Sbjct  387   YVTLPLYALVTQMGSSMKPIIFGDNVATALRSWHNTAKKRVRHGRVSENTTPISSRPATP  446

Query  1692  LHGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAE-----------  1835
             L GTSP+HLL+ Y K   D+V A P     +N  W N+    N D   E           
Sbjct  447   LRGTSPVHLLRGYPKYNEDNVQAYPRTSNVENEGWANETSTENKDHQEEGQILQHASTSM  506

Query  1836  ENRNELQREIEMESAEFSFENK  1901
             ++ +  Q +IE+  ++F+F NK
Sbjct  507   QHPHTDQHQIEIAMSDFTFGNK  528



>ref|XP_002322867.1| hypothetical protein POPTR_0016s08940g [Populus trichocarpa]
 gb|EEF04628.1| hypothetical protein POPTR_0016s08940g [Populus trichocarpa]
Length=488

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/521 (65%), Positives = 398/521 (76%), Gaps = 47/521 (9%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLEETPTWAVA VCFV+V ISI+IE++IHLIGK L+KR K+ALYEALEKIK+
Sbjct  1     MAEAVKARSLEETPTWAVAVVCFVMVLISIIIEHIIHLIGKWLKKRRKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLT+GQ  I +IC+ KS+G +WHPC + E++                   
Sbjct  61    ELMLLGFMSLLLTIGQGPISEICVPKSVGATWHPCKKQEKDP------------------  102

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                  ++DE            GG+DKCA++     +SADGI QL+IFIFVLA FHVL CI
Sbjct  103   -----SEDE-----------NGGSDKCAEKAF-SLVSADGITQLNIFIFVLAAFHVLCCI  145

Query  771   ITLAFGRLK---MRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLL  941
             ITL   R K   MRKWK WE ET T  YQF+HDP RFRFAR+TSFGRRHL+FW+RSP LL
Sbjct  146   ITLTLSRAKACTMRKWKKWEIETTTSNYQFSHDPVRFRFARETSFGRRHLNFWARSPILL  205

Query  942   WIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISP  1121
             WIVCFFRQF+RSVPKVDY+TLRHGFI AHLAP+SQ  FDFQ YIKRSLEEDFKVVVGISP
Sbjct  206   WIVCFFRQFLRSVPKVDYLTLRHGFITAHLAPRSQTKFDFQTYIKRSLEEDFKVVVGISP  265

Query  1122  PIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
              IW FAV+FLLFNT+G  SYLWLPFIPL++IL V TKLQV+IT+MGLRIQ   +VV+GTP
Sbjct  266   TIWFFAVLFLLFNTYGWYSYLWLPFIPLIVILSVSTKLQVVITQMGLRIQGT-QVVRGTP  324

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawa--------wYEFGLKSCFHEKT  1457
             VVQP DDLFWFN PRL+LYLI+FVLFQNAFQ AFFAW          YEFGLKSCFH+  
Sbjct  325   VVQPGDDLFWFNHPRLLLYLINFVLFQNAFQFAFFAWTWASFFGFITYEFGLKSCFHKYP  384

Query  1458  EDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLR  1637
             EDL++RI+M  ++Q  CSYVTLPLYALVTQMG+ M+PTIFNER+AKAL++WH TA++ ++
Sbjct  385   EDLILRITMWAIVQFFCSYVTLPLYALVTQMGTTMRPTIFNERLAKALRNWHHTAKQHVK  444

Query  1638  QKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGAS  1760
             Q RHSG+VTP +S PGTP H  SP+H L  Y+ E   + AS
Sbjct  445   QNRHSGTVTPATSAPGTPSHTISPVHPLHDYRGESGGIQAS  485



>gb|KFK35674.1| hypothetical protein AALP_AA4G022500 [Arabis alpina]
Length=576

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/545 (61%), Positives = 407/545 (75%), Gaps = 20/545 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E  IH IG   ++++KKAL+EALEK+KA
Sbjct  1     MANQVKERTLEETSTWAVAVVCFVLLFISIVLEKSIHKIGTWFKQKHKKALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICIS+ + +S HPC           +     G +   ++
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISQKVASSMHPCS--------AAEEARKYGKKDTGKK  112

Query  591   lllAFADDEYSGES----------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFV  740
                   + E SG            HRR LA  G DKCA++G V F+SA GIHQLHIFIFV
Sbjct  113   EGDGDGEKEKSGRRLLLELADTYIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFV  172

Query  741   LALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFW  920
             LA+ HV+YCI+T A G+ KMR+WK WE+ETKT+EYQ+ +DPERFRFARDTSFGRRHL+FW
Sbjct  173   LAVVHVIYCIVTYALGKTKMRRWKQWENETKTIEYQYANDPERFRFARDTSFGRRHLNFW  232

Query  921   SRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFK  1100
             S++   LWIVCFFRQF  SV KVDY+ LRHGFI AH AP  + NFDF++YI+RSLEEDFK
Sbjct  233   SKTRVTLWIVCFFRQFFGSVTKVDYLALRHGFITAHFAP-GEKNFDFRKYIQRSLEEDFK  291

Query  1101  VVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERG  1280
              VV ISP IW  AV+FLL NT G RSYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G
Sbjct  292   TVVEISPVIWFVAVLFLLTNTSGLRSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKG  351

Query  1281  EVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTE  1460
             +VV+G PVVQP DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE + 
Sbjct  352   DVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFKLKNCFHESSA  411

Query  1461  DLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ  1640
             D+VIRI +G ++Q+LCSYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+K+ + 
Sbjct  412   DVVIRIVVGGVVQILCSYVTLPLYALVTQMGTTMKPTVFNERVATALKQWHHTAKKETKH  471

Query  1641  KRHSGSVTPLSSRPGTPLHGTSPIHLL-QYYKSEIDSVGASPARDIEDNLPWFNQRRDNN  1817
              RHS S TP SSRP TP HG+SPIHLL  Y K  ++S   SP+    D   +++    ++
Sbjct  472   GRHSESNTPYSSRPTTPTHGSSPIHLLHNYNKRSVESFPNSPSPRHSDGHHFWDPESQHH  531

Query  1818  VDQPA  1832
             V + +
Sbjct  532   VAESS  536



>ref|NP_001288934.1| MLO-like protein 2 [Brassica rapa]
 gb|AAX77014.1| MLO1 [Brassica rapa]
Length=574

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/558 (61%), Positives = 414/558 (74%), Gaps = 9/558 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E+ IH IG   ++++KKALYEALEK+KA
Sbjct  1     MADQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGSWFKQKHKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICIS+++ +S HPC   +E +KYG       G +   + 
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISQNVASSMHPCSAAQEAEKYGKKDSGKKGGDDDEKP  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                   +   S    RR LA  G DKCA++G V F+SA GIHQLHIFIFVLA+ HV+YCI
Sbjct  121   SHRLLLELAESFIP-RRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVIYCI  179

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T A G+ KMR+WK WE+ETKT+EYQ+ +DPERFRFARDTSFGRRHL+FWS++   LW V
Sbjct  180   VTYALGKTKMRRWKQWENETKTIEYQYANDPERFRFARDTSFGRRHLNFWSKTSITLWTV  239

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+ LRHGFI AH AP S+ +FDF++YI+RSLEEDFK VV ISP IW
Sbjct  240   CFFRQFFGSVTKVDYLALRHGFITAHFAPGSERSFDFRKYIQRSLEEDFKTVVEISPVIW  299

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G RSYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G+VV+G PVVQ
Sbjct  300   FVAVLFLLTNTNGLRSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKGDVVRGAPVVQ  359

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE   D++IRI +G+
Sbjct  360   PGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVIIRIVVGV  419

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+KQ +  RHS S TP 
Sbjct  420   VVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKKQTKHGRHSESTTPY  479

Query  1671  SSRPGTPLHGTSPIHLLQYYK-SEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRN  1847
             SSRP TP HG+SPIHLL  +    ++S   SP+       P ++   D++     E  R 
Sbjct  480   SSRPTTPTHGSSPIHLLHNFNHRSVESFPNSPS-------PRYSSHHDDHQFWDPESQRQ  532

Query  1848  ELQREIEMESAEFSFENK  1901
             E         A  S E K
Sbjct  533   EAGSSSHHSLAHESSEKK  550



>ref|XP_010458517.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=575

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/515 (65%), Positives = 402/515 (78%), Gaps = 6/515 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E  IH IG   +K++KKAL+EALEK+KA
Sbjct  1     MANQVKERTLEETSTWAVAVVCFVLLFISIVLEKYIHKIGTWFKKKHKKALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICISK + ++ HPC   EE  KY         D    + 
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISKHVASTMHPCSAEEEARKYHKKDTGKKEDGDGDKP  120

Query  591   lllAFADDEYSGESH--RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
                   +     ES+  RR LA  G DKCA++G V F+SA GIHQLHIFIFVLA+ HV+Y
Sbjct  121   SHRLLLE---LAESYIPRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVIY  177

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHLSFWS++   LW
Sbjct  178   CIVTYALGKTKMRRWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLSFWSKTSITLW  237

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF  SV KVDY+ LRHGFI+AHLA  S+  FDF++YI+RSLEEDFK VV ISP 
Sbjct  238   IVCFFRQFYGSVTKVDYLALRHGFIMAHLAHGSESRFDFRKYIQRSLEEDFKTVVEISPV  297

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G RSYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G+VV+G PV
Sbjct  298   IWFVAVLFLLTNTNGLRSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKGDVVRGAPV  357

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP DDLFWF +PR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE   D+VIRI +
Sbjct  358   VQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVVIRIVV  417

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+++Q+LCSYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+ Q +  RHSGS T
Sbjct  418   GVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKDQTKHGRHSGSNT  477

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPA  1766
             P SSRP TP HG+SPIHLL  + +  ++S  ASP+
Sbjct  478   PFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPS  512



>ref|XP_006592218.1| PREDICTED: MLO-like protein 6-like isoform X2 [Glycine max]
Length=434

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/440 (71%), Positives = 371/440 (84%), Gaps = 7/440 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG GGR+LEETPTWAV+AVCFVL+ ISI IE++IHLIGK L+K++++ALYE+LEKIK+
Sbjct  1     MAGGSGGRNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICIS+ +  +WHPCD     +    ++ +          
Sbjct  61    ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCDDSSNHESDSEESENRTNSRRLLAA  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                 +  D+ +    RR+LAGGG DKC  EG VPF+S+DGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   F---YGSDDVNP---RRVLAGGGADKCP-EGKVPFVSSDGIHQLHIFIFVLAVFHVLYCI  173

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              T+A GR KM++WK WE ETKT EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WIV
Sbjct  174   FTMALGRAKMKRWKRWEEETKTTEYQFSHDPERFRFARETSFGRRHLSFWTKNPVLIWIV  233

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVP VDY+TLRHGFI+AHLAPQS   FDF++YIKRSL+EDFKVVVGISPP W
Sbjct  234   CFFRQFVRSVPNVDYLTLRHGFIMAHLAPQSHSKFDFRKYIKRSLDEDFKVVVGISPPFW  293

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  SYLWLPFIPL+IILLVGTKLQVIIT+MGL+IQ+RGEV+KG P+VQ
Sbjct  294   FFAVLFLLLNTHGWYSYLWLPFIPLIIILLVGTKLQVIITEMGLKIQQRGEVLKGVPLVQ  353

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRP L+LYLI+FVLFQNAFQLAFFAW+  +FG+KSCFH  TED+VIRI+MG+
Sbjct  354   PGDHLFWFNRPGLILYLINFVLFQNAFQLAFFAWSALQFGIKSCFHSHTEDVVIRITMGV  413

Query  1491  LIQVLCSYVTLPLYALVTQM  1550
             LIQ+LCSYVTLPLYALVTQ+
Sbjct  414   LIQILCSYVTLPLYALVTQI  433



>ref|XP_010492667.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=577

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/515 (65%), Positives = 403/515 (78%), Gaps = 4/515 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E  IH IG   +K++KKAL+EALEK+KA
Sbjct  1     MANQVKERTLEETSTWAVAVVCFVLLFISIVLEKSIHKIGTWFKKKHKKALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICISK++ ++ HPC    E  KY         D      
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISKNVASTMHPCSAEAEARKYHKKDTGKKEDGDGDGD  120

Query  591   lllAFADDEYSGESH--RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
               +     E + ES+  RR LA  G DKCA++G V F+SA GIHQLHIFIFVLA+ HV+Y
Sbjct  121   KPVHRLLLELA-ESYIPRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVIY  179

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHLSFWS++   LW
Sbjct  180   CIVTYALGKTKMRRWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLSFWSKTSITLW  239

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF  SV KVDY+ LRHGFI+AHLA  S+  FDF++YI+RSLEEDFK VV ISP 
Sbjct  240   IVCFFRQFYGSVTKVDYLALRHGFIMAHLAHGSESRFDFRKYIQRSLEEDFKTVVEISPV  299

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G RSYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G+VV+G PV
Sbjct  300   IWFVAVLFLLTNTNGLRSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKGDVVRGAPV  359

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP DDLFWF +PR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE   D+VIRI +
Sbjct  360   VQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVVIRIVV  419

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+++Q+LCSYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+ Q +  RHSGS T
Sbjct  420   GVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKDQTKHGRHSGSNT  479

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPA  1766
             P SSRP TP HG+SPIHLL  + +  ++S  ASP+
Sbjct  480   PFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPS  514



>gb|AIT98397.1| MLO1 [Solanum melongena]
Length=523

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/557 (58%), Positives = 406/557 (73%), Gaps = 45/557 (8%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RS+E TPTWAVA VCF+L+AISI IE +IH +G+ L +++KK L+EALEKIKAELMLLGF
Sbjct  5     RSMEGTPTWAVAVVCFILLAISIFIEQIIHHLGEWLLEKHKKPLHEALEKIKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  +  IC+ K++G SWHPC                            A  D
Sbjct  65    ISLLLTVVQDPVSNICVPKTVGYSWHPCK---------------------------AQED  97

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D+   +           D C ++G V F S+  IHQLHIFIFVLA+ HVLYCI T A GR
Sbjct  98    DKPKYD-----------DPCLEKGKVQFASSYAIHQLHIFIFVLAVAHVLYCIATFALGR  146

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             LKMRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRHL FWS+SP LLWIVCFFRQF 
Sbjct  147   LKMRKWRAWEDETKTIEYQFYNDPERFRFARETSFGRRHLHFWSKSPLLLWIVCFFRQFF  206

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF++AHL P++Q NFDFQ YI R++++DFKVVVGISP +WLF V++ 
Sbjct  207   SSVAKVDYLTLRHGFMMAHLTPENQKNFDFQIYINRAVDKDFKVVVGISPALWLFTVLYF  266

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T G  SYLW+PF+PL+IILLVGTKLQ+IIT+MG+RI ERG++VKG PVV+  D LFW
Sbjct  267   LTTTDGLYSYLWVPFVPLIIILLVGTKLQMIITEMGVRISERGDIVKGVPVVETGDHLFW  326

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+L+LI+FVLFQNAFQ+AFF W+W++F   SCFH+   DL IR++MG++IQV CS
Sbjct  327   FNRPGLVLFLINFVLFQNAFQVAFFVWSWWKFDFPSCFHKNAADLAIRLTMGVIIQVHCS  386

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS+MKP IF + VA AL+SWH  A+K+++  R SG+ TP+SSRP TP
Sbjct  387   YVTLPLYALVTQMGSSMKPIIFGDNVATALRSWHHMAKKRVKHGRLSGNTTPVSSRPTTP  446

Query  1692  LHGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQ----  1856
             LHGTSP+HLL+ Y +   DSV ASP     +N  W N+   +N D         ++    
Sbjct  447   LHGTSPVHLLRGYPQYNEDSVQASPRTSNVENEGWANEISTDNKDYQEGHASTSVRPPHA  506

Query  1857  --REIEMESAEFSFENK  1901
               ++IE+  ++F+F NK
Sbjct  507   HNQQIEITMSDFTFGNK  523



>gb|KFK40693.1| hypothetical protein AALP_AA2G029100 [Arabis alpina]
Length=594

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/557 (59%), Positives = 400/557 (72%), Gaps = 8/557 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA      +L+ET TW VA VCF L+ ISIVIE +IH +G   + +NKKA+YEALEKIKA
Sbjct  1     MADQVYEATLQETSTWPVAVVCFFLLLISIVIEKLIHKLGTWFKNKNKKAMYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GF+SLLLT+GQ  I +ICISK +  S HPC   E E        +   +EG    
Sbjct  61    ELMLMGFLSLLLTIGQDYISQICISKGIAASMHPCSAAELEKLTKKKPKNDAENEGEEEE  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                    +       RR LA  G DKCA++G V F+S+ G+HQLHIFIFVLA+ HV+YCI
Sbjct  121   HSGRKLLELVESFIPRRSLATKGYDKCAEKGKVAFVSSYGMHQLHIFIFVLAVCHVIYCI  180

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +  A G+ KMR WK WE ETKT+EYQ+++DPERFRFARDTSFGRRHL+ WS+S   LW V
Sbjct  181   VIYALGKTKMRSWKRWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNIWSKSTITLWFV  240

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V ISP IW
Sbjct  241   CFFRQFFGSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEISPVIW  300

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  SYLWLPFIP  +IL+VGTKLQVIITK+GLRI E+G+VVKGTP+VQ
Sbjct  301   FVAVLFLLSNTNGLNSYLWLPFIPFTVILIVGTKLQVIITKLGLRIHEKGDVVKGTPLVQ  360

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D  FWF RPR ML+LIH VLF NAFQLAFFAW+ YEF LK+CFH+   D++IRI++G+
Sbjct  361   PGDHFFWFGRPRFMLFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHKNNIDVIIRIALGV  420

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  R+S S TP 
Sbjct  421   IVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKQIKHGRNSESTTPF  480

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPA-------RDIEDNLPWFNQRRDNNVDQP  1829
             SSRP TP HG+SPIHLL+       S   + +       R  + + PW  + +   V Q 
Sbjct  481   SSRPTTPTHGSSPIHLLRNVHKRSKSFDDNNSFANSISPRHSDFDSPWDPESQQETV-QA  539

Query  1830  AEENRNELQREIEMESA  1880
             +  + N+  R  E E +
Sbjct  540   SSSSMNQHSRFREEEDS  556



>gb|KHN05728.1| MLO-like protein 6 [Glycine soja]
Length=504

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/439 (71%), Positives = 370/439 (84%), Gaps = 7/439 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG GGR+LEETPTWAV+AVCFVL+ ISI IE++IHLIGK L+K++++ALYE+LEKIK+
Sbjct  1     MAGGSGGRNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICIS+ +  +WHPCD     +    ++ +          
Sbjct  61    ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCDDSSNHESDSEESENRTNSRRLLAA  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                 +  D+ +    RR+LAGGG DKC  EG VPF+S+DGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   F---YGSDDVNP---RRVLAGGGADKCP-EGKVPFVSSDGIHQLHIFIFVLAVFHVLYCI  173

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              T+A GR KM++WK WE ETKT EYQF+HDPERFRFAR+TSFGRRHLSFW+++P L+WIV
Sbjct  174   FTMALGRAKMKRWKRWEEETKTPEYQFSHDPERFRFARETSFGRRHLSFWTKNPVLIWIV  233

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVP VDY+TLRHGFI+AHLAPQS   FDF++YIKRSL+EDFKVVVGISPP W
Sbjct  234   CFFRQFVRSVPNVDYLTLRHGFIMAHLAPQSHSKFDFRKYIKRSLDEDFKVVVGISPPFW  293

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTHG  SYLWLPFIPL+IILLVGTKLQVIIT+MGL+IQ+RGEV+KG P+VQ
Sbjct  294   FFAVLFLLLNTHGWYSYLWLPFIPLIIILLVGTKLQVIITEMGLKIQQRGEVLKGVPLVQ  353

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRP L+LYLI+FVLFQNAFQLAFFAW+  +FG+KSCFH  TED+VIRI+MG+
Sbjct  354   PGDHLFWFNRPGLILYLINFVLFQNAFQLAFFAWSALQFGIKSCFHSHTEDVVIRITMGV  413

Query  1491  LIQVLCSYVTLPLYALVTQ  1547
             LIQ+LCSYVTLPLYALVTQ
Sbjct  414   LIQILCSYVTLPLYALVTQ  432



>ref|XP_010476039.1| PREDICTED: MLO-like protein 2 isoform X1 [Camelina sativa]
Length=576

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/515 (65%), Positives = 401/515 (78%), Gaps = 6/515 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E  IH IG   +K++KKAL+EALEK+KA
Sbjct  1     MANQVKERTLEETSTWAVAVVCFVLLFISIVLEKSIHKIGTWFKKKHKKALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICISK + ++ HPC   +E  KY         D    + 
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISKHVASTMHPCSAEDEARKYHKKDTGKKEDGDGDKH  120

Query  591   lllAFADDEYSGESH--RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
                   +     ES+  RR LA  G DKCA++G V F+S+ GIHQLHIFIFVLA+ HV+Y
Sbjct  121   GRRLLLE---LAESYIPRRSLATKGYDKCAEKGKVAFVSSYGIHQLHIFIFVLAVVHVIY  177

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHLSFWS++   LW
Sbjct  178   CIVTYALGKTKMRRWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLSFWSKTSITLW  237

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF  SV KVDY+ LRHGFI+AHLA  S+  FDF++YI+RSLEEDFK VV ISP 
Sbjct  238   IVCFFRQFYGSVTKVDYLALRHGFIMAHLAHGSESRFDFRKYIQRSLEEDFKTVVEISPV  297

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G RSYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G+VV+G PV
Sbjct  298   IWFVAVLFLLTNTNGLRSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKGDVVRGAPV  357

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP DDLFWF +PR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE   D+VIRI +
Sbjct  358   VQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVVIRIVV  417

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+++Q+LCSYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+ Q +  RHS S T
Sbjct  418   GVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKDQTKHGRHSESNT  477

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPA  1766
             P SSRP TP HG+SPIHLL  + +  ++S  ASP+
Sbjct  478   PFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPS  512



>ref|XP_011089323.1| PREDICTED: MLO-like protein 6 [Sesamum indicum]
Length=533

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/491 (68%), Positives = 391/491 (80%), Gaps = 15/491 (3%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVGQ  I  ICISK  G +WHPC + +E+     ++    GD+ RR+ L 
Sbjct  1     MLLGFISLLLTVGQGPISDICISKKAGATWHPCSKKQEQYSKYPESSKNIGDDTRRKLLS  60

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
                ADD     + RR+LA G   K A +G V F+SADGIHQLHIFIFVLA+FHVLYCI+T
Sbjct  61    ---ADDG----NFRRMLAAGVKLKRALQGKVAFVSADGIHQLHIFIFVLAIFHVLYCILT  113

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
             +A GR KM  WKAWE ET+T EYQF+HDPERFRFAR+TSFGRRHLSFWS++P LLWIVCF
Sbjct  114   MALGRAKMSSWKAWEIETRTAEYQFSHDPERFRFARETSFGRRHLSFWSKTPVLLWIVCF  173

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQFVRSVPK+DY+TLRHGFI+AHLAPQS   FDFQ+YI RSLEEDFKVVVGISPPIWLF
Sbjct  174   FRQFVRSVPKIDYLTLRHGFIVAHLAPQSHAKFDFQKYINRSLEEDFKVVVGISPPIWLF  233

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+FLLFNTHG  SYLWLPFIPL+IIL+VGTKLQVIIT+MG+RIQERGEVVKG PVVQP 
Sbjct  234   AVLFLLFNTHGWYSYLWLPFIPLIIILVVGTKLQVIITRMGVRIQERGEVVKGVPVVQPG  293

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             DDLFWFNRPRL+LYLI+FVLFQNAFQLA FAW WYEFGLKSCFHE  ED+VIRI+MG+LI
Sbjct  294   DDLFWFNRPRLILYLINFVLFQNAFQLALFAWTWYEFGLKSCFHEHVEDIVIRITMGILI  353

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             Q+LCSYVTLPLYALVTQMGS MKPTIFNERVA AL++WH TA+K ++Q +HS   TP S+
Sbjct  354   QILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTAKKHIKQTKHSAPTTPTST  413

Query  1677  RPGTPLHGTSPIHLLQYYKSEIDSVGASPAR--------DIEDNLPWFNQRRDNNVDQPA  1832
             RP TP HG SP+HLL++++SE+DS   S  +        DIE +       + N     +
Sbjct  414   RPPTPSHGFSPVHLLRHHRSEMDSFQTSSWKSNSNVDRWDIEGSPSTTRSHQGNGSSPSS  473

Query  1833  EENRNELQREI  1865
               +R E++ E+
Sbjct  474   HHHRAEVEHEV  484



>ref|XP_010430163.1| PREDICTED: MLO-like protein 6 isoform X2 [Camelina sativa]
Length=633

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/563 (59%), Positives = 399/563 (71%), Gaps = 30/563 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++LEET TWAVA VCFVL+ ISIVIE +IH IG   + +NKKALYEALEK+KAELML+GF
Sbjct  44    KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  103

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ  I  ICI K++  S HPC                        +      D
Sbjct  104   ISLLLTIGQGYISNICIPKNIAASMHPCS---------ASEEARKYGNKDVPKEEDGDND  154

Query  612   DEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             DE S             RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+Y
Sbjct  155   DENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIY  214

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHLSFWSR+   LW
Sbjct  215   CIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLSFWSRTTITLW  274

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P 
Sbjct  275   IVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPV  334

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G  SYLWLPFIP V+IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+
Sbjct  335   IWFVAVLFLLTNTNGLNSYLWLPFIPFVVILVVGTKLQVIITKLGLRIQEKGDVVKGTPL  394

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTE--DLVIRI  1478
             VQP D  FWF RPR +L+LIH VLF NAFQLAFF W+      ++C   K    D++IRI
Sbjct  395   VQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWST--VSKQNCILHKLNNVDVIIRI  452

Query  1479  SMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGS  1658
             S+GL++Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++  R S S
Sbjct  453   SIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKQMKHGRSSES  512

Query  1659  VTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLP-WFNQRRDNNVDQPAE  1835
              TP SSRP TP HG+SPIHLL+       +V    +R  +D      + RR+++ D    
Sbjct  513   TTPFSSRPTTPTHGSSPIHLLR-------NVPHKRSRSFDDGFANSMSPRRNSDFDSWDP  565

Query  1836  ENRNELQREIEMESAEFSFENKR  1904
             E+++      E  +   S    R
Sbjct  566   ESQSPHHETAEASTNSVSNHRSR  588



>gb|KHN13369.1| MLO-like protein 12 [Glycine soja]
Length=592

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/535 (61%), Positives = 390/535 (73%), Gaps = 33/535 (6%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLE+TPTWA A VCFVL+AISI+IE+VI  IGK  +K++K ALYE+LEK+K ELM+LGF
Sbjct  9     RSLEDTPTWAFAVVCFVLLAISIIIEHVIDAIGKWFKKKHKSALYESLEKVKGELMMLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             IS+LL V Q  + KICIS+++ ++WHPC   ++         D D +  +          
Sbjct  69    ISMLLVVFQGPLSKICISQNVASTWHPCSNPKKALSKSDGKSDSDTNGRKLL--------  120

Query  612   DEYSGESHRRILAGGGTDKCAKE---------------------GMVPFISADGIHQLHI  728
              EY     RR+LA  G DKCA +                     G V F+SA GIHQLHI
Sbjct  121   -EYLDPIPRRVLAAKGYDKCADKATSKDSKDSLLITINNKLVWVGKVAFVSAYGIHQLHI  179

Query  729   FIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRH  908
             FIF+LA+FH+L CIIT+A GR KMR+WK WE+ETKT+EYQF +DPERFR A+DT+FG+RH
Sbjct  180   FIFMLAVFHILQCIITIALGRTKMRRWKKWENETKTIEYQFYNDPERFRLAKDTTFGQRH  239

Query  909   LSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLE  1088
             L+ WS+S   LWIV FFRQF  SV KVDY  LRHGFI AHLAP S   FDFQ+YIKRSL+
Sbjct  240   LNTWSQSSISLWIVSFFRQFSGSVKKVDYFALRHGFITAHLAPGSDARFDFQKYIKRSLD  299

Query  1089  EDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRI  1268
             EDFKVVVGISP IW FAV+FLL NTHG  SY WLPFIPL+ ILLVG KLQ+IITKMGLRI
Sbjct  300   EDFKVVVGISPIIWFFAVLFLLANTHGWYSYYWLPFIPLIAILLVGAKLQMIITKMGLRI  359

Query  1269  QERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFH  1448
             Q+RGEV+KG PVV+P DDLFWFNRPRL+L +IH V FQNAFQLA FAW+ YEF + SCFH
Sbjct  360   QDRGEVLKGAPVVEPGDDLFWFNRPRLLLSIIHLVFFQNAFQLAHFAWSTYEFSINSCFH  419

Query  1449  EKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARK  1628
             + T D +IR++MG++IQVLCSYVTLPLYALV QMGS MKPTIFN+RVA ALK WH T++K
Sbjct  420   KTTVDTIIRLTMGVVIQVLCSYVTLPLYALVAQMGSTMKPTIFNDRVAAALKKWHHTSKK  479

Query  1629  QLRQKRHS--GSVTPLSSRPGTPLHGTSPIHLL-QYYKSEIDSVGASPARDIEDN  1784
              ++ ++HS   +VTP SSR  TP  G SPIHLL ++     DS   SP     +N
Sbjct  480   HVKDRKHSEGNNVTPFSSRSSTPTFGMSPIHLLHRHLAGRSDSAQTSPRTSNYEN  534



>ref|XP_010476040.1| PREDICTED: MLO-like protein 2 isoform X2 [Camelina sativa]
Length=573

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/508 (65%), Positives = 398/508 (78%), Gaps = 6/508 (1%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++L+ T TWAVA VCFVL+ ISIVIE  IH IG  L+K+NKK LYEALEK+KAELMLLGF
Sbjct  5     QTLQFTSTWAVAVVCFVLLFISIVIEKSIHRIGTWLKKKNKKDLYEALEKVKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ+ I  ICISK + ++ HPC   +E  KY         D    +       +
Sbjct  65    ISLLLTIGQTPISNICISKHVASTMHPCSAEDEARKYHKKDTGKKEDGDGDKHGRRLLLE  124

Query  612   DEYSGESH--RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
                  ES+  RR LA  G DKCA++G V F+S+ GIHQLHIFIFVLA+ HV+YCI+T A 
Sbjct  125   ---LAESYIPRRSLATKGYDKCAEKGKVAFVSSYGIHQLHIFIFVLAVVHVIYCIVTYAL  181

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             G+ KMR+WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHLSFWS++   LWIVCFFRQ
Sbjct  182   GKTKMRRWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLSFWSKTSITLWIVCFFRQ  241

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             F  SV KVDY+ LRHGFI+AHLA  S+  FDF++YI+RSLEEDFK VV ISP IW  AV+
Sbjct  242   FYGSVTKVDYLALRHGFIMAHLAHGSESRFDFRKYIQRSLEEDFKTVVEISPVIWFVAVL  301

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
             FLL NT+G RSYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G+VV+G PVVQP DDL
Sbjct  302   FLLTNTNGLRSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKGDVVRGAPVVQPGDDL  361

Query  1326  FWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVL  1505
             FWF +PR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE   D+VIRI +G+++Q+L
Sbjct  362   FWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVVIRIVVGVVVQIL  421

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+ Q +  RHS S TP SSRP 
Sbjct  422   CSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKDQTKHGRHSESNTPFSSRPT  481

Query  1686  TPLHGTSPIHLLQYYKS-EIDSVGASPA  1766
             TP HG+SPIHLL  + +  ++S  ASP+
Sbjct  482   TPTHGSSPIHLLHNFNNRSVESYPASPS  509



>gb|KDP25722.1| hypothetical protein JCGZ_23943 [Jatropha curcas]
Length=548

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/581 (57%), Positives = 400/581 (69%), Gaps = 71/581 (12%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R L +TPTWAVA VC V++A+SI IE++ HL  K  +K +K AL EALEKIKAELML+G 
Sbjct  7     RPLGDTPTWAVAVVCLVMIAVSIFIEHIFHLAEKWFKKMHKPALVEALEKIKAELMLMGL  66

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT  Q  I KICISKS+ +SWHPC                               D
Sbjct  67    ISLLLTALQEPISKICISKSVASSWHPC------------------------------VD  96

Query  612   DEYSGESHRRILAGGGTDKCA-KEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
             +E + E           +KC  KE  V F+SA GI QLH FIFVLA+ HVLYCIIT   G
Sbjct  97    EEKAKEYE---------NKCKDKENTVAFVSAYGIDQLHYFIFVLAVVHVLYCIITYILG  147

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
             + KMRKWKAWE ETKT+EYQ+ +DPERFRFARDTSFGRRH+  WSRS   +WIVCFFRQF
Sbjct  148   KTKMRKWKAWEDETKTIEYQYHNDPERFRFARDTSFGRRHMKLWSRSTLFVWIVCFFRQF  207

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
               SV K+DY+TLRHGFI AHLAP S+  FDFQ+YI RSLEEDFKVVVGISP IW  A + 
Sbjct  208   FGSVTKIDYLTLRHGFITAHLAPGSETRFDFQKYINRSLEEDFKVVVGISPVIWFIACLM  267

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             LL +THG  +YLWLPFIPLV++LL+G KLQVIIT+MGLRIQ+RG+VVKG PVV+P DDLF
Sbjct  268   LLTSTHGWYAYLWLPFIPLVVVLLIGAKLQVIITQMGLRIQDRGDVVKGAPVVKPGDDLF  327

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WF RPRL+L+LIH VLFQNAFQLA F W+ ++ G K C+H+KTED+VI+++MG++IQVLC
Sbjct  328   WFGRPRLILFLIHLVLFQNAFQLALFIWSLWKVGSKGCYHDKTEDIVIKVTMGVIIQVLC  387

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGT  1688
             SYVTLPLYALVTQMGS+M+PT+FN+RVA ALK+WH TA+KQ +  RHS S TP+SSRP T
Sbjct  388   SYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTAKKQAKHSRHSESHTPMSSRPQT  447

Query  1689  PLHGTSPIHLLQYYKSEI--DSVGASPARDIEDNLPWFNQRRDNN--------VDQPAEE  1838
             P +G SP+HLL  Y+S    +S+ ASP     +   W  +  +N          + P   
Sbjct  448   PTYGMSPVHLLHNYRSSTAPNSLQASPRNSNYEADNWDPEALNNQQVIGEPEGSESPDAR  507

Query  1839  NRNE---------------------LQREIEMESAEFSFEN  1898
             ++NE                      Q EI +   EF+F+N
Sbjct  508   DQNETAIVVQEPSTMELPPAPGSIRTQHEIGVSLREFTFKN  548



>ref|NP_001268005.1| MLO6 protein [Vitis vinifera]
 gb|ACF25913.1| MLO-like protein 13 [Vitis vinifera]
Length=545

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/582 (58%), Positives = 412/582 (71%), Gaps = 74/582 (13%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSL ETPTWAVA VCFVL+A+SI IE++IH IG  L +RNK+ALYEALEKIKA
Sbjct  1     MADELEDRSLTETPTWAVAVVCFVLLAVSIFIEHIIHHIGSWLARRNKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTV Q+ I KICISKS+G++W+PCD                        
Sbjct  61    ELMLLGFMSLLLTVLQTPISKICISKSVGSTWYPCD------------------------  96

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKE-GMVPFISADGIHQLHIFIFVLALFHVLYC  767
                   + E+              + C  E G VPF+S  GIHQLHIFIFVLALFHV+YC
Sbjct  97    ----VDEKEFK-------------NTCGTESGKVPFVSYYGIHQLHIFIFVLALFHVIYC  139

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             + TLA G  KMR+WK WE ET+T EYQ++HDPERFR+AR+TSFGRRHL+FWS SP LLWI
Sbjct  140   VATLALGTYKMRRWKTWEDETRTAEYQYSHDPERFRYARETSFGRRHLNFWSSSPVLLWI  199

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQF  SV + DY+ LRHGFI+AHLAP+S+  FDF++YI RSLEEDFK VVGISP I
Sbjct  200   VCFFRQFYGSVHRDDYLALRHGFIVAHLAPESERKFDFRKYIHRSLEEDFKAVVGISPVI  259

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W  A++FLL NTHG  SY WLPFIPL+I+LLVGTKLQVIIT++GLRI ERG VVKGTP+V
Sbjct  260   WFCAILFLLTNTHGWYSYFWLPFIPLIILLLVGTKLQVIITELGLRIAERGVVVKGTPIV  319

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P D LFWFNRP LML+LI+FVLF NAFQLAFFAW+ Y  GLKSC+H+ TED VIRI+MG
Sbjct  320   EPGDHLFWFNRPSLMLFLINFVLFLNAFQLAFFAWSTY--GLKSCYHDTTEDYVIRITMG  377

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             ++ QVLCSYVTLPLYALVTQMG+ M+ T+FN++VA AL+ WH+TARK  R   HS  V+P
Sbjct  378   VMTQVLCSYVTLPLYALVTQMGTTMRSTVFNDKVAVALRDWHETARKHTRHG-HSDGVSP  436

Query  1668  LSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQ------RRDNNVDQP  1829
              SSRP TP +G SP+HLLQ Y +  ++   SP     DN  W+ +      ++D++  +P
Sbjct  437   QSSRPSTPSYGMSPVHLLQSYDN--NTPDMSPVASNYDNERWYGEGSGSLGKKDDDEQRP  494

Query  1830  AE-ENRN--------------------ELQREIEMESAEFSF  1892
                E+R                     + Q E+ + S+EFSF
Sbjct  495   ENFESREPGRGTQDSSSAQLALGPLPIQTQHEVNITSSEFSF  536



>ref|XP_007150220.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
 gb|ESW22214.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
Length=420

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/435 (70%), Positives = 362/435 (83%), Gaps = 17/435 (4%)
 Frame = +3

Query  246   GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLL  425
             GGRSLEETPTWAVA VCFVL+ ISIVI+++ HLIGK L+K++K+ALYE+LEKIK+ELMLL
Sbjct  2     GGRSLEETPTWAVAVVCFVLLTISIVIDHIFHLIGKWLKKKHKRALYESLEKIKSELMLL  61

Query  426   GFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAF  605
             GFISLLLTVGQS I +ICIS+ +  ++HPC    +  +                     F
Sbjct  62    GFISLLLTVGQSVISRICISEKVAGTFHPCTHKTDHTRRLLPEL---------------F  106

Query  606   ADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
               D    ++ RRILA GGTDKCA +G VPF+S++GIHQLHIFIFVLA+FHVLYCI+TLA 
Sbjct  107   RSDH--NQNLRRILAAGGTDKCAAQGKVPFVSSEGIHQLHIFIFVLAVFHVLYCILTLAL  164

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             GR KMR+WK WE ETKT +YQF+HDPERFRFAR+TSFGRRHLSFW++   L+WI+CFFRQ
Sbjct  165   GRAKMRRWKRWEEETKTAQYQFSHDPERFRFARETSFGRRHLSFWTQHTILVWIICFFRQ  224

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             FVRSVPKVDY+TLRHGF++AHL PQS+  FDF+QYIKRSLEEDFKVVV ISPPIW   V+
Sbjct  225   FVRSVPKVDYLTLRHGFMMAHLGPQSRHKFDFRQYIKRSLEEDFKVVVEISPPIWFITVL  284

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
             FLLF+THG  SYLWLPF PL+I+LLVGTKLQVIITKMG RIQERGEVVKG P+VQP DDL
Sbjct  285   FLLFHTHGWYSYLWLPFAPLIIVLLVGTKLQVIITKMGQRIQERGEVVKGMPLVQPGDDL  344

Query  1326  FWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVL  1505
             FWFN+PRL+LYL++FVLFQNAFQLA+F+W   +FG+KSCFH +TED+VI+ISMG+ +Q L
Sbjct  345   FWFNKPRLILYLVNFVLFQNAFQLAYFSWTAVQFGMKSCFHSQTEDVVIKISMGVFVQFL  404

Query  1506  CSYVTLPLYALVTQM  1550
             CSYVTLPLYALVTQ+
Sbjct  405   CSYVTLPLYALVTQV  419



>emb|CBI31481.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/582 (58%), Positives = 410/582 (70%), Gaps = 74/582 (13%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSL ETPTWAVA VCFVL+A+SI IE++IH IG  L +RNK+ALYEALEKIKA
Sbjct  1     MAEELKDRSLTETPTWAVAVVCFVLLAVSIFIEHIIHHIGSWLARRNKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTV Q+ I KICISKS+G++W+PCD                        
Sbjct  61    ELMLLGFMSLLLTVLQTPISKICISKSVGSTWYPCD------------------------  96

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKE-GMVPFISADGIHQLHIFIFVLALFHVLYC  767
                   + E+              + C  E G VPF+S  GIHQLHIFIFVLALFHV+YC
Sbjct  97    ----VDEKEFK-------------NTCGTESGKVPFVSYYGIHQLHIFIFVLALFHVIYC  139

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             + TLA G  KMR+WK WE ET+T EYQ++HDPERFR+AR+TSFGRRHL+FWS SP LLWI
Sbjct  140   VATLALGTYKMRRWKTWEDETRTAEYQYSHDPERFRYARETSFGRRHLNFWSSSPVLLWI  199

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQF  SV + DY+ LRHGFI+AHL P+S+  FDF++YI RSLEEDFK VVGISP I
Sbjct  200   VCFFRQFYGSVHRDDYLALRHGFIVAHLPPESERKFDFRKYIHRSLEEDFKAVVGISPVI  259

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W  A++FLL NTHG  SY WLPFIPL+I+LLVGTKLQVIIT++GLRI ERG VVKGTP+V
Sbjct  260   WFCAILFLLTNTHGWYSYFWLPFIPLIILLLVGTKLQVIITELGLRIAERGVVVKGTPIV  319

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P D LFWFNRP LML+LI+FVLF NAFQLAFFAW+ Y  GLKSC+H+ TED VIRI+MG
Sbjct  320   EPGDHLFWFNRPSLMLFLINFVLFLNAFQLAFFAWSTY--GLKSCYHDTTEDYVIRITMG  377

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             ++ QVLCSYVTLPLYALVTQMG+ M+ T+FN++VA AL+ WH TARK  R   HS  V+P
Sbjct  378   VMTQVLCSYVTLPLYALVTQMGTTMRSTVFNDKVAVALRDWHDTARKHTRHG-HSDGVSP  436

Query  1668  LSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQ------RRDNNVDQP  1829
              SSRP TP +G SP+HLLQ Y +  ++   SP     DN  W+ +      ++D++  +P
Sbjct  437   QSSRPSTPSNGMSPVHLLQSYDN--NTPDMSPVASNYDNERWYGEGSGSLGKKDDDEQRP  494

Query  1830  AE-ENRN--------------------ELQREIEMESAEFSF  1892
                E+R                     + Q E+ + S+EFSF
Sbjct  495   ENFESREPGRGTQDSSSAQLALGPLPIQTQHEVNITSSEFSF  536



>ref|XP_009378090.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=569

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/513 (64%), Positives = 390/513 (76%), Gaps = 21/513 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLEETPTWAVA VCFVL+A+SIVIE +IHLIGK L +++K+AL EALEKIK+
Sbjct  1     MAELAKERSLEETPTWAVAVVCFVLLAVSIVIERMIHLIGKWLARKHKRALVEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTV Q TI  ICIS+S+G +WHPC  ++            +        
Sbjct  61    ELMLLGFLSLLLTVLQGTISDICISQSVGATWHPCKYNKSSKSGSNGRKLLEFF------  114

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                          +HRR LA  G D C ++G V F+SA  IHQLHIFIFVLA+FHVLYCI
Sbjct  115   -------------NHRRRLAVKGNDYCTEKGKVAFLSAYAIHQLHIFIFVLAVFHVLYCI  161

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TL FGR KMRKWK WE ET+++EYQ  +DPERFRF RDTSFGRRHL+FWS+SP  +WI 
Sbjct  162   LTLGFGRYKMRKWKVWEEETRSIEYQCHNDPERFRFTRDTSFGRRHLNFWSKSPVSIWIA  221

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQF  SV KVDY+TLRHGFI+AHL P S+  FDF++YI RSLEEDFKV+V ISP IW
Sbjct  222   SFFRQFFHSVTKVDYLTLRHGFIMAHLEPGSESTFDFRKYITRSLEEDFKVIVEISPVIW  281

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+F+L NT+G  SYLWLP IPL+I+LLVGTKL VIITKMGLRIQERG+VVKG P+VQ
Sbjct  282   FSAVLFMLSNTYGWHSYLWLPIIPLIIVLLVGTKLLVIITKMGLRIQERGDVVKGAPLVQ  341

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWF  PRLML+LIHFVLFQNAFQLAFFAW+ Y+FG+KSCFH++TED+VIR+S+G+
Sbjct  342   PGDHLFWFGSPRLMLFLIHFVLFQNAFQLAFFAWSTYQFGIKSCFHQRTEDIVIRLSIGI  401

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++QVLCSYVTLPLYALVTQMGS MKPTIFNE VA A+K+ H  A+K  +   HS S TP 
Sbjct  402   MVQVLCSYVTLPLYALVTQMGSTMKPTIFNEEVAAAVKNCHHKAKKNAKHSHHSPSTTPF  461

Query  1671  SSRPGTPLHGTSPIHLLQY--YKSEIDSVGASP  1763
             S+ P TP  G SP+HLL    Y+S  D    SP
Sbjct  462   STMPPTPTQGMSPVHLLHTHNYRSNDDGFITSP  494



>gb|AFM35696.1| Mlo [Vitis pseudoreticulata]
Length=545

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/581 (58%), Positives = 409/581 (70%), Gaps = 72/581 (12%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSL ETPTWAVA VCFVL+A+SI IE++IH IG  L +RNK+ALYEALEKIKA
Sbjct  1     MAEELKDRSLTETPTWAVAVVCFVLLAVSIFIEHIIHHIGSWLARRNKRALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTV Q+ I KICISKS+G++W+PCD                        
Sbjct  61    ELMLLGFMSLLLTVLQTPISKICISKSVGSTWYPCDV-----------------------  97

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                    DE      ++     GT+     G VPF+S  GIHQLHIFIFVLALFHV+YC+
Sbjct  98    -------DE------KKFKNTCGTES----GKVPFVSYYGIHQLHIFIFVLALFHVIYCV  140

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA G  K+R+WK WE ET+T EYQ++HDPERFR+AR+TSFGRRHL+FWS SP LLWIV
Sbjct  141   ATLALGTYKVRRWKTWEDETRTAEYQYSHDPERFRYARETSFGRRHLNFWSSSPVLLWIV  200

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV + DY+ LRHGFI+AHLAP+S+  FDF++YI RSLEEDFK VVGISP IW
Sbjct  201   CFFRQFYGSVHRDDYLALRHGFIVAHLAPESERKFDFRKYIHRSLEEDFKAVVGISPVIW  260

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               A++FLL NTHG  SY WLPFIPL+I+LLVGTKLQVIIT++GLRI ERG VVKGTP+V+
Sbjct  261   FCAILFLLTNTHGWYSYFWLPFIPLIILLLVGTKLQVIITELGLRIAERGVVVKGTPIVE  320

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWFNRP LML+L +FVLF NAFQLAFFAW+ Y  GLKSC+H+ TED VIRI+MG+
Sbjct  321   PGDHLFWFNRPSLMLFLTNFVLFLNAFQLAFFAWSTY--GLKSCYHDTTEDYVIRITMGV  378

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             + QVLCSYVTLPLYALVTQMG+ M+PT+FN++VA AL+ WH+ ARK  R   HS  V+P 
Sbjct  379   MTQVLCSYVTLPLYALVTQMGTTMRPTVFNDKVAVALRDWHEKARKHTRHG-HSDGVSPQ  437

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQ------RRDNNVDQPA  1832
             SSRP TP +G SP+HLLQ Y +  ++   SP     DN  W+ +      ++D++  +P 
Sbjct  438   SSRPSTPSYGMSPVHLLQSYDN--NTPDMSPVTSNYDNERWYGEGSGSLGKKDDDEQRPE  495

Query  1833  EENRNE---------------------LQREIEMESAEFSF  1892
                  E                      Q E+ + S+EFSF
Sbjct  496   NFESREPGRGTQDSSSAQLALGPLPIPTQHEVNITSSEFSF  536



>emb|CDY07075.1| BnaA04g22400D [Brassica napus]
Length=574

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/512 (64%), Positives = 392/512 (77%), Gaps = 19/512 (4%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA---ELML  422
             RSLEETPTWAVA VCFV++ ISI+IEY +H IG   +K++KKAL EALEK+KA   +LML
Sbjct  6     RSLEETPTWAVAVVCFVILFISILIEYFLHFIGHWFKKKHKKALCEALEKVKAGKFKLML  65

Query  423   LGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllA  602
             LGFISLLL V Q+ + +ICI      +WHPC R +E  KYG D  D              
Sbjct  66    LGFISLLLVVLQTPVSEICIPNRAAATWHPCSRAQELAKYGQDYIDDGRKILEDYD----  121

Query  603   FADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLA  782
              ++D YS    RR LA  G DKCA++ +   +SA GIHQLHIFIFVLA+FHVLYCI T A
Sbjct  122   -SNDFYSP---RRSLATKGYDKCAEKALA-LVSAYGIHQLHIFIFVLAVFHVLYCITTYA  176

Query  783   FGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFR  962
              G+ KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LW+ CFFR
Sbjct  177   LGKTKMKKWKSWEKETKTIEYQYANDPERFRFARDTSFGRRHLNVWSKSSVTLWMTCFFR  236

Query  963   QFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAV  1142
             QF  SV KVDY+TLRHGFI+AHL   S+  FDFQ+YI+RSLEEDFKVVVGISP IW  AV
Sbjct  237   QFFGSVTKVDYLTLRHGFIMAHLPAGSEARFDFQKYIQRSLEEDFKVVVGISPLIWCIAV  296

Query  1143  IFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADD  1322
             +F+L NTHG  SYLWLPFIPL++IL+VG KLQVII+K+GLRIQ++G+VVKG PVV+P DD
Sbjct  297   LFILTNTHGWASYLWLPFIPLLVILVVGAKLQVIISKLGLRIQDKGDVVKGAPVVEPGDD  356

Query  1323  LFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQV  1502
             LFWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI MG+LIQV
Sbjct  357   LFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDITIRIVMGVLIQV  416

Query  1503  LCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRP  1682
             LCSY+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+K  +   HSGS TP  SRP
Sbjct  417   LCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHNTAKKHTKHG-HSGSNTP--SRP  473

Query  1683  GTPLHGTSPIHLL-QYYKSEID---SVGASPA  1766
              TP H  SP+HLL  Y+   +D   S  ASP+
Sbjct  474   TTPTHDMSPVHLLHNYHNRSLDQQTSFTASPS  505



>ref|XP_010264736.1| PREDICTED: MLO-like protein 6 isoform X2 [Nelumbo nucifera]
Length=413

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/419 (78%), Positives = 361/419 (86%), Gaps = 6/419 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG GGGRSLEETPTWAVA VCFVLVAISI+IE++IHLIGK L KR+K+ALYE+LEKIK+
Sbjct  1     MAGDGGGRSLEETPTWAVATVCFVLVAISIIIEHIIHLIGKWLTKRHKRALYESLEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I +ICI KS+GNSWHPC++ EE         D   +  RR  
Sbjct  61    ELMLLGFISLLLTVGQGLISEICIPKSVGNSWHPCNKKEEAKLDAEKESDDPEEHHRRLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             +    AD   SG S RR+LA GGTDKCA +G VPF+S++GIHQLHIFIFVLA+FHVLYCI
Sbjct  121   M---IAD---SGGSFRRVLAAGGTDKCAAKGKVPFVSSEGIHQLHIFIFVLAVFHVLYCI  174

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT+A GRLKMR+WKAWE ETKT+EYQF+HDPERFRFAR+TSFGRRHLSFWS++P LLWIV
Sbjct  175   ITMALGRLKMRRWKAWERETKTIEYQFSHDPERFRFARETSFGRRHLSFWSKTPALLWIV  234

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQS   FDFQ+YI RSLEEDFKVVVGISP +W
Sbjct  235   CFFRQFVRSVPKVDYLTLRHGFITAHLAPQSHTQFDFQKYINRSLEEDFKVVVGISPTVW  294

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLL NTH   SYLWLPF+PL+IILL+GTKLQV+ITKMGLRIQERGEVVKG PVV+
Sbjct  295   FFAVLFLLLNTHDWHSYLWLPFLPLIIILLLGTKLQVVITKMGLRIQERGEVVKGVPVVE  354

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             P DDLFWFNRPRL+LYLIHFVLFQNAFQLAF  W WYEFG KSCFHE TEDLVIRISMG
Sbjct  355   PGDDLFWFNRPRLILYLIHFVLFQNAFQLAFLVWTWYEFGRKSCFHEHTEDLVIRISMG  413



>ref|XP_010476041.1| PREDICTED: MLO-like protein 2 isoform X3 [Camelina sativa]
Length=568

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/507 (65%), Positives = 394/507 (78%), Gaps = 9/507 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++L+ T TWAVA VCFVL+ ISIVIE  IH IG  L+K+NKK LYEALEK+KAELMLLGF
Sbjct  5     QTLQFTSTWAVAVVCFVLLFISIVIEKSIHRIGTWLKKKNKKDLYEALEKVKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ+ I KICISK + ++ HPC   +       +   G G++ R          
Sbjct  65    ISLLLTIGQTPISKICISKHVVSTMHPCSAAQAAKMKAAEKEHGGGEKSRLLL-------  117

Query  612   DEYSGESHRRILAGGGTDKC-AKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
             D       RR LA  G DKC  + G V F+SA GIHQLHIFIFVLA+ HV+YCI+T   G
Sbjct  118   DLAESYIPRRSLAAKGDDKCTGQPGKVAFVSAYGIHQLHIFIFVLAVVHVIYCIVTYGLG  177

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
             + KMR+WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHLSFWS++   LWIVCFFRQF
Sbjct  178   KSKMRRWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLSFWSKTSITLWIVCFFRQF  237

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
               SV KVDY+ LRHGFI+AHLA  S+  FDF++YI+RSLEEDFK VV ISP IW  AV+F
Sbjct  238   YGSVTKVDYLALRHGFIMAHLAHGSESRFDFRKYIQRSLEEDFKTVVEISPVIWFVAVLF  297

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             LL NT+G RSYLWLPFIPLV+IL+VGTKLQVIITK+GLRIQE+G+VV+G PVVQP DDLF
Sbjct  298   LLTNTNGLRSYLWLPFIPLVVILIVGTKLQVIITKLGLRIQEKGDVVRGAPVVQPGDDLF  357

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WF +PR +L+LIH VLF NAFQLAFFAW+ YEF LK+CFHE   D+VIRI +G+++Q+LC
Sbjct  358   WFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVVIRIVVGVVVQILC  417

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGT  1688
             SYVTLPLYALVTQMG+ MKPT+FNERVA ALK WH TA+ Q +  RHS S TP SSRP T
Sbjct  418   SYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKDQTKHGRHSESNTPFSSRPTT  477

Query  1689  PLHGTSPIHLLQYYKS-EIDSVGASPA  1766
             P HG+SPIHLL  + +  ++S  ASP+
Sbjct  478   PTHGSSPIHLLHNFNNRSVESYPASPS  504



>ref|XP_009782286.1| PREDICTED: MLO-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=532

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/566 (57%), Positives = 403/566 (71%), Gaps = 56/566 (10%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RS+E TPTWAVA VCF+L+AISI IE +IH +G+ L K++KK LYEALEKIKAELMLLGF
Sbjct  5     RSMEATPTWAVAVVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q+ +  +C+ KS+G SWHPC                              AD
Sbjct  65    ISLLLTVVQTPVSNLCVPKSVGYSWHPCK-----------------------------AD  95

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             ++   +           D C  +G V F S+  IHQLHIFIFVLA+ HVLY I T A GR
Sbjct  96    EDAKSKY---------DDPCLPKGKVQFASSYAIHQLHIFIFVLAVAHVLYSIATFALGR  146

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             LKMRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRHL +WS+SP LLWIVCFFRQF 
Sbjct  147   LKMRKWRAWEDETKTIEYQFYNDPERFRFARETSFGRRHLHYWSKSPVLLWIVCFFRQFF  206

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF+IAHL PQ+Q NFDFQ YI R++E+DFK VV ISP +WLF V++ 
Sbjct  207   SSVAKVDYLTLRHGFMIAHLTPQNQENFDFQIYINRAVEKDFKFVVEISPALWLFTVLYF  266

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T+G  SYLW+PFIPLVIILLVGTKL++II +MG+RI +RG++V+G PVV+  D LFW
Sbjct  267   LTTTNGLYSYLWVPFIPLVIILLVGTKLEMIIAEMGVRISKRGDIVRGVPVVETGDHLFW  326

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP  +L+LI+FVLFQNAFQ+AFF W+W++FG  SCFH+   D+ IR++MG++IQV CS
Sbjct  327   FNRPAFVLFLINFVLFQNAFQVAFFVWSWWKFGYPSCFHQNAADIAIRLTMGVIIQVHCS  386

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMG++MKP IF + VA AL+SWH TA+K+++  R SG+ TP+SSRP TP
Sbjct  387   YVTLPLYALVTQMGTSMKPIIFGDNVATALRSWHNTAKKRVKHGRLSGNNTPVSSRPATP  446

Query  1692  LHGTSPIHLL----QYYKSE-----------IDSVGASPARDIEDNLPWFNQRRDNNVDQ  1826
             LHGTSP+HLL    QY   E            + +  SP R IE+     +  ++  +  
Sbjct  447   LHGTSPVHLLRSYPQYSNEESRTSNAENEGWANEISTSPRRQIENTKD--DDHQEGEIHA  504

Query  1827  PAEENR-NELQREIEMESAEFSFENK  1901
              +   R +  Q ++E+  +EF+F NK
Sbjct  505   SSSMQRPHPDQHQVEVTLSEFTFGNK  530



>emb|CDY14402.1| BnaC03g21930D [Brassica napus]
Length=560

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/514 (61%), Positives = 379/514 (74%), Gaps = 44/514 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA---ELML  422
             RSLEETPTWAVA VCFV++ ISI+IEY +H IG   +K++KKAL EALEK+KA   +LML
Sbjct  6     RSLEETPTWAVAVVCFVILFISILIEYFLHFIGHWFKKKHKKALCEALEKVKAGKFKLML  65

Query  423   LGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllA  602
             LGFISLLL V Q+ + +ICI      +WHPC  H+                         
Sbjct  66    LGFISLLLVVLQTPVSEICIPNRAAATWHPCSSHQ-------------------------  100

Query  603   FADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLA  782
               +    G+ +         D    EG V  +SA GIHQLHIFIFVLA+FH+LYCIIT A
Sbjct  101   --ESTKYGKDY--------IDDVLVEGKVALVSAYGIHQLHIFIFVLAVFHILYCIITYA  150

Query  783   FGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFR  962
              G+ KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CFFR
Sbjct  151   LGKTKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSSFTLWITCFFR  210

Query  963   QFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAV  1142
             QF  SV KVDY+TLRHGFI+AH+   S+  FDFQ+YI+RSLEEDFK VVGISP IW  AV
Sbjct  211   QFFGSVTKVDYLTLRHGFIMAHMPAGSEARFDFQKYIQRSLEEDFKAVVGISPVIWCIAV  270

Query  1143  IFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADD  1322
             +F+L NTHG+ SY WLPFIPL +IL+VG KLQVII+K+GLRIQ++G+VVKG PVV+P DD
Sbjct  271   LFILTNTHGSESYFWLPFIPLFVILIVGAKLQVIISKLGLRIQDKGDVVKGAPVVEPGDD  330

Query  1323  LFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQV  1502
             LFWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KT D+ +RI+MG+LIQV
Sbjct  331   LFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTVDIALRITMGVLIQV  390

Query  1503  LCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRP  1682
             +CSY+TLPLYALVTQMG++M+PTIFN+RVA ALK WH+TA+KQ +    SGS TP SSRP
Sbjct  391   VCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHKTAKKQSKHGT-SGSNTPHSSRP  449

Query  1683  GTPLHGTSPIHLLQYYKSEID-----SVGASPAR  1769
              TP HG SP+HLL  +   +D     +  +SP R
Sbjct  450   ATPTHGMSPMHLLHSHNRSLDYQTSFTASSSPPR  483



>gb|KHN00832.1| MLO-like protein 6 [Glycine soja]
Length=563

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/516 (61%), Positives = 378/516 (73%), Gaps = 40/516 (8%)
 Frame = +3

Query  258   LEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFIS  437
             LE T TWAVA VCFV++AISI+IE+++  +GK L+K+++KAL+EALEK+K ELMLLGFIS
Sbjct  12    LEATSTWAVAVVCFVMLAISILIEHILEELGKWLKKKHQKALHEALEKVKGELMLLGFIS  71

Query  438   LLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADDE  617
             LLL V Q  I  ICI KS+ ++WHPCD                                +
Sbjct  72    LLLVVFQDRISTICIPKSIASTWHPCD-------------------------------PD  100

Query  618   YSGESHRRILAGGGTDKCAKEG--MVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             Y  +        G  DKCA++G  +V F+S   IHQLHIF+FVLA+FH+L CI+TL  GR
Sbjct  101   YKSKK-----PEGYYDKCAEKGKDLVAFMSEYSIHQLHIFVFVLAIFHILQCIMTLTLGR  155

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM KW+ WE ETK+LE+QF HDPERFRFARDT+FGRRHLS WSRSP  LWIV FFRQF 
Sbjct  156   TKMSKWRKWEDETKSLEHQFYHDPERFRFARDTTFGRRHLSSWSRSPISLWIVSFFRQFY  215

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
             RS+ KVDYM LRHGFI+AHL P S+  FDFQ YIKR+L+EDF VVVGI+P IW FAV+ L
Sbjct  216   RSLNKVDYMALRHGFIVAHLTPASEAKFDFQNYIKRTLDEDFAVVVGITPTIWFFAVLIL  275

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLW+PFIP++IILLVGTKLQ+IIT+M LRIQ+RGEVVKG PVV+P D LFW
Sbjct  276   LTNTHGWHSYLWIPFIPVIIILLVGTKLQMIITEMALRIQDRGEVVKGAPVVEPGDGLFW  335

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLK--SCFHEKTEDLVIRISMGLLIQVL  1505
             FNRPR +L+LIH VLFQNAFQLAFFAW+ ++ G K  SCFH  T D+VIR++MG+L QVL
Sbjct  336   FNRPRFILFLIHLVLFQNAFQLAFFAWSTFDNGFKINSCFHRTTADIVIRLTMGVLTQVL  395

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMGS MKPTIFNE VA AL +WH +AR  ++  + S S TP SSRPG
Sbjct  396   CSYVTLPLYALVTQMGSTMKPTIFNENVATALMNWHHSARNHIKHNKGSTSNTPFSSRPG  455

Query  1686  TPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
             TP HG SP+HLL  +    DS   SP     +N  W
Sbjct  456   TPTHGMSPVHLLHKHPRHSDSPIVSPMAYNYENEQW  491



>ref|XP_003555433.1| PREDICTED: MLO-like protein 12-like isoform X1 [Glycine max]
Length=559

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/516 (61%), Positives = 378/516 (73%), Gaps = 40/516 (8%)
 Frame = +3

Query  258   LEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFIS  437
             LE T TWAVA VCFV++AISI+IE+++  +GK L+K+++KAL+EALEK+K ELMLLGFIS
Sbjct  12    LEATSTWAVAVVCFVMLAISILIEHILEELGKWLKKKHQKALHEALEKVKGELMLLGFIS  71

Query  438   LLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADDE  617
             LLL V Q  I  ICI KS+ ++WHPCD                                +
Sbjct  72    LLLVVFQDRISTICIPKSIASTWHPCD-------------------------------PD  100

Query  618   YSGESHRRILAGGGTDKCAKEG--MVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             Y  +        G  DKCA++G  +V F+S   IHQLHIF+FVLA+FH+L CI+TL  GR
Sbjct  101   YKSKK-----PEGYYDKCAEKGKDLVAFMSEYSIHQLHIFVFVLAIFHILQCIMTLTLGR  155

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM KW+ WE ETK++E+QF HDPERFRFARDT+FGRRHLS WSRSP  LWIV FFRQF 
Sbjct  156   TKMSKWRKWEDETKSVEHQFYHDPERFRFARDTTFGRRHLSSWSRSPISLWIVSFFRQFY  215

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
             RS+ KVDYM LRHGFI+AHL P S+  FDFQ YIKR+L+EDF VVVGI+P IW FAV+ L
Sbjct  216   RSLNKVDYMALRHGFIVAHLTPASEAKFDFQNYIKRTLDEDFAVVVGITPTIWFFAVLIL  275

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLW+PFIP++IILLVGTKLQ+IIT+M LRIQ+RGEVVKG PVV+P D LFW
Sbjct  276   LTNTHGWHSYLWIPFIPVIIILLVGTKLQMIITEMALRIQDRGEVVKGAPVVEPGDGLFW  335

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLK--SCFHEKTEDLVIRISMGLLIQVL  1505
             FNRPR +L+LIH VLFQNAFQLAFFAW+ ++ G K  SCFH  T D+VIR++MG+L QVL
Sbjct  336   FNRPRFILFLIHLVLFQNAFQLAFFAWSTFDNGFKINSCFHRTTADIVIRLTMGVLTQVL  395

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMGS MKPTIFNE VA AL +WH +AR  ++  + S S TP SSRPG
Sbjct  396   CSYVTLPLYALVTQMGSTMKPTIFNENVATALMNWHHSARNHIKHNKGSTSNTPFSSRPG  455

Query  1686  TPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW  1793
             TP HG SP+HLL  +    DS   SP     +N  W
Sbjct  456   TPTHGMSPVHLLHKHPRHSDSPIVSPMAYNYENEQW  491



>ref|XP_003519926.1| PREDICTED: MLO-like protein 12-like [Glycine max]
Length=573

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/568 (61%), Positives = 416/568 (73%), Gaps = 28/568 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVA VCFVL+A+SIVIE++IH IGK  +K++K AL+EALEK+K EL+LLGF
Sbjct  10    RTLEETPTWAVAVVCFVLLAVSIVIEHIIHGIGKWFKKKHKNALFEALEKVKGELLLLGF  69

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTV Q  I KIC+SK++ ++WHPC   +       +    D     R+ L      
Sbjct  70    LSLLLTVLQDEISKICVSKNVASTWHPCANPKAPKTSQSEDESEDFQINSRKLL------  123

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              ++     RR+LA  G DKC ++G V F+SA GIHQLHIFIFVLA+FH+L CI+TL  GR
Sbjct  124   -QFYDLVPRRVLATKGYDKCDEKGKVAFVSAYGIHQLHIFIFVLAIFHILQCIVTLTLGR  182

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMRKW+AWE+ETKT+EYQF +DPERFRFARDT+FGRRHL+ WS+S   L IV FFRQF 
Sbjct  183   TKMRKWRAWENETKTIEYQFYNDPERFRFARDTTFGRRHLNSWSQSTISLSIVSFFRQFF  242

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI AHLAP S   FDFQ+YI+RSLEEDFKVVVGISP IW FAV+FL
Sbjct  243   GSVNKVDYLTLRHGFITAHLAPGSDARFDFQKYIERSLEEDFKVVVGISPIIWFFAVLFL  302

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY WLPFIPL IILLVG KLQ+IITKMGL+I +RGEVVKG PVV P DDLFW
Sbjct  303   LTNTHGWYSYYWLPFIPLFIILLVGAKLQMIITKMGLKITDRGEVVKGAPVVVPGDDLFW  362

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+L+LIH VLFQNAFQLAFF+W+ YEF + SCFHE TED+VIR+ MG++IQ LCS
Sbjct  363   FNRPGLLLFLIHLVLFQNAFQLAFFSWSTYEFSINSCFHETTEDIVIRLVMGVVIQFLCS  422

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKPTIFN+RVA ALK+WH TA+K ++  +H+   TP SSRP TP
Sbjct  423   YVTLPLYALVTQMGSTMKPTIFNQRVASALKNWHNTAKKHVKNSKHT---TPFSSRPSTP  479

Query  1692  LHGTSPIHLL-QYYKSEIDSVGASPARDIEDNLPW-------------FNQRRDNNVDQP  1829
              +G SPIHLL ++     +S   SP     +N  W               +     V +P
Sbjct  480   QYGMSPIHLLHRHLAGRSESAQTSPRTSNYENEQWDVEGSPSPSHHAVAAEETQMQVFEP  539

Query  1830  AEENRNEL----QREIEMESAEFSFENK  1901
                +  EL    Q +I + S+EFSFE +
Sbjct  540   GSSSAPELPISSQLDIRVSSSEFSFEKR  567



>ref|XP_003548913.1| PREDICTED: MLO-like protein 12-like [Glycine max]
Length=576

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/574 (61%), Positives = 419/574 (73%), Gaps = 32/574 (6%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVA VCFVL+++SIVIE++IH IGK  +K++K AL+EALEK+K ELMLLGF
Sbjct  10    RTLEETPTWAVAVVCFVLLSVSIVIEHIIHGIGKWFKKKHKNALFEALEKVKGELMLLGF  69

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTV Q  I KIC+SK++ ++WHPC   +       +    D     R+ L      
Sbjct  70    LSLLLTVLQDPISKICVSKNVASTWHPCANPKAPKTSQSEDESEDFQINSRKLL------  123

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              +Y     RR+LA  G DKC ++G V F+SA GIHQLHIFIFVLA+FH+L CI+TLA GR
Sbjct  124   -QYYDIIPRRVLATKGYDKCDEKGKVAFVSAYGIHQLHIFIFVLAIFHILQCIVTLALGR  182

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMRKW+AWE+ETKT+EYQF +DPERFRFARDT+FGRRHL+ WS+S   L IV FFRQF 
Sbjct  183   TKMRKWRAWENETKTIEYQFYNDPERFRFARDTTFGRRHLNSWSQSTISLSIVSFFRQFF  242

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI AHLAP S   FDFQ+YI+RSLEEDFKVVVGISP IW FAV+FL
Sbjct  243   GSVNKVDYLTLRHGFITAHLAPGSHARFDFQKYIERSLEEDFKVVVGISPIIWFFAVLFL  302

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY WLPFIPLVIILLVG KLQ+IITKMGLRI +RGEVVKG PVV+P DDLFW
Sbjct  303   LTNTHGWYSYYWLPFIPLVIILLVGAKLQMIITKMGLRITDRGEVVKGAPVVEPGDDLFW  362

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRPRL+L+LIH VLFQNAFQLAFF+W+ YEF +KSCFHE TED VIR+  G++IQVLCS
Sbjct  363   FNRPRLLLFLIHLVLFQNAFQLAFFSWSTYEFSVKSCFHETTEDNVIRLVTGVVIQVLCS  422

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS M+PTIFN+RVA ALK+WH TA+K ++  +H+   TP SSRP TP
Sbjct  423   YVTLPLYALVTQMGSTMRPTIFNQRVASALKNWHNTAKKHVKNSKHT---TPFSSRPSTP  479

Query  1692  LHGTSPIHLL-QYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNEL-----  1853
              +G SP HLL ++     +S   SP     +N  W  +   +        +  ++     
Sbjct  480   QYGMSPTHLLHKHLAGRSESAQTSPRTSNYENEQWGVEGSPSPSHHAVAADETQMQVLEP  539

Query  1854  ---------------QREIEMESAEFSFENKREI  1910
                            Q +I + S+EFSFE KR I
Sbjct  540   GSGCSGSAPELPISSQLDIRVSSSEFSFE-KRHI  572



>ref|XP_010534417.1| PREDICTED: MLO-like protein 12 [Tarenaya hassleriana]
Length=581

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/493 (65%), Positives = 383/493 (78%), Gaps = 10/493 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWAVA VCFVLV ISI+IEY +H +G   ++++K+ALYEALEK+KAELML+GF
Sbjct  6     RSLEETPTWAVAVVCFVLVLISILIEYFLHFVGHWFKRKHKRALYEALEKVKAELMLMGF  65

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV QS I  ICI   +  +WHPC+                  +           D
Sbjct  66    ISLLLTVLQSPISNICIPGDVAATWHPCN---------SKLELSKYGKDYIDDGRKLLED  116

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              ++   + RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FHV+YCI+T A G 
Sbjct  117   SDFDLYNPRRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHVIYCIMTYALGS  176

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWK WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWI CFFRQF 
Sbjct  177   TKMKKWKKWEKETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSSVTLWIACFFRQFF  236

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI+AHL P S + FDFQ+YI+RSLEEDFKVVVGISP IW  AV+F+
Sbjct  237   GSVTKVDYLTLRHGFIMAHLPPGSAVRFDFQKYIQRSLEEDFKVVVGISPVIWFIAVLFI  296

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SYLWLPFIPLV+IL+VG KLQVIITK+GLRIQ++G+VVKG PVV+P DDLFW
Sbjct  297   LTNTHGWSSYLWLPFIPLVVILVVGAKLQVIITKLGLRIQDKGDVVKGAPVVEPGDDLFW  356

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+VIRI+MG+LIQ+LCS
Sbjct  357   FGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDVVIRITMGVLIQILCS  416

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             Y+TLPLYALVTQMGS M+PTIFN+RVA AL++WH TA++  +   +S   TPLSSRP TP
Sbjct  417   YITLPLYALVTQMGSTMRPTIFNDRVATALRNWHHTAKRHTKHG-NSEPHTPLSSRPATP  475

Query  1692  LHGTSPIHLLQYY  1730
              HG SP+HLL  Y
Sbjct  476   SHGLSPVHLLHSY  488



>ref|XP_009595993.1| PREDICTED: MLO-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=525

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/565 (57%), Positives = 401/565 (71%), Gaps = 61/565 (11%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RS+E TPTWAVAAVCF+L+AISI IE +IH +G+ L K++KK LYEALEKIKAELMLLGF
Sbjct  5     RSMEATPTWAVAAVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV QS +  +C+ KS+G SWHPC                                
Sbjct  65    ISLLLTVVQSPVSNLCVPKSVGYSWHPCK------------------------------S  94

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             DE +   +         D C  +G V F S+  IHQLHIFIFVLA+ HVLY I T A GR
Sbjct  95    DEAAKNKY--------DDPCLPKGKVQFASSYAIHQLHIFIFVLAVAHVLYSIATFALGR  146

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             LKMRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRHL +WS+SP LLWIVCFFRQF 
Sbjct  147   LKMRKWRAWEEETKTIEYQFYNDPERFRFARETSFGRRHLHYWSKSPVLLWIVCFFRQFF  206

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF++AHL PQ+Q NFDFQ YI R++E+DFK VV ISP +WLF V++ 
Sbjct  207   SSVAKVDYLTLRHGFMMAHLTPQNQENFDFQIYINRAVEKDFKFVVEISPALWLFTVLYF  266

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T+G  SYLW+PFIPLVIILLVGTKL++II +MG+RI +RG++V+G PVV+  D LFW
Sbjct  267   LTTTNGLYSYLWVPFIPLVIILLVGTKLEMIIAEMGVRISKRGDIVRGVPVVETGDHLFW  326

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP  +L+LI+FVLFQNAFQ+AFF W+W++F   SCFH+   D+ IR++MG++IQV CS
Sbjct  327   FNRPGFVLFLINFVLFQNAFQVAFFVWSWWKFSYPSCFHQNAADIAIRLTMGVIIQVHCS  386

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMG++MKP IF + VA AL+SWH TA+K+++  R S + TP+SSRP TP
Sbjct  387   YVTLPLYALVTQMGTSMKPIIFGDNVATALRSWHNTAKKRVKHGRLSENTTPVSSRPATP  446

Query  1692  LHGTSPIHLL----QYYKSE-----------IDSVGASPARDIEDNLPWFNQRRDNNVDQ  1826
             LHGTSP+HLL    QY   E            + +  SP R IE      N + D++  Q
Sbjct  447   LHGTSPVHLLRSYPQYSNEESRTSNAENEGWANEIPTSPRRQIE------NIKDDDH--Q  498

Query  1827  PAEENRNELQREIEMESAEFSFENK  1901
               E + +    ++E+  +EF+F NK
Sbjct  499   EGEIHASSSVHQVEIAMSEFTFGNK  523



>ref|XP_007218951.1| hypothetical protein PRUPE_ppa003466mg [Prunus persica]
 gb|EMJ20150.1| hypothetical protein PRUPE_ppa003466mg [Prunus persica]
Length=572

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/510 (65%), Positives = 390/510 (76%), Gaps = 19/510 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLE+TPTWAVA VCFVL+A+SI IE +IHLIGK L  ++K+AL EALEKIK+
Sbjct  1     MAELSKERSLEQTPTWAVAVVCFVLLAVSIFIERIIHLIGKWLTSKHKRALVEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTV Q  I  ICI KS+G SWHPC +  E           D        
Sbjct  61    ELMLLGFLSLLLTVLQGPISDICIPKSIGASWHPCSKEAESKSENKGRKLLD--------  112

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                 F+D ++S   +RR LA  G D C+++G V F+SA GIHQLHIFIFVLA+FHVLYCI
Sbjct  113   ----FSDPDFS---YRRRLAVKGYDYCSEQGKVAFVSAYGIHQLHIFIFVLAVFHVLYCI  165

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TL  GR KMRKWK WE ETK++E+Q+ +DPERFRFARDTSFG+RHL F  RSP  LWIV
Sbjct  166   LTLTLGRYKMRKWKVWEKETKSIEHQYHNDPERFRFARDTSFGQRHLKF--RSPLTLWIV  223

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQ  +SV +VDY+TLRHGFI+AHLAP S+  FDF++YI RSLEEDFKVVV ISP IW
Sbjct  224   SFFRQLFQSVTRVDYLTLRHGFIMAHLAPDSETTFDFRKYISRSLEEDFKVVVEISPIIW  283

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  SY WLPFIPLVIIL+VGTKLQVII+ MGLRIQERG+VVKG P+VQ
Sbjct  284   FSAVLFLLSNTYGWYSYFWLPFIPLVIILMVGTKLQVIISMMGLRIQERGDVVKGAPLVQ  343

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P D LFWF  PR ML+LIHFVLFQNAFQLAFFAW+ YEFG+ SCFH++TED+VIRISMG+
Sbjct  344   PGDHLFWFGSPRFMLFLIHFVLFQNAFQLAFFAWSTYEFGIASCFHQRTEDIVIRISMGV  403

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             +IQ LCSYVTLPLYALVTQMGS MK T+F E  A+ALKSWH  A+K  +   HS S TP 
Sbjct  404   IIQFLCSYVTLPLYALVTQMGSTMKRTVFKEEEAEALKSWHNKAKKNTKLSHHSHSNTPF  463

Query  1671  SSRPGTPLHGT--SPIHLLQYYKSEIDSVG  1754
             SS PGTP HG   SP+HLL  + +  D+ G
Sbjct  464   SSTPGTPGHGVRMSPLHLLHQHNNRSDADG  493



>gb|AIT98395.1| MLO1 [Solanum tuberosum]
Length=518

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/552 (59%), Positives = 403/552 (73%), Gaps = 40/552 (7%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RS+E TPTWA+A VCF+L+AISI IE +IH IG+ L ++ KK LYEALEKIKAELMLLGF
Sbjct  5     RSMEATPTWAIAVVCFILLAISIFIEQIIHHIGEWLLEKRKKPLYEALEKIKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTV Q  +  +C+ KS+G SWHPC                            A A 
Sbjct  65    LSLLLTVLQEPVSNLCVPKSIGYSWHPCK-------------------------PKADAQ  99

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              EY   S            C K+G V F S+  IHQLHIFIFVLA+ HVLYCI T A GR
Sbjct  100   SEYEVTS------------CDKKGKVQFASSYAIHQLHIFIFVLAVAHVLYCIATFALGR  147

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             LKMRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRH+ FWS+SP LLWIVCFFRQF 
Sbjct  148   LKMRKWRAWEDETKTIEYQFYNDPERFRFARETSFGRRHMHFWSKSPVLLWIVCFFRQFF  207

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF++AHL PQ+Q NFDFQ YI R++++DFKVVVGISP +WLF V++ 
Sbjct  208   SSVAKVDYLTLRHGFMMAHLTPQNQNNFDFQIYINRAVDKDFKVVVGISPALWLFTVLYF  267

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T G  SYLW+PF+PLVIILLVGTKLQ+IIT+MG+RI ERG++VKG PVV+  D LFW
Sbjct  268   LTTTDGLYSYLWVPFVPLVIILLVGTKLQMIITEMGVRISERGDIVKGVPVVETGDHLFW  327

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+L+LI+FVLFQNAFQ+AFF W+W++FG  SCFH+   DL IR++MG++IQV CS
Sbjct  328   FNRPGLVLFLINFVLFQNAFQVAFFVWSWWKFGFPSCFHQNAADLAIRLTMGVIIQVHCS  387

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS+MKP IF + VA AL+SWH TA+K+++    SG  TP +SRP TP
Sbjct  388   YVTLPLYALVTQMGSSMKPIIFGDNVATALRSWHHTAKKRVKHGL-SGHTTPANSRPTTP  446

Query  1692  LHGTSPIHLLQ-YYKSEIDSVGASPARDIEDNLPWFNQ-RRDNNVDQPAEENRNELQREI  1865
             LHGTSP+HLL+ Y +   DSV ASP     +N  W N+   DN   +  +    +  ++I
Sbjct  447   LHGTSPVHLLRGYPQYNEDSVQASPRTSNVENEGWANEISNDNQEGEILQHASTDHNKQI  506

Query  1866  EMESAEFSFENK  1901
             E+  ++F+F NK
Sbjct  507   EITMSDFTFGNK  518



>emb|CDY03836.1| BnaC01g29530D [Brassica napus]
Length=471

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/480 (65%), Positives = 374/480 (78%), Gaps = 19/480 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+L++T TWAVA VCF L+ ISIVIE +IH +G   +++NKKALYEALEK+KA
Sbjct  1     MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGNWFKRKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I +IC+S+S+  S  PC R EEE KY     D   D      
Sbjct  61    ELMLMGFISLLLTIGQNYISQICVSESIAASMRPCSRSEEEKKYPNTKKDTGKDV-----  115

Query  591   lllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                   D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFIFVL
Sbjct  116   -----GDEENSGRKLLELVDSFIPRRSLATKGYDKCAEKGQVAFVSSYGMHQLHIFIFVL  170

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWS  923
             A+ HV+YCI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWS
Sbjct  171   AVCHVIYCILTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWS  230

Query  924   RSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKV  1103
             +S   LWI CFFRQF  SV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK 
Sbjct  231   KSTITLWIACFFRQFFGSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKT  290

Query  1104  VVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGE  1283
             +V ISP IW  AV+FLL NT+G  SY+W PFIPLV+IL+VGTKLQVIITK+GL IQE+G+
Sbjct  291   IVEISPVIWFVAVLFLLTNTNGLNSYVWQPFIPLVVILIVGTKLQVIITKLGLLIQEKGD  350

Query  1284  VVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTED  1463
             +VKG P+VQP D LFWF RPR +L+L+H VLF NAFQLAFFAW  YEF LK+CFH+ T D
Sbjct  351   IVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWTTYEFKLKNCFHKNTVD  410

Query  1464  LVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQK  1643
             +VIRIS+G+++QVLCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+KQ++ +
Sbjct  411   VVIRISVGVIVQVLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAKKQMKNR  470



>gb|AIT98396.1| MLO1 [Nicotiana tabacum]
Length=519

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/563 (57%), Positives = 399/563 (71%), Gaps = 61/563 (11%)
 Frame = +3

Query  258   LEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFIS  437
             +E TPTWAVAAVCF+L+AISI IE +IH +G+ L K++KK LYEALEKIKAELMLLGFIS
Sbjct  1     MEATPTWAVAAVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELMLLGFIS  60

Query  438   LLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADDE  617
             LLLTV QS +  +C+ KS+G SWHPC                                DE
Sbjct  61    LLLTVVQSPVSNLCVPKSVGYSWHPCK------------------------------SDE  90

Query  618   YSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGRLK  797
              +   +         D C  +G V F S+  IHQLHIFIFVLA+ HVLY I T A GRLK
Sbjct  91    AAKNKY--------DDPCLPKGKVQFASSYAIHQLHIFIFVLAVAHVLYSIATFALGRLK  142

Query  798   MRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFVRS  977
             MRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRHL +WS+SP LLWIVCFFRQF  S
Sbjct  143   MRKWRAWEEETKTIEYQFYNDPERFRFARETSFGRRHLHYWSKSPVLLWIVCFFRQFFSS  202

Query  978   VPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFLLF  1157
             V KVDY+TLRHGF++AHL PQ+Q NFDFQ YI R++E+DFK VV ISP +WLF V++ L 
Sbjct  203   VAKVDYLTLRHGFMMAHLTPQNQENFDFQIYINRAVEKDFKFVVEISPALWLFTVLYFLT  262

Query  1158  NTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFWFN  1337
              T+G  SYLW+PFIPLVIILLVGTKL++II +MG+RI +RG++V+G PVV+  D LFWFN
Sbjct  263   TTNGLYSYLWVPFIPLVIILLVGTKLEMIIAEMGVRISKRGDIVRGVPVVETGDHLFWFN  322

Query  1338  RPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCSYV  1517
             RP  +L+LI+FVLFQNAFQ+AFF W+W++F   SCFH+   D+ IR++MG++IQV CSYV
Sbjct  323   RPGFVLFLINFVLFQNAFQVAFFVWSWWKFSYPSCFHQNAADIAIRLTMGVIIQVHCSYV  382

Query  1518  TLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTPLH  1697
             TLPLYALVTQMG++MKP IF + VA AL+SWH TA+K+++  R S + TP+SSRP TPLH
Sbjct  383   TLPLYALVTQMGTSMKPIIFGDNVATALRSWHNTAKKRVKHGRLSENTTPVSSRPATPLH  442

Query  1698  GTSPIHLL----QYYKSE-----------IDSVGASPARDIEDNLPWFNQRRDNNVDQPA  1832
             GTSP+HLL    QY   E            + +  SP R IE      N + D++  Q  
Sbjct  443   GTSPVHLLRSYPQYSNEESRTSNAENEGWANEIPTSPRRQIE------NIKDDDH--QEG  494

Query  1833  EENRNELQREIEMESAEFSFENK  1901
             E + +    ++E+  +EF+F NK
Sbjct  495   EIHASSSVHQVEIAMSEFTFGNK  517



>ref|XP_009148458.1| PREDICTED: MLO-like protein 2 [Brassica rapa]
Length=572

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/511 (62%), Positives = 393/511 (77%), Gaps = 0/511 (0%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LE+T TWAVA VCFVL+ ISIV+E+ IH IG   +K++KKALYEALEKIKA
Sbjct  1     MANQVKERTLEQTSTWAVAVVCFVLLFISIVLEHSIHKIGSWFKKKHKKALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I  ICIS+S+ +S HPC   +E  KYG        D+G    
Sbjct  61    ELMLMGFISLLLTIGQTPISNICISQSVASSMHPCSAADEARKYGKKVPAKQEDDGEENS  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                    D      HRR LA  G DKCA++G V F+SA GIHQLHIFIF+LA+ H++YCI
Sbjct  121   GHRRLLLDLAESYIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFILAVVHIIYCI  180

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T A G+ K R+WK WE+ETKT+EY +++DPERFRFARDTSFGRRHL+FWS++   LW V
Sbjct  181   VTYALGKTKTRRWKHWENETKTIEYHYSNDPERFRFARDTSFGRRHLNFWSKTSVTLWTV  240

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+ LRHGFI+AHLAP S+  FDF++YI++++EEDFK VV ISP IW
Sbjct  241   CFFRQFFGSVTKVDYLALRHGFIMAHLAPGSERTFDFRKYIQKTVEEDFKTVVEISPVIW  300

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  S+LWLPFIPLV+IL+VGTKLQV ITK+ LRIQE+G+VV+G PVVQ
Sbjct  301   FVAVLFLLTNTNGLHSFLWLPFIPLVVILVVGTKLQVTITKLCLRIQEKGDVVRGAPVVQ  360

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF L++CF+E   D+VIRI +G+
Sbjct  361   PGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLRNCFYENDADVVIRIVVGV  420

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS M+PT+FNERVA A+K+WH TA+K  +  +H+ S TP 
Sbjct  421   VVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTAKKHTKHGKHTESNTPY  480

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASP  1763
             +SRP TP HG+SP+H+L     E      SP
Sbjct  481   TSRPTTPTHGSSPLHILNNRSVETLPSSTSP  511



>gb|AAX77015.1| MLO1 [Lotus japonicus]
Length=551

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/512 (62%), Positives = 377/512 (74%), Gaps = 44/512 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             + LEETPTWAVA VCFV++AISI+IE+ I  I K L+KR+KKAL+EA+EKIK ELML+GF
Sbjct  7     KKLEETPTWAVAVVCFVMLAISIIIEHGIEAIEKWLEKRHKKALHEAVEKIKGELMLMGF  66

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             IS LLTV +  I  ICISK + ++WHPC                               +
Sbjct  67    ISFLLTVFKDPISNICISKQVASTWHPCH-----------------------------PE  97

Query  612   DEYSGESHRRILAGGGTDKCAKEGM--VPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
             ++  G         G  DKCAK+G   V F+S  GIHQLHIFIFVLA+FH+L CI TLA 
Sbjct  98    EKKKGPE-------GYYDKCAKDGKDKVAFMSQYGIHQLHIFIFVLAIFHILQCITTLAL  150

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             GR +M  WK WE ETKTLE+QF +DPERFRFARDT+FGRRHL+ WS+SP  LWIV FFRQ
Sbjct  151   GRTRMAMWKKWEEETKTLEHQFDNDPERFRFARDTTFGRRHLNSWSQSPISLWIVSFFRQ  210

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             F  SV KVDYM LRHGFIIAHLAP S+  FDFQ+YI RS++EDFKVVVGISP +W FAV+
Sbjct  211   FYGSVDKVDYMVLRHGFIIAHLAPGSESKFDFQKYISRSVDEDFKVVVGISPTVWFFAVL  270

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
              LL NTHG  SYLWLPFIPL+IILLVGTKLQ+IIT MGL+IQERG+V+KG P+V+P DDL
Sbjct  271   ILLTNTHGWHSYLWLPFIPLIIILLVGTKLQMIITNMGLKIQERGDVIKGAPLVEPGDDL  330

Query  1326  FWFNRPRLMLYLIHFVlfqnafqla--ffawawYEFGLKSCFHEKTEDLVIRISMGLLIQ  1499
             FWFNRPRL+L L+H VLFQNAFQLA   ++    +F + SCFH  T D+VIR+++G++ Q
Sbjct  331   FWFNRPRLILSLVHLVLFQNAFQLAFFAWSACDNDFKINSCFHRSTADVVIRLTLGVVTQ  390

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSG--SVTPLS  1673
             VLCSYVTLPLYALVTQMGS M+PTIF++RVA ALKSWH TA+K ++  R S   S TP S
Sbjct  391   VLCSYVTLPLYALVTQMGSTMRPTIFHDRVATALKSWHHTAKKHVKHNRDSNSHSNTPFS  450

Query  1674  SRPGTPLHGTSPIHLLQYYKS--EIDSVGASP  1763
             SRP TP HG SP+HLL  + +    DS  ASP
Sbjct  451   SRPATPTHGMSPVHLLHKHHNYHNSDSPLASP  482



>gb|AFW98803.1| MLO protein 3 [Rosa multiflora]
Length=563

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/498 (65%), Positives = 380/498 (76%), Gaps = 18/498 (4%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LE+TPTWAVA VCFVL+ ISI IE+VI+ IGK  + R+K+ALYEALEK+K+ELMLLGF
Sbjct  7     RTLEKTPTWAVAVVCFVLLVISIFIEHVINFIGKWFKSRHKRALYEALEKLKSELMLLGF  66

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTV Q  I  ICI KS+  +WHPC+                              +
Sbjct  67    LSLLLTVLQDPIAGICIPKSVAATWHPCND------------------ATSDSKARKLHE  108

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
                S  S RR LA  G D C + G V F+SA GIHQLH+FIFVLA+FHVLYCI TLA GR
Sbjct  109   SSDSVFSFRRKLATKGYDNCTENGKVAFVSAYGIHQLHVFIFVLAVFHVLYCITTLALGR  168

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMR WK WE+ETKT+EYQF+ DPERFR+ARDTSFGRRHL+FWS+SP  LWIVCFFRQF 
Sbjct  169   HKMRIWKYWENETKTVEYQFSTDPERFRYARDTSFGRRHLNFWSQSPVFLWIVCFFRQFF  228

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
             RSV K DY+TLRHGFI+AHLAP S+  FDF++YI RSLE+DF V+V ISP IW  AV+FL
Sbjct  229   RSVTKTDYLTLRHGFIMAHLAPGSETTFDFRKYISRSLEDDFLVIVEISPIIWFSAVLFL  288

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L N +G  SYLWLPFI L IILLVGTKLQVIIT MG+RIQERG VV G P+VQP D  FW
Sbjct  289   LSNAYGWYSYLWLPFISLFIILLVGTKLQVIITMMGMRIQERGGVVMGAPLVQPGDHYFW  348

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPR ML+LIHFVLFQNAFQLAFFAW+ ++FG+ SCFH+  ED+ IRISMG++IQVLCS
Sbjct  349   FGRPRFMLFLIHFVLFQNAFQLAFFAWSTWQFGIDSCFHQTPEDIAIRISMGVIIQVLCS  408

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS+MKPT+FNE VA+A+KSWH  A+K+++   HS   TPLSSRPGTP
Sbjct  409   YVTLPLYALVTQMGSSMKPTVFNEGVAEAVKSWHHKAKKKVKHSLHSERSTPLSSRPGTP  468

Query  1692  LHGTSPIHLLQYYKSEID  1745
              HG SP+HLL    +  D
Sbjct  469   THGMSPVHLLHNVNNRSD  486



>ref|XP_008365656.1| PREDICTED: MLO-like protein 6 [Malus domestica]
Length=573

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/526 (63%), Positives = 389/526 (74%), Gaps = 40/526 (8%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEETPTWAVA VCFVL+A+SI IE+ IHLIGK L +++K+AL EALEKIK+
Sbjct  1     MAELAKERTLEETPTWAVAVVCFVLLAVSIFIEHTIHLIGKWLARKHKRALVEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTV Q  I  ICISKS+G +WHPC                         
Sbjct  61    ELMLLGFLSLLLTVLQGPISXICISKSIGATWHPCK------------------------  96

Query  591   lllAFADDEYSGESHRRIL---------AGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                 +     SG++ R++L         A  G D C ++G V F+S+ GIHQLHIFIFVL
Sbjct  97    ----YNKSSKSGKNGRKLLEFFNPRRRLAVKGYDYCTEKGKVAFVSSYGIHQLHIFIFVL  152

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEY-QFTHDPERFRFARDTSFGRRHLSFW  920
             A+FHVLYCI+TL  GR KMR WK WE ETK++EY QF +DPERFRFARDTSFG+RHL+FW
Sbjct  153   AVFHVLYCILTLGLGRYKMRTWKVWEKETKSIEYRQFXNDPERFRFARDTSFGQRHLNFW  212

Query  921   SRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFK  1100
             S+SP  L IV FFRQF  SV KVDY+TLRHGFI+AHLAP S+  FDFQ+YI RS+EEDFK
Sbjct  213   SKSPVSLCIVSFFRQFFHSVTKVDYLTLRHGFIMAHLAPGSESTFDFQKYINRSVEEDFK  272

Query  1101  VVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERG  1280
             V+VGISP IW  AV+FLL NT+G  SY+WLP IPL+I+L VGTKLQVIITKMGLRIQERG
Sbjct  273   VIVGISPIIWFSAVLFLLSNTYGWYSYIWLPTIPLIIVLTVGTKLQVIITKMGLRIQERG  332

Query  1281  EVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTE  1460
             +VVKG P+VQP+D LFWF  PR MLYL+HFVLFQNAFQ+AFFAW+ YEFG+ SCFH  TE
Sbjct  333   DVVKGAPLVQPSDHLFWFGSPRFMLYLLHFVLFQNAFQMAFFAWSTYEFGITSCFHRSTE  392

Query  1461  DLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ  1640
             D+V+R+S G+++QVLCSYVTLPLYALVTQMGS MKPT+FNE VA ALK WH  A+K    
Sbjct  393   DIVVRLSFGVIVQVLCSYVTLPLYALVTQMGSTMKPTVFNEGVAAALKDWHHKAKKNTNH  452

Query  1641  KRHSGSVTPLSSRPGTPLHGTSPIHLL--QYYKSEIDSVGASPARD  1772
               HS S TP SS P +P  GTSP+HLL    Y+S  D    SP R 
Sbjct  453   SHHSPSTTPFSSMPPSPTRGTSPVHLLHNHNYRSNDDEFYVSPRRS  498



>ref|XP_009333712.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=559

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/597 (56%), Positives = 404/597 (68%), Gaps = 85/597 (14%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEETPTWAVA VCFVL+A+SI IE+ IHLIGK L +++K+AL EALEKIK+
Sbjct  1     MAELAKERTLEETPTWAVAVVCFVLLAVSIFIEHTIHLIGKWLARKDKRALVEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTV Q  I  ICISKS+G +WHPC                         
Sbjct  61    ELMLLGFLSLLLTVLQEPISDICISKSIGATWHPCK------------------------  96

Query  591   lllAFADDEYSGESHRRIL---------AGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                 +     SG++ R++L         A  G D C  +G V F+S+ GIHQLHIFIFVL
Sbjct  97    ----YNKSSKSGKNGRKLLEFFNPRRRLAVKGYDYCTGKGKVAFVSSYGIHQLHIFIFVL  152

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEY-QFTHDPERFRFARDTSFGRRHLSFW  920
             A+FHVLYCI+TL  GR KMR WK WE ETK++EY QF +D E+FRFARDTSFGRRHL+FW
Sbjct  153   AVFHVLYCILTLGLGRYKMRTWKVWEKETKSIEYRQFYNDSEKFRFARDTSFGRRHLNFW  212

Query  921   SRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFK  1100
             S+SP  LWIVCFFRQF  SV KVDY+TLRHGFI+AHLAP S+  FDFQ+YI RS+EEDFK
Sbjct  213   SKSPVFLWIVCFFRQFFHSVTKVDYLTLRHGFIMAHLAPGSESTFDFQKYINRSVEEDFK  272

Query  1101  VVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERG  1280
             V+VGISP IW  AV+FLL NT+G  SY+WLP IPL+I+L+VGTKLQVIITKMGLRIQE G
Sbjct  273   VIVGISPIIWFSAVLFLLSNTYGWYSYIWLPTIPLIIVLMVGTKLQVIITKMGLRIQESG  332

Query  1281  EVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTE  1460
              VVKG P+VQP+D LFWF  P  MLYL+HFV+FQNAFQ+AFFAW+ YEFG+ SCFH  TE
Sbjct  333   HVVKGAPLVQPSDHLFWFGSPHFMLYLLHFVVFQNAFQMAFFAWSTYEFGITSCFHRSTE  392

Query  1461  DLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ  1640
             D+V+R+S G+++QVLCSYVTLPLYALVTQMGS MKPT+FN+ VA ALK WH  A+K  + 
Sbjct  393   DIVVRLSFGVIVQVLCSYVTLPLYALVTQMGSTMKPTVFNKGVAAALKDWHHKAKKNTKH  452

Query  1641  KRHSGSVTPLSSRPGTPLHGTSPIHLLQ--YYKSEIDSVGASPARDIEDNLPWFNQRR--  1808
              RHS S              T+P+HLL    Y+S  D    SP+R   +   W  +    
Sbjct  453   SRHSPS--------------TTPVHLLHNYNYRSNDDEFYVSPSRANLEMGHWGTEGSSH  498

Query  1809  --DNNV-----------------DQ----------PAEENRNELQREIEMESAEFSF  1892
               +NNV                 DQ          P    R + Q E+ + S++FSF
Sbjct  499   SPNNNVGPSDGDEIRQMTNVRDLDQEPGSTELPRSPLPVRRTQSQHEVAISSSDFSF  555



>gb|KHN17123.1| MLO-like protein 6 [Glycine soja]
Length=563

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/579 (56%), Positives = 398/579 (69%), Gaps = 70/579 (12%)
 Frame = +3

Query  258   LEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFIS  437
             LE TPTWAVA VCFV++AISI+IE+++  +GK L+K++KKAL+EALEK+K ELMLLGFIS
Sbjct  9     LEATPTWAVAVVCFVMLAISILIEHILEELGKWLKKKHKKALHEALEKVKGELMLLGFIS  68

Query  438   LLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADDE  617
             LLL + Q  I  ICI KS+ ++WHPCD                                 
Sbjct  69    LLLVMFQDHISNICIPKSVASTWHPCD---------------------------------  95

Query  618   YSGESHRRILAGGGTDKCAKEG--MVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
               G+  ++    G  DKCA +G   V F+S   IHQLHIF+FVLA+FH+L CI+TL  GR
Sbjct  96    -PGDERKK--PDGYYDKCADKGKDQVAFMSEYSIHQLHIFVFVLAIFHILQCIMTLTLGR  152

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM  W+ WE ETK+L++QF HDPERFRFARDT+FGRRHLS WSRSP  LWIV FFRQF 
Sbjct  153   TKMSIWRKWEDETKSLDHQFHHDPERFRFARDTTFGRRHLSSWSRSPVSLWIVSFFRQFY  212

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              S+ KVDYM LRHGFI+AHL P ++  FDFQ YIKR+L+EDF VVVGI+P IW FAV+ L
Sbjct  213   GSLNKVDYMALRHGFIVAHLTPANEAKFDFQNYIKRTLDEDFAVVVGITPTIWFFAVLIL  272

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY W+PFIP++IILLVGTKLQ+IIT+M L+IQ+RGEVVKG P+V+P D+LFW
Sbjct  273   LTNTHGWYSYFWIPFIPVIIILLVGTKLQMIITEMALKIQDRGEVVKGAPLVEPGDELFW  332

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLK--SCFHEKTEDLVIRISMGLLIQVL  1505
             FNRPRL+L+LIH VLFQNAFQLAFFAW+ Y+ G K  SCFH+ T D+VIR++MG+L QVL
Sbjct  333   FNRPRLILFLIHLVLFQNAFQLAFFAWSTYDNGFKINSCFHKTTADIVIRLTMGVLTQVL  392

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMGS MKPTIFNE VA ALK+WH TA+K ++  + S S TP SSRPG
Sbjct  393   CSYVTLPLYALVTQMGSTMKPTIFNENVAVALKNWHHTAKKHIKHNKDSTSNTPFSSRPG  452

Query  1686  TPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPW--------FNQRRDNNVDQ-----  1826
             TP HG SP+HLL  +    DS   SP     +N  W         +  RD++ D      
Sbjct  453   TPTHGMSPVHLLHKHPRHSDSPVVSPRAYNYENEQWGVEGIHSPSHHARDHDPDHEKTMQ  512

Query  1827  -----------------PAEENRNELQREIEMESAEFSF  1892
                              P+  N    Q EI +  +EFSF
Sbjct  513   MQMQMQQQRPAPTAELPPSGLNPIRTQHEINIALSEFSF  551



>gb|KHN00604.1| MLO-like protein 12 [Glycine soja]
Length=567

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/568 (60%), Positives = 410/568 (72%), Gaps = 34/568 (6%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVA VCFVL+A+SIVIE++IH IGK  +K++K AL+EALEK+K EL+LLGF
Sbjct  10    RTLEETPTWAVAVVCFVLLAVSIVIEHIIHGIGKWFKKKHKNALFEALEKVKGELLLLGF  69

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTV Q  I KIC+SK++ ++WHPC   +       +    D     R+ L      
Sbjct  70    LSLLLTVLQDEISKICVSKNVASTWHPCANPKAPKTSQSEDESEDFQINSRKLL------  123

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              ++     RR+LA  G DKC ++         GIHQLHIFIFVLA+FH+L CI+TL  GR
Sbjct  124   -QFYDLVPRRVLATKGYDKCDEKATY------GIHQLHIFIFVLAIFHILQCIVTLTLGR  176

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMRKW+AWE+ETKT+EYQF +DPERFRFARDT+FGRRHL+ WS+S   L IV FFRQF 
Sbjct  177   TKMRKWRAWENETKTIEYQFYNDPERFRFARDTTFGRRHLNSWSQSTISLSIVSFFRQFF  236

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI AHLAP S   FDFQ+YI+RSLEEDFKVVVGISP IW FAV+FL
Sbjct  237   GSVNKVDYLTLRHGFITAHLAPGSDARFDFQKYIERSLEEDFKVVVGISPIIWFFAVLFL  296

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY WLPFIPL IILLVG KLQ+IITKMGL+I +RGEVVKG PVV P DDLFW
Sbjct  297   LTNTHGWYSYYWLPFIPLFIILLVGAKLQMIITKMGLKITDRGEVVKGAPVVVPGDDLFW  356

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+L+LIH VLFQNAFQLAFF+W+ YEF + SCFHE TED+VIR+ MG++IQ LCS
Sbjct  357   FNRPGLLLFLIHLVLFQNAFQLAFFSWSTYEFSINSCFHETTEDIVIRLVMGVVIQFLCS  416

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKPTIFN+RVA ALK+WH TA+K ++  +H+   TP SSRP TP
Sbjct  417   YVTLPLYALVTQMGSTMKPTIFNQRVASALKNWHNTAKKHVKNSKHT---TPFSSRPSTP  473

Query  1692  LHGTSPIHLL-QYYKSEIDSVGASPARDIEDNLPW-------------FNQRRDNNVDQP  1829
              +G SPIHLL ++     +S   SP     +N  W               +     V +P
Sbjct  474   QYGMSPIHLLHKHLAGRSESAQTSPRTSNYENEQWDVEGSPSPSHHAVAAEETQMQVFEP  533

Query  1830  AEENRNEL----QREIEMESAEFSFENK  1901
                +  EL    Q +I + S+EFSFE +
Sbjct  534   GSSSAPELPISSQLDIRVSSSEFSFEKR  561



>ref|XP_006356488.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=517

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/558 (57%), Positives = 386/558 (69%), Gaps = 63/558 (11%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R L+ETPTWAVA VCFVLV IS+ IE +IH +G+ L K+ K+ LYEALEKIK+ELMLLGF
Sbjct  13    RPLDETPTWAVAMVCFVLVIISLFIEQLIHHLGEWLWKKQKRPLYEALEKIKSELMLLGF  72

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISL LTV Q  + KICI +S+G SWHPCD ++                           D
Sbjct  73    ISLFLTVVQDPVSKICIPRSVGRSWHPCDINKHI-------------------------D  107

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D+Y              D C  +G + F S   IHQLHIFIFVLA+ HVLYCI TL  G+
Sbjct  108   DQY-------------LDPCRIKGKLQFASKYAIHQLHIFIFVLAVAHVLYCITTLGIGK  154

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             L+MR W+AWE E+KT+EYQF +DPERFRF R+TSFGR+HL FWS SP LLWIVCFFRQF 
Sbjct  155   LRMRTWRAWEDESKTIEYQFYNDPERFRFTRETSFGRKHLHFWSNSPILLWIVCFFRQFY  214

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF +AHLAPQ + NFDFQ YI R+LEEDF  VVGISP +W+FAV++ 
Sbjct  215   ASVEKVDYLTLRHGFAMAHLAPQQEKNFDFQLYINRALEEDFTDVVGISPVLWMFAVLYF  274

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T+G  SY WLPFIPL+IILLVGTKLQVIITKMGLRIQERGE+VKGTP+V+P DDLFW
Sbjct  275   LTTTNGWYSYYWLPFIPLIIILLVGTKLQVIITKMGLRIQERGEIVKGTPLVEPGDDLFW  334

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+L+ IHFVLFQNA+QLAFFAW+W++F + SCFH+   D+ I ++MG LIQVLCS
Sbjct  335   FNRPALLLFFIHFVLFQNAYQLAFFAWSWWKFNVPSCFHKNATDIAITLTMGALIQVLCS  394

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKP IF + VA A+++WHQTA+++ +  R S +V+P+ SR  +P
Sbjct  395   YVTLPLYALVTQMGSTMKPVIFGDNVASAIRTWHQTAKQRAKNGRPSENVSPVRSRAASP  454

Query  1692  LHGTSPIHLLQYYKSEIDSVGASPARDIEDNL--PWFNQRRDNNVDQPAEENR------N  1847
             L G                 G+ P +     L  P  N  R  +   P   +R      +
Sbjct  455   LRG-----------------GSFPVQQKHGQLYPPSPNSSRRRSGGNPESSSRQIFDAGS  497

Query  1848  ELQREIEMESAEFSFENK  1901
             + Q EIE+   + S ENK
Sbjct  498   DEQSEIEITLNDLSLENK  515



>ref|NP_001234814.1| MLO1 protein [Solanum lycopersicum]
 gb|AAX77013.1| MLO1 [Solanum lycopersicum]
Length=507

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/549 (59%), Positives = 400/549 (73%), Gaps = 43/549 (8%)
 Frame = +3

Query  258   LEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFIS  437
             +E TPTWA+A VCF+L+AISI IE +IH IG+ L ++ KK+LYEALEKIKAELMLLGF+S
Sbjct  1     MEATPTWAIAVVCFILLAISIFIEQIIHHIGEWLLEKRKKSLYEALEKIKAELMLLGFLS  60

Query  438   LLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADDE  617
             LLLTV Q  +  +C+ KS+G SWHPC                         +    A  E
Sbjct  61    LLLTVLQDPVSNLCVPKSVGYSWHPC-------------------------MAKEDAKSE  95

Query  618   YSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGRLK  797
             Y              D C  +G V F S+  IHQLHIFIFVLA+ HVLYCI T A GRLK
Sbjct  96    YD-------------DPCLPKGKVQFASSYAIHQLHIFIFVLAVAHVLYCIATFALGRLK  142

Query  798   MRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFVRS  977
             MRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRHL FWS+SP LL IVCFFRQF  S
Sbjct  143   MRKWRAWEDETKTMEYQFYNDPERFRFARETSFGRRHLHFWSKSPVLLSIVCFFRQFFSS  202

Query  978   VPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFLLF  1157
             V KVDY+TLRHGF++AHL PQ+Q NFDFQ YI R++++DFKVVVGISP +WLF V++ L 
Sbjct  203   VAKVDYLTLRHGFMMAHLTPQNQNNFDFQLYINRAVDKDFKVVVGISPALWLFTVLYFLT  262

Query  1158  NTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFWFN  1337
              T    SYLW+PFIPLVIILLVGTKLQ+IIT+MG+RI ERG++VKG PVV+  D LFWFN
Sbjct  263   TTDRLYSYLWVPFIPLVIILLVGTKLQMIITEMGVRISERGDIVKGVPVVETGDHLFWFN  322

Query  1338  RPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCSYV  1517
             RP L+L+LI+FVLFQNAFQ+AFF W+W++FG  SCFH+   DL IR++MG++IQV CSYV
Sbjct  323   RPALVLFLINFVLFQNAFQVAFFFWSWWKFGFPSCFHKNAADLAIRLTMGVIIQVHCSYV  382

Query  1518  TLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTPLH  1697
             TLPLYALVTQMGS+MKP IF + VA AL+SWH TA+K+++    SG  TP +SRP TPL 
Sbjct  383   TLPLYALVTQMGSSMKPIIFGDNVATALRSWHHTAKKRVKHGL-SGHTTPANSRPTTPLR  441

Query  1698  GTSPIHLLQ-YYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQREIEME  1874
             GTSP+HLL+ Y +   DSV ASP     +N  W N+ ++  + Q A  + N   ++IE+ 
Sbjct  442   GTSPVHLLRGYPQYNEDSVQASPRTSNVENEGWANENQEGEILQHASTDHN---KQIEIT  498

Query  1875  SAEFSFENK  1901
              ++F+F NK
Sbjct  499   MSDFTFGNK  507



>ref|XP_010032208.1| PREDICTED: MLO-like protein 2 isoform X2 [Eucalyptus grandis]
Length=534

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/494 (64%), Positives = 370/494 (75%), Gaps = 23/494 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LE T TWAVA VCFV++AISI++E+ IHL  K L+++ + AL EALEK+K+ELMLLGF
Sbjct  9     RTLEYTATWAVAIVCFVILAISILLEHAIHLFEKFLKRKRRVALVEALEKVKSELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I  IC+ + + +SW PC    E  K G    +                 
Sbjct  69    ISLLLTVLQGPISNICVPRRIASSWLPCKEGLEAKKSGRRLLEF----------------  112

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              E+ G   RR LA  G D C  +G   F++A GIHQLHIFIFVLA+FHVLYC+ TLA G 
Sbjct  113   SEFGGVI-RRSLATKGYDNCTGKGEYAFVTAYGIHQLHIFIFVLAIFHVLYCLTTLALGN  171

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             +KMR+W+AWE ETKT EY++ +DPERFR+ R+TSFG+RHLSFWSR    +WIVCFFRQF 
Sbjct  172   IKMRRWEAWEKETKTHEYKYFNDPERFRYTRETSFGQRHLSFWSRWKISVWIVCFFRQFF  231

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI AHL P S+  FDFQ YI+RSLE+DFKVVVGISP IW  AV+FL
Sbjct  232   GSVTKVDYLTLRHGFIKAHLPPGSETKFDFQDYIQRSLEDDFKVVVGISPIIWFSAVLFL  291

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L N+HG RSY+WLPFI L I+LLVGTKLQVIITK+GLRIQERG +VKG PVVQP D+LFW
Sbjct  292   LTNSHGWRSYIWLPFITLFIVLLVGTKLQVIITKLGLRIQERGNIVKGIPVVQPGDELFW  351

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPRL+L LIHFVLFQNAFQLAFFAW  Y FGLK+CFHE+T D++ R+SMG+ IQVLCS
Sbjct  352   FGRPRLLLLLIHFVLFQNAFQLAFFAWGTYSFGLKNCFHERTADIIFRVSMGVFIQVLCS  411

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKPTIFN+ VA A+K WH TA+K  +Q  HS +  P SSRP T 
Sbjct  412   YVTLPLYALVTQMGSTMKPTIFNDHVATAIKHWHTTAKKHTKQSHHSNADPPFSSRPAT-  470

Query  1692  LHGTSPIHLLQYYK  1733
                  P HLLQ Y 
Sbjct  471   -----PAHLLQTYN  479



>ref|XP_010032207.1| PREDICTED: MLO-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW51610.1| hypothetical protein EUGRSUZ_J01100 [Eucalyptus grandis]
Length=545

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/494 (64%), Positives = 370/494 (75%), Gaps = 23/494 (5%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LE T TWAVA VCFV++AISI++E+ IHL  K L+++ + AL EALEK+K+ELMLLGF
Sbjct  9     RTLEYTATWAVAIVCFVILAISILLEHAIHLFEKFLKRKRRVALVEALEKVKSELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I  IC+ + + +SW PC    E  K G    +                 
Sbjct  69    ISLLLTVLQGPISNICVPRRIASSWLPCKEGLEAKKSGRRLLEF----------------  112

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              E+ G   RR LA  G D C  +G   F++A GIHQLHIFIFVLA+FHVLYC+ TLA G 
Sbjct  113   SEFGGVI-RRSLATKGYDNCTGKGEYAFVTAYGIHQLHIFIFVLAIFHVLYCLTTLALGN  171

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             +KMR+W+AWE ETKT EY++ +DPERFR+ R+TSFG+RHLSFWSR    +WIVCFFRQF 
Sbjct  172   IKMRRWEAWEKETKTHEYKYFNDPERFRYTRETSFGQRHLSFWSRWKISVWIVCFFRQFF  231

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGFI AHL P S+  FDFQ YI+RSLE+DFKVVVGISP IW  AV+FL
Sbjct  232   GSVTKVDYLTLRHGFIKAHLPPGSETKFDFQDYIQRSLEDDFKVVVGISPIIWFSAVLFL  291

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L N+HG RSY+WLPFI L I+LLVGTKLQVIITK+GLRIQERG +VKG PVVQP D+LFW
Sbjct  292   LTNSHGWRSYIWLPFITLFIVLLVGTKLQVIITKLGLRIQERGNIVKGIPVVQPGDELFW  351

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             F RPRL+L LIHFVLFQNAFQLAFFAW  Y FGLK+CFHE+T D++ R+SMG+ IQVLCS
Sbjct  352   FGRPRLLLLLIHFVLFQNAFQLAFFAWGTYSFGLKNCFHERTADIIFRVSMGVFIQVLCS  411

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKPTIFN+ VA A+K WH TA+K  +Q  HS +  P SSRP T 
Sbjct  412   YVTLPLYALVTQMGSTMKPTIFNDHVATAIKHWHTTAKKHTKQSHHSNADPPFSSRPAT-  470

Query  1692  LHGTSPIHLLQYYK  1733
                  P HLLQ Y 
Sbjct  471   -----PAHLLQTYN  479



>gb|KHN13370.1| MLO-like protein 12 [Glycine soja]
Length=563

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/576 (59%), Positives = 414/576 (72%), Gaps = 49/576 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVA VCFVL+++SIVIE++IH IGK  +K++K AL+EALEK+K ELMLLGF
Sbjct  10    RTLEETPTWAVAVVCFVLLSVSIVIEHIIHGIGKWFKKKHKNALFEALEKVKGELMLLGF  69

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTV Q  I KIC+SK++ ++WHPC                       +    + ++
Sbjct  70    LSLLLTVLQDPISKICVSKNVASTWHPCAN--------------------PKAPKTSQSE  109

Query  612   DEYSG--ESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
             DE      + R++L     D   + G V F+SA GIHQLHIFIFVLA+FH+L CI+TLA 
Sbjct  110   DESEDFQINSRKLLQY--YDIIPRRGKVAFVSAYGIHQLHIFIFVLAIFHILQCIVTLAL  167

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             GR KMRKW+AWE+ETKT+EYQF +DPERFRFARDT+FGRRHL+ WS+S   L IV FFRQ
Sbjct  168   GRTKMRKWRAWENETKTIEYQFYNDPERFRFARDTTFGRRHLNSWSQSTISLSIVSFFRQ  227

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             F  SV KVDY+TLRHGFI AHLAP S   FDFQ+YI+RSLEEDFKVVVGISP IW FAV+
Sbjct  228   FFGSVNKVDYLTLRHGFITAHLAPGSHARFDFQKYIERSLEEDFKVVVGISPIIWFFAVL  287

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
             FLL NTHG  SY WLPFIPLVIILLVG KLQ+IITKMGLRI +RGEVVKG PVV+P DDL
Sbjct  288   FLLTNTHGWYSYYWLPFIPLVIILLVGAKLQMIITKMGLRITDRGEVVKGAPVVEPGDDL  347

Query  1326  FWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVL  1505
             FWFNRPRL+L+LIH VLFQNAFQLAFF+W+ YEF +KSCFHE TED VIR+  G++IQVL
Sbjct  348   FWFNRPRLLLFLIHLVLFQNAFQLAFFSWSTYEFSVKSCFHETTEDNVIRLVTGVVIQVL  407

Query  1506  CSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPG  1685
             CSYVTLPLYALVTQMGS M+PTIFN+RVA ALK+WH TA+K ++  +H+   TP SSRP 
Sbjct  408   CSYVTLPLYALVTQMGSTMRPTIFNQRVASALKNWHNTAKKHVKNSKHT---TPFSSRPS  464

Query  1686  TPLHGTSPIHLL-QYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNEL---  1853
             TP +G SPIHLL ++     +S   SP     +N  W  +   +        +  ++   
Sbjct  465   TPQYGMSPIHLLHKHLAGRSESAQTSPRTSNYENEQWGVEGSPSPSHHAVAADETQMQVL  524

Query  1854  -----------------QREIEMESAEFSFENKREI  1910
                              Q +I + S+EFSFE KR I
Sbjct  525   EPGSGCSGSAPELPISSQLDIRVSSSEFSFE-KRHI  559



>ref|XP_004235223.1| PREDICTED: MLO-like protein 2 isoform X1 [Solanum lycopersicum]
Length=517

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/551 (58%), Positives = 392/551 (71%), Gaps = 49/551 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R L+ETPTWAVA VCFVLV IS+ IE +IH +G+ L K+ K+ LYEALEKIK+ELMLLGF
Sbjct  13    RPLDETPTWAVAMVCFVLVVISLFIEQLIHHLGEWLWKKQKRPLYEALEKIKSELMLLGF  72

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISL LTV Q  + KICI +S+G SWHPCD ++                           D
Sbjct  73    ISLFLTVVQDPMSKICIPRSVGRSWHPCDINKHI-------------------------D  107

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
             D+Y              D C  +G + F S   IHQLHIFIFVLA+ HVLYCI TL  G+
Sbjct  108   DQY-------------LDPCRIKGKLQFASKYAIHQLHIFIFVLAVAHVLYCITTLGIGK  154

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             L+MR W+AWE E+KT+EYQF +DPERFRFAR+TSFGR+HL FWS SP LLWIVCFFRQF 
Sbjct  155   LRMRTWRAWEDESKTIEYQFYNDPERFRFARETSFGRKHLHFWSNSPILLWIVCFFRQFY  214

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF +AHLAPQ + NFDFQ YI R+LEEDFK VVGISP +W+FAV++ 
Sbjct  215   ASVEKVDYLTLRHGFAMAHLAPQQEKNFDFQLYINRALEEDFKDVVGISPLLWMFAVLYF  274

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T+G  SY WLPFIPL+IILLVGTKLQVIITKMGLRI+ERG++VKGTP+V+P DDLFW
Sbjct  275   LTTTNGWYSYYWLPFIPLIIILLVGTKLQVIITKMGLRIKERGDIVKGTPLVEPGDDLFW  334

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+ + IHFVLFQNA+QLAFFAW+W++F L SCFH+   D+ I +SMG LIQVLCS
Sbjct  335   FNRPDLLHFFIHFVLFQNAYQLAFFAWSWWKFNLPSCFHKNVTDIAITLSMGALIQVLCS  394

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTP  1691
             YVTLPLYALVTQMGS MKP IF + VA A+++WHQTA+++ +  R S + +P+ SR  +P
Sbjct  395   YVTLPLYALVTQMGSTMKPVIFGDNVAYAIRTWHQTAKQRAKDGRPSKNASPVRSRAVSP  454

Query  1692  LH-GTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQREIE  1868
             L  G+SP+   Q    ++     +P+R      P      +++  Q  ++  +E Q EIE
Sbjct  455   LRGGSSPV---QQKHGQLYPPSPNPSRRRSGGNP------ESSSRQIFDDGSHE-QSEIE  504

Query  1869  MESAEFSFENK  1901
             +   + S ENK
Sbjct  505   ITLNDLSLENK  515



>ref|XP_008463927.1| PREDICTED: MLO-like protein 6 isoform X2 [Cucumis melo]
Length=416

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/419 (73%), Positives = 350/419 (84%), Gaps = 3/419 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGG GRSLEETPTWAVAAVCFVLV ISI+IE+++HLIGK L+K++K+ALYEALEKIK+
Sbjct  1     MAGGGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  +CI   +  +WHPC    EE+              R+  
Sbjct  61    ELMLLGFISLLLTVGQSLITNVCIPPDVAATWHPCSPQREEELTKEADLVDSDHNRRKLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                A      +    R + A GGTDKCA +G VPF+S  GIHQLHIFIFVLA+FHVLYC+
Sbjct  121   ---ATVSHHVNATFRRSLAAAGGTDKCAAKGKVPFVSEGGIHQLHIFIFVLAVFHVLYCV  177

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR WK+WE ET+T+EYQF+HDPERFRFARDTSFGRRHLSFW++SPFL+WIV
Sbjct  178   LTLALGNAKMRSWKSWEKETRTVEYQFSHDPERFRFARDTSFGRRHLSFWTKSPFLIWIV  237

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGF++AHLAP S   FDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  238   CFFRQFVRSVPKVDYLTLRHGFVMAHLAPHSDQKFDFQKYIKRSLEEDFKVVVSISPPIW  297

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNT+G R+YLWLPF+PL+I+LLVGTKLQVIITKM LRIQERGEVVKG PVV+
Sbjct  298   FFAVLFLLFNTNGWRAYLWLPFVPLIIVLLVGTKLQVIITKMALRIQERGEVVKGVPVVE  357

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW W EFG+KSCFHE TEDLVIRI+MG
Sbjct  358   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSCFHEHTEDLVIRITMG  416



>emb|CDY20991.1| BnaA08g25340D [Brassica napus]
Length=553

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/538 (58%), Positives = 389/538 (72%), Gaps = 15/538 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TW VA VCFVL+ IS++IE++IH IG  L+K++K  LYEALEK+KA
Sbjct  1     MADKEYERTLEETSTWTVAVVCFVLILISLLIEHLIHKIGSWLKKKHKGNLYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q+ I   CI KS+ +S  PC   E   K              +  
Sbjct  61    ELMLLGFISLLLTVAQTPISSFCIPKSIASSMRPCSAAERAKKELDKKEADKQKSTGKLL  120

Query  591   lllAFADDEYSGESH--RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             L LA        ES+  RR LA  G ++C K G VPF+SA GIHQLHIFIFVLA+ HV+Y
Sbjct  121   LELA--------ESYIPRRNLATKGYNECPK-GKVPFVSAYGIHQLHIFIFVLAVVHVIY  171

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KM KW+ WE ETKT+EYQ+++DP RFRFARDT+FGRRHL+ WS++   LW
Sbjct  172   CIVTYALGKTKMGKWEQWEEETKTIEYQYSNDPGRFRFARDTTFGRRHLNAWSKTSVTLW  231

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQS---QMNFDFQQYIKRSLEEDFKVVVGI  1115
              VCFFRQFV SV KVDY+TLRHGFI A  AP S   +M +DF  YI+RSLE+DFK VV I
Sbjct  232   TVCFFRQFVGSVTKVDYLTLRHGFITAQFAPGSGSEKMPYDFCNYIQRSLEKDFKTVVEI  291

Query  1116  SPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKG  1295
             SP IW   V+FLL N  G  SYLWLPFIPL+++L+VGTKLQVIITK+GLRIQE+G+VV+G
Sbjct  292   SPVIWFVTVLFLLTNLDGLHSYLWLPFIPLIVVLIVGTKLQVIITKLGLRIQEKGDVVRG  351

Query  1296  TPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIR  1475
              P+V+P DDLFWF++P  ML+LIH VLF NAFQLAFFAW+ YEFG+ +CFH+K +D+ IR
Sbjct  352   APLVKPGDDLFWFDKPSFMLFLIHLVLFTNAFQLAFFAWSSYEFGISNCFHKKPQDITIR  411

Query  1476  ISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSG  1655
             I +GL +Q+LCSYVTLPLYALVTQMG+ MKPT+FN RV K LK WH  A+++ +  R S 
Sbjct  412   IVVGLFVQILCSYVTLPLYALVTQMGTTMKPTVFNGRVFKMLKKWHHKAQEETQHGRRSE  471

Query  1656  SVTPLSSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPARDIEDNLPWFNQRRDNNVDQ  1826
             S TP +SRP TP HG+SPIHLL  Y    ++S+   P+ +  D+  +++    +   +
Sbjct  472   SNTPYASRPATPTHGSSPIHLLHNYNDRSVESLPNPPSPNHHDHYQFYDPESQHKAAE  529



>ref|XP_007151753.1| hypothetical protein PHAVU_004G071800g [Phaseolus vulgaris]
 gb|ESW23747.1| hypothetical protein PHAVU_004G071800g [Phaseolus vulgaris]
Length=539

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/541 (58%), Positives = 390/541 (72%), Gaps = 20/541 (4%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLEETPTWA A VCF+L+AISI+IE VIH IGK L+K++K  LYE+LEK+K ELM+LGF
Sbjct  9     RSLEETPTWAFAVVCFMLLAISIIIELVIHAIGKWLRKKHKSGLYESLEKVKGELMMLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +S+LLTV Q  + KICIS++  ++WHPC   +        +   D               
Sbjct  69    LSMLLTVFQDPLSKICISQNAASTWHPCSNPKAVSNSNATSHTIDRKLL-----------  117

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
               +     RR+LA  G DKCA +G V F+SA GIHQLHIFIFVLA+FH++ CI+TLA GR
Sbjct  118   --HLDPIPRRVLAAKGYDKCADKGKVAFVSAYGIHQLHIFIFVLAIFHIIQCIVTLALGR  175

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMR+WK WE ETKT+EYQF +D +RFR A+DT+FG+RHL+ WS+S   LWIV FFRQF 
Sbjct  176   TKMRRWKKWEDETKTIEYQFYNDSKRFRLAKDTTFGQRHLNTWSQSSISLWIVSFFRQFF  235

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY  LRHGFI+AH++P+S   FDFQ+YIKRSL+EDFKVVVGISP IW FAV+FL
Sbjct  236   GSVKKVDYFVLRHGFIMAHVSPRSDSGFDFQRYIKRSLDEDFKVVVGISPIIWFFAVLFL  295

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  S  WLPFIPL+ IL+VG  LQ+IITKMGLRIQ+RG VV G PVV+P DDLFW
Sbjct  296   LTNTHGWYSNYWLPFIPLITILIVGADLQMIITKMGLRIQDRG-VVMGAPVVEPGDDLFW  354

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRPRL+L++IH VLFQNAFQLA FAW+ YEF ++SCFH+   + V+R++MG++ QVLCS
Sbjct  355   FNRPRLLLFIIHLVLFQNAFQLAHFAWSTYEFSIESCFHKTNAENVVRLTMGVVTQVLCS  414

Query  1512  YVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGS--VTPLSSRPG  1685
             YVTLPLYALVTQMGS +KPTIFN+RVA ALK WH T++K L+  +HS +    P SS   
Sbjct  415   YVTLPLYALVTQMGSTLKPTIFNDRVAAALKKWHHTSKKHLKHSQHSEAKKSIPFSSTSS  474

Query  1686  TPLHGTSPIHLLQYYK-SEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQRE  1862
             +P+ G SPIHLL  +     DS   SP   + +N     Q   +  + P     NE Q +
Sbjct  475   SPIFGMSPIHLLHRHPVGRSDSAQTSPRTSLYENQQCDVQGESSVSNHPGT---NETQMQ  531

Query  1863  I  1865
             +
Sbjct  532   V  532



>ref|XP_010107562.1| MLO-like protein 12 [Morus notabilis]
 gb|EXC16244.1| MLO-like protein 12 [Morus notabilis]
Length=696

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/598 (54%), Positives = 386/598 (65%), Gaps = 103/598 (17%)
 Frame = +3

Query  231   MAGG-GGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQ---------------  362
             MAG     RSLEETPTWAVA VCFVLV ISI+IE+VIHLIGKL                 
Sbjct  152   MAGKLSKERSLEETPTWAVAIVCFVLVLISIIIEHVIHLIGKLFVVAPIVLIIIRILHSS  211

Query  363   --KRNKKALYEALEKIKAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeed  536
               +R+   LY    K   ++MLLGFISLLLTVGQ+ I KICISK++  +WHPC + +E  
Sbjct  212   GWQRDTNELYLKHLKRSNQVMLLGFISLLLTVGQTPISKICISKAVAATWHPCKKKQESK  271

Query  537   kyggdtgdgdgdegrrrrlllAFADDEYSGESHRRILAGGGTDKCAKEGM----------  686
                                          GES RR+LA    DKCA +            
Sbjct  272   LSHDYDNSHRRLLLVSD-----------PGESIRRVLASASDDKCAAKACLTIFWSYLSL  320

Query  687   ---------VPFISADGIHQLHIFIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTL  839
                      V F+SA GIHQLHIFIFVLA+FHVLYCIITLA  R KMRKWKAWE ET+T 
Sbjct  321   ISRMFAQDKVAFVSAYGIHQLHIFIFVLAVFHVLYCIITLALSRTKMRKWKAWEMETRTT  380

Query  840   EYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFI  1019
             +YQF++DPERFRFARDTSFGRRHL+FWS  PFLLWIVCFFRQFVRSVPKVDY+TLRHGFI
Sbjct  381   DYQFSNDPERFRFARDTSFGRRHLNFWSHCPFLLWIVCFFRQFVRSVPKVDYLTLRHGFI  440

Query  1020  IAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfi  1199
             +AHL PQS + F+F +YIKR+LE DFKV++ +                            
Sbjct  441   MAHLGPQSHVKFNFHEYIKRALEGDFKVIILL----------------------------  472

Query  1200  plviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlf  1379
                    VGTKLQVIITKMGLRIQERGEVVKGTP+VQP DDLFWF +PRL+LYLI+FVLF
Sbjct  473   -------VGTKLQVIITKMGLRIQERGEVVKGTPLVQPGDDLFWFKQPRLILYLINFVLF  525

Query  1380  qnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSN  1559
             QNAFQLAF AW  YEFG+KSCFHE +ED++IRISMG        Y+TLPL+ALVTQMGSN
Sbjct  526   QNAFQLAFLAWTLYEFGIKSCFHENSEDVIIRISMG--------YMTLPLHALVTQMGSN  577

Query  1560  MKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKSE  1739
             +KPTIFN+RVA AL+ WH TARKQ+RQ R +      +S P TP    SP+HLL  Y SE
Sbjct  578   IKPTIFNDRVANALRKWHHTARKQVRQTRQT------ASSPSTPRKSMSPVHLLHRYNSE  631

Query  1740  ID-SVGASP--ARDIEDNLPWFNQRRDNNVDQPAEENR---NELQREIEMESAEFSFE  1895
             +  S   SP  +   +DN    +++ +  + +P   +    +++Q EI ++S +FSF+
Sbjct  632   LGMSTLTSPRMSNFNDDNAQHGSRQDEETIHEPRSVHNPVGHQVQHEINIQSVDFSFD  689



>ref|XP_009110727.1| PREDICTED: MLO-like protein 2 [Brassica rapa]
Length=553

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/538 (57%), Positives = 386/538 (72%), Gaps = 15/538 (3%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TW VA VCFVL+ IS+ IE++IH IG  L+K++K  LYEALEK+KA
Sbjct  1     MADKEYERTLEETSTWTVAVVCFVLILISLFIEHLIHKIGSWLKKKHKGNLYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q+ I  +CI KS+ +S  PC   E   K              +  
Sbjct  61    ELMLLGFISLLLTVAQTPISSLCIPKSIASSMRPCSAAEIAKKELDKKEADKQKSTGKLL  120

Query  591   lllAFADDEYSGESH--RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             L LA        ES+  RR LA  G ++C K G VPF+SA GIHQLHIFIFVLA+ HV+Y
Sbjct  121   LELA--------ESYIPRRSLATKGYNECPK-GKVPFVSAYGIHQLHIFIFVLAVVHVIY  171

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KM KW+ WE ETKT+EYQ+++DP RFRFARDT+FGRRHL+ WS++   LW
Sbjct  172   CIVTYALGKTKMGKWEQWEEETKTIEYQYSNDPGRFRFARDTTFGRRHLNAWSKTSVTLW  231

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQS---QMNFDFQQYIKRSLEEDFKVVVGI  1115
              VCFFRQFV SV KVDY+TLRHGFI A  AP S   +M +DF  YI+RSLE+DFK VV I
Sbjct  232   TVCFFRQFVGSVTKVDYLTLRHGFITAQFAPGSGSEKMPYDFCNYIQRSLEKDFKTVVEI  291

Query  1116  SPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKG  1295
             SP IW   V+FLL N  G  SYLWLP IPL+++L+VGTKLQVIITK+GLRIQE+G+VV+G
Sbjct  292   SPVIWFVTVLFLLTNLDGLHSYLWLPLIPLIVVLIVGTKLQVIITKLGLRIQEKGDVVRG  351

Query  1296  TPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIR  1475
              P+V+P DDLFWF++P  ML+LIH VLF NAFQLAFFAW+ YEFG+ +CFH++ +D+ IR
Sbjct  352   APLVKPGDDLFWFDKPSFMLFLIHLVLFTNAFQLAFFAWSSYEFGISNCFHKEPQDITIR  411

Query  1476  ISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSG  1655
             I  GL +Q+LCSYVTLPLYALVTQMG+ MKPT+FN RV K LK WH  A+++ +  R S 
Sbjct  412   IVFGLFVQILCSYVTLPLYALVTQMGTTMKPTVFNGRVFKMLKKWHHKAQEETQHGRRSE  471

Query  1656  SVTPLSSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPARDIEDNLPWFNQRRDNNVDQ  1826
             S TP +SRP TP HG+SPIHLL  Y    ++S    P+ +  D+  +++    +   +
Sbjct  472   SNTPYASRPTTPTHGSSPIHLLHNYNDRSVESFPNPPSPNHHDHYQFYDPESQHKAAE  529



>gb|AEC12478.1| membrane protein [Rosa multiflora]
Length=567

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/499 (64%), Positives = 379/499 (76%), Gaps = 22/499 (4%)
 Frame = +3

Query  255   SLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFI  434
             +LE TPTWAVA VCFVL+ ISI IE+V++ IGK  + R K+ALYEALE +K+ELMLLGF+
Sbjct  12    TLEXTPTWAVAVVCFVLLVISISIEHVLNFIGKWFKSRQKRALYEALEXLKSELMLLGFL  71

Query  435   SLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADD  614
             SLLLTV Q  I  ICI KS+G +W+PC+                           A    
Sbjct  72    SLLLTVLQEPIAGICIPKSVGATWNPCNH--------------------GTSDSKARKLH  111

Query  615   EYSGE--SHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
             EYS    S RR LA  GTDKC ++G V F+S+ GIHQLH+FIFV+A+FHVLYCI TLA G
Sbjct  112   EYSDSVFSFRRKLAKKGTDKCMEKGKVAFVSSYGIHQLHVFIFVIAVFHVLYCITTLALG  171

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
             R KMR WK WE+ETKT+EY+ + DPERFR+ARDTSFGRRHL+FWS+SP  LW VCFFRQF
Sbjct  172   RHKMRIWKYWENETKTVEYKSSTDPERFRYARDTSFGRRHLNFWSQSPVFLWFVCFFRQF  231

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
               SV K DY+TLRHGFI+AHLAP S+  FDF++YI RSLE+DF V+V ISP IW  AV+F
Sbjct  232   FTSVTKTDYLTLRHGFIMAHLAPGSETTFDFRKYISRSLEDDFLVIVEISPIIWFSAVLF  291

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             LL N +G  SYLWLPFI L IILLVGTKLQVIIT MG+RIQERG VV G P+VQP D  F
Sbjct  292   LLSNAYGWYSYLWLPFISLFIILLVGTKLQVIITMMGMRIQERGGVVMGAPLVQPGDHYF  351

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WF RPR ML+LIHFVLFQNAFQLAFFAW+ ++FG+ SCFH+  ED+ IRISMG++IQVLC
Sbjct  352   WFGRPRFMLFLIHFVLFQNAFQLAFFAWSTWQFGIDSCFHQTPEDIAIRISMGVIIQVLC  411

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGT  1688
             SYVTLPLYALVTQMGS+MKPT+FNE VA+A+KSWH  A+K+++   HS   TPLSSRPGT
Sbjct  412   SYVTLPLYALVTQMGSSMKPTVFNEGVAEAVKSWHHKAKKKVKHSLHSERSTPLSSRPGT  471

Query  1689  PLHGTSPIHLLQYYKSEID  1745
             P HG SP+HLL    +  D
Sbjct  472   PTHGMSPVHLLHNVNNRSD  490



>gb|AFW98804.1| MLO protein 4 [Rosa multiflora]
Length=564

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/499 (64%), Positives = 380/499 (76%), Gaps = 22/499 (4%)
 Frame = +3

Query  255   SLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGFI  434
             +LE TPTWAVA VCFVL+ ISI IE+V++ IGK  + R K+ALYEALEK+K+ELMLLGF+
Sbjct  12    TLENTPTWAVAVVCFVLLVISISIEHVLNFIGKWFKSRQKRALYEALEKLKSELMLLGFL  71

Query  435   SLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADD  614
             SLLLTV Q  I  ICI KS+G +W+PC+                           A    
Sbjct  72    SLLLTVLQEPIAGICIPKSVGATWNPCNH--------------------GTSDSKARKLH  111

Query  615   EYSGE--SHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
             EYS    S RR LA  GTDKC ++G V F+S+ GIHQLH+FIFV+A+FHVLYCI TLA G
Sbjct  112   EYSDSVFSFRRKLAKKGTDKCMEKGKVAFVSSYGIHQLHVFIFVIAVFHVLYCITTLALG  171

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
             R KMR WK WE+ETKT+EY+ + DPERFR+ARDTSFGRRHL+FWS+SP  LW VCFFRQF
Sbjct  172   RHKMRIWKYWENETKTVEYKSSTDPERFRYARDTSFGRRHLNFWSQSPVFLWFVCFFRQF  231

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
              RSV K DY+TLRHGFI+AHLAP ++M FDF++YI RSLE+DF V+V IS  IW  AV+F
Sbjct  232   FRSVTKTDYLTLRHGFIMAHLAPGNEMTFDFRKYISRSLEDDFLVIVEISSIIWFSAVLF  291

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             LL + +G  SYLWLPFI L IILLVGTKLQVIIT MG+RIQERG+VV G P+VQP D  F
Sbjct  292   LLSSAYGWHSYLWLPFISLFIILLVGTKLQVIITMMGMRIQERGDVVMGAPLVQPGDHYF  351

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WF RPR ML+LIHFVLFQNAFQLAFFAW+ +EFG++SCFH   E + IRISMG++IQVLC
Sbjct  352   WFGRPRFMLFLIHFVLFQNAFQLAFFAWSAWEFGIQSCFHPIPESIAIRISMGVIIQVLC  411

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGT  1688
             SYVTLPLYALVTQMGS+MKPT+FNE VA+A+KSWH  A+K+++   HS   TP SSRPGT
Sbjct  412   SYVTLPLYALVTQMGSSMKPTVFNEGVAEAVKSWHHKAKKKVKHSLHSERSTPFSSRPGT  471

Query  1689  PLHGTSPIHLLQYYKSEID  1745
             P HG SP+HLL    +  D
Sbjct  472   PTHGMSPVHLLHNVNNRSD  490



>ref|XP_008387612.1| PREDICTED: MLO-like protein 6 isoform X2 [Malus domestica]
Length=415

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/419 (75%), Positives = 349/419 (83%), Gaps = 4/419 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG  GRSLE+TPTWAVA VCFVLV ISI+IEY IHLIGK L+KRNK+ALYEALEKIK+
Sbjct  1     MAGGKKGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIGKWLKKRNKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I  ICISK++G +WHPC + +E      +      D+  RRR
Sbjct  61    ELMLLGFLSLLLTVGQGPISNICISKAVGATWHPCSKKQEVKSDKNEDKSSVSDDNARRR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
             LL A  D    G   RR+LA  G DKCA +  VPF+S  GIHQLHI IFVLA+FHVLYCI
Sbjct  121   LLSAL-DSSGGG---RRVLAAAGYDKCAAKNKVPFVSYYGIHQLHILIFVLAVFHVLYCI  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TL  GR KMRKWK WE ETKT  YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIV
Sbjct  177   TTLVLGRAKMRKWKTWELETKTAAYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISP IW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFIAAHLAPQSQTKFDFQKYINRSLEEDFKVVVGISPTIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             LFAV+ L+ NTHG+RSYLWLPF+PLV+IL+VGTKLQVIITKMGL++ ERGEVV+GTP+V+
Sbjct  297   LFAVLILMSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEVVRGTPLVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             P D LFWFN PRL+LY+IHFVLFQNAF LAFFAW WYEFGLKSCFHEK ED+V+RISMG
Sbjct  357   PGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSCFHEKLEDVVLRISMG  415



>ref|XP_010492678.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=568

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/555 (56%), Positives = 399/555 (72%), Gaps = 23/555 (4%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++L+ T TWAVA VCFVL+ ISIVIE  IH IG  L+K++KK L+EALEK+KAELMLLGF
Sbjct  11    QNLQHTSTWAVAVVCFVLLFISIVIEKSIHRIGTWLKKKHKKDLFEALEKVKAELMLLGF  70

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ+ I KICISK + ++ HPC   +       +   G G++ R    L     
Sbjct  71    ISLLLTIGQTPISKICISKHVASTMHPCSAAQAAKMKAAEKEHGGGEKSRLLFEL-----  125

Query  612   DEYSGESH--RRILAGGGTDKC-AKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLA  782
                  ES+  RR LA  G DKC  + G V F+SA GIHQLHIFIFVLA+ HV+YCI+T  
Sbjct  126   ----AESYIPRRSLATKGDDKCTGQPGKVAFVSAYGIHQLHIFIFVLAVVHVIYCIVTYG  181

Query  783   FGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFR  962
              G+ KMR+WK WE E KT+EYQ ++DP R RFARDT+FGRRHLSFWS++   LWIVCFFR
Sbjct  182   LGKSKMRRWKPWEEEAKTIEYQLSNDPARSRFARDTTFGRRHLSFWSKTSITLWIVCFFR  241

Query  963   QFVRSVPKVDYMTLRHGFIIAHLAPQSQ--MNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             QF  S+ KVDY+TLRHGFI AH AP++Q  + +DF+++I+R+LEEDFK VV ISP IW  
Sbjct  242   QFFGSITKVDYLTLRHGFITAHFAPRNQSIITYDFRKHIQRTLEEDFKTVVEISPVIWFA  301

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+FLL N+ G  SYLWLPFIPLV+ L+ GTKLQVIITKMGLR Q++ ++V+G PVVQP 
Sbjct  302   AVLFLLTNSTGLHSYLWLPFIPLVVSLIAGTKLQVIITKMGLRTQQKDDMVRGAPVVQPG  361

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKT-EDLVIRISMGLL  1493
             DDLFWFN PR  L+LIH VLF NAFQLAFFAW+ +EFGLK+CFH+++  ++VIR+ +G  
Sbjct  362   DDLFWFNNPRFFLFLIHLVLFTNAFQLAFFAWSTFEFGLKNCFHDESIPNVVIRLLVGAF  421

Query  1494  IQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLS  1673
             +Q+LCSYVTLPLYALVT MGS +KPT+FNE VA AL+ WH TA+ Q +  +HS S TP +
Sbjct  422   VQILCSYVTLPLYALVTHMGSQLKPTVFNEEVATALEKWHHTAKDQTKHGKHSESNTPFA  481

Query  1674  SRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWF----NQRRDNNVDQPAEEN  1841
             SRP TPLH +S  HLL     +  SVG+ P+    D+  W     +Q  + +   P    
Sbjct  482   SRPATPLHESSSSHLLHNVNKQ--SVGSHPSSQEHDH-SWDPESQHQEAETSTHNPLAHE  538

Query  1842  RNELQREIEMESAEF  1886
              +E ++ + + S+E 
Sbjct  539   SSEKKKPV-LSSSEL  552



>ref|XP_007143692.1| hypothetical protein PHAVU_007G093600g [Phaseolus vulgaris]
 gb|ESW15686.1| hypothetical protein PHAVU_007G093600g [Phaseolus vulgaris]
Length=556

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/545 (58%), Positives = 380/545 (70%), Gaps = 45/545 (8%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R LE TPTW VAAVCFV++AISI+IE+VI  +GK L+K++KKAL+EALEKIK ELMLLGF
Sbjct  9     RKLEATPTWVVAAVCFVMLAISIIIEHVIEELGKWLKKKHKKALHEALEKIKGELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +S LL V +  I+ ICI +S+ ++W+PCD                               
Sbjct  69    LSFLLVVFEDRIVSICIPESVASTWNPCD-------------------------------  97

Query  612   DEYSGESHRRILAGGGTDKCAK--EGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAF  785
                   S+    A G  +KCAK  EG V F+S  G+HQLHIF+FVLA+FH+L CI+TL  
Sbjct  98    -----PSYVSKGAEGYVEKCAKKKEGTVAFMSKYGLHQLHIFVFVLAIFHILQCIMTLTL  152

Query  786   GRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQ  965
             GR K+  W+ WE ETK LE+QF+HDPERFRFARDT+FGRRHL+ WS+SP LLWIV F RQ
Sbjct  153   GRTKISIWRKWEDETKGLEHQFSHDPERFRFARDTTFGRRHLNSWSKSPTLLWIVSFCRQ  212

Query  966   FVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVI  1145
             F  S+ K DYM LRHGF++AHL P S+  FDFQ YI R+L+EDF VVVGISP IW FAV+
Sbjct  213   FYGSLNKADYMALRHGFVVAHLTPASEPKFDFQNYITRTLDEDFAVVVGISPTIWFFAVV  272

Query  1146  FLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDL  1325
              LL NTHG  SY W+PFIPL+IILLVGTKLQ+IIT M L+IQ+RGEVVKG PVVQP D+L
Sbjct  273   ILLTNTHGWYSYFWVPFIPLIIILLVGTKLQMIITDMALKIQDRGEVVKGEPVVQPGDEL  332

Query  1326  FWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLK--SCFHEKTEDLVIRISMGLLIQ  1499
             FWFN PRL+L+LIH VLF NAFQLAFF W+  + G K  SCFH  T D+VIR++MG+L Q
Sbjct  333   FWFNNPRLVLFLIHLVLFLNAFQLAFFTWSTLDNGFKINSCFHRTTADIVIRLTMGVLTQ  392

Query  1500  VLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSR  1679
             VLCSYVTLPLYALV QMGS+MKPTIF + VA ALKSWH +A+K L+  R S S TP SSR
Sbjct  393   VLCSYVTLPLYALVIQMGSSMKPTIFKDNVASALKSWHHSAKKHLKHNRDSTSNTPFSSR  452

Query  1680  PGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQR  1859
             PGTP  G SP+HLL  +    DS   SP     +N  W     D  V      +  ++  
Sbjct  453   PGTPTRGMSPVHLLHKHPRHSDSPLVSPRASDYENGQW-----DAEVSHSPSHHARDIDH  507

Query  1860  EIEME  1874
             E  M+
Sbjct  508   EETMQ  512



>ref|XP_004149543.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
Length=415

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/419 (72%), Positives = 346/419 (83%), Gaps = 4/419 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGG GRSLEETPTWAVAAVCFVLV ISI+IE+++HLIGK L+K++K+ALYEALEKIK+
Sbjct  1     MAGGGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQS I  +CI   +  +WHPC    EE+              R+  
Sbjct  61    ELMLLGFISLLLTVGQSLITNVCIPPDVAATWHPCSPQREEELTKEADLVDSDQNRRKLL  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              L    +  +     R + A GGTDKCA +G VPF+S  GIHQLHIFIFVLA+FHVLYC+
Sbjct  121   ALSHHVNATF----RRSLAAAGGTDKCAAKGKVPFVSEGGIHQLHIFIFVLAVFHVLYCV  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +TLA G  KMR WK+WE ET+T+EYQF+HDPERFRFARDTSFGRRHLSFW++SPFL+WIV
Sbjct  177   LTLALGNAKMRSWKSWEKETRTVEYQFSHDPERFRFARDTSFGRRHLSFWTKSPFLIWIV  236

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGF++      S   FDFQ+YIKRSLEEDFKVVV ISPPIW
Sbjct  237   CFFRQFVRSVPKVDYLTLRHGFVMVSSILHSDQKFDFQKYIKRSLEEDFKVVVSISPPIW  296

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG R+YLWLPF+PL+I+LLVGTKLQVIITKM LRIQERGEVVKG PVV+
Sbjct  297   FFAVLFLLFNTHGWRAYLWLPFVPLIIVLLVGTKLQVIITKMALRIQERGEVVKGVPVVE  356

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             P DDLFWFNRPRL+LYLI+FVLFQNAFQLAFFAW W EFG+KSCFHE TEDLVIRI+MG
Sbjct  357   PGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSCFHEHTEDLVIRITMG  415



>ref|NP_001185281.1| MLO-like protein 6 [Arabidopsis thaliana]
 ref|NP_001185283.1| MLO-like protein 6 [Arabidopsis thaliana]
 gb|AEE33852.1| MLO-like protein 6 [Arabidopsis thaliana]
 gb|AEE33854.1| MLO-like protein 6 [Arabidopsis thaliana]
Length=521

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/496 (62%), Positives = 366/496 (74%), Gaps = 19/496 (4%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             ML+GFISLLLT+GQ  I  ICI K++  S HPC   EE  KYG      + +E   RR L
Sbjct  1     MLMGFISLLLTIGQGYISNICIPKNIAASMHPCSASEEARKYGKKDVPKEDEEENLRRKL  60

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
             L   D        RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+YCI+T
Sbjct  61    LQLVDSLIP----RRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIYCIVT  116

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
              A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHLSFWS+S   LWIVCF
Sbjct  117   YALGKTKMRRWKKWEEETKTIEYQYSHDPERFRFARDTSFGRRHLSFWSKSTITLWIVCF  176

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P IW  
Sbjct  177   FRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPVIWFI  236

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+FLL NT+G  SYLWLPFIP ++IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+VQP 
Sbjct  237   AVLFLLTNTNGLNSYLWLPFIPFIVILIVGTKLQVIITKLGLRIQEKGDVVKGTPLVQPG  296

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             D  FWF RPR +L+LIH VLF NAFQLAFF W+ YEFGLK+CFHE   D++IRIS+GLL+
Sbjct  297   DHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNCFHESRVDVIIRISIGLLV  356

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+K ++  R S S TP SS
Sbjct  357   QILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKNIKHGRTSESTTPFSS  416

Query  1677  RPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQ  1856
             RP TP HG+SPIHLL+       +     +R ++++          N   P   + +   
Sbjct  417   RPTTPTHGSSPIHLLR-------NAPHKRSRSVDESFA--------NSFSPRNSDFDSWD  461

Query  1857  REIEMESAEFSFENKR  1904
              E + E+AE S  N R
Sbjct  462   PESQHETAETSNSNHR  477



>ref|XP_006595457.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=579

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/459 (66%), Positives = 360/459 (78%), Gaps = 15/459 (3%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVG+  I +ICIS+ +   +HPC       +      D   D+   RRLL
Sbjct  1     MLLGFISLLLTVGEGVISRICISEKVAGKFHPCS----IKRVKPPLDDHHHDDTNGRRLL  56

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
              AF D +   +++RRILA G  DKCA +G VPF+S++ IHQLHIFIFVLA+FHVLYCI+T
Sbjct  57    AAFLDSD--NQNNRRILALGARDKCAAQGKVPFVSSEAIHQLHIFIFVLAVFHVLYCILT  114

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
             LA GR KMR+WK WE ETKT EYQF+HDPERFRFAR+TSFGRRHLSFW+++  L+WIVCF
Sbjct  115   LALGRAKMRRWKRWEVETKTAEYQFSHDPERFRFARETSFGRRHLSFWTQNTVLVWIVCF  174

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQFVRSVPKVDY+TLRHGF++ HL PQS   F+F++YIKRSLEEDFKVVV ISPPIW  
Sbjct  175   FRQFVRSVPKVDYLTLRHGFMMTHLGPQSHQKFNFRKYIKRSLEEDFKVVVEISPPIWFI  234

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
              V+FLLFNTHG  SYLWLPF PL+I+LLVGTKLQVIITKMG RIQ+RGEVVKG P+VQP 
Sbjct  235   TVLFLLFNTHGWYSYLWLPFAPLIIVLLVGTKLQVIITKMGQRIQQRGEVVKGVPLVQPG  294

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             DDLFWFN+PRL+LYLI+FVLFQNAFQLAFF+WA  +F +KSCFH + +D+VIRISMG+ +
Sbjct  295   DDLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSCFHSQKQDVVIRISMGIFV  354

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             Q LCSYVTLPLYALVTQMGS MKPTIFNERVA+AL+ WH TA+K ++  R          
Sbjct  355   QFLCSYVTLPLYALVTQMGSTMKPTIFNERVARALRKWHHTAKKNVKHNR--------GL  406

Query  1677  RPGTPLHGTSPIHLLQYYKSEIDSVGASPAR-DIEDNLP  1790
             R  TP H  S  + L+ Y SE+ +  +SP R D++ +LP
Sbjct  407   RLQTPNHTKSNANFLRRYHSEMATYPSSPIRFDLDAHLP  445


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  1248  TKMGLRIQERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEF  1427
              K G RI++RGEVVK  P+VQP DDLFWFN+PRL LYLI+FVLFQNAFQLA+F+W   +F
Sbjct  487   NKDGQRIEQRGEVVKVVPLVQPGDDLFWFNKPRLTLYLINFVLFQNAFQLAYFSWTALQF  546

Query  1428  GLKSCFHEKTEDLVIRISMGL  1490
             G+KS FH +TED VI++SMGL
Sbjct  547   GIKSSFHSQTEDSVIKVSMGL  567



>ref|XP_010043721.1| PREDICTED: MLO-like protein 6 isoform X2 [Eucalyptus grandis]
Length=409

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/419 (72%), Positives = 345/419 (82%), Gaps = 10/419 (2%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLE+TPTWAVA VCFVLV +SI+IEY+IHLIG+ L+K++K+ALYEALEKIK+
Sbjct  1     MAGAAGGRSLEQTPTWAVAVVCFVLVLVSIIIEYIIHLIGQWLKKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTVGQ  I KICI + +G +WHPC++ EEE+    ++  G         
Sbjct  61    ELMLLGFISLLLTVGQGPITKICIPQKVGATWHPCNKKEEEEGAEEESDAGRRRLLGMMG  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                        G S RR LA   T     EG VPFISADGIHQLHIFIFVLA+FHVLYCI
Sbjct  121   ----------PGGSFRRALATATTTNQCAEGKVPFISADGIHQLHIFIFVLAVFHVLYCI  170

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A G+ KMR WKAWE+ET+T EYQF+HDP RFRF R+TSFG+RHL+FW+++P L+WIV
Sbjct  171   LTMALGQAKMRSWKAWETETRTAEYQFSHDPHRFRFTRETSFGKRHLNFWTKTPVLIWIV  230

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISPPIW
Sbjct  231   CFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSQTKFDFQKYINRSLEEDFKVVVGISPPIW  290

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLLFNTHG  SYLWLPFIPL+IILLVGTKLQVIITKMGLRI ERGEV+KG P+V 
Sbjct  291   FLAVLFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVIITKMGLRIHERGEVIKGVPLVH  350

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             P DDLFWFNRP L+LYLI+FVLFQNAFQLAFFAW  YEFG KSCFH  TED+VIRI+MG
Sbjct  351   PGDDLFWFNRPHLILYLINFVLFQNAFQLAFFAWTVYEFGFKSCFHAHTEDVVIRITMG  409



>ref|XP_010068861.1| PREDICTED: MLO-like protein 2 [Eucalyptus grandis]
Length=560

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/583 (56%), Positives = 396/583 (68%), Gaps = 54/583 (9%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+L++T TW+VA VC VL+AISI IE++IHL+GK L+ R K AL+EALE +K 
Sbjct  1     MAEASEERTLQKTSTWSVAVVCVVLLAISIFIEHIIHLLGKWLKNRRKPALFEALEVVKN  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q  I  ICIS+++  +W PC   E    Y                
Sbjct  61    ELMLLGFISLLLTVFQEHIAGICISENIAYTWLPCSEEELSKIYPNGRRLL---------  111

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKE-GMVPFISADGIHQLHIFIFVLALFHVLYC  767
                    D  +G   RR LA  G DKC +E G V F++A GIHQLHIFIFVLA+FHVLY 
Sbjct  112   -------DFSAGPISRRSLATKGYDKCTEEEGKVAFVTAYGIHQLHIFIFVLAIFHVLYG  164

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             I TLA G  KMRKWK WE+ETKT EYQF +DPERFRFARDTSFGRRHLSFWSRSP  LWI
Sbjct  165   ITTLALGTFKMRKWKVWENETKTTEYQFYNDPERFRFARDTSFGRRHLSFWSRSPISLWI  224

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQF+ SV KVDYM LRHGFI+AHLAP++  +FDFQ YI RSLEEDFKVVVGISP I
Sbjct  225   VCFFRQFLGSVTKVDYMVLRHGFIMAHLAPENAPSFDFQNYISRSLEEDFKVVVGISPTI  284

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVK-GTP-  1301
             W  AV+FLL NTHG  SYLWLPFI L++    GT L          +Q   E+   G P 
Sbjct  285   WFTAVLFLLSNTHGWYSYLWLPFISLIVNNTDGTPL----------VQPGDELFWFGRPR  334

Query  1302  ---------VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEK  1454
                      + QP D+LFWF RPR +L+LIHFVLFQNAFQLAFFAW+ ++F +++CFH K
Sbjct  335   FILFLIHFVLFQPGDELFWFGRPRFILFLIHFVLFQNAFQLAFFAWSTWQFKVQNCFHYK  394

Query  1455  TEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQL  1634
              E+++IRI+MG++IQ+LCSYVTLPLYALVTQMGS MKPTIF++RVA AL+ WH  AR+ +
Sbjct  395   PEEIIIRIAMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFHDRVATALRHWHHGARRHV  454

Query  1635  RQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYKS-EIDSVGASPARDIEDNLPWF-----  1796
             R  +HS + TP  + P TP HG+SPIHLL +Y+   +DS   SP +   +N  W      
Sbjct  455   RHSQHSNNPTPSGTAPATPEHGSSPIHLLHHYQQRSLDSPVTSPRKSDGENEQWAVIGLQ  514

Query  1797  ---NQRRDN-NVDQPAEE------NRNELQREIEMESAEFSFE  1895
                NQ  D+ ++D   +E      N    Q EI++  ++FSF+
Sbjct  515   SPQNQGIDSRHLDTTGQEGSTQQPNSTSNQHEIDITLSDFSFQ  557



>ref|XP_010473363.1| PREDICTED: MLO-like protein 6 isoform X2 [Camelina sativa]
Length=492

 Score =   534 bits (1376),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 296/449 (66%), Positives = 347/449 (77%), Gaps = 18/449 (4%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             ++LEET TWAVA VCFVL+ ISIVIE +IH IG   + +NKKALYEALEK+KAELML+GF
Sbjct  9     KTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLMGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLT+GQ  I  ICI K++  S HPC   EE  KYG        D            D
Sbjct  69    ISLLLTIGQGYISNICIPKNIAASMHPCSPSEEARKYGKKDVPKVEDGEN---------D  119

Query  612   DEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             DE S             RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+Y
Sbjct  120   DENSRRKLLQLVDSFIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIY  179

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI+T A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHL+FWSR+   LW
Sbjct  180   CIVTYALGKTKMRRWKRWEEETKTIEYQYSHDPERFRFARDTSFGRRHLNFWSRTTITLW  239

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P 
Sbjct  240   IVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPV  299

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IW  AV+FLL NT+G  SYLWLPFIP V+IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+
Sbjct  300   IWFVAVLFLLTNTNGLNSYLWLPFIPFVVILVVGTKLQVIITKLGLRIQEKGDVVKGTPL  359

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQP D  FWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFHE + D++IRIS+
Sbjct  360   VQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFKLKNCFHESSVDVIIRISI  419

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPT  1571
             GL++Q+LCSYVTLPLYALVTQMGS M  T
Sbjct  420   GLIVQILCSYVTLPLYALVTQMGSKMTHT  448



>dbj|BAF00789.1| membrane protein Mlo12 [Arabidopsis thaliana]
Length=516

 Score =   534 bits (1376),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 295/454 (65%), Positives = 352/454 (78%), Gaps = 13/454 (3%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLL V Q+ + +ICI +++  +WHPC  H+E  KYG D  D            
Sbjct  1     MLLGFISLLLVVLQTPVSEICIPRNIAATWHPCSNHQEIAKYGKDYIDDGRKILEDFD--  58

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
                ++D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FHVLYCIIT
Sbjct  59    ---SNDFYSP---RRNLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIIT  112

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
              A G+ KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI CF
Sbjct  113   YALGKTKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSTFTLWITCF  172

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQF  SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLE+DF VVVGISP IW  
Sbjct  173   FRQFFGSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIERSLEQDFTVVVGISPLIWCI  232

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+F+L NTHG  SYLWLPF+PL++IL+VG KLQ+II+K+GLRIQE+G+VVKG PVV+P 
Sbjct  233   AVLFILTNTHGWDSYLWLPFLPLIVILIVGAKLQMIISKLGLRIQEKGDVVKGAPVVEPG  292

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             DDLFWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI+MG+LI
Sbjct  293   DDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMGVLI  352

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             QVLCSY+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +   HSGS TP SS
Sbjct  353   QVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHG-HSGSNTPHSS  411

Query  1677  RPGTPLHGTSPIHLLQYYKS----EIDSVGASPA  1766
             RP TP HG SP+HLL  Y +    +  S  ASP+
Sbjct  412   RPTTPTHGMSPVHLLHNYNNRSLDQQTSFTASPS  445



>ref|XP_009133344.1| PREDICTED: MLO-like protein 12 isoform X2 [Brassica rapa]
Length=570

 Score =   533 bits (1373),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 295/457 (65%), Positives = 354/457 (77%), Gaps = 13/457 (3%)
 Frame = +3

Query  408   AELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrr  587
             ++LMLLGFISLLL V Q+ + +ICI + +  +WHPC  H+E  KYG D  D         
Sbjct  26    SQLMLLGFISLLLVVLQTPVSQICIPEKIAATWHPCSSHQESTKYGKDYIDDGRKILEDY  85

Query  588   rlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                   ++D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FH+LYC
Sbjct  86    D-----SNDFYSP---RRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHILYC  137

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             IIT A G+ KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWI
Sbjct  138   IITYALGKTKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNVWSKSSSTLWI  197

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
              CFFRQF  SV KVDY+TLRHGFI+AHL   S   FDFQ+YI+RSLEEDFKVVVGISP I
Sbjct  198   TCFFRQFFGSVTKVDYLTLRHGFIMAHLPAGSGARFDFQKYIQRSLEEDFKVVVGISPVI  257

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W  AV+F+L NTHG  SY WLPF+PLV+IL+VG KLQVII+K+GLRIQ++G+VVKG PVV
Sbjct  258   WCIAVLFILTNTHGWGSYFWLPFLPLVVILIVGAKLQVIISKLGLRIQDKGDVVKGAPVV  317

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P DDLFWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI+MG
Sbjct  318   EPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMG  377

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             +LIQVLCSY+TLPLYALVTQMG++M+PTIFN++VA ALK WH TA+KQ +   HSGS TP
Sbjct  378   VLIQVLCSYITLPLYALVTQMGTSMRPTIFNDKVANALKKWHHTAKKQTKHG-HSGSNTP  436

Query  1668  LSSRPGTPLHGTSPIHLLQYYKS----EIDSVGASPA  1766
              SSRP TP HG SP+HLL  Y++    +  S  ASP+
Sbjct  437   HSSRPTTPTHGMSPVHLLHNYRNRSLDQQTSFTASPS  473



>dbj|BAJ34622.1| unnamed protein product [Thellungiella halophila]
Length=516

 Score =   530 bits (1364),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 295/454 (65%), Positives = 353/454 (78%), Gaps = 13/454 (3%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLL V Q+ + +ICI K +  +WHPC R +E DKYG D  D            
Sbjct  1     MLLGFISLLLVVLQTPVSEICIPKRVAATWHPCSRQQEIDKYGKDYIDDGRKILEDYD--  58

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
                ++D YS    RR LA  G DKCA++G V  +SA GIHQLHIFIFVLA+FH+LYCIIT
Sbjct  59    ---SNDFYSP---RRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHILYCIIT  112

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
              A G+ KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRH++ W++S F LW+ CF
Sbjct  113   YALGKTKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHMNVWTKSSFTLWLTCF  172

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQF  SV KVDY+TLRHGFI AHL   S   FDFQ+YI+RSLEEDFKVVVGISP IW  
Sbjct  173   FRQFFGSVTKVDYLTLRHGFITAHLPAGSAARFDFQKYIQRSLEEDFKVVVGISPVIWCI  232

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+FLL NTHG  SYLWLPF+PL++IL+VG KLQ+II+K+GLRIQ++G+VVKG PVV+P 
Sbjct  233   AVLFLLTNTHGWDSYLWLPFLPLLVILIVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPG  292

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             DDLFWF RPR +L+LIH VLF NAFQLAFF W+ YEF L++CFH KTED+ IRI+MGLLI
Sbjct  293   DDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHKTEDIAIRITMGLLI  352

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             QVLCSY+TLPLYALVTQMG++M+PTIFN+RVA ALK WH TA+KQ +  + SGS TP SS
Sbjct  353   QVLCSYITLPLYALVTQMGTSMRPTIFNDRVASALKKWHHTAKKQTKHGQ-SGSNTPHSS  411

Query  1677  RPGTPLHGTSPIHLL-QYYKSEID---SVGASPA  1766
             RP TP HG SP+HLL  Y+   +D   S  ASP+
Sbjct  412   RPATPTHGMSPVHLLHNYHNRGMDHQTSFTASPS  445



>emb|CDY07669.1| BnaA03g18420D [Brassica napus]
Length=516

 Score =   524 bits (1349),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 287/457 (63%), Positives = 350/457 (77%), Gaps = 17/457 (4%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLL V QS + +ICI + +  +WHPC R +E  KYG D  D   +        
Sbjct  1     MLLGFISLLLVVLQSPVSQICIPERIAATWHPCSREQELAKYGKDYIDDGRE--------  52

Query  597   lAFADDEYSG-ESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCII  773
                 D +++   S RR LA  G DKCA++ +   +SA GIHQLHIFIFVLA+FH+LYCII
Sbjct  53    -VLEDYDFNNFYSPRRSLATKGYDKCAEKALA-LVSAYGIHQLHIFIFVLAVFHILYCII  110

Query  774   TLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVC  953
             T A G+ KM+KWK+WE ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S F LWI C
Sbjct  111   TYALGKTKMKKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSSFTLWITC  170

Query  954   FFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWL  1133
             FFRQF  SV KVDY+TLRHGFI+AH+   S+  FDFQ+YI+RSLEEDFK VVGISP IW 
Sbjct  171   FFRQFFGSVTKVDYLTLRHGFIMAHMPAGSEARFDFQKYIQRSLEEDFKAVVGISPVIWC  230

Query  1134  FAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQP  1313
              AV+F+L NTHG+ SY WLPFIPL +IL+VG KLQVII+K+GLRIQ++G+VVKG PVV+P
Sbjct  231   IAVLFILTNTHGSESYFWLPFIPLFVILIVGAKLQVIISKLGLRIQDKGDVVKGAPVVEP  290

Query  1314  ADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLL  1493
              DDLFWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KT D+ +RI+MG+L
Sbjct  291   GDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTVDIALRITMGVL  350

Query  1494  IQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLS  1673
             IQV+CSY+TLPLYALVTQMG++M+PTIFN+RVA ALK WH+TA+KQ +    SGS TP S
Sbjct  351   IQVVCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHKTAKKQSKHGT-SGSNTPHS  409

Query  1674  SRPGTPLHGTSPIHLLQYYKSEID-----SVGASPAR  1769
             SRP TP HG SP+HLL  +   +D     +  +SP R
Sbjct  410   SRPATPTHGMSPMHLLHSHNRSLDYQTSFTASSSPPR  446



>ref|XP_010917470.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6 [Elaeis guineensis]
Length=614

 Score =   524 bits (1349),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 302/484 (62%), Positives = 354/484 (73%), Gaps = 27/484 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             M  G  GR+LEETPTWAVA +C VLV ISI+IE+ I+L  K L+K +KKAL EA EK+K+
Sbjct  1     MGAGESGRNLEETPTWAVATICAVLVVISIIIEHGIYLSSKWLEKHHKKALREAFEKVKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGF+SLLLTVGQ  I +IC+ KS+ +SWHPC     +D           + GRR  
Sbjct  61    ELMLLGFMSLLLTVGQGIITEICVPKSVADSWHPCKEEVHDDGGSKSHESDKSNAGRR--  118

Query  591   lllAFADDEYSGESHRRILAGGGTDK--CAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
                    D  S  S RR L+ G      CAK   VPFISADG+HQLHIF+FVLA+FHVLY
Sbjct  119   ----LVHDSESMASFRRALSSGAEPNKYCAK-NKVPFISADGLHQLHIFVFVLAVFHVLY  173

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
             CI T+A G LKMR+WK+WE ET+T EYQF+H        R+TS   +         F+L 
Sbjct  174   CITTMALGSLKMRRWKSWELETRTAEYQFSHG----MLIRETSSTHKRTKL---QVFILK  226

Query  945   IV-----------CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEE  1091
             +V           CFFRQFVRSVPKVDY+TLRHGFI+AHLAPQS  NFDF+ YIKRSLEE
Sbjct  227   LVHILKVXSFXQVCFFRQFVRSVPKVDYLTLRHGFIMAHLAPQSSSNFDFRNYIKRSLEE  286

Query  1092  DFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQ  1271
             D KVVVGISPP+W FAV+FLLF +HG  SY W PFIPL+IILLVGT+LQVII KM  +I 
Sbjct  287   DMKVVVGISPPMWSFAVLFLLFYSHGWHSYQWHPFIPLIIILLVGTRLQVIIIKMASQIM  346

Query  1272  ERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHE  1451
             ERG+VVKG PVV P DDLFWF  PR MLYLIHFVLFQNAFQLA FAW+WYEFG  SCFH+
Sbjct  347   ERGDVVKGAPVVHPTDDLFWFKCPRFMLYLIHFVLFQNAFQLALFAWSWYEFGFLSCFHQ  406

Query  1452  KTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQ  1631
             + +D++IR SMG+LIQVLCSYVTLPLYALVTQMGSNM+PTIF++ VA AL+ WH TAR  
Sbjct  407   RVDDIIIRFSMGVLIQVLCSYVTLPLYALVTQMGSNMRPTIFSKGVATALRKWHHTARNH  466

Query  1632  LRQK  1643
             L++ 
Sbjct  467   LKEN  470



>gb|EYU41617.1| hypothetical protein MIMGU_mgv1a0045332mg, partial [Erythranthe 
guttata]
Length=390

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 276/385 (72%), Positives = 318/385 (83%), Gaps = 19/385 (5%)
 Frame = +3

Query  798   MRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFVRS  977
             MRKWKAWE ET+T EYQ++HDPERFRF RDTSFGRRH+SFWS+SP L+W+VCFFRQFVRS
Sbjct  1     MRKWKAWEMETRTAEYQYSHDPERFRFTRDTSFGRRHMSFWSKSPVLIWVVCFFRQFVRS  60

Query  978   VPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFLLF  1157
             VPKVDYMTLRHGFI AHLAP SQ +FDFQ+YIKR+LE DFKV+VGISPPIWLFAV+FLLF
Sbjct  61    VPKVDYMTLRHGFITAHLAPHSQTDFDFQKYIKRTLEADFKVIVGISPPIWLFAVLFLLF  120

Query  1158  NTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFWFN  1337
             NT G RSYLWLPFIPL++ILLVGTKLQVIITKMGLR QERGEVVKGTPVVQPAD+LFWFN
Sbjct  121   NTQGWRSYLWLPFIPLIMILLVGTKLQVIITKMGLRFQERGEVVKGTPVVQPADNLFWFN  180

Query  1338  RPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCSYV  1517
             RP L+L+L+HFV FQNAFQLAFF WAWYEFG++SCFHE T+D+ IRI+MG++IQ+LCSYV
Sbjct  181   RPYLLLHLVHFVFFQNAFQLAFFIWAWYEFGIRSCFHETTKDITIRITMGVVIQILCSYV  240

Query  1518  TLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTPLH  1697
             TLPLYALVTQMGSNMKPTIFNERVAKAL++WHQTARKQ+++  HSG  TP SSRP TPLH
Sbjct  241   TLPLYALVTQMGSNMKPTIFNERVAKALRTWHQTARKQIKKNSHSGLGTPPSSRPSTPLH  300

Query  1698  GTSPIHLLQYYKSEIDSVGASPARDI---------EDNLPWFNQRRDNNVDQPAEE----  1838
             G+SP+HLL++ KSE DSV ASP   I          D++PW N       +   EE    
Sbjct  301   GSSPLHLLRHNKSEFDSVNASPRTTIHKTESWPAEHDDVPWSNNNNTGTANPIEEETEIQ  360

Query  1839  --NRNELQR----EIEMESAEFSFE  1895
               + N + +      E  S +FSFE
Sbjct  361   EYSNNPISQPHHLRNETHSVDFSFE  385



>ref|XP_006485875.1| PREDICTED: MLO-like protein 12-like [Citrus sinensis]
Length=411

 Score =   516 bits (1329),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 288/412 (70%), Positives = 331/412 (80%), Gaps = 9/412 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVAAV FVL+A+S+VIE++IH+IGK L  R+KKAL+EA+EK+KAELMLLGF
Sbjct  9     RTLEETPTWAVAAVFFVLIAVSVVIEHLIHIIGKWLNNRHKKALFEAVEKVKAELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I  IC+SKS+ NSWHPC    E+D Y  D  +             +F D
Sbjct  69    ISLLLTVLQEPISGICVSKSVANSWHPCTDKLEKDAYSSDNKESRRRLL-------SFLD  121

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
                   S RR LA  G DKCA EG V F+SA GIHQLHIFIFVLA+FHVLYC+ TLA GR
Sbjct  122   S--GTASTRRSLATKGYDKCADEGKVAFVSAYGIHQLHIFIFVLAIFHVLYCLFTLALGR  179

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWKAWE+ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWIVCFFRQF+
Sbjct  180   TKMKKWKAWENETKTIEYQYYNDPERFRFARDTSFGRRHLNIWSKSSISLWIVCFFRQFL  239

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV K+DY TLRHGFI+AHLAP S+  FDFQ+YI RSLEEDFK VVGI+P +W  A +FL
Sbjct  240   GSVNKIDYHTLRHGFIMAHLAPGSETKFDFQKYISRSLEEDFKDVVGITPILWFIATLFL  299

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  +YLWLPFIPL IILLVG KLQVIITK+GLRIQERG+VVKG PVVQP DDLFW
Sbjct  300   LTNTHGWFAYLWLPFIPLFIILLVGAKLQVIITKLGLRIQERGDVVKGAPVVQPGDDLFW  359

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             F RPR +L+LIH VLFQNAFQLAFF+W+ YEF LKSCFH+KTED+ IRISMG
Sbjct  360   FGRPRFILFLIHLVLFQNAFQLAFFSWSTYEFALKSCFHKKTEDIAIRISMG  411



>gb|KDO48444.1| hypothetical protein CISIN_1g008391mg [Citrus sinensis]
Length=411

 Score =   516 bits (1328),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 288/412 (70%), Positives = 331/412 (80%), Gaps = 9/412 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVAAV FVL+A+S+VIE++IH+IGK L  R+KKAL+EA+EK+KAELMLLGF
Sbjct  9     RTLEETPTWAVAAVFFVLIAVSVVIEHLIHIIGKWLNNRHKKALFEAVEKVKAELMLLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I  IC+SKS+ NSWHPC    E+D Y  D  +             +F D
Sbjct  69    ISLLLTVLQEPISGICVSKSVANSWHPCTDKLEKDAYSSDNKESRRRLL-------SFLD  121

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
                   S RR LA  G DKCA EG V F+SA GIHQLHIFIFVLA+FHVLYC+ TLA GR
Sbjct  122   S--GTASTRRSLATKGYDKCADEGKVAFVSAYGIHQLHIFIFVLAVFHVLYCLFTLALGR  179

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KM+KWKAWE+ETKT+EYQ+ +DPERFRFARDTSFGRRHL+ WS+S   LWIVCFFRQF+
Sbjct  180   TKMKKWKAWENETKTIEYQYYNDPERFRFARDTSFGRRHLNIWSKSSISLWIVCFFRQFL  239

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV K+DY TLRHGFI+AHLAP S+  FDFQ+YI RSLEEDFK VVGI+P +W  A +FL
Sbjct  240   GSVNKIDYHTLRHGFIMAHLAPGSETKFDFQKYISRSLEEDFKDVVGITPILWFIATLFL  299

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  +YLWLPFIPL IILLVG KLQVIITK+GLRIQERG+VVKG PVVQP DDLFW
Sbjct  300   LTNTHGWFAYLWLPFIPLFIILLVGAKLQVIITKLGLRIQERGDVVKGAPVVQPGDDLFW  359

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             F RPR +L+LIH VLFQNAFQLAFF+W+ YEF LKSCFH+KTED+ IRISMG
Sbjct  360   FGRPRFILFLIHLVLFQNAFQLAFFSWSTYEFALKSCFHKKTEDIAIRISMG  411



>ref|NP_001185282.1| MLO-like protein 6 [Arabidopsis thaliana]
 gb|AEE33853.1| MLO-like protein 6 [Arabidopsis thaliana]
Length=521

 Score =   518 bits (1335),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 301/498 (60%), Positives = 362/498 (73%), Gaps = 23/498 (5%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             ML+GFISLLLT+GQ  I  ICI K++  S HPC   EE  KYG      + +E   RR L
Sbjct  1     MLMGFISLLLTIGQGYISNICIPKNIAASMHPCSASEEARKYGKKDVPKEDEEENLRRKL  60

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIIT  776
             L   D        RR LA  G DKCA++G V F+SA G+HQLHIFIFVLA+ HV+YCI+T
Sbjct  61    LQLVDSLIP----RRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIYCIVT  116

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
              A G+ KMR+WK WE ETKT+EYQ++HDPERFRFARDTSFGRRHLSFWS+S   LWIVCF
Sbjct  117   YALGKTKMRRWKKWEEETKTIEYQYSHDPERFRFARDTSFGRRHLSFWSKSTITLWIVCF  176

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQF RSV KVDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V I+P IW  
Sbjct  177   FRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPVIWFI  236

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+FLL NT+G  SYLWLPFIP ++IL+VGTKLQVIITK+GLRIQE+G+VVKGTP+VQP 
Sbjct  237   AVLFLLTNTNGLNSYLWLPFIPFIVILIVGTKLQVIITKLGLRIQEKGDVVKGTPLVQPG  296

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSC-FHE-KTEDLVIRISMGL  1490
             D  FWF RPR +L+LIH VLF NAFQLAFF W+      +SC  HE +T D++IRIS+GL
Sbjct  297   DHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWST--VSKQSCILHELETVDVIIRISIGL  354

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             L+Q+LCSYVTLPLYALVTQMGS MKPT+FNERVA ALKSWH TA+K ++  R S S TP 
Sbjct  355   LVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKNIKHGRTSESTTPF  414

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNE  1850
             SSRP TP HG+SPIHLL+       +     +R ++++          N   P   + + 
Sbjct  415   SSRPTTPTHGSSPIHLLR-------NAPHKRSRSVDESFA--------NSFSPRNSDFDS  459

Query  1851  LQREIEMESAEFSFENKR  1904
                E + E+AE S  N R
Sbjct  460   WDPESQHETAETSNSNHR  477



>emb|CDY07665.1| BnaA03g18460D [Brassica napus]
Length=521

 Score =   518 bits (1333),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 301/530 (57%), Positives = 363/530 (68%), Gaps = 47/530 (9%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLL V QS + +ICI + +  +WHPC   +E  KY  D  D            
Sbjct  1     MLLGFISLLLVVLQSPVSQICIPERIAATWHPCSSQQELAKYSKDYIDDGRKILEDYD--  58

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKE------GMVPFISADGIHQLHIFIFVLALFHV  758
                ++D YS    RR LA  G DKCA+       G V  +SA GIHQLHIFIFVLA+FH+
Sbjct  59    ---SNDFYSP---RRSLATKGYDKCAENALFLLFGKVALVSAYGIHQLHIFIFVLAVFHI  112

Query  759   LYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFL  938
             LYCIIT A G+ KM+KWK+WE ETKTLEYQ+ +DPERFRFARDTSFGRRHL+ WS+S F 
Sbjct  113   LYCIITYALGKTKMKKWKSWEKETKTLEYQYANDPERFRFARDTSFGRRHLNIWSKSSFT  172

Query  939   LWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGIS  1118
             LWI CFFRQF  SV KVDY+TLRHGFI+AHL   S+  FDFQ+YI+RSLEEDFK VVGIS
Sbjct  173   LWITCFFRQFFGSVTKVDYLTLRHGFIMAHLPAGSEARFDFQKYIQRSLEEDFKAVVGIS  232

Query  1119  PPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGT  1298
             P IW  AV+F+L NTHG  SY WLPF+PL++IL+VG KLQVII+K+GLRIQ++G+VVKG 
Sbjct  233   PVIWCIAVLFILTNTHGWDSYFWLPFLPLLVILIVGAKLQVIISKLGLRIQDKGDVVKGA  292

Query  1299  PVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRI  1478
             PVV+P DDLFWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ IRI
Sbjct  293   PVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRI  352

Query  1479  SMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGS  1658
             +MG+LIQV+CSY+TLPLYALVTQMGS+M+PTIFN+RVA ALK WH TA+KQ +   +SGS
Sbjct  353   TMGVLIQVVCSYITLPLYALVTQMGSSMRPTIFNDRVANALKKWHNTAKKQAKHG-NSGS  411

Query  1659  VTPLSSRPGTPLHGTSPIHLLQYYKSEID-------------------------------  1745
              TP SSRP TP H  S  HLL      +D                               
Sbjct  412   NTPRSSRPTTPKHNRSLDHLLHNRNRSLDHQTSFTASPSPPRLSDSGRHGHGPQHFFDPE  471

Query  1746  SVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQREIEMESAEFSFE  1895
             S   SP  DI D      Q+   +V  P  E + E+   ++++  EF+F+
Sbjct  472   SQNVSPYSDITDFDNGNIQQPHADVASPVTEEK-EITEHVKIDLPEFTFK  520



>emb|CDY14401.1| BnaC03g21940D [Brassica napus]
Length=524

 Score =   516 bits (1329),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 300/533 (56%), Positives = 360/533 (68%), Gaps = 50/533 (9%)
 Frame = +3

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLL V QS + +ICI + +  +WHPC   +E  KY  D  D            
Sbjct  1     MLLGFISLLLVVLQSPVSQICIPERIAATWHPCSSQQELAKYSKDYIDDGRKILEDY---  57

Query  597   lAFADDEYSGESHRRILAGGGTDKCAKE---------GMVPFISADGIHQLHIFIFVLAL  749
                  D     S RR LA  G DKCA+          G V  +SA GIHQLHIFIFVLA+
Sbjct  58    -----DSNDFNSPRRSLATKGYDKCAENACLYFSYSLGKVALVSAYGIHQLHIFIFVLAV  112

Query  750   FHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRS  929
             FH+LYCIIT A G+ KM+KWK+WE ETKTLEYQ+ +DPERFRFARDTSFGRRHL+ WS+S
Sbjct  113   FHILYCIITYALGKTKMKKWKSWEKETKTLEYQYANDPERFRFARDTSFGRRHLNIWSKS  172

Query  930   PFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVV  1109
              F LWI CFFRQF  SV KVDY+TLRHGFI+AHL   S+  FDFQ+YI+RSLEEDFK VV
Sbjct  173   SFTLWITCFFRQFFGSVTKVDYLTLRHGFIMAHLPAGSEARFDFQKYIQRSLEEDFKAVV  232

Query  1110  GISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVV  1289
             GISP IW  AV+F+L NTHG  SY WLPF+PL++IL+VG KLQVII+K+GLRIQ++G+VV
Sbjct  233   GISPVIWCIAVLFILTNTHGWDSYFWLPFLPLLVILIVGAKLQVIISKLGLRIQDKGDVV  292

Query  1290  KGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLV  1469
             KG PVV+P DDLFWF RPR +L+LIH VLF NAFQLAFF W+ YEF LK+CFH KTED+ 
Sbjct  293   KGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIA  352

Query  1470  IRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRH  1649
             IRI+MG+LIQV+CSY+TLPLYALVTQMGS+M+PTIFN+RVA ALK WH TA+KQ +   +
Sbjct  353   IRITMGVLIQVVCSYITLPLYALVTQMGSSMRPTIFNDRVANALKKWHNTAKKQAKHG-N  411

Query  1650  SGSVTPLSSRPGTPLHGTSPIHLLQYYKSEID----------------------------  1745
             SGS TP SSRP TP H  S  HLL      +D                            
Sbjct  412   SGSNTPRSSRPTTPKHNRSLDHLLHNRNRSLDHQTSFTASPSPPRLSDSGRHGHGPQHFF  471

Query  1746  ---SVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQREIEMESAEFSFE  1895
                S   SP  DI D      Q+   +V  P  E + E+   ++++  EF+F+
Sbjct  472   DPESQNVSPYSDITDFDNGNIQQPHADVASPVTEEK-EITEHVKIDLPEFTFK  523



>ref|XP_010658319.1| PREDICTED: MLO7 protein isoform X1 [Vitis vinifera]
Length=377

 Score =   506 bits (1303),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 326/419 (78%), Gaps = 42/419 (10%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     RSLEETPTWAVA VCFVL+A+SI IE++ HLIG  L+ R+++ALYE+LEKIKA
Sbjct  1     MADELEERSLEETPTWAVAVVCFVLLAVSIFIEHIFHLIGSWLKGRHRRALYESLEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLG ISLLLT+ Q  I KICIS+S+G++WHPC +                       
Sbjct  61    ELMLLGVISLLLTILQDYISKICISESVGSTWHPCKKE----------------------  98

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                                     + C+ EG VP +S+ GIHQLHIFIFVLALFHV+YC+
Sbjct  99    -------------------TKDFKNTCS-EGKVPLVSSYGIHQLHIFIFVLALFHVIYCV  138

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
              TLA GR KMR+WKAWE +TKT+EYQ++HDPERFRFARDTSFGRRHL+FWSRSP LLWIV
Sbjct  139   ATLALGRTKMRRWKAWEDQTKTIEYQYSHDPERFRFARDTSFGRRHLNFWSRSPVLLWIV  198

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF RSV  VDY+TLRHGFI+AHL+P S+  FDF+ YIKRSLEEDFKVVV ISP IW
Sbjct  199   CFFRQFFRSVNNVDYLTLRHGFIMAHLSPGSETKFDFRNYIKRSLEEDFKVVVSISPVIW  258

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NTHG  SYLWLPFIPLVIILLVGTKLQVIITK+GLRI ERG+VVKGTPVV+
Sbjct  259   FCAVLFLLTNTHGWYSYLWLPFIPLVIILLVGTKLQVIITKLGLRIAERGDVVKGTPVVE  318

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             PA+DLFWFNRP L+L+LI+FVLF NAFQLAFFAW+ YEFGL+SC+H+KTED+ IRISMG
Sbjct  319   PANDLFWFNRPHLILFLINFVLFLNAFQLAFFAWSTYEFGLQSCYHQKTEDIAIRISMG  377



>ref|XP_006488133.1| PREDICTED: MLO-like protein 6-like isoform X2 [Citrus sinensis]
Length=418

 Score =   506 bits (1302),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 300/419 (72%), Positives = 347/419 (83%), Gaps = 1/419 (0%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  GGRSLEETPTWAVA VCFVLV ISI+IE++IHLIGK L K++K+ALYEALEKIK+
Sbjct  1     MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV  S I KICI +S+ N+WHPCD+  E +                 R
Sbjct  61    ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDKEREAELNNEKETTEQETTEHENR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
               L  A     G   R + AG  TDKC+K G VPF+S DG+HQLHIFIFVLALFHVLY I
Sbjct  121   RRLLAAVAASGGSIRRALAAGSTTDKCSK-GKVPFVSEDGLHQLHIFIFVLALFHVLYSI  179

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A  R KM+KWK WE ET+T+EYQF+HDPERFRFAR+TSFGRRHLS W+++P L+WIV
Sbjct  180   LTMALSRAKMKKWKKWEKETRTIEYQFSHDPERFRFARETSFGRRHLSSWTKTPVLIWIV  239

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQFVRSVPKVDY+TLRHGF+ AHLAPQS   F+FQ+YI RSLEEDFKVVVGISP IW
Sbjct  240   CFFRQFVRSVPKVDYLTLRHGFVTAHLAPQSHTQFNFQKYINRSLEEDFKVVVGISPLIW  299

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FAV+FLLFNTHG  +YLWLPFIPL++ILLVGTKLQVIITKMG+RIQERGEV+KG PVVQ
Sbjct  300   FFAVVFLLFNTHGWYAYLWLPFIPLIVILLVGTKLQVIITKMGIRIQERGEVLKGVPVVQ  359

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
               DDLFWF++PRL+LYLI+FVLFQNAFQLAFFAW+W+EFG++SCFHE TED+VIRI+MG
Sbjct  360   LGDDLFWFSQPRLILYLINFVLFQNAFQLAFFAWSWFEFGIESCFHEHTEDIVIRITMG  418



>emb|CDX97946.1| BnaA06g06970D [Brassica napus]
Length=543

 Score =   510 bits (1314),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 297/511 (58%), Positives = 369/511 (72%), Gaps = 29/511 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LE+T TWAVA VCFVL+ ISIV+E+ IH IG   +K++KKALYEALEKIKA
Sbjct  1     MANQVKERTLEQTSTWAVAVVCFVLLFISIVLEHSIHKIGSWFKKKHKKALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I  ICIS+S+ +S HPC   +E  KYG        D+G    
Sbjct  61    ELMLMGFISLLLTIGQTPISNICISQSVASSMHPCSAADEARKYGKKVPAKQEDDGEENS  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                    D      HRR LA  G DKCA++G V F+SA GIHQLHIFIF+LA+ HV+YCI
Sbjct  121   GHRRLLLDLAESYIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFILAVVHVIYCI  180

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T A G+ K R+WK WE+ETKT+EY +++DPERFR                         
Sbjct  181   VTYALGKTKTRRWKHWENETKTIEYHYSNDPERFR-------------------------  215

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
                 QF  SV KVDY+ LRHGFI+AHLAP S+  FDF++YI++++EEDFK VV ISP IW
Sbjct  216   ----QFFGSVTKVDYLALRHGFIMAHLAPGSERTFDFRKYIQKTVEEDFKTVVEISPVIW  271

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  S+LWLPFIPLV+IL+VGTKLQVIITK+ LRIQE+G+VV+G PVVQ
Sbjct  272   FVAVLFLLTNTNGLHSFLWLPFIPLVVILVVGTKLQVIITKLCLRIQEKGDVVRGAPVVQ  331

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF L++CF+E   D+VIRI +G+
Sbjct  332   PGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLRNCFYENDADVVIRIVVGV  391

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS M+PT+FNERVA A+K+WH TA+K  +  +H+ S TP 
Sbjct  392   VVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTAKKHTKHGKHTESNTPY  451

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASP  1763
             +SRP TP HG+SP+H+L     E      SP
Sbjct  452   TSRPTTPTHGSSPLHILNNRSVETLPSSTSP  482



>gb|KHN33781.1| MLO protein like 1 [Glycine soja]
Length=547

 Score =   510 bits (1313),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 293/564 (52%), Positives = 380/564 (67%), Gaps = 30/564 (5%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGG    RSL+ETPTWAVAAVC V + IS++IE+ IH +GK  QKR+KKA+ EALEKI
Sbjct  1     MAGGGATAERSLKETPTWAVAAVCSVFIIISVLIEHGIHSLGKWFQKRHKKAMNEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K+ELMLLGFISLL+T G   I KICI  S G+   PC +            +    +   
Sbjct  61    KSELMLLGFISLLITFGTKYIAKICIPVSAGDIMLPCKK-----------VEVSDSDDDS  109

Query  585   rrlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
                    + D+   E  R + A  G D C+++G VP IS  G+HQLHIFIFVLA+FH+ Y
Sbjct  110   NDRRKLLSFDDNVVEWRRVLAAASGGDYCSQKGKVPLISQSGVHQLHIFIFVLAVFHIFY  169

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
              ++T+   R KM+KWKAWE+ET +LEYQFT+DP RFR A  TSF RRH S WSR P + W
Sbjct  170   SVMTMVLARAKMKKWKAWEAETSSLEYQFTNDPARFRLAHQTSFVRRH-SGWSRMPGIRW  228

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IV FFRQF  SV KVDYMT+RHGFI AH AP S+  FDFQ+YIKRS+E+DFKVVVGIS P
Sbjct  229   IVAFFRQFFGSVTKVDYMTMRHGFINAHFAPDSK--FDFQKYIKRSMEDDFKVVVGISIP  286

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             +W+FA++F+L N +   +  WL   PLVI+LLVGTKL++II +M  +IQ+R  +V+G P+
Sbjct  287   LWVFAIVFMLVNVYKWYTLTWLSLAPLVILLLVGTKLELIIMEMAQQIQDRATIVRGVPI  346

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             V+P +  FWFNRP+ +++LIHF LF+NAFQ+AFF W WYEF + SCFHE    ++ R+ +
Sbjct  347   VEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSCFHENLPLILTRVVL  406

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+ +QV+CSY+T PLY+LVTQMGS+MK TIF E+ AKALK W Q A K  R+ R +G   
Sbjct  407   GIALQVVCSYITFPLYSLVTQMGSHMKKTIFEEQTAKALKKW-QKAAKDKRKLRKAGIDI  465

Query  1665  PLSSRPG--TPLHGTSPIHLLQYYK---SEIDSVGASP---ARDIEDNLPWFNQRRDNNV  1820
             P  +  G  TP  GTSP+HLL  YK   ++ DSV  SP     D + +    +  + N +
Sbjct  466   PSGTMSGETTPSQGTSPLHLLHKYKPSHTDTDSVLYSPRSYQSDTDLSETEGSSHQLNEI  525

Query  1821  DQPAEENRNELQREIEMESAEFSF  1892
              Q  + +RN      E  + +FSF
Sbjct  526   TQTRQASRNG-----ETHNIDFSF  544



>emb|CDY57371.1| BnaCnng31840D [Brassica napus]
Length=446

 Score =   504 bits (1297),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 281/453 (62%), Positives = 344/453 (76%), Gaps = 23/453 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     ++L++T TWAVA VCF L+  SIVIE +IH +G   + +NKKALYEALEK+KA
Sbjct  1     MADKVDEKTLQQTSTWAVAVVCFFLLLFSIVIEKLIHKLGTWFKIKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I +IC+S+S+  S HPC   EE  KY     D          
Sbjct  61    ELMLMGFISLLLTIGQNYISQICVSESIAASMHPCSESEEAKKYPPKKKDTKN-------  113

Query  591   lllAFADDEYSGES---------HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVL  743
                   D+E SG            RR LA  G DKCA++G V F+S+ G+HQLHIFIFVL
Sbjct  114   ------DEENSGRKLLELVQSYIPRRSLATKGYDKCAEKGKVAFVSSYGMHQLHIFIFVL  167

Query  744   ALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTH-DPERFRFARDTSFGRRHLSFW  920
             A+ HV+YCI+T A G+ KMR+WK WE ETKT+EYQ++H DPERFRFARDTSFGRRHL+FW
Sbjct  168   AVCHVIYCIVTYALGKTKMRRWKRWEEETKTIEYQYSHADPERFRFARDTSFGRRHLNFW  227

Query  921   SRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFK  1100
             S+S   LWIVCFFRQF  SV +VDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK
Sbjct  228   SKSTITLWIVCFFRQFFGSVTRVDYLTLRHGFIMAHLAPGSDGRFDFRKYIQRSLEEDFK  287

Query  1101  VVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERG  1280
              +V ISP IW  AV+FLL NT+G  S+LW PFIPLV+IL+VGTKLQVIITK+GL IQE+G
Sbjct  288   TIVEISPVIWFVAVLFLLTNTNGLHSFLWQPFIPLVVILIVGTKLQVIITKLGLLIQEKG  347

Query  1281  EVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTE  1460
             ++VKG P+VQP D LFWF RPR +L+LIH VLF NAFQLAFFAW  YEF L++C+H+   
Sbjct  348   DIVKGMPLVQPGDHLFWFGRPRFILFLIHLVLFTNAFQLAFFAWTTYEFQLENCYHKTIV  407

Query  1461  DLVIRISMGLLIQVLCSYVTLPLYALVTQMGSN  1559
             D+VIRIS+G+++Q+LCSYVTLPLYALVTQ+ S 
Sbjct  408   DVVIRISVGVIVQILCSYVTLPLYALVTQVSST  440



>gb|KEH25655.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=411

 Score =   500 bits (1287),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 269/412 (65%), Positives = 324/412 (79%), Gaps = 9/412 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             R+LEETPTWAVA VCFVL+AISIVIE++IH IGK  +K+NK ALYEALEK+K ELML+GF
Sbjct  9     RTLEETPTWAVAVVCFVLLAISIVIEHIIHAIGKWFKKKNKNALYEALEKVKGELMLMGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             ISLLLTV Q  I KICIS+ +G++WHPC   + +     +  + +  + +          
Sbjct  69    ISLLLTVFQDYISKICISEKVGSTWHPCSTPKTKTASNDENSESENHDRKLL--------  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              EY   + RRILA  G D+CA +G V  +SA GIH+LHIFIFVLA+FH+L CIITLA GR
Sbjct  121   -EYFDPNPRRILATKGYDQCADKGKVALVSAYGIHELHIFIFVLAIFHILQCIITLALGR  179

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMR+WK WE ET+T+EYQF +DPERFRFARDT+FGRRHLS W++SP  LWIVCFFRQF 
Sbjct  180   FKMRRWKKWEDETRTVEYQFYNDPERFRFARDTTFGRRHLSMWTKSPISLWIVCFFRQFF  239

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              S+ +VDY+ LRHGFI+AHLAP +   FDFQ+YI RSLE+DFKVVVGISP IW FAV+FL
Sbjct  240   GSISRVDYLALRHGFIMAHLAPGNDAEFDFQKYISRSLEKDFKVVVGISPTIWFFAVLFL  299

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  S  WLPF+PL+IILLVG KLQ+IITKMGLRIQ+RGEV+KG PVV+P D LFW
Sbjct  300   LTNTHGWYSSYWLPFLPLIIILLVGAKLQMIITKMGLRIQDRGEVIKGAPVVEPGDHLFW  359

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             FN P L+L++IH VLFQNAFQLAFF+W+ YEF + SCFH  T D VIR+S+G
Sbjct  360   FNSPNLLLFIIHLVLFQNAFQLAFFSWSTYEFSINSCFHRTTADNVIRVSVG  411



>ref|XP_007135967.1| hypothetical protein PHAVU_009G006800g [Phaseolus vulgaris]
 gb|ESW07961.1| hypothetical protein PHAVU_009G006800g [Phaseolus vulgaris]
Length=551

 Score =   505 bits (1300),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 299/573 (52%), Positives = 385/573 (67%), Gaps = 35/573 (6%)
 Frame = +3

Query  231   MAGG--GGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGG  GG R+L+ETPTWAVA+VC V V +S++IE+ IHL+ K  QKRNKKA+ EALEKI
Sbjct  1     MAGGASGGERTLQETPTWAVASVCAVFVVLSVLIEHGIHLLEKWFQKRNKKAMREALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             KAELMLLGFISLL+T G   I KICI  S G+   PC +            +    +   
Sbjct  61    KAELMLLGFISLLITFGTKYIAKICIPTSAGDIMLPCKK----------VEESKNSDDSN  110

Query  585   rrlllAFADDEYSGESHRRILA--GGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHV  758
              R LL F D+       RR+LA    G D C+++G V  IS  G+HQLHIFIFVLA+FH+
Sbjct  111   GRKLLYFEDNM----EWRRVLATASSGGDFCSQKGKVSLISQSGVHQLHIFIFVLAVFHI  166

Query  759   LYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFL  938
             LY ++T+   R KM+KWKAWE+ET +LEYQFT+DP RFRFA  TSF RRH S  SR P +
Sbjct  167   LYSVMTMVLARAKMKKWKAWEAETSSLEYQFTNDPSRFRFAHQTSFVRRH-SGLSRMPGI  225

Query  939   LWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGIS  1118
              WIV FFRQF  SV KVDYMT+RHGFI AH AP S+  FDFQ+YIKRS+E+DFKVVVGIS
Sbjct  226   RWIVAFFRQFFASVTKVDYMTMRHGFINAHFAPNSK--FDFQKYIKRSMEDDFKVVVGIS  283

Query  1119  PPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGT  1298
              P+W+FA++F+L N +   +  WL   PLVI+LLVGTKL++II +M   IQ+R  VV+G 
Sbjct  284   IPLWVFAIVFMLVNVYKWYTLTWLSLAPLVILLLVGTKLELIIMEMAQEIQDRTTVVRGV  343

Query  1299  PVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRI  1478
             P+V+P +  FWFNRP+ +++LIHF LF+NAFQ+AFF W WYEF + SCFHE    ++ R+
Sbjct  344   PIVEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSCFHENLPLILTRV  403

Query  1479  SMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGS  1658
              +G+ +QV+CSY+T PLY+LVTQMGS+MK  IF E+ AKALK W + A+ + R+ R +G 
Sbjct  404   FLGIALQVVCSYITFPLYSLVTQMGSHMKQAIFEEQTAKALKKWQKVAKDK-RKLRKAGV  462

Query  1659  VTPLSSRPG--TPLHGTSPIHLLQYYK---SEIDSVGASP---ARDIEDNLPWFNQRRDN  1814
               P  +  G  TP  GTSPIHLL  YK   ++ D V  SP     D + +    +  + N
Sbjct  463   DVPSGTMSGEATPSQGTSPIHLLHKYKPSQTDTDVVLYSPRSYQSDTDFSDTEGSSHQLN  522

Query  1815  NVDQPAEENRNELQREIEMESAEFSFENKREIR  1913
              + Q  +  RN      E  S EFSF +   ++
Sbjct  523   QITQTHQAPRNG-----EAHSIEFSFVSHNNVQ  550



>emb|CDY19353.1| BnaC05g08620D [Brassica napus]
Length=543

 Score =   504 bits (1297),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 292/518 (56%), Positives = 373/518 (72%), Gaps = 31/518 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LE+T TWAVA VCFVL+ ISIV+E+ IH IG   ++++KKALYEALEKIKA
Sbjct  1     MANQVKERTLEQTSTWAVAVVCFVLLLISIVLEHSIHKIGAWFKQKHKKALYEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I  ICIS+S+ +S HPC   +E  KYG        D+G  + 
Sbjct  61    ELMLMGFISLLLTIGQTPISNICISQSVASSMHPCSAADEAKKYGKKVPAKQEDDGEDKS  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                    +      HRR LA  G DKCA++G V F+SA GIHQLHIFIF+LA+ HV+YCI
Sbjct  121   GHRRLLLEVAESYIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFILAVVHVIYCI  180

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T A G+ K R+WK WE+ETKT+E+ +++DPERFR                         
Sbjct  181   VTYALGKTKTRRWKHWENETKTIEFHYSNDPERFR-------------------------  215

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
                 QF  SV KVDYM LRHGFI+AHLAP S+  FDF++YI++++EEDFK VV ISP IW
Sbjct  216   ----QFFGSVTKVDYMALRHGFIMAHLAPGSERTFDFRKYIQKTVEEDFKTVVEISPVIW  271

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL NT+G  S+LWLPFIPL +IL+VGTKLQVIITK+ LRIQE+G+VV+G PVVQ
Sbjct  272   FVAVLFLLTNTNGLHSFLWLPFIPLAVILIVGTKLQVIITKLCLRIQEKGDVVRGAPVVQ  331

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P DDLFWF RPR +L+LIH VLF NAFQLAFFAW+ YEF L++CF+E   D++IRI +G+
Sbjct  332   PGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLRNCFYENDADVIIRIVVGV  391

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
             ++Q+LCSYVTLPLYALVTQMGS M+PT+FNERVA A+K+WH TA+K  +  +H+ S TP 
Sbjct  392   VVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTAKKHTKHGKHTESNTPY  451

Query  1671  SSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDN  1784
             +SRP TP HG+S +H L      +++  +SP+    D+
Sbjct  452   TSRPTTPTHGSSTMHTLN--NRSVETFPSSPSPRYSDH  487



>gb|KHN20094.1| MLO protein like 1 [Glycine soja]
Length=541

 Score =   503 bits (1295),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 299/562 (53%), Positives = 381/562 (68%), Gaps = 32/562 (6%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGG    RSLEETPTWAVAAVC V V IS++IE+ IH +GK  QKR+KKA+ EALEKI
Sbjct  1     MAGGGATAERSLEETPTWAVAAVCSVFVIISVLIEHGIHSLGKWFQKRHKKAMNEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K+ELMLLGFISLL+T G   I KICI  S G+   PC +                D+   
Sbjct  61    KSELMLLGFISLLITFGTQYIAKICIPVSAGDIMLPCKK---------VEVSDSDDDSND  111

Query  585   rrlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             RR LL+F D+    E  R + A  G D C+++G V  IS  G+HQLHIFIFVLA+FH+ Y
Sbjct  112   RRKLLSFDDNM---EWRRVLAAASGGDYCSQKGKVSLISQSGVHQLHIFIFVLAVFHIFY  168

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
              ++T+   R KM+KWKAWE+ET +LEYQFT+DP RFRFA  TSF RRH S WSR P + W
Sbjct  169   SVMTMVLARAKMKKWKAWEAETSSLEYQFTNDPSRFRFAHQTSFVRRH-SGWSRMPGIRW  227

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IV FFRQF  SV KVDYMT+RHGFI AH AP S+  FDFQ+YIKRS+E+DFKVVVGIS P
Sbjct  228   IVAFFRQFFGSVSKVDYMTMRHGFINAHFAPDSK--FDFQKYIKRSMEDDFKVVVGISIP  285

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             +W+FA++F+L N +   +  WL   PLVI+LLVGTKL++II +M  +IQ+R  +V+G P+
Sbjct  286   LWVFAIVFMLVNVYKWYTLTWLSLAPLVILLLVGTKLELIIMEMAQQIQDRATIVRGVPI  345

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             V+P +  FWFNRP+ +++LIHF LF+NAFQ+AFF W WYEF + SCFHE    ++ R+ +
Sbjct  346   VEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSCFHESLPLILTRVVL  405

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+ +QV+CSY+T PLY+LV QMGS+MK  IF E+ AKALK W Q A K  R+ R +G   
Sbjct  406   GIALQVVCSYITFPLYSLVIQMGSHMKKAIFEEQTAKALKKW-QKAAKDKRKLRKAGIDM  464

Query  1665  PLSSRPGTPLHGTSPIHLLQYYK---SEIDSVGASP---ARDIEDNLPWFNQRRDNNVDQ  1826
                S   TP  GTSP+HLLQ YK   ++ DSV  SP     D + +    +  + N + Q
Sbjct  465   ---SGETTPSQGTSPLHLLQKYKPSHTDTDSVLYSPRSYQSDTDLSETEGSSHQLNEITQ  521

Query  1827  PAEENRNELQREIEMESAEFSF  1892
               +  RN      E  + +FSF
Sbjct  522   THQAPRNG-----ETHNIDFSF  538



>ref|XP_004500844.1| PREDICTED: MLO protein homolog 1-like [Cicer arietinum]
Length=553

 Score =   503 bits (1294),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 300/569 (53%), Positives = 377/569 (66%), Gaps = 30/569 (5%)
 Frame = +3

Query  231   MAGGG-GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIK  407
             MAG   G R+L+ETPTWAVAAVC V + IS++IEY IH + K   K++KKA+ EALEKIK
Sbjct  1     MAGAALGERTLKETPTWAVAAVCAVFIIISVLIEYGIHSLEKWFHKKHKKAMSEALEKIK  60

Query  408   AELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrr  587
             AELMLLGFISLLLT G   I KICI   LG+S  PC +              + D    R
Sbjct  61    AELMLLGFISLLLTFGTKYIAKICIPVKLGDSMLPCKKE-----------RVEEDSKDDR  109

Query  588   rlllAFADDEYSGESHRRIL--AGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVL  761
             R LL+F DD       RR L  A GG D C+ +  VP IS  G+HQLHIFIFVLA+FH+ 
Sbjct  110   RRLLSFDDDNLVW---RRSLAAAAGGDDYCSNKNEVPLISQSGVHQLHIFIFVLAVFHIF  166

Query  762   YCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLL  941
             Y ++T+   R KM+KWKAWE ET ++EYQFTHDP RFRFA  T+F +RH S WSR P + 
Sbjct  167   YSVMTMVLARAKMQKWKAWEMETSSVEYQFTHDPARFRFAHQTTFVKRH-SGWSRKPGIR  225

Query  942   WIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISP  1121
             WIV FFRQF  SV KVDYMT+RHGFI AH AP S+  FDF +YIKRS+E+DFKVVVGIS 
Sbjct  226   WIVAFFRQFFASVSKVDYMTMRHGFINAHFAPDSK--FDFHKYIKRSMEDDFKVVVGISI  283

Query  1122  PIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
             P+W FA+IFLL N +   +  WL   PLVI+LLVGTKL++II +M   IQ+R  +V+G P
Sbjct  284   PLWAFAIIFLLMNVYSWYTLTWLSLAPLVILLLVGTKLELIIMEMAQEIQDRTTIVRGVP  343

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRIS  1481
             VV+P +  FWFNRP  +++LIHF LFQNAFQ+A+F W WYEF + SCFHE    +V R+ 
Sbjct  344   VVEPNNKYFWFNRPHWIIFLIHFTLFQNAFQIAYFLWTWYEFTITSCFHENLPLIVTRVV  403

Query  1482  MGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTAR--KQLRQKRHSG  1655
             +GL +QVLCSY+T PLYALVTQMGS+MK  IF E+  KALK W ++AR  ++LR+    G
Sbjct  404   LGLALQVLCSYITFPLYALVTQMGSHMKRGIFEEQTTKALKKWQKSARDKRKLRKAGGGG  463

Query  1656  SV-TPLSSRPGTPLHGTSPIHLLQYYK----SEIDSVGASPARDIEDNLPWFNQRRDN--  1814
             S+  P  S   TP  GTSP+HLL  +K    ++ DSV  SP     D   + +       
Sbjct  464   SIDVPSVSGETTPSQGTSPMHLLHKFKPSSHTDTDSVLYSPRSYQSDQTDFSDTEGSTHR  523

Query  1815  -NVDQPAEENRNELQREIEMESAEFSFEN  1898
              N+DQ   + ++         + +FSF+ 
Sbjct  524   LNLDQIMSQPQHNPPGNQLTHNIDFSFDK  552



>ref|XP_003527634.1| PREDICTED: MLO protein homolog 1-like [Glycine max]
Length=541

 Score =   501 bits (1290),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 298/562 (53%), Positives = 381/562 (68%), Gaps = 32/562 (6%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGG    RSLEETPTWAVAAVC V V IS++IE+ IH +GK  QKR+KKA+ EALEKI
Sbjct  1     MAGGGATAERSLEETPTWAVAAVCSVFVIISVLIEHGIHSLGKWFQKRHKKAMNEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K+ELMLLGFISLL+T G   I KICI  S G+   PC +                D+   
Sbjct  61    KSELMLLGFISLLITFGTQYIAKICIPVSAGDIMLPCKK---------VEVSDSDDDSND  111

Query  585   rrlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             RR LL+F D+    E  R + A  G D C+++G V  IS  G+HQLHIFIFVLA+FH+ Y
Sbjct  112   RRKLLSFDDNM---EWRRVLAAASGGDYCSQKGKVSLISQSGVHQLHIFIFVLAVFHIFY  168

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
              ++T+   R KM+KWKAWE+ET +LEYQFT+DP RFRFA  TSF RRH S WSR P + W
Sbjct  169   SVMTMVLARAKMKKWKAWEAETSSLEYQFTNDPSRFRFAHQTSFVRRH-SGWSRMPGIRW  227

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IV FFRQF  SV KVDYMT+RHGFI AH AP S+  FDFQ+YIKRS+++DFKVVVGIS P
Sbjct  228   IVAFFRQFFGSVSKVDYMTMRHGFINAHFAPDSK--FDFQKYIKRSMKDDFKVVVGISIP  285

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             +W+FA++F+L N +   +  WL   PLVI+LLVGTKL++II +M  +IQ+R  +V+G P+
Sbjct  286   LWVFAIVFMLVNVYKWYTLTWLSLAPLVILLLVGTKLELIIMEMAQQIQDRATIVRGVPI  345

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             V+P +  FWFNRP+ +++LIHF LF+NAFQ+AFF W WYEF + SCFHE    ++ R+ +
Sbjct  346   VEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSCFHESLPLILTRVVL  405

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+ +QV+CSY+T PLY+LV QMGS+MK  IF E+ AKALK W Q A K  R+ R +G   
Sbjct  406   GIALQVVCSYITFPLYSLVIQMGSHMKKAIFEEQTAKALKKW-QKAAKDKRKLRKAGIDM  464

Query  1665  PLSSRPGTPLHGTSPIHLLQYYK---SEIDSVGASP---ARDIEDNLPWFNQRRDNNVDQ  1826
                S   TP  GTSP+HLLQ YK   ++ DSV  SP     D + +    +  + N + Q
Sbjct  465   ---SGETTPSQGTSPLHLLQKYKPSHTDTDSVLYSPRSYQSDTDLSETEGSSHQLNEITQ  521

Query  1827  PAEENRNELQREIEMESAEFSF  1892
               +  RN      E  + +FSF
Sbjct  522   THQAPRNG-----ETHNIDFSF  538



>emb|CDY12904.1| BnaA09g13700D [Brassica napus]
Length=582

 Score =   499 bits (1286),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 278/440 (63%), Positives = 340/440 (77%), Gaps = 5/440 (1%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     ++L++T TWAVA VCF L+  SIVIE +IH +G   + +NKKALYEALEK+KA
Sbjct  1     MADKVDEKTLQQTSTWAVAVVCFFLLLFSIVIEKLIHKLGTWFKIKNKKALYEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLT+GQ+ I +IC+S+S+  S HPC   EE  KY     D    E    R
Sbjct  61    ELMLMGFISLLLTIGQNYISQICVSESIAASMHPCSESEEAKKYPPKKKDTKNAEENSGR  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              L             RR LA  G DKCA++G V F+S+ G+HQLHIFIFVLA+ HV+YC+
Sbjct  121   KLHELVQSYIP----RRSLATKGYDKCAEKGKVAFVSSYGMHQLHIFIFVLAVCHVIYCV  176

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTH-DPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             +T A G+ KMR+WK WE ETKT+EYQ++H DPERFRFARDTSFGRRHL+FWS+S   LWI
Sbjct  177   VTYALGKTKMRRWKRWEEETKTIEYQYSHADPERFRFARDTSFGRRHLNFWSKSTITLWI  236

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             VCFFRQF  SV +VDY+TLRHGFI+AHLAP S   FDF++YI+RSLEEDFK +V ISP I
Sbjct  237   VCFFRQFFGSVTRVDYLTLRHGFIMAHLAPGSDGRFDFRKYIQRSLEEDFKTIVEISPVI  296

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W  AV+FLL NT+G  S+LW PFIPLV+IL+VGTKLQVIITK+GL IQE+G++VKG P+V
Sbjct  297   WFVAVLFLLTNTNGLHSFLWQPFIPLVVILIVGTKLQVIITKLGLLIQEKGDIVKGMPLV  356

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             QP D LFWF RPR +L+LIH VLF NAFQLAFFAW  YEF L++C+H+   D+VIRIS+G
Sbjct  357   QPGDHLFWFGRPRFILFLIHLVLFTNAFQLAFFAWTTYEFQLENCYHKTIVDVVIRISVG  416

Query  1488  LLIQVLCSYVTLPLYALVTQ  1547
             +++Q+LCSYVTLPLYALVTQ
Sbjct  417   VIVQILCSYVTLPLYALVTQ  436



>ref|XP_008228898.1| PREDICTED: MLO protein homolog 1-like [Prunus mume]
Length=558

 Score =   498 bits (1283),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 288/522 (55%), Positives = 356/522 (68%), Gaps = 16/522 (3%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
                G RSL+ETPTWAVA  C V + ISI+IE  IH +GK  QKRNKKA+ EALEKIKAEL
Sbjct  4     AAAGERSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAEL  63

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVG   + KICI +  GN+  PC+   +  + GG   DG    G      
Sbjct  64    MLLGFISLLLTVGTRYLPKICIPEKYGNTMLPCELESKYKEDGGGKDDGKNKGGGGGDGG  123

Query  597   lAFADDEYSGESH-----RRILAGGGTDKCA-KEGMVPFISADGIHQLHIFIFVLALFHV  758
                       E       RR+LA  G D  A  E  VP IS  G+HQLHIFIFVLA+FHV
Sbjct  124   DDNDRRRKLLEFAETMIWRRVLAPSGGDSSACSEDKVPLISPSGMHQLHIFIFVLAVFHV  183

Query  759   LYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFL  938
             +Y +IT+A  + KM+KWKAWESET +LEYQFT+DP RFRF R TSF +RH  F S  P +
Sbjct  184   VYSVITMALAQAKMKKWKAWESETSSLEYQFTNDPSRFRFIRQTSFIKRHSGF-STMPGI  242

Query  939   LWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGIS  1118
              WIV FFRQF  SV +VDYMT+RHGFI AH AP S+  FDF +YIKRS+E+DFKVVVGIS
Sbjct  243   RWIVAFFRQFFGSVTRVDYMTMRHGFINAHFAPNSK--FDFHKYIKRSMEDDFKVVVGIS  300

Query  1119  PPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGT  1298
              P+W+FAV+FL+ N H   ++ WL   PLVI+LLVGTKL++II +M   + +R  VVKGT
Sbjct  301   IPLWIFAVVFLVLNVHKWHTFTWLSLAPLVILLLVGTKLELIIMEMAQEMHDRTTVVKGT  360

Query  1299  PVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRI  1478
             PVV+P++  FWFNRP  +L LIHF LFQNAFQ+A+F W   EFGL SCFHE    ++ R+
Sbjct  361   PVVEPSNKFFWFNRPEWILLLIHFTLFQNAFQMAYFLWTSLEFGLTSCFHENLPLILTRV  420

Query  1479  SMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTA--RKQLRQKRHS  1652
              +G+ +Q+LCSY+T PLYAL+TQMGS+MK  IF E+ AKALK+W + A  RK+LR+    
Sbjct  421   FLGVALQILCSYITFPLYALITQMGSHMKKAIFEEQTAKALKNWQKAAKQRKKLRKATGD  480

Query  1653  GSVTPLSSRPGTPLHGTSPIHLLQYYK-----SEIDSVGASP  1763
              S +   S   TP  G+SP+HLL   K     S+++SV  SP
Sbjct  481   ASSSGFVSGENTPSQGSSPLHLLHNQKHRSNQSDLESVLNSP  522



>ref|NP_001105660.1| barley mlo defense gene homolog1 [Zea mays]
 gb|AAK38337.2| seven transmembrane protein Mlo1 [Zea mays]
 gb|ACF81106.1| unknown [Zea mays]
 tpg|DAA43123.1| TPA: Seven transmembrane protein Mlo1 [Zea mays]
Length=563

 Score =   495 bits (1275),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 280/570 (49%), Positives = 370/570 (65%), Gaps = 20/570 (4%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGR L  TPTWAVA VC V+V +S+ +E+ +H +G     R KKA+ EALEKIKA
Sbjct  1     MAGGGGGRDLPSTPTWAVALVCAVIVLVSVAMEHGLHKLGHWFHTRQKKAMREALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLL VGQ+ I KICI    G+   PC   +       D             
Sbjct  61    ELMLMGFISLLLAVGQTPISKICIPAKAGSIMLPCKPPKGAAAAADDDKSDGRRRLLWYP  120

Query  591   lllAFADDEYSGESHRRILAGGGTDK--CAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
                 + +  +    HRR LAG   D   C+ +G V  IS+ G+HQLHIFIFVLA+FH++Y
Sbjct  121   PYPGYDEPGH----HRRFLAGAAPDDNYCSDQGKVSLISSAGVHQLHIFIFVLAVFHIVY  176

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
              + T+A GRLKMRKWK WESET +LEYQ+ +DP RFRF   TSF +RHL   S +P + W
Sbjct  177   SVATMALGRLKMRKWKKWESETNSLEYQYANDPSRFRFTHQTSFVKRHLGL-SSTPGVRW  235

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             +V FFRQF  SV KVDY+T+R GFI  HL+P ++  F+FQQYIKRSLE+DFKVVVGIS P
Sbjct  236   VVAFFRQFFASVTKVDYLTMRQGFINYHLSPSTK--FNFQQYIKRSLEDDFKVVVGISLP  293

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             +W  A+  LL +  G  + +W+ F+PLVI+LLVG KL+V+I +M   IQ++  V+KG PV
Sbjct  294   LWFVAIFTLLIDIKGFGTLVWISFVPLVILLLVGAKLEVVIMEMAKEIQDKATVIKGAPV  353

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             V+P+D  FWFNRP  +L+LIH  LFQNAFQ+A F W      LK C+HE+    ++++++
Sbjct  354   VEPSDRFFWFNRPGWVLFLIHLTLFQNAFQMAHFVWTLLTPDLKKCYHERLGLSIMKVAV  413

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSG---  1655
             GL++QVLCSY+T PLYALVTQMGS+MK TIF E+ AKA+  W +TA+ ++RQ+  +G   
Sbjct  414   GLVLQVLCSYITFPLYALVTQMGSHMKKTIFEEQTAKAVMKWRKTAKDKVRQREAAGFLD  473

Query  1656  -----SVTPLSSRPGTPLHGTSPIHLLQYYKS---EIDSVGASPARDIEDNLPWFNQRRD  1811
                    TP  SR  +P  G SP+HLL  Y+    E  S  ASP R++ D  P  +Q R 
Sbjct  474   VLTSADTTPSHSRATSPSRGNSPVHLLHKYRGRSEEPQSGPASPGRELGDMYPVADQHRL  533

Query  1812  NNVDQPAEENRNELQREIEMESAEFSFENK  1901
             + +D       +     I++  A+FSF  +
Sbjct  534   HRLDPERMRPASSTAVNIDIADADFSFSMR  563



>ref|XP_008786739.1| PREDICTED: MLO protein homolog 1 [Phoenix dactylifera]
Length=545

 Score =   494 bits (1273),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 287/576 (50%), Positives = 372/576 (65%), Gaps = 57/576 (10%)
 Frame = +3

Query  231   MAGGG-GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIK  407
             MAGG    RSLE+TPTWAVA VC V+V IS+++E+ IH +GKL Q R+KKA+ EALEKIK
Sbjct  1     MAGGNPADRSLEDTPTWAVALVCAVMVIISMMMEHAIHKLGKLFQTRHKKAMNEALEKIK  60

Query  408   AELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrr  587
             AELMLLGFISLLLT+GQ+ I KICI    G+   PC +                      
Sbjct  61    AELMLLGFISLLLTIGQAPISKICIPAKAGDIMLPCKK----------------------  98

Query  588   rlllAFADDEYSGESHRR------------ILAGGGTDKCAKEGMVPFISADGIHQLHIF  731
                 A   ++  G+  RR            ILA    D C+    VP IS +GIHQLHIF
Sbjct  99    ----AHDVEKEDGDGRRRLLWYQEKVVWHRILAEATVDHCSNSDKVPLISQNGIHQLHIF  154

Query  732   IFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHL  911
             IFVLA+FHVLY I+T+A G+ KM+KWK WE+ET +LEYQF++DP RFRF   TSF +RH+
Sbjct  155   IFVLAVFHVLYSILTMALGQAKMKKWKTWEAETASLEYQFSNDPSRFRFTHQTSFVKRHV  214

Query  912   SFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEE  1091
                S +P + W+V FFRQF RSV KVDY+T+RHGFI AHL+P S+  FDF +YIKRSLE+
Sbjct  215   GL-SSTPGIRWMVAFFRQFFRSVTKVDYLTMRHGFITAHLSPNSK--FDFHKYIKRSLED  271

Query  1092  DFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQ  1271
             DFKVVVGIS P+WL A++ LL + +G  + +W+ F+PL+I+L+VG KL+++I +M   IQ
Sbjct  272   DFKVVVGISSPLWLMAIVILLLDVYGWYTLVWISFVPLIILLIVGMKLEIVIMEMAHEIQ  331

Query  1272  ERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHE  1451
              R  VVKG P+++P++  FWFNRP+ +LYLIH  LF+NAFQ+A F W WY F LKSC H+
Sbjct  332   GRTTVVKGAPIIEPSNKFFWFNRPQWILYLIHLTLFENAFQMAHFLWTWYSFSLKSCIHD  391

Query  1452  KTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQ  1631
                  + +I MGL +Q LCSY+T PLYALVTQMGS+MK  IF E+ AKAL  W Q A K+
Sbjct  392   NLPLTIAKIIMGLALQFLCSYITFPLYALVTQMGSHMKKAIFEEQTAKALIRWRQAA-KE  450

Query  1632  LRQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYK---SEIDSVGASPARDIEDN------  1784
              ++ R + S     S   TP  G+SPIHLL  YK    +++S+ +SP     DN      
Sbjct  451   RKKHRDAKSDAGYLSGENTPSQGSSPIHLLHKYKLNSVDVESIPSSPRFYHSDNDNSEME  510

Query  1785  LPWFNQRRDNNVDQPAEENRNELQREIEMESAEFSF  1892
              P F    D+   +P    RN       +  ++FSF
Sbjct  511   APPFVNHGDSEPTRPISVGRNP-----NVGDSDFSF  541



>ref|XP_011074078.1| PREDICTED: MLO protein homolog 1-like [Sesamum indicum]
Length=565

 Score =   494 bits (1272),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 293/570 (51%), Positives = 384/570 (67%), Gaps = 25/570 (4%)
 Frame = +3

Query  231   MAGGGG--GRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MA G G   RSLE+T TWAVA VC V V IS+ IE+ I  +GK  QKR KKA+ EALEKI
Sbjct  1     MAAGSGPAERSLEQTSTWAVAIVCAVFVIISVAIEHGIQSLGKWFQKREKKAMLEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             KAELMLLGFISLLLTVG + I KIC+SK LG+ W PCD   +     GD  D D  +G++
Sbjct  61    KAELMLLGFISLLLTVGTTYIAKICVSKELGDKWLPCDTGLKNGGGSGDDDDDDDGKGKK  120

Query  585   rrlllAFADDEYSGES-HRRILAGGGT--DKCAKEGMVPFISADGIHQLHIFIFVLALFH  755
                 L      Y+ E   RR LA G    D C+ +G V  IS  G+HQLH+FIFVLA+ H
Sbjct  121   GHRKLL----SYAQEMVWRRALAAGNDQYDYCSAKGQVSLISYSGVHQLHVFIFVLAVMH  176

Query  756   VLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPF  935
             VLY +I +  G  KM+KWKAWE ET +LEYQFT+DP RFRFA  TSF RRH  F++ +P 
Sbjct  177   VLYSVILVMLGHAKMKKWKAWELETSSLEYQFTNDPARFRFAHQTSFVRRHSGFYT-TPG  235

Query  936   LLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGI  1115
             L WIV FFRQF  S+ KVDYMT+R+GFI AH AP ++  FDF +YIKRS+E+D+K V+GI
Sbjct  236   LKWIVAFFRQFFGSISKVDYMTIRNGFINAHFAPNTK--FDFHKYIKRSMEDDYKSVLGI  293

Query  1116  SPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKG  1295
             S P+W+FAV+FL FN +   +  W+  IPL+IILLVGTKL+++I +M  +IQ+R  VV+G
Sbjct  294   SIPLWIFAVMFLFFNIYKWHTLAWISLIPLIIILLVGTKLELVIMEMAQQIQDRATVVRG  353

Query  1296  TPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIR  1475
              P+V+P ++ FWFNRP+ +L+LIHF LFQNA+Q+A+F W WYEFG+ +CFHEK   ++IR
Sbjct  354   APLVEPTNNFFWFNRPQWILFLIHFTLFQNAYQMAYFLWKWYEFGITTCFHEKLFAIMIR  413

Query  1476  ISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSG  1655
             + +G+ +Q+LCSY+T PLY LV +MGS+MK +IF E+ AKALK WHQ A KQ ++ R +G
Sbjct  414   VWLGVALQILCSYITFPLYTLVGKMGSHMKKSIFEEQTAKALKKWHQAA-KQRKKMRKAG  472

Query  1656  SVTPLS-----SRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNV  1820
               T  S     S   TP  G+SP+HLL  YK        S A D  D+LP   +   ++ 
Sbjct  473   GGTDTSNAGFMSGETTPTQGSSPLHLLHKYKHR------SSAPDT-DSLPPSPRSYASDT  525

Query  1821  DQPAEENRNELQREIEMESAEFSFENKREI  1910
             +    +  N  +RE   ++++   +    I
Sbjct  526   ELSELDASNHGKRETTFDASQLKDDESHNI  555



>ref|XP_007210822.1| hypothetical protein PRUPE_ppa020311mg [Prunus persica]
 gb|EMJ12021.1| hypothetical protein PRUPE_ppa020311mg [Prunus persica]
Length=566

 Score =   494 bits (1272),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 294/565 (52%), Positives = 370/565 (65%), Gaps = 18/565 (3%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
                G RSL+ETPTWAVA  C V + ISI+IE  IH +GK  QKRNKKA+ EALEKIKAEL
Sbjct  4     AAAGERSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAEL  63

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVG   + KICI +  GN+  PC+          D  +  G  G      
Sbjct  64    MLLGFISLLLTVGTRYLPKICIPEKYGNTMLPCELEGNGGGKDDDGKNKGGGGGDGDDND  123

Query  597   lAFADDEYSGES-HRRILAG--GGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
                   E++     RR+LA   GG      EG VP IS  G+HQLHIFIFVLA+FHV+Y 
Sbjct  124   RRRKLLEFAETMIWRRVLAAPSGGDSAACSEGKVPLISPSGMHQLHIFIFVLAVFHVMYS  183

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             ++T+A    KM+KWKAWESET +LEYQFT+DP RFRF R TSF +RH  F S  P + WI
Sbjct  184   VLTMALAHAKMKKWKAWESETSSLEYQFTNDPSRFRFTRQTSFVKRHSGF-STMPGIRWI  242

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             V FFRQF  SV KVDY+T+RHGFI AH AP S+  FDF +YIKRS+E+DFKVVVGIS P+
Sbjct  243   VAFFRQFFGSVTKVDYLTMRHGFINAHFAPNSK--FDFHKYIKRSMEDDFKVVVGISIPL  300

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W+FAV+FL+ N H   ++ WL   PLVI+LLVGTKL++II +M   + +R  VVKG PVV
Sbjct  301   WIFAVVFLVLNVHKWHAFTWLSLAPLVILLLVGTKLELIIMEMAQEMHDRTTVVKGAPVV  360

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P++  FWFNRP  +L LIHF LFQNAFQ+A+F W   EFG  SCFHE    ++ R+ +G
Sbjct  361   EPSNKFFWFNRPEWILLLIHFTLFQNAFQMAYFLWTSSEFGFTSCFHENLPLILTRVFLG  420

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTA--RKQLRQKRHSGSV  1661
             + +Q+LCSY+T PLYAL+TQMGS+MK  IF E+ AKALK+W + A  RK+LR K    S 
Sbjct  421   VALQILCSYITFPLYALITQMGSHMKKAIFEEQTAKALKNWQKAAKQRKKLR-KAGDASS  479

Query  1662  TPLSSRPGTPLHGTSPIHLLQYYK-----SEIDSVGASPARDIEDNLPWFNQRRDNNVDQ  1826
             +   S   TP  G+SP+HLL   K     S+++SV  SP      +    ++R  +  D 
Sbjct  480   SGFVSGENTPSQGSSPLHLLHNQKHRSNQSDLESVLNSPRSVSYQSDTDLSEREGSAHDG  539

Query  1827  P---AEENRNELQREIEMESAEFSF  1892
                 +E+    L+RE    S +FSF
Sbjct  540   NGIRSEDQPAALRRE-GSHSVDFSF  563



>ref|XP_004985865.1| PREDICTED: MLO protein homolog 1-like [Setaria italica]
Length=553

 Score =   493 bits (1269),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 282/572 (49%), Positives = 375/572 (66%), Gaps = 33/572 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG  G R L ETPTWAVA VC V+V +S+ +E+ +H +G     R KKA+ EALEKIKA
Sbjct  1     MAGAPGDRELPETPTWAVALVCAVIVLLSVAMEHGLHKLGHWFHTRQKKAMREALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLL VGQ+ I KICI    G+   PC   ++ +  G               
Sbjct  61    ELMLMGFISLLLAVGQTPISKICIPTKAGSVMLPCKPKDDGESGGDRRRRLLW-------  113

Query  591   lllAFADDEYSGE--SHRRILAGG-GTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVL  761
                      Y GE  +HRR LAG  G D C ++G V  IS  G+HQLHIFIFVLA+FHV+
Sbjct  114   ---------YPGEEVNHRRFLAGAVGEDYCKEKGKVSLISTTGVHQLHIFIFVLAVFHVV  164

Query  762   YCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLL  941
             Y + T+A  RLKMR+WK WESET +LEYQF +DP RFRF   TSF +RHL   S +P + 
Sbjct  165   YSVATMALARLKMRRWKRWESETSSLEYQFANDPSRFRFTNQTSFVKRHLGV-SSTPGVR  223

Query  942   WIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISP  1121
             W+V FFRQF  SV KVDY+T+R GFI AHL+P ++  FDFQ+YIKRSLE+DFKVVVGIS 
Sbjct  224   WMVAFFRQFFASVTKVDYLTMRQGFINAHLSPNAK--FDFQKYIKRSLEDDFKVVVGISL  281

Query  1122  PIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
             P+W  A+  L  +  G  + +W+ F+PLVI+LLVGTKL+++I +M   IQ++  V+KG P
Sbjct  282   PLWFVAIFILFMDVQGFGTLIWISFVPLVILLLVGTKLEIVIMEMAKEIQDKATVIKGAP  341

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRIS  1481
             +V+P+D  FWFNRP+ +L+LIH  LFQNAFQ+A F W     GLK+C+HE     ++++S
Sbjct  342   IVEPSDRFFWFNRPKWVLFLIHLTLFQNAFQMAHFIWTLLTPGLKTCYHENLGLGIMKVS  401

Query  1482  MGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRH----  1649
             +GL +QVLCSY+T PLYALVTQMGS+MK TIF E+ AKA+  W + A+ +++Q+      
Sbjct  402   VGLGLQVLCSYITFPLYALVTQMGSHMKKTIFEEQTAKAVMKWRKAAKDKVKQREAGFEG  461

Query  1650  --SGSVTPLSSRPGTPLHGTSPIHLLQYYKS---EIDSVGASPAR--DIEDNLPWFNQRR  1808
               S   TP  SRP +P  G+SP+HLLQ Y+    + +S   SP R  ++ D  P  +Q R
Sbjct  462   LMSTDTTPSHSRPTSPGGGSSPVHLLQKYRGRSEDPESAPTSPGRGQELGDMYPVTDQHR  521

Query  1809  DNNVDQPAEENRNELQREIEMESAEFSFENKR  1904
              + +D       +    +I++  A+FSF  +R
Sbjct  522   MHRLDPERRRAASSTAVDIDIADADFSFSIQR  553



>ref|XP_009372684.1| PREDICTED: MLO protein homolog 1-like [Pyrus x bretschneideri]
Length=565

 Score =   493 bits (1269),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 284/518 (55%), Positives = 353/518 (68%), Gaps = 15/518 (3%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
                G RSL+ETPTWAVA  C V + IS++IE  IH +GK  QKRNKKA+ EALEKIKAEL
Sbjct  4     AAAGERSLKETPTWAVAIACAVFIVISVIIEQAIHALGKWFQKRNKKAMLEALEKIKAEL  63

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVG   + KICIS   G++  PC  +E +    G    G+   G   R  
Sbjct  64    MLLGFISLLLTVGTRFLPKICISTKYGDTMLPCQLNESKYSDNGGKDKGNKGGGDDDRRR  123

Query  597   lAFADDEYSGESHRRILA--GGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                +  E      RR+LA   G +  CA  G VP ISA G+HQLHIFIFVLA+FHV Y +
Sbjct  124   KLLSHAE--NVIWRRVLAPSAGDSSSCAG-GKVPLISASGMHQLHIFIFVLAVFHVFYSV  180

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             IT+A  + KM+KWKAWESET +LEYQFT+DP RFRF R TSF +RH  F S  P + WIV
Sbjct  181   ITMALAQAKMKKWKAWESETSSLEYQFTNDPSRFRFTRQTSFVKRHSGF-STMPGIRWIV  239

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQF  SV +VDY+T+RHGFI AH AP S+  FDF +YIKRS+E+DFKVVVGIS P+W
Sbjct  240   AFFRQFFGSVTRVDYLTMRHGFINAHFAPNSK--FDFHKYIKRSMEDDFKVVVGISLPLW  297

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             +FAV+FLL N +   +  WL   PL+I+LLVGTKL++II +M   + +R  VVKG PVV+
Sbjct  298   IFAVVFLLLNVYKWYTLTWLSLAPLIILLLVGTKLELIIVEMAQEMHDRNTVVKGAPVVE  357

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P +  FWFNRP   L LIHF LFQNAFQ+A+F W   EFG  SCFH+    ++IR+ +G+
Sbjct  358   PNNKYFWFNRPEWTLLLIHFTLFQNAFQMAYFVWISSEFGFTSCFHDNLPLILIRVFLGV  417

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTA--RKQLRQKRHSGSVT  1664
              +Q+LCSY+T PLY L+TQMGS+MK  IF E+ AKALK+W + A  RK+LR  +   S +
Sbjct  418   ALQILCSYITFPLYCLITQMGSHMKKAIFEEQTAKALKNWQKAAKQRKKLRNTKGDASSS  477

Query  1665  PLSSRPGTPLHGTSPIHLLQYYK-----SEIDSVGASP  1763
                S   TP  GTSP+HLL   K     S+++SV  SP
Sbjct  478   GFVSGENTPSRGTSPLHLLHNQKLRSNQSDLESVLNSP  515



>ref|XP_006599405.1| PREDICTED: MLO-like protein 12-like isoform X2 [Glycine max]
Length=411

 Score =   487 bits (1253),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 265/412 (64%), Positives = 318/412 (77%), Gaps = 9/412 (2%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSLE+TPTWA A VCFVL+AISI+IE+VI  IGK  +K++K ALYE+LEK+K ELM+LGF
Sbjct  9     RSLEDTPTWAFAVVCFVLLAISIIIEHVIDAIGKWFKKKHKSALYESLEKVKGELMMLGF  68

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             IS+LL V Q  + KICIS+++ ++WHPC   ++         D D +  +          
Sbjct  69    ISMLLVVFQGPLSKICISQNVASTWHPCSNPKKALSKSDGKSDSDTNGRKLL--------  120

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              EY     RR+LA  G DKCA +G V F+SA GIHQLHIFIF+LA+FH+L CIIT+A GR
Sbjct  121   -EYLDPIPRRVLAAKGYDKCADKGKVAFVSAYGIHQLHIFIFMLAVFHILQCIITIALGR  179

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
              KMR+WK WE+ETKT+EYQF +DPERFR A+DT+FG+RHL+ WS+S   LWIV FFRQF 
Sbjct  180   TKMRRWKKWENETKTIEYQFYNDPERFRLAKDTTFGQRHLNTWSQSSISLWIVSFFRQFS  239

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY  LRHGFI AHLAP S   FDFQ+YIKRSL+EDFKVVVGISP IW FAV+FL
Sbjct  240   GSVKKVDYFALRHGFITAHLAPGSDARFDFQKYIKRSLDEDFKVVVGISPIIWFFAVLFL  299

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L NTHG  SY WLPFIPL+ ILLVG KLQ+IITKMGLRIQ+RGEV+KG PVV+P DDLFW
Sbjct  300   LANTHGWYSYYWLPFIPLIAILLVGAKLQMIITKMGLRIQDRGEVLKGAPVVEPGDDLFW  359

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             FNRPRL+L +IH V FQNAFQLA FAW+ YEF + SCFH+ T D +IR++MG
Sbjct  360   FNRPRLLLSIIHLVFFQNAFQLAHFAWSTYEFSINSCFHKTTVDTIIRLTMG  411



>ref|XP_008237952.1| PREDICTED: MLO protein homolog 1-like [Prunus mume]
Length=569

 Score =   491 bits (1264),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 296/572 (52%), Positives = 369/572 (65%), Gaps = 29/572 (5%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
                G RSL+ETPTWAVA  C V + ISI+IE  IH +GK  QKRNKKA+ EALEKIKAEL
Sbjct  4     AAAGERSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAEL  63

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             MLLGFISLLLTVG   + KICI +  GN+  PC+   +    G    D     G      
Sbjct  64    MLLGFISLLLTVGTRYLPKICIPEKYGNTMLPCELESKYKDDGDGKDDDKNKGGGGGDGD  123

Query  597   lA--------FADDEYSGESHRRILAG--GGTDKCAKEGMVPFISADGIHQLHIFIFVLA  746
                       FA+        RR+LA   GG      EG VP IS  G+HQLHIFIFVLA
Sbjct  124   DNDRRRKLLEFAETMI----WRRVLAAPSGGDSSACSEGKVPLISPSGMHQLHIFIFVLA  179

Query  747   LFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSR  926
             +FHVLY ++T+A    KM+KWKAWESET +LEYQFT+DP RFRF R TSF +RH  F S 
Sbjct  180   VFHVLYSVLTMALAHAKMKKWKAWESETSSLEYQFTNDPSRFRFTRQTSFVKRHSGF-ST  238

Query  927   SPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVV  1106
              P + WIV FFRQF  SV KVDY+T+RHGFI AH AP S+  FDF +YIKRS+E+DFKVV
Sbjct  239   MPGIRWIVAFFRQFFGSVTKVDYLTMRHGFINAHFAPNSK--FDFHKYIKRSMEDDFKVV  296

Query  1107  VGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEV  1286
             VGIS P+W+FAV+FL+ N H   +  WL   PLVI+LLVGTKL++II +M   + +R  V
Sbjct  297   VGISIPLWIFAVVFLVLNVHKWHTLTWLSLAPLVILLLVGTKLELIIMEMAQEMHDRTTV  356

Query  1287  VKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDL  1466
             VKG PVV+P++  FWFNRP  +L LIHF LFQNAFQ+A+F W   EFG  SCFHE    +
Sbjct  357   VKGAPVVEPSNKFFWFNRPEWILLLIHFTLFQNAFQMAYFLWTSSEFGFTSCFHENLPLI  416

Query  1467  VIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTA--RKQLRQ  1640
             + R+ +G+ +Q+LCSY+T PLYAL+TQMGS+MK  IF E+ AKALK+W + A  RK+LR 
Sbjct  417   LTRVFLGVALQILCSYITFPLYALITQMGSHMKKAIFEEQTAKALKNWQKAAKQRKKLR-  475

Query  1641  KRHSGSVTPLSSRPGTPLHGTSPIHLLQYYK-----SEIDSVGASPARDIEDNLPWFNQR  1805
             K    S +   S   TP  G+SP+HLL   K     S+++SV  SP      +    ++R
Sbjct  476   KAGDASSSGFVSGENTPSQGSSPLHLLHNQKHRSNQSDLESVLNSPRSVSYQSETDLSER  535

Query  1806  RDNNVDQP---AEENRNELQREIEMESAEFSF  1892
               +  D     +E+    L+RE    S +FSF
Sbjct  536   EGSAHDGNGIRSEDQPAALRRE-GSHSVDFSF  566



>ref|XP_002273002.1| PREDICTED: MLO protein homolog 1-like [Vitis vinifera]
Length=558

 Score =   490 bits (1262),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 287/561 (51%), Positives = 386/561 (69%), Gaps = 16/561 (3%)
 Frame = +3

Query  234   AGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAE  413
             A   G RSL+ETPTWAVA VC V V +S++IE+ I  + K  +K+ KKA+ EALEKIKAE
Sbjct  3     APAAGERSLQETPTWAVALVCAVFVIVSVLIEHGIESLAKWFKKKQKKAMSEALEKIKAE  62

Query  414   LMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr-  590
             LMLLGFISLLLT+G   I KICI   LG++  PC R  ++    G  G  DGD+G   R 
Sbjct  63    LMLLGFISLLLTIGTRFIAKICIPAELGSTMLPCKRGYKDGGGYGGGGGDDGDDGGDGRR  122

Query  591   lllAFADDEYSGESHRRILAG-GGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYC  767
              LL++A++       RR+LA   G D C+K   +P IS  G+HQLHIFIF+LA+FHVLY 
Sbjct  123   KLLSYAEEMIL----RRVLAAQAGGDYCSKSDKIPLISQTGVHQLHIFIFMLAVFHVLYS  178

Query  768   IITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI  947
             ++T+A  + KM+KWK+WESET +LEY+FT+DP RFRF   TSF RRH  F SR+P + WI
Sbjct  179   VVTMALAQAKMKKWKSWESETSSLEYEFTNDPARFRFTHQTSFVRRHAGF-SRAPGIRWI  237

Query  948   VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPI  1127
             V FFRQF  SV KVDY T+R GFI AHLAP S+  F+F +YIKRS+E+DFKVVVGIS P+
Sbjct  238   VAFFRQFFASVTKVDYTTMRRGFINAHLAPNSK--FNFHKYIKRSMEDDFKVVVGISMPL  295

Query  1128  WLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVV  1307
             W+FA+IF+L N +   +  W+  +P+ I+L+VGTKL++II +M   IQ+R  VVKG P+V
Sbjct  296   WIFAIIFMLLNVYKWYTLSWMQIVPVTILLVVGTKLELIIMEMAEEIQDRTTVVKGAPIV  355

Query  1308  QPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             +P +  FWFNRP  +L LIHF+LFQNAFQ++FF W  YE+G+KSCFHE   ++++R+  G
Sbjct  356   EPNNKFFWFNRPHWVLLLIHFILFQNAFQMSFFLWITYEYGIKSCFHENLAEILVRLVCG  415

Query  1488  LLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP  1667
             + +Q+LCSY+T PLYALVTQMGS+MK +IF E+ A+ALK W + A+++ + ++  G + P
Sbjct  416   VALQILCSYITFPLYALVTQMGSHMKKSIFEEQTAQALKKWQKAAKERKKLRKAGGDIAP  475

Query  1668  LS-SRPGTPLHGTSPIHLLQYYK-----SEIDSVGASPARDIEDNLPWFNQRRDNNVDQP  1829
              S     TP HG SP+HLL+ +K     +E++S   SP     D      +    +    
Sbjct  476   GSLGGENTPSHGASPLHLLRNHKYRSSTNEVESAPTSPKSCQSDTDLSDMEGSSRHGHHQ  535

Query  1830  AEENRNELQREIEMESAEFSF  1892
             ++EN + L R  E  S +FSF
Sbjct  536   SKEN-DHLDRNAESHSIDFSF  555



>ref|NP_001117268.1| MLO-like protein 2 [Arabidopsis thaliana]
 gb|AEE28716.1| MLO-like protein 2 [Arabidopsis thaliana]
Length=418

 Score =   484 bits (1246),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 269/419 (64%), Positives = 329/419 (79%), Gaps = 1/419 (0%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MA     R+LEET TWAVA VCFVL+ ISIV+E+ IH IG   +K++K+AL+EALEK+KA
Sbjct  1     MADQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKQALFEALEKVKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLT+GQ+ I  ICIS+ + ++ HPC   EE  KYG        D    + 
Sbjct  61    ELMLLGFISLLLTIGQTPISNICISQKVASTMHPCSAAEEAKKYGKKDAGKKDDGDGDKP  120

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                   +   S   HRR LA  G DKCA++G V F+SA GIHQLHIFIFVLA+ HV+YCI
Sbjct  121   GRRLLLELAES-YIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVVYCI  179

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T AFG++KMR WK+WE ETKT+EYQ+++DPERFRFARDTSFGRRHL+FWS++   LWIV
Sbjct  180   VTYAFGKIKMRTWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNFWSKTRVTLWIV  239

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
             CFFRQF  SV KVDY+ LRHGFI+AH AP ++  FDF++YI+RSLE+DFK VV ISP IW
Sbjct  240   CFFRQFFGSVTKVDYLALRHGFIMAHFAPGNESRFDFRKYIQRSLEKDFKTVVEISPVIW  299

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
               AV+FLL N++G RSYLWLPFIPLV+IL+VGTKL+VIITK+GLRIQE+G+VV+G PVVQ
Sbjct  300   FVAVLFLLTNSYGLRSYLWLPFIPLVVILIVGTKLEVIITKLGLRIQEKGDVVRGAPVVQ  359

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMG  1487
             P DDLFWF +PR +L+LIH VLF NAFQLAFFAW+ YEF L +CFHE T D+VIR+ +G
Sbjct  360   PGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNCFHESTADVVIRLVVG  418



>ref|XP_006855670.1| hypothetical protein AMTR_s00044p00123510 [Amborella trichopoda]
 gb|ERN17137.1| hypothetical protein AMTR_s00044p00123510 [Amborella trichopoda]
Length=556

 Score =   489 bits (1258),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 278/514 (54%), Positives = 350/514 (68%), Gaps = 27/514 (5%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGGGG  R+LE+TPTWAVAAVC V++ ISI++E  +H +G+   KR K +++EALEK+
Sbjct  1     MAGGGGGDSRTLEQTPTWAVAAVCAVILLISILLEKGLHHVGEWFTKRKKMSMFEALEKV  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             KAELM+LGFISLLLT GQS I KICI   + ++  PC                  +    
Sbjct  61    KAELMILGFISLLLTFGQSYIAKICIPDHVADTMLPCK---------------AANVKTN  105

Query  585   rrlllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLY  764
             ++    F  DE      RR LAG  +     +G V  +S + IHQLHIFIF LA+FHV++
Sbjct  106   KKFSKRFLFDELFVNGVRRSLAGADSTASCSKGKVSLVSTNAIHQLHIFIFFLAVFHVIF  165

Query  765   CIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLW  944
               + +A GR K+R+WK WE ET++L Y+ +HDP RFRFA DTSF R H SFW++ PF+  
Sbjct  166   SAVVMALGRAKIRRWKEWEKETQSLNYESSHDPTRFRFAHDTSFVRAHSSFWNKIPFIFH  225

Query  945   IVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
             IVCFFRQF RSV K DY+T+RHGFI  HLAP S+  FDFQ+YIKRSLE+DFK VVGISP 
Sbjct  226   IVCFFRQFFRSVRKADYLTMRHGFIAVHLAPGSK--FDFQKYIKRSLEDDFKEVVGISPV  283

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             +W  AVIFLL N +G  +  W+  IPLVIIL VGTKLQ IIT M L IQER  VV+G P+
Sbjct  284   LWASAVIFLLLNVNGWYALFWVTLIPLVIILAVGTKLQAIITNMALEIQERHAVVQGMPL  343

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             VQ  D  FWF  P+L+L+LIHF LFQNAFQ+ +F W WYEFGLKSCFHE    ++ R++ 
Sbjct  344   VQLNDKHFWFGSPKLVLFLIHFTLFQNAFQIVYFLWIWYEFGLKSCFHENFRLIIARVAT  403

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+ +Q LCSY+TLPLYALVTQMGS+MK +IF+E+ +KALK WHQ A+K  RQ R S    
Sbjct  404   GVGVQFLCSYITLPLYALVTQMGSHMKRSIFDEQTSKALKKWHQAAKK--RQGRSS----  457

Query  1665  PLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPA  1766
                SR        SP H L  +K+   S  ++P+
Sbjct  458   --LSRSNGVSPAASPFHPLHRFKTVGHSARSAPS  489



>ref|XP_010918343.1| PREDICTED: MLO protein homolog 1 [Elaeis guineensis]
Length=546

 Score =   486 bits (1251),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 276/528 (52%), Positives = 356/528 (67%), Gaps = 47/528 (9%)
 Frame = +3

Query  231   MAGGGGGR-SLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIK  407
             MAGG  G  SLE TPTWAVA VC ++V IS++IE+ IH +GK  Q R KKA+ EALEKIK
Sbjct  1     MAGGSSGDLSLEVTPTWAVALVCAIMVIISVMIEHGIHKLGKWFQTRQKKAMNEALEKIK  60

Query  408   AELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrr  587
             AELMLLGFISLLLT+GQ+TI KICI    G+   PC +                      
Sbjct  61    AELMLLGFISLLLTIGQTTISKICIPAKAGDIMLPCKK----------------------  98

Query  588   rlllAFADDEYSGESHRR------------ILAGGGTDKCAK-EGMVPFISADGIHQLHI  728
                 A   ++   +S RR            ILAG   D C+K +  VP IS  GIHQLHI
Sbjct  99    ----AHDVEKEDSDSQRRLLWHQEKVVWHRILAGSTVDNCSKYKDKVPLISQSGIHQLHI  154

Query  729   FIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRH  908
             FIFVLA+FHVLY ++T+A G+ KM+KWK WE+ET +LEYQF++DP RFRF   TSF +RH
Sbjct  155   FIFVLAVFHVLYSVLTMALGKAKMKKWKTWEAETASLEYQFSNDPSRFRFTHQTSFVKRH  214

Query  909   LSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLE  1088
             +   S +P + WIV FFRQF RSV KVDY+T+RHGFI AHL+P S+  FDF +YIKRSLE
Sbjct  215   VGL-SSTPGIRWIVAFFRQFFRSVTKVDYLTMRHGFINAHLSPNSK--FDFHKYIKRSLE  271

Query  1089  EDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRI  1268
             +DFKVVVGIS P+W  A++ LL + +G  + +W+ F+PL+I+L+VG KL+++I +M   I
Sbjct  272   DDFKVVVGISFPLWFLAIVMLLLDVYGWYTLVWISFVPLIILLIVGMKLEIVIMEMAHEI  331

Query  1269  QERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFH  1448
             Q R  VVKG P+++P++  FWFNRP+ +L+LIH  LF+NAFQ+A F W+ Y FGLKSC H
Sbjct  332   QNRTSVVKGAPIIEPSNKFFWFNRPQWILFLIHLTLFENAFQMAHFLWSVYSFGLKSCIH  391

Query  1449  EKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARK  1628
             E     V ++ MGL +Q LCSY+T PLYALVTQMGS+MK  IF E+ AKAL  W + A K
Sbjct  392   ENLAFTVAKVIMGLALQFLCSYITFPLYALVTQMGSHMKKAIFEEQTAKALIRWRRAA-K  450

Query  1629  QLRQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYK---SEIDSVGASP  1763
             + ++ R + S     S   TP  G+SP+HLL  YK    +++SV +SP
Sbjct  451   ERKKLRGANSDAGYMSGENTPSRGSSPMHLLHKYKLNSVDVESVPSSP  498



>gb|EYU36580.1| hypothetical protein MIMGU_mgv1a020678mg [Erythranthe guttata]
Length=560

 Score =   486 bits (1251),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 272/543 (50%), Positives = 366/543 (67%), Gaps = 24/543 (4%)
 Frame = +3

Query  231   MAGGG--GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGG   G RSLE+T TWAVA VC V V IS+ IE+ I  + K  +KR+KK++ EALEKI
Sbjct  1     MAGGASSGERSLEQTSTWAVAIVCAVFVIISVAIEHGIESLAKWFKKRDKKSMIEALEKI  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             KAELMLLGFISLLLTVG + I KIC+ + LGN W PCD+  E D  G +           
Sbjct  61    KAELMLLGFISLLLTVGTTYIAKICVPEKLGNKWLPCDKEVENDDEGQNGKRKLI-----  115

Query  585   rrlllAFADDEYSGESHRRILAGG--GTDKCAKEGMVPFISADGIHQLHIFIFVLALFHV  758
                  ++ DD       RR LA G    D C  +G V  IS  G+HQLHIFIFVLA+ HV
Sbjct  116   -----SYDDDRMVW---RRSLAAGTDNYDYCGAKGKVSLISYSGVHQLHIFIFVLAVMHV  167

Query  759   LYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFL  938
              Y +  +  G  KM+KWKAWE ET +LEY+FT+DP RFRFA  TSF RRH   ++ +P L
Sbjct  168   FYSVTLMVLGNAKMKKWKAWELETTSLEYEFTNDPARFRFAHQTSFVRRHTGIYN-TPVL  226

Query  939   LWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGIS  1118
              WIV FFRQF  S+ KVDY+ +R+GFI AHLAP ++  FDF +YIKRS+E+D+K V+GIS
Sbjct  227   KWIVAFFRQFFGSISKVDYIAIRNGFINAHLAPNTK--FDFHKYIKRSMEDDYKSVLGIS  284

Query  1119  PPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGT  1298
              P+W FA++FL  N +   +  W+  IP++II+LVGTKL+++I +M  +IQ+R  VV+G 
Sbjct  285   IPLWFFAIMFLFLNIYRWHTLAWITLIPVIIIVLVGTKLELVIVEMAQQIQDRTAVVRGA  344

Query  1299  PVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRI  1478
             P+V+P ++ FWFNRP+ +L+LIHF LFQNA+Q+A+F W WYEFG+ +CFHEK   +++R+
Sbjct  345   PLVEPTNNFFWFNRPQWILFLIHFTLFQNAYQMAYFLWKWYEFGITTCFHEKLHIVLVRV  404

Query  1479  SMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGS  1658
              +G+ +Q+LCSY+T PLYALVTQMGS+MK +IF E+ AKALK WHQ A+++ + ++   S
Sbjct  405   FLGVALQILCSYITFPLYALVTQMGSHMKKSIFEEQTAKALKKWHQAAKQRKKLRKVDAS  464

Query  1659  VTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEE  1838
              T   S   TP   TSP+HLL ++     +  A+ +  + D  P  +   D  + +  E 
Sbjct  465   YT---SGDTTPSRATSPLHLLHHHNRRSSTAPATDSESLADLSPARSYISDTELSE-LES  520

Query  1839  NRN  1847
             N N
Sbjct  521   NSN  523



>ref|XP_002510708.1| Protein MLO, putative [Ricinus communis]
 gb|EEF52895.1| Protein MLO, putative [Ricinus communis]
Length=556

 Score =   485 bits (1248),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 278/541 (51%), Positives = 356/541 (66%), Gaps = 51/541 (9%)
 Frame = +3

Query  234   AGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAE  413
             A   G RSL+ETPTWA+A VC V V IS++IE+VIH +GKL QKR  KA+ EALEKIKAE
Sbjct  3     AAPSGERSLQETPTWALALVCAVFVVISVLIEHVIHSLGKLFQKRRNKAMSEALEKIKAE  62

Query  414   LMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrl  593
             LMLLGFISLLLTVG   I KICI    G+   PC                          
Sbjct  63    LMLLGFISLLLTVGTKYIAKICIPAKYGDDMLPCK----------------------SGY  100

Query  594   llAFADDEYSGESHRRIL---------------AGGGTDKCAKEGMVPFISADGIHQLHI  728
               +++D    G+  RR L               A GG D CAK+G +P IS  G+HQLHI
Sbjct  101   EESYSDK--GGDDRRRKLLSFAGDVIWRRGLAAAAGGDDYCAKKGKIPLISQTGVHQLHI  158

Query  729   FIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRH  908
             FIFVLA+FHVLY ++T+A  + KM+KWK WESET +LEYQFT+DP RFR A  TSF +RH
Sbjct  159   FIFVLAVFHVLYSVLTIALAQAKMKKWKTWESETSSLEYQFTNDPSRFRLAHQTSFVKRH  218

Query  909   LSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLE  1088
              S  S +P + WIV FFRQF  SV KVDY+T+R+GFI AH AP S+  FDF +YIKR +E
Sbjct  219   -SGISTAPGIRWIVAFFRQFFGSVTKVDYLTMRNGFINAHFAPNSK--FDFHKYIKRCME  275

Query  1089  EDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRI  1268
             +DFKVVVGIS P+W+FA+ FLL N +   +  WL  +PL+I+L+VGTKL+++I +M  +I
Sbjct  276   DDFKVVVGISIPLWVFAIAFLLLNVYKWYTLTWLTIVPLIILLMVGTKLELVIIEMAEQI  335

Query  1269  QERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFH  1448
             QER  VV+G PVV+P +  FWFNRP+ +L LIH+ LFQNAFQ+AFF W WYEFGLKSCFH
Sbjct  336   QERSTVVRGAPVVEPNNKYFWFNRPQWILLLIHYTLFQNAFQMAFFLWTWYEFGLKSCFH  395

Query  1449  EKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARK  1628
             E    ++ R+ +G+ +Q +CSY+T PLY LVTQMGS+MK  IF E+  KAL+ W + A++
Sbjct  396   ENLAAILARVFLGVALQFVCSYITFPLYCLVTQMGSHMKKAIFEEQTTKALRKWQKAAKE  455

Query  1629  QLRQKRHSGSVTP----LSSRPGTPLHGTSPIHLLQYYK-----SEIDSVGASPARDIED  1781
             + + ++  G        +S    TP  G SPIHLL  +K     ++I+SV  SP   + D
Sbjct  456   RKKSRKAGGGGGSSPGFMSVESTTPSQGASPIHLLHGHKYRSSQTDIESVLNSPRSYLSD  515

Query  1782  N  1784
              
Sbjct  516   T  516



>ref|XP_003603854.1| MLO protein-like protein [Medicago truncatula]
 gb|AES74105.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=551

 Score =   483 bits (1242),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 287/533 (54%), Positives = 358/533 (67%), Gaps = 53/533 (10%)
 Frame = +3

Query  231   MAGGG-GGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIK  407
             MAGG  G R+L+ETPTWAVAAVC V V IS++IE+ IH + K   K++KKA+ EALEKIK
Sbjct  1     MAGGAPGERTLKETPTWAVAAVCAVFVIISVLIEHGIHKLEKWFHKKHKKAMSEALEKIK  60

Query  408   AELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrr  587
              ELMLLGFISLLLT G   I KICI   LG+S  PC + E                    
Sbjct  61    EELMLLGFISLLLTFGTKYIAKICIPNKLGDSMLPCKKGEV-------------------  101

Query  588   rlllAFADDEYSGESHRRIL----------------AGGGTDKCAKEGMVPFISADGIHQ  719
                     +E S +  RR+L                A GG D C+ +G VP IS  G+HQ
Sbjct  102   --------EEESKDDRRRLLSFDFDENVVWRRGLAPAAGGDDYCSNKGQVPLISQSGVHQ  153

Query  720   LHIFIFVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFG  899
             LHIFIFVLA+FH+ Y ++T+   R KM+KWKAWE+ET ++EYQFTHDP RFRFA  T+F 
Sbjct  154   LHIFIFVLAVFHIFYSVMTIVLARAKMQKWKAWETETSSVEYQFTHDPSRFRFAHQTTFV  213

Query  900   RRHLSFWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKR  1079
             +RH S WS  P + WIV FFRQF  SV KVDYMT+RHGFI AH AP S+  FDF +YIKR
Sbjct  214   KRH-SGWSEKPGIRWIVAFFRQFFASVSKVDYMTMRHGFINAHFAPDSK--FDFHKYIKR  270

Query  1080  SLEEDFKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMG  1259
             S+E+DFKVVVGIS P+W FA+IFLL N +   +  WL   PLVI+LLVGTKL++II +M 
Sbjct  271   SMEDDFKVVVGISVPLWAFAIIFLLMNVYNWYTLTWLSLAPLVILLLVGTKLELIIMEMA  330

Query  1260  LRIQERGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKS  1439
               IQ+R  +V+G PVV+P +  FWFNRP  +++LIHF LFQNAFQ+A+F W WYEF + S
Sbjct  331   QEIQDRTTIVRGVPVVEPNNKYFWFNRPHWIIFLIHFTLFQNAFQIAYFLWTWYEFTITS  390

Query  1440  CFHEKTEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQT  1619
             CFHE    +V R+ +G+ +QVLCSY+T PLYALVTQMGS+MK  IF E+  KALK W + 
Sbjct  391   CFHENLPLIVTRVVLGVALQVLCSYITFPLYALVTQMGSHMKRGIFEEQTTKALKKWQKA  450

Query  1620  ARKQLRQKRHSGSVT-PLSSRPGTPLHGTSPIHLLQYYK----SEIDSVGASP  1763
             AR + R+ R++GS+  P  S   TP  GTSP+HLL  +K    ++ DSV  SP
Sbjct  451   ARDK-RKLRNAGSIEIPSVSGDTTPSQGTSPLHLLHKFKPSNQTDTDSVLYSP  502



>emb|CBI40746.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   481 bits (1238),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 267/524 (51%), Positives = 354/524 (68%), Gaps = 45/524 (9%)
 Frame = +3

Query  234   AGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAE  413
             A   G RSL+ETPTWAVA VC V V +S++IE+ I  + K  +K+ KKA+ EALEKIKAE
Sbjct  3     APAAGERSLQETPTWAVALVCAVFVIVSVLIEHGIESLAKWFKKKQKKAMSEALEKIKAE  62

Query  414   LMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrl  593
             LMLLGFISLLLT+G   I KICI   LG++  PC +                        
Sbjct  63    LMLLGFISLLLTIGTRFIAKICIPAELGSTMLPCKQMIL---------------------  101

Query  594   llAFADDEYSGESHRRILAG-GGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
                           RR+LA   G D C+K   +P IS  G+HQLHIFIF+LA+FHVLY +
Sbjct  102   --------------RRVLAAQAGGDYCSKSDKIPLISQTGVHQLHIFIFMLAVFHVLYSV  147

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+A  + KM+KWK+WESET +LEY+FT+DP RFRF   TSF RRH  F SR+P + WIV
Sbjct  148   VTMALAQAKMKKWKSWESETSSLEYEFTNDPARFRFTHQTSFVRRHAGF-SRAPGIRWIV  206

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQF  SV KVDY T+R GFI AHLAP S+  F+F +YIKRS+E+DFKVVVGIS P+W
Sbjct  207   AFFRQFFASVTKVDYTTMRRGFINAHLAPNSK--FNFHKYIKRSMEDDFKVVVGISMPLW  264

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
             +FA+IF+L N +   +  W+  +P+ I+L+VGTKL++II +M   IQ+R  VVKG P+V+
Sbjct  265   IFAIIFMLLNVYKWYTLSWMQIVPVTILLVVGTKLELIIMEMAEEIQDRTTVVKGAPIVE  324

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P +  FWFNRP  +L LIHF+LFQNAFQ++FF W  YE+G+KSCFHE   ++++R+  G+
Sbjct  325   PNNKFFWFNRPHWVLLLIHFILFQNAFQMSFFLWITYEYGIKSCFHENLAEILVRLVCGV  384

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPL  1670
              +Q+LCSY+T PLYALVTQMGS+MK +IF E+ A+ALK W + A+++ + ++  G + P 
Sbjct  385   ALQILCSYITFPLYALVTQMGSHMKKSIFEEQTAQALKKWQKAAKERKKLRKAGGDIAPG  444

Query  1671  S-SRPGTPLHGTSPIHLLQYYK-----SEIDSVGASPARDIEDN  1784
             S     TP HG SP+HLL+ +K     +E++S   SP     D 
Sbjct  445   SLGGENTPSHGASPLHLLRNHKYRSSTNEVESAPTSPKSCQSDT  488



>ref|XP_002519555.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF42969.1| calmodulin binding protein, putative [Ricinus communis]
Length=450

 Score =   478 bits (1229),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 294/480 (61%), Positives = 339/480 (71%), Gaps = 37/480 (8%)
 Frame = +3

Query  234   AGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAE  413
             AG GGG  LEETPTWAVA VCFVLV+ISIVIE +  LIGK L KRNK  L++ALEKIK E
Sbjct  3     AGAGGGLPLEETPTWAVAVVCFVLVSISIVIERISELIGKWLTKRNKTTLHDALEKIKLE  62

Query  414   LMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrl  593
              M LG ISLLLTVGQ    +ICI KS+ ++ HPC+      K    +        RR   
Sbjct  63    FMRLGLISLLLTVGQG-FSEICIPKSIADTRHPCE-----TKQKSKSTYKASINLRRLLS  116

Query  594   llAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCII  773
             + + +    S   +RR+LA  G DKC  +G VPF+S DGIHQLHIFI VLA+ H+LYCI 
Sbjct  117   ISSSSISGSSSTINRRVLAAEGYDKCVAKGKVPFVSVDGIHQLHIFISVLAVLHLLYCIA  176

Query  774   TLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWI--  947
              L  GR K               + F  DPER RFARDT+FG RHL F    PF++    
Sbjct  177   ILGLGREKFL-------------FDFAVDPERVRFARDTTFGTRHLLF--LEPFIVSFMD  221

Query  948   -VCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPP  1124
              V  F +F+R V K   M+       +HLAPQSQ+ F+FQ YIKRSLEEDFKVVVGIS  
Sbjct  222   KVLDFWKFIRDVSKTQIMS-------SHLAPQSQIKFNFQNYIKRSLEEDFKVVVGISST  274

Query  1125  IWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPV  1304
             IWLFA+IFLLFNTHG  SYLWLPFIPL++ILLVGTKLQVIITKMG RIQERGEVVKG P+
Sbjct  275   IWLFALIFLLFNTHGWYSYLWLPFIPLIVILLVGTKLQVIITKMGRRIQERGEVVKGKPL  334

Query  1305  VQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISM  1484
             V+P DDLFWFN+PRL+LYLIHFVLFQNAF LAFFAW+WYEFGLKSC HE  ED+ IRI+M
Sbjct  335   VEPGDDLFWFNKPRLLLYLIHFVLFQNAFDLAFFAWSWYEFGLKSCLHENPEDIGIRITM  394

Query  1485  GLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVT  1664
             G+ I VLCSYVTLPLYALVTQ      PTIF+ERV KAL+ WH TARK ++Q  HS  +T
Sbjct  395   GITIHVLCSYVTLPLYALVTQ------PTIFSERVGKALRKWHHTARKHMKQVGHSNRIT  448



>ref|XP_008387611.1| PREDICTED: MLO-like protein 6 isoform X1 [Malus domestica]
Length=406

 Score =   473 bits (1216),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 265/400 (66%), Positives = 306/400 (77%), Gaps = 32/400 (8%)
 Frame = +3

Query  777   LAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCF  956
             L +   +MRKWK WE ETKT  YQF+HDPERFRFARDTSFGRRHLSFWSRSP  LWIVCF
Sbjct  7     LGWDGTQMRKWKTWELETKTAAYQFSHDPERFRFARDTSFGRRHLSFWSRSPISLWIVCF  66

Query  957   FRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLF  1136
             FRQFVRSVPKVDY+TLRHGFI AHLAPQSQ  FDFQ+YI RSLEEDFKVVVGISP IWLF
Sbjct  67    FRQFVRSVPKVDYLTLRHGFIAAHLAPQSQTKFDFQKYINRSLEEDFKVVVGISPTIWLF  126

Query  1137  AVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPA  1316
             AV+ L+ NTHG+RSYLWLPF+PLV+IL+VGTKLQVIITKMGL++ ERGEVV+GTP+V+P 
Sbjct  127   AVLILMSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEVVRGTPLVEPG  186

Query  1317  DDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLI  1496
             D LFWFN PRL+LY+IHFVLFQNAF LAFFAW WYEFGLKSCFHEK ED+V+RISMG++I
Sbjct  187   DHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSCFHEKLEDVVLRISMGVII  246

Query  1497  QVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSS  1676
             Q+LCSYVTLPLYALVTQMGS MKP IFN+RVA ALK WH  A+K ++ K  S      +S
Sbjct  247   QILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWHIAAKKHVKHKNASP-----AS  301

Query  1677  RPGTPLHGTSPIHLLQYYKSE--IDSVGASPARDI------------EDNLPWFN-----  1799
              PGTPLH  SP+HLL+ YK E  IDS+  SP                +DNL W       
Sbjct  302   APGTPLHSMSPVHLLRNYKYEQDIDSIQTSPRMPYFDNEGSDSPFHHQDNLTWSQQGTNM  361

Query  1800  --QRRDNNVDQPAEENR------NELQREIEMESAEFSFE  1895
               Q+ + +   P  E+       + +Q EI++ SA  +FE
Sbjct  362   EGQKEEISAHGPNAESNALGAYGSIIQHEIQIHSAALTFE  401



>ref|XP_003558907.1| PREDICTED: protein MLO-like [Brachypodium distachyon]
Length=556

 Score =   474 bits (1220),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 276/583 (47%), Positives = 368/583 (63%), Gaps = 52/583 (9%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAG   GR L +TPTWAVA VC V++ +S+ +E+ +H +G   QKR KKA+ EALEKIKA
Sbjct  1     MAGPAVGRELPQTPTWAVAVVCLVMILLSLALEHALHKLGHWFQKRQKKAVAEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLLTVGQ+ I KICISK  G+   PC      +                  
Sbjct  61    ELMLMGFISLLLTVGQTPISKICISKEAGSVMLPCKLSVAAED-----------------  103

Query  591   lllAFADDE-----------YSGESHRRILAGG-GTDKCAKEGMVPFISADGIHQLHIFI  734
                  ADDE           +  E HRR LA   G D CA +G V  +SA  +HQLHIFI
Sbjct  104   -----ADDEGKDNGRRRLLWFQEEIHRRFLAAAPGVDPCASQGKVALMSASSMHQLHIFI  158

Query  735   FVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLS  914
             FVLA+FHV Y + T+A GRLKM+KWK WESET +LEYQF +DP RFRF   TSF +RH+ 
Sbjct  159   FVLAVFHVFYSVTTMALGRLKMKKWKKWESETTSLEYQFANDPSRFRFTHQTSFVKRHMG  218

Query  915   FWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEED  1094
               S +P + WIV FFRQF  SV KVDY+T+R GFI AHL+  S+  FDF +YIKRSLE+D
Sbjct  219   L-SSTPGVRWIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSK--FDFHKYIKRSLEDD  275

Query  1095  FKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQE  1274
             FKVVVGIS P+W  AV+ L  + +G  + +W+ F+P VI+LLVGTKL+++I +M   IQ+
Sbjct  276   FKVVVGISLPLWFVAVLTLFLDINGIYTLIWISFVPFVILLLVGTKLEIVIMEMAQEIQD  335

Query  1275  RGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEK  1454
             R  V+KG PVV+P++  FWF RP  +L+LIH  LFQNAFQ+A F WA +  GLK C+H+ 
Sbjct  336   RASVIKGAPVVEPSNKFFWFKRPDWVLFLIHLTLFQNAFQMAHFVWALFTPGLKKCYHQN  395

Query  1455  TEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQL  1634
                 ++++ +G+ +QVLCSY+T PLYALVTQMGSNMK  IF+E+ AKAL +W  TAR++ 
Sbjct  396   MGLSIMKVVVGVALQVLCSYITFPLYALVTQMGSNMKRAIFDEQTAKALTNWRNTAREK-  454

Query  1635  RQKRHSGSVTPLSSRPGTPLHGTSPIHLLQYYK---SEIDSVGASPARDIEDNLPWFNQR  1805
             ++ R + +         TP  G+SP+HLL   +    +  S+  SP R   + +  +   
Sbjct  455   KKTRDADAFMAQMIGDATPSQGSSPVHLLHKNRMRSEDPQSIPTSP-RAEHEAMDMYPVA  513

Query  1806  RDNNVDQPAEENRNE----------LQREIEMESAEFSFENKR  1904
             +  +   P   +R +             + ++ SA+FSF  +R
Sbjct  514   QVVHTSHPHPPHRLDPSDRRRSASSSALDTDIASADFSFSMQR  556



>ref|XP_010318227.1| PREDICTED: MLO-like protein 2 isoform X2 [Solanum lycopersicum]
Length=445

 Score =   468 bits (1205),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 269/484 (56%), Positives = 335/484 (69%), Gaps = 49/484 (10%)
 Frame = +3

Query  453   GQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFADDEYSGES  632
              Q  + KICI +S+G SWHPCD                         +    DD+Y    
Sbjct  8     SQDPMSKICIPRSVGRSWHPCD-------------------------INKHIDDQY----  38

Query  633   HRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGRLKMRKWK  812
                       D C  +G + F S   IHQLHIFIFVLA+ HVLYCI TL  G+L+MR W+
Sbjct  39    ---------LDPCRIKGKLQFASKYAIHQLHIFIFVLAVAHVLYCITTLGIGKLRMRTWR  89

Query  813   AWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFVRSVPKVD  992
             AWE E+KT+EYQF +DPERFRFAR+TSFGR+HL FWS SP LLWIVCFFRQF  SV KVD
Sbjct  90    AWEDESKTIEYQFYNDPERFRFARETSFGRKHLHFWSNSPILLWIVCFFRQFYASVEKVD  149

Query  993   YMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFLLFNTHGT  1172
             Y+TLRHGF +AHLAPQ + NFDFQ YI R+LEEDFK VVGISP +W+FAV++ L  T+G 
Sbjct  150   YLTLRHGFAMAHLAPQQEKNFDFQLYINRALEEDFKDVVGISPLLWMFAVLYFLTTTNGW  209

Query  1173  RSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFWFNRPRLM  1352
              SY WLPFIPL+IILLVGTKLQVIITKMGLRI+ERG++VKGTP+V+P DDLFWFNRP L+
Sbjct  210   YSYYWLPFIPLIIILLVGTKLQVIITKMGLRIKERGDIVKGTPLVEPGDDLFWFNRPDLL  269

Query  1353  LYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCSYVTLPLY  1532
              + IHFVLFQNA+QLAFFAW+W++F L SCFH+   D+ I +SMG LIQVLCSYVTLPLY
Sbjct  270   HFFIHFVLFQNAYQLAFFAWSWWKFNLPSCFHKNVTDIAITLSMGALIQVLCSYVTLPLY  329

Query  1533  ALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTPLSSRPGTPLH-GTSP  1709
             ALVTQMGS MKP IF + VA A+++WHQTA+++ +  R S + +P+ SR  +PL  G+SP
Sbjct  330   ALVTQMGSTMKPVIFGDNVAYAIRTWHQTAKQRAKDGRPSKNASPVRSRAVSPLRGGSSP  389

Query  1710  IHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQPAEENRNELQREIEMESAEFS  1889
             +   Q    ++     +P+R      P      +++  Q  ++  +E Q EIE+   + S
Sbjct  390   V---QQKHGQLYPPSPNPSRRRSGGNP------ESSSRQIFDDGSHE-QSEIEITLNDLS  439

Query  1890  FENK  1901
              ENK
Sbjct  440   LENK  443



>ref|XP_010256542.1| PREDICTED: MLO-like protein 9 [Nelumbo nucifera]
Length=537

 Score =   471 bits (1213),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 282/543 (52%), Positives = 362/543 (67%), Gaps = 39/543 (7%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             M+GG     R L++TPTWAVA VC  ++ ISIV+E V+H +G+  Q+R KKALYEALEK+
Sbjct  1     MSGGDNSQSRQLDQTPTWAVAFVCAFIIIISIVLEKVLHRVGEWFQERRKKALYEALEKV  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K ELM+LGFISLLLT GQ  I K+CI +   N+  PC        +G + G+        
Sbjct  61    KGELMILGFISLLLTFGQIYIAKVCIPEHFANTMLPCPYRAGGLAHGAEDGEH-------  113

Query  585   rrlllAFADDEYSGESH--------RRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFV  740
                       E +GE H        RRIL+GGG  KC  EG  P IS +G+HQLHIFIF 
Sbjct  114   --------KTESAGEGHHRKLLWNERRILSGGGDYKCM-EGYEPLISINGLHQLHIFIFF  164

Query  741   LALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFW  920
             LA+FHV+Y   T+A GRLK+R W+AWE+ET + +Y+F+ D  RFR  ++TSF + H +FW
Sbjct  165   LAVFHVVYSCATMALGRLKIRGWRAWETETLSHDYEFSQDQARFRLTKETSFVKAHNNFW  224

Query  921   SRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFK  1100
             +R PFL  IVCFFRQF RSV K DY+T+RHGF+  HLAP S+  FDFQ+YIKRSLE+DFK
Sbjct  225   TRVPFLFIIVCFFRQFFRSVRKADYLTMRHGFVAVHLAPGSK--FDFQKYIKRSLEDDFK  282

Query  1101  VVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERG  1280
             VVVGISP +W   V+  L N +G  +  W+  IPLV+IL VGTKLQ IIT M L IQER 
Sbjct  283   VVVGISPLLWASVVVVFLLNVNGWHAMFWVSMIPLVVILAVGTKLQSIITTMALEIQERH  342

Query  1281  EVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTE  1460
              VV+G P+VQ  D  FWF+ P+L+LYLIHFVLFQNAFQ+ +F W WYEFGLKSCFHE   
Sbjct  343   AVVQGIPLVQVTDRHFWFHWPQLVLYLIHFVLFQNAFQITYFFWIWYEFGLKSCFHENLT  402

Query  1461  DLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ  1640
              + IR++MG+ +QV+CSY+TLPLYALVTQMGS MK +IF+E+ +KALK WH  A K    
Sbjct  403   LIFIRVAMGIGVQVVCSYITLPLYALVTQMGSTMKKSIFDEQTSKALKKWHMNAVK----  458

Query  1641  KRHSG---SVTPLSSRPGTPLH--GTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQR  1805
             K+H+G   + +P     G+P      +P H L   +S+I++  +  A ++ D      Q 
Sbjct  459   KKHTGDKPAASPTKGHGGSPKSSPNQTPTHPLN--RSDIEAHASPTAANLMDKPESLQQD  516

Query  1806  RDN  1814
               N
Sbjct  517   GQN  519



>emb|CDP01770.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   471 bits (1212),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 279/566 (49%), Positives = 358/566 (63%), Gaps = 39/566 (7%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGG G RSL+ETPTWAVAAVC V V IS++IE+ IH + K  QK  KKAL EALEKIKA
Sbjct  1     MAGGPGDRSLKETPTWAVAAVCAVFVIISVLIEHGIHSLAKWFQKSQKKALLEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLL+TVGQ  I KICISK  G++  PC +                       
Sbjct  61    ELMLLGFISLLITVGQKPISKICISKGAGDTMLPCKK-----------------------  97

Query  591   lllAFADDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCI  770
              LL +A D  +         G  TD C+K   VP IS  GIHQLHIFIFVLA+FHVLY +
Sbjct  98    -LLWYAGDALA-RRFLAAAGGDDTDHCSKYKKVPLISQSGIHQLHIFIFVLAVFHVLYSV  155

Query  771   ITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIV  950
             +T+   R K++KWK+WE ET +L YQ T+DP RFRF   TSF R++  F S  P + WIV
Sbjct  156   LTIVLARAKVKKWKSWEQETASLNYQLTNDPSRFRFVHQTSFIRQYSGF-STKPGIRWIV  214

Query  951   CFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIW  1130
              FFRQF  SV K DY+TLRHGFI AH A  S+  FDF +YIKRS+E+DFKVVVGIS P+W
Sbjct  215   TFFRQFFCSVTKTDYLTLRHGFINAHFAANSK--FDFHKYIKRSMEDDFKVVVGISIPLW  272

Query  1131  LFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQ  1310
              FA++FL  N +   S   +  +P ++++++G KLQ+II  M L IQ+R  VV G P+V+
Sbjct  273   TFAILFLALNVYRWYSLFAISLVPPIMLVIIGAKLQIIIMDMALHIQDRTTVVTGVPIVE  332

Query  1311  PADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGL  1490
             P++  FWFNRP  +L LIHF  F+NAFQ+A+F W WY+FGL SCFHE    ++ ++ +G+
Sbjct  333   PSNKYFWFNRPHFILGLIHFTSFENAFQMAYFLWTWYQFGLTSCFHENLPVILAKVFLGV  392

Query  1491  LIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSVTP-  1667
              +QVL SY+T PLYALVTQMGS+MK  IF E+ AKAL  W + A+++ + ++  G ++P 
Sbjct  393   AVQVLGSYITFPLYALVTQMGSHMKKAIFEEQTAKALMKWQKAAKERRKLRKAGGDMSPD  452

Query  1668  LSSRPGTPLHGTSPIHLLQYYKSEIDSVGA----------SPARDIEDNLPWFNQRRDNN  1817
             L S   TP  G+SPIHLL  YK+  D   +          S A   E   P  N   D N
Sbjct  453   LMSGNTTPSRGSSPIHLLHKYKTNSDIENSINNPTPRPYHSDADYSETEGPALNSSDDQN  512

Query  1818  VDQPAEENRNELQREIEMESAEFSFE  1895
                     +  + +E E  + +FSF 
Sbjct  513   ARNHNTPKKEIVGKEPETYNWDFSFS  538



>ref|XP_010663996.1| PREDICTED: MLO-like protein 9 [Vitis vinifera]
Length=531

 Score =   470 bits (1210),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 270/550 (49%), Positives = 357/550 (65%), Gaps = 48/550 (9%)
 Frame = +3

Query  237   GGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAEL  416
             G G  R L++TPTWAVAAVC V++ ISI++E V+HL+G+L Q+R KKALYEALEK+K EL
Sbjct  4     GEGNSRELDQTPTWAVAAVCAVIILISIILEKVLHLVGELFQRRRKKALYEALEKVKGEL  63

Query  417   MLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrll  596
             M+LGFISLLLT GQ+ I KICI   L ++  PC                    G +    
Sbjct  64    MILGFISLLLTFGQNYISKICIPSDLADTMLPCPS------------------GGQAHHE  105

Query  597   lAFADDEYSGESHR-------RILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFH  755
                  +   GE HR       R L+        KEG VP IS  G+HQLHIFIF LA+FH
Sbjct  106   AEHKPEPAEGEHHRKLLWNEHRFLSVESEGVVCKEGHVPLISTHGLHQLHIFIFFLAVFH  165

Query  756   VLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPF  935
             V+Y  IT+A GRLK R WK WE ET     ++ +D  RFR   +TSF R H SFW+++PF
Sbjct  166   VIYSAITMALGRLKTRAWKEWERET-----EYDNDAARFRLTHETSFVRDHSSFWTKTPF  220

Query  936   LLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGI  1115
             L  IVCFFRQF RSV K DY+T+RHGF+  HLAP S+  F+FQ+YIKRSLE+DFKVVVGI
Sbjct  221   LFVIVCFFRQFFRSVRKADYLTMRHGFVTVHLAPGSK--FNFQKYIKRSLEDDFKVVVGI  278

Query  1116  SPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKG  1295
             SP +W   V+FLL N HG  +  W+   PLV+IL VGTKLQ IIT M L IQE+  VV+G
Sbjct  279   SPVLWASVVVFLLLNVHGWEAMFWISIFPLVVILAVGTKLQAIITNMALEIQEKHAVVQG  338

Query  1296  TPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIR  1475
              P+V+ +D  FWF+ P+L+LYLIHF LF NAF++ +F W WYEFGLKSCFH   + +++R
Sbjct  339   IPLVKVSDRHFWFSWPQLVLYLIHFTLFLNAFEITYFFWIWYEFGLKSCFHSDFDLIILR  398

Query  1476  ISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQ-KRHS  1652
             +++G+ +Q++CSY+TLPLYALVTQMGS MK  IF+E+ ++ALK WH  A+K+  + K   
Sbjct  399   VAIGVGVQIMCSYITLPLYALVTQMGSTMKRAIFDEQTSRALKKWHMNAQKKKNEGKPEH  458

Query  1653  GSVTPLSSRPG-TPLHGTSPIHLLQYYK------------SEIDSVGASPARDIEDNLPW  1793
             G    L   PG +P++  S  H   ++             +E D+  ++ A +I  ++  
Sbjct  459   GPTRTLGGSPGDSPVNTPSAAH--PHFTNTAGQSDHCLPVAEADAPSSNQAANIMTSIDL  516

Query  1794  FNQRRDNNVD  1823
              +Q++D+  D
Sbjct  517   RDQQQDSPPD  526



>ref|XP_010270524.1| PREDICTED: MLO-like protein 9 [Nelumbo nucifera]
Length=561

 Score =   471 bits (1213),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 289/556 (52%), Positives = 362/556 (65%), Gaps = 55/556 (10%)
 Frame = +3

Query  231   MAGGGGG----RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALE  398
             MAGG GG    R L++TPTWAVAAVC V++ ISIV+E V+H +G+   +R K AL+EALE
Sbjct  1     MAGGEGGASQSRELDQTPTWAVAAVCAVIIIISIVLEKVLHRLGEWFTERRKNALFEALE  60

Query  399   KIKAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdeg  578
             K+KAELM+LGFISLLLT  QS I+KICI + +     PC                     
Sbjct  61    KVKAELMVLGFISLLLTFCQSYIVKICIPEKITRKMLPC---------------------  99

Query  579   rrrrlllAFADDEYSGESHRRIL--------AGGGTDKCAKEGMVPFISADGIHQLHIFI  734
                     +       E HRR+L              KC KEG  P IS +G+HQLHIFI
Sbjct  100   -------PYRPSNTEEEDHRRLLWNERRFLSTASKASKC-KEGYEPLISLNGLHQLHIFI  151

Query  735   FVLALFHVLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLS  914
             F LA+FHVLY   T+  GRLK+R WKAWE ET++L Y+F +DP RFR   +TSF R H +
Sbjct  152   FFLAVFHVLYSATTMMLGRLKIRGWKAWERETQSLNYEFHYDPSRFRLTHETSFVRAHTN  211

Query  915   FWSRSPFLLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEED  1094
             FW+R PF    VCFFR F RSV K DY+TLRHGFI  HLAP S+  FDFQ+YIKRSLE+D
Sbjct  212   FWTRIPFFFVFVCFFRHFFRSVRKADYLTLRHGFISVHLAPGSK--FDFQKYIKRSLEDD  269

Query  1095  FKVVVGISPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQE  1274
             FKVVVGISP +W   V+FLL N  G R+  W+  IPL+IIL VGTKLQ IIT M L IQE
Sbjct  270   FKVVVGISPLLWASLVVFLLLNVSGWRTLFWVSIIPLIIILAVGTKLQAIITTMALEIQE  329

Query  1275  RGEVVKGTPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEK  1454
             R  VV+G P+V+ +D  FWFNRP+L+LYLIHFV+FQNAFQ+ +F W WYEFGLKSCFHE 
Sbjct  330   RHAVVQGIPLVKVSDKHFWFNRPQLVLYLIHFVMFQNAFQITYFLWIWYEFGLKSCFHEN  389

Query  1455  TEDLVIRISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQL  1634
                ++IR+SMG+ +Q LCSY+TLPLYALVTQMGS MK ++F+E+ +KA+K W   A K+ 
Sbjct  390   FTLIIIRVSMGVGVQFLCSYITLPLYALVTQMGSTMKKSVFDEQTSKAIKKWRMAAMKKK  449

Query  1635  RQKR--HSGSVTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGAS--PARDIEDNLPWFNQ  1802
              +KR  HS + +  S    +P+   SP H LQ +K+   S  +S    R+ ED++     
Sbjct  450   HEKRTGHSPTRSVGSGPSASPVQ--SPPHPLQRFKTTGHSTRSSTYSMRNSEDDM-----  502

Query  1803  RRDNNVDQPAEENRNE  1850
               DN  D P+  +  E
Sbjct  503   -SDNEADAPSPTSVTE  517



>ref|XP_010319697.1| PREDICTED: MLO1 protein isoform X1 [Solanum lycopersicum]
Length=410

 Score =   465 bits (1197),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 273/433 (63%), Positives = 327/433 (76%), Gaps = 38/433 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RS+E TPTWA+A VCF+L+AISI IE +IH IG+ L ++ KK+LYEALEKIKAELMLLGF
Sbjct  5     RSMEATPTWAIAVVCFILLAISIFIEQIIHHIGEWLLEKRKKSLYEALEKIKAELMLLGF  64

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTV Q  +  +C+ KS+G SWHPC   E+                         A 
Sbjct  65    LSLLLTVLQDPVSNLCVPKSVGYSWHPCMAKED-------------------------AK  99

Query  612   DEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFGR  791
              EY              D C  +G V F S+  IHQLHIFIFVLA+ HVLYCI T A GR
Sbjct  100   SEYD-------------DPCLPKGKVQFASSYAIHQLHIFIFVLAVAHVLYCIATFALGR  146

Query  792   LKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQFV  971
             LKMRKW+AWE ETKT+EYQF +DPERFRFAR+TSFGRRHL FWS+SP LL IVCFFRQF 
Sbjct  147   LKMRKWRAWEDETKTMEYQFYNDPERFRFARETSFGRRHLHFWSKSPVLLSIVCFFRQFF  206

Query  972   RSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIFL  1151
              SV KVDY+TLRHGF++AHL PQ+Q NFDFQ YI R++++DFKVVVGISP +WLF V++ 
Sbjct  207   SSVAKVDYLTLRHGFMMAHLTPQNQNNFDFQLYINRAVDKDFKVVVGISPALWLFTVLYF  266

Query  1152  LFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLFW  1331
             L  T    SYLW+PFIPLVIILLVGTKLQ+IIT+MG+RI ERG++VKG PVV+  D LFW
Sbjct  267   LTTTDRLYSYLWVPFIPLVIILLVGTKLQMIITEMGVRISERGDIVKGVPVVETGDHLFW  326

Query  1332  FNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLCS  1511
             FNRP L+L+LI+FVLFQNAFQ+AFF W+W++FG  SCFH+   DL IR++MG++IQV CS
Sbjct  327   FNRPALVLFLINFVLFQNAFQVAFFFWSWWKFGFPSCFHKNAADLAIRLTMGVIIQVHCS  386

Query  1512  YVTLPLYALVTQM  1550
             YVTLPLYALVTQ+
Sbjct  387   YVTLPLYALVTQL  399



>ref|XP_010260351.1| PREDICTED: MLO-like protein 12 isoform X1 [Nelumbo nucifera]
Length=505

 Score =   468 bits (1205),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 268/532 (50%), Positives = 353/532 (66%), Gaps = 50/532 (9%)
 Frame = +3

Query  249   GRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLG  428
             G S+EETPTWA+AAVCFVL++ISI+IE+ ++LI K   +R +K+L  AL KIK+ELMLLG
Sbjct  8     GSSIEETPTWAIAAVCFVLISISILIEHALNLISKFFTRRRRKSLRLALYKIKSELMLLG  67

Query  429   FISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFA  608
             FISLLLT+ +  I KICI K++G S+ PC                           L  +
Sbjct  68    FISLLLTICEEHISKICIPKNVGESFLPCKN-------------------------LIHS  102

Query  609   DDEYSGESHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVLYCIITLAFG  788
             +D             G   +CA+EG V  +S +G+ QL   IFVLA FHVL C++T   G
Sbjct  103   NDI------------GEEPRCAEEGKVSILSRNGVQQLQYLIFVLAFFHVLSCVLTFGLG  150

Query  789   RLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLLWIVCFFRQF  968
               KM++W++WE ET+TLEY FT+DP RFR    TSFG+RHL  WS  P LLW VCF RQF
Sbjct  151   MAKMKRWESWEEETRTLEYHFTNDPRRFRLTHQTSFGKRHLKCWSEYPLLLWPVCFLRQF  210

Query  969   VRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISPPIWLFAVIF  1148
               SV K DY TLRHGFI+AH A  S+  FDFQ++++R+++EDF VVVGISP +W+F+V+F
Sbjct  211   NASVSKTDYFTLRHGFIMAHFAEGSE--FDFQKFLRRAVDEDFHVVVGISPLMWIFSVLF  268

Query  1149  LLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTPVVQPADDLF  1328
             + FN +G  +Y WLPFIPLV++LLVGTKLQV+ITKMGL       VV+GT +V+P+DDLF
Sbjct  269   IFFNANGFYNYFWLPFIPLVMLLLVGTKLQVVITKMGLESHGEAPVVRGTFIVKPSDDLF  328

Query  1329  WFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRISMGLLIQVLC  1508
             WF RP+L+L+LI F+LFQNAFQ+AFFAW WY+FGL+SCFH  TED+VIRI MG+L+QV C
Sbjct  329   WFKRPQLLLHLIQFILFQNAFQMAFFAWTWYKFGLRSCFHRTTEDIVIRIVMGVLVQVYC  388

Query  1509  SYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGS-VTPLSSRPG  1685
              Y TLPLYALVTQMGS+MK ++F ERV   LK+WH +A++ L     + S V      P 
Sbjct  389   GYATLPLYALVTQMGSSMKKSVFTERVIDGLKNWHHSAKRSLATSSKTNSTVASPDPSPS  448

Query  1686  TPLHGT----SPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQP  1829
               LH +      +  ++ Y    ++       +I +      ++ D NV+ P
Sbjct  449   RTLHTSLSDGQEVETVELYHPSPNADAGHLGVEIRE------EKFDINVNDP  494



>ref|XP_002465934.1| hypothetical protein SORBIDRAFT_01g048500 [Sorghum bicolor]
 gb|EER92932.1| hypothetical protein SORBIDRAFT_01g048500 [Sorghum bicolor]
Length=563

 Score =   469 bits (1208),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 285/577 (49%), Positives = 370/577 (64%), Gaps = 34/577 (6%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGR L  TPTWAVA VC V+V +S+ +E+ +H +G     R KKA+ EALEKIKA
Sbjct  1     MAGGGGGRDLPSTPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHTRQKKAMREALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELML+GFISLLL VGQ+ I KICI    GN   PC   +++D   G              
Sbjct  61    ELMLMGFISLLLAVGQTPISKICIPTKAGNIMLPCKAQKDDDSESGGDARRRLLWY----  116

Query  591   lllAFADDEYSGES---HRRILAGGGT--DKCAKEGMVPFISADGIHQLHIFIFVLALFH  755
                      YSGE    HRR LAG     D C K+G V  IS +G+HQLHIFIFVLA+FH
Sbjct  117   -------SPYSGEEYGHHRRFLAGAAATDDYCDKQGKVSLISTNGVHQLHIFIFVLAVFH  169

Query  756   VLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPF  935
             + Y + T+A GRLKMRKWK WE ET ++EYQF +DP RFRF   TSF +RHL   S +P 
Sbjct  170   ISYSVATMALGRLKMRKWKKWELETNSVEYQFANDPSRFRFTHQTSFVKRHLGL-SSTPG  228

Query  936   LLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGI  1115
             + WIV FFRQF  SV KVDY+T+R GFI  HL+P ++  F+FQQYIKRSLE+DFKVVVGI
Sbjct  229   VRWIVGFFRQFFASVTKVDYLTMRQGFINYHLSPNAK--FNFQQYIKRSLEDDFKVVVGI  286

Query  1116  SPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKG  1295
             S P+W  A+  LL +  G  + +W+ F+PLVI+LLVGTKL+V+I +M   IQ++  V+KG
Sbjct  287   SLPLWFVAIFILLLDIEGLGTLIWISFVPLVILLLVGTKLEVVIMEMANEIQDKATVIKG  346

Query  1296  TPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIR  1475
              P V+P+D  FWFNRPR +L+LIH  LFQNAFQ+A F W      LK C+HE+    +++
Sbjct  347   APAVEPSDRFFWFNRPRWVLFLIHLTLFQNAFQMAHFVWTLLTPDLKKCYHEQMGLTIMK  406

Query  1476  ISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSG  1655
             + +G+ +QVLCSY+T PLYALVTQMGS+MK TIF E+ AKA+  W +TA+  ++Q+   G
Sbjct  407   VVVGVALQVLCSYITFPLYALVTQMGSHMKKTIFEEQTAKAVMKWRKTAKDNVKQREAKG  466

Query  1656  --------SVTPLSSRPGTPLHGTSPIHLLQYYKS---EIDSVGASPAR----DIEDNLP  1790
                       TP  SR  +P  G SP+HLL  YK    E  S   SP R    ++ D  P
Sbjct  467   YLDGLMSADTTPSHSRATSPSRGNSPVHLLHKYKGRSEEPQSAPTSPGRGRGQELGDMYP  526

Query  1791  WFNQRRDNNVDQPAEENRNELQREIEMESAEFSFENK  1901
               + +R + +D   +   +    +I++  A+FSF  +
Sbjct  527   VADHQRLHRLDPERKRAASSTAIDIDIADADFSFSTR  563



>emb|CDP06355.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   469 bits (1206),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 272/562 (48%), Positives = 357/562 (64%), Gaps = 47/562 (8%)
 Frame = +3

Query  231   MAGGGGG--RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKI  404
             MAGGGGG  R L++TPTWAVA VC V++ ISI +E ++H IG  L  R+KKALYEALEK+
Sbjct  1     MAGGGGGSSRQLDQTPTWAVAGVCAVIILISIALEKLLHKIGTWLTDRHKKALYEALEKV  60

Query  405   KAELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrr  584
             K ELM+LGFISLLL   Q  I +IC+   + +S  PC                      R
Sbjct  61    KNELMILGFISLLLVFSQYYITQICVPSGVADSMLPC----------------------R  98

Query  585   rrlllAFADDEYSGE---SHRRILAGGGTDKCAKEGMVPFISADGIHQLHIFIFVLALFH  755
              R  +A  +D +        RR+LA G  +   K+G VP IS DG+HQLHI IF LA+FH
Sbjct  99    ARDKVATKNDGHRRRLIGYERRVLAAGAKEPSCKQGRVPLISVDGLHQLHILIFFLAVFH  158

Query  756   VLYCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPF  935
             V+Y  +T+A GRLK+R WK WE ET +  Y+F++DP RFR   +TSF R H SFW+  P 
Sbjct  159   VIYSAVTMALGRLKIRGWKDWEQETSSHHYEFSNDPTRFRLTHETSFVRAHTSFWTSIPI  218

Query  936   LLWIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGI  1115
               +I CFFRQF  SV K DY+TLR+GFI  HLAP S+  F+FQ+YIKRSLE+DFK VVG+
Sbjct  219   FFYIGCFFRQFFHSVSKSDYLTLRNGFISVHLAPGSK--FNFQKYIKRSLEDDFKTVVGV  276

Query  1116  SPPIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKG  1295
             SP +W   V+FLL N  G ++  W   IP+V+IL VGTKLQ I+T+M + I ER  VV+G
Sbjct  277   SPVLWASFVVFLLLNVSGWKALFWASLIPVVVILAVGTKLQAILTRMAIEITERHAVVQG  336

Query  1296  TPVVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIR  1475
              P+VQ +D  FWF  P L+L+LIHF LFQN+FQ+ +F W WYEFGLKSCFHE  E ++ +
Sbjct  337   IPLVQGSDKYFWFGHPELVLHLIHFALFQNSFQITYFLWIWYEFGLKSCFHENFELVIAK  396

Query  1476  ISMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQK---R  1646
             +++G+ + VLCSY+TLPLYALV QMGS MK +IF+E+ +KALK WH   +K+  +K   R
Sbjct  397   LALGVGVLVLCSYITLPLYALVAQMGSYMKKSIFDEQTSKALKKWHMAVKKKQGRKSPTR  456

Query  1647  HSGSVTPLSSRPGTPLHGTSP-IHLLQ----------YYKSEIDSVGASPARDIEDNLPW  1793
               G  +P +S   T LH T P +H  +          Y   E   +   P+  + + L  
Sbjct  457   RLGDASPTASVAST-LHSTGPALHRFKTTGHSTRSFTYEDQEASDLETDPSTPVTNKLMI  515

Query  1794  ---FNQRRDNNVDQPAEENRNE  1850
                 + R + NV   AEE +N+
Sbjct  516   TVDHDTRNELNVPSDAEEIKND  537



>ref|NP_001048845.1| Os03g0129100 [Oryza sativa Japonica Group]
 dbj|BAA85400.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93786.1| MLO protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10759.1| Os03g0129100 [Oryza sativa Japonica Group]
 dbj|BAG93853.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58266.1| hypothetical protein OsJ_09270 [Oryza sativa Japonica Group]
Length=555

 Score =   465 bits (1197),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 290/571 (51%), Positives = 372/571 (65%), Gaps = 29/571 (5%)
 Frame = +3

Query  231   MAGGGGGRSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKA  410
             MAGGGGGR+L ETPTWAVA VC V+V +S+ +E+ +H +G    KR KKA+ EALEKIKA
Sbjct  1     MAGGGGGRALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALEKIKA  60

Query  411   ELMLLGFISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrr  590
             ELMLLGFISLLLTV Q+ I KICI +S  N   PC   ++  K      D          
Sbjct  61    ELMLLGFISLLLTVAQTPISKICIPESAANIMLPCKAGQDIVKGLKGKKDHRRRLLW---  117

Query  591   lllAFADDEYSGE--SHRRILAGG-GTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVL  761
                      Y+GE  SHRR LAG  G D CA+ G V  +S+ G+HQLHIFIFVLA+FHV 
Sbjct  118   ---------YTGEEESHRRSLAGAAGEDYCAQSGKVALMSSGGMHQLHIFIFVLAVFHVT  168

Query  762   YCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLL  941
             YC+IT+A GRLKM+KWK WE ET +LEYQF +DP RFRF   TSF +RHL   S +P L 
Sbjct  169   YCVITMALGRLKMKKWKKWELETNSLEYQFANDPSRFRFTHQTSFVKRHLGL-SSTPGLR  227

Query  942   WIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISP  1121
             WIV FFRQF  SV KVDY+T+R GFI AHL+  S+  FDF +YIKRSLE+DFKVVVGIS 
Sbjct  228   WIVAFFRQFFGSVTKVDYLTMRQGFINAHLSQNSK--FDFHKYIKRSLEDDFKVVVGISL  285

Query  1122  PIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
             P+W  A++ L  +  G  + +W+ F+PLVI++LVGTKL+++I +M   IQ+R  V+KG P
Sbjct  286   PLWFVAILVLFLDIQGFGTLIWISFVPLVILMLVGTKLEMVIMEMAQEIQDRATVIKGAP  345

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRIS  1481
             VV+P++  FWFNRP  +L+ IH +LFQNAFQ+A F W     GLK CFHE     ++++ 
Sbjct  346   VVEPSNKYFWFNRPDWVLFFIHLILFQNAFQMAHFVWTLATPGLKKCFHENMGLSIMKVV  405

Query  1482  MGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTARKQLRQKRHSGSV  1661
             +G+ IQ LCSY T PLYALVTQMGSNMK TIF E+  KAL +W +TAR++ ++ R +   
Sbjct  406   VGIFIQFLCSYSTFPLYALVTQMGSNMKKTIFEEQTMKALMNWRKTAREK-KKLRDADEF  464

Query  1662  TPLSSRPGTPLHGTSPIHLL--QYYKSE-IDSVGASP-----ARDIEDNLPWFNQRRD--  1811
                 S   TP  G+SP+HLL  Q  +SE   S  ASP     ARD+         R    
Sbjct  465   LAQMSGDTTPSRGSSPVHLLHKQRVRSEDPPSAPASPGFAGEARDMYPVPVAPVVRPHGF  524

Query  1812  NNVDQPAEENRNELQREIEMESAEFSFENKR  1904
             N +D       +    ++++  ++FSF  +R
Sbjct  525   NRMDPDKRRAASSSAIQVDIADSDFSFSVQR  555



>gb|KDO85189.1| hypothetical protein CISIN_1g041242mg [Citrus sinensis]
Length=544

 Score =   465 bits (1196),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 288/562 (51%), Positives = 368/562 (65%), Gaps = 51/562 (9%)
 Frame = +3

Query  252   RSLEETPTWAVAAVCFVLVAISIVIEYVIHLIGKLLQKRNKKALYEALEKIKAELMLLGF  431
             RSL +TPTWAVA VC VL+ +SI+IE+ IH + K  QKR KKA+ EALEKIKAELMLLGF
Sbjct  16    RSLRDTPTWAVALVCAVLLILSILIEHGIHSLSKWFQKRQKKAMSEALEKIKAELMLLGF  75

Query  432   ISLLLTVGQSTILKICISKSLGNSWHPCDRHeeedkyggdtgdgdgdegrrrrlllAFAD  611
             +SLLLTVG   I KICI    GN+  PC                               D
Sbjct  76    LSLLLTVGTRFIYKICIPAEYGNTMLPCK----------------------IENDTGGDD  113

Query  612   DE-------YSGESH-RRILAG--GGTDKCAKEGMVPFISADGIHQLHIFIFVLALFHVL  761
             D+       YSG+   RR+LA   GG D C+++G V  IS  G+HQLHIFIFVLA+FHVL
Sbjct  114   DDHRRKLLLYSGDVMWRRVLAAPAGGDDYCSRKGQVSLISLTGLHQLHIFIFVLAVFHVL  173

Query  762   YCIITLAFGRLKMRKWKAWESETKTLEYQFTHDPERFRFARDTSFGRRHLSFWSRSPFLL  941
             Y +IT+A  + KM+KW+AWE ET +LEYQFT+DP RFRF   TSF +RH S  SR+P + 
Sbjct  174   YSVITIALAKAKMKKWQAWELETNSLEYQFTNDPARFRFTHQTSFVKRH-SGLSRTPGIR  232

Query  942   WIVCFFRQFVRSVPKVDYMTLRHGFIIAHLAPQSQMNFDFQQYIKRSLEEDFKVVVGISP  1121
             WIV FFRQF  SV KVDYMT+RHGFI AH AP +  +FDF +YIKRSLE+DFKVVVGIS 
Sbjct  233   WIVAFFRQFFGSVSKVDYMTMRHGFINAHFAPNT--SFDFHKYIKRSLEDDFKVVVGISI  290

Query  1122  PIWLFAVIFLLFNTHGTRSYlwlpfiplviillvGTKLQVIITKMGLRIQERGEVVKGTP  1301
             P+W+ AVIFLL N      Y W     L IILLVGTKL+++I +M   IQ+R  VV+G P
Sbjct  291   PLWIVAVIFLLVNV-----YKWDSLSWLTIILLVGTKLELVIMEMAQEIQDRTTVVRGAP  345

Query  1302  VVQPADDLFWFNRPRLMLYLIHFVlfqnafqlaffawawYEFGLKSCFHEKTEDLVIRIS  1481
             VV+P +  FWFNRP  +L+LIH+ LFQNAFQ+AFF W  YEFG+ SCFHE    ++ R+ 
Sbjct  346   VVEPNNKFFWFNRPEWILFLIHYTLFQNAFQMAFFLWIVYEFGIHSCFHENLPLILTRVI  405

Query  1482  MGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVAKALKSWHQTA--RKQLRQKRHSG  1655
             +G+ +Q LCSY+T PLYALVTQMGS+MK +IF E+ AKALK W + A  R++ R K  +G
Sbjct  406   VGVALQFLCSYITFPLYALVTQMGSHMKKSIFEEQTAKALKKWQKAAKERRRSRNKAAAG  465

Query  1656  S--VTPLSSRPGTPLHGTSPIHLLQYYKSEIDSVGASPARDIEDNLPWFNQRRDNNVDQP  1829
             +   +   S   TP  G SPIHLL +YK        S  +DIE    + +    + ++  
Sbjct  466   ADKCSGFLSGENTPSQGASPIHLLHHYKYR------SNQQDIESVRSYQSDNELSEIEPS  519

Query  1830  AEENRNELQ-REIEMESAEFSF  1892
             +  + ++ Q R+ ++ +++FSF
Sbjct  520   STHHHHQDQGRDEDLHNSDFSF  541



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6045065740944