BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c115318_g1_i1 len=142 path=[1:0-141]

Length=142
                                                                      Score     E

ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273  62.8    8e-10   
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710  62.0    2e-09   
gb|KDP28318.1|  hypothetical protein JCGZ_14089                       61.6    2e-09   
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg           61.2    2e-09   
ref|XP_002515212.1|  conserved hypothetical protein                   61.2    3e-09   Ricinus communis
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696  60.1    8e-09   
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322  59.7    1e-08   
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112  58.9    2e-08   Vitis vinifera
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg           58.5    2e-08   
ref|XP_010456117.1|  PREDICTED: uncharacterized protein LOC104737601  58.2    2e-08   
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390           58.2    3e-08   
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922  58.2    3e-08   
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446  58.2    3e-08   
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112  58.2    3e-08   
gb|AAM13860.1|  unknown protein                                       57.8    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192096.1|  tolB-related protein                                57.8    4e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                  57.4    5e-08   
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825  57.4    5e-08   
emb|CAN71280.1|  hypothetical protein VITISV_027089                   57.4    6e-08   Vitis vinifera
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg           57.0    7e-08   
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537  57.0    8e-08   
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg           57.0    8e-08   
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                 57.0    1e-07   
ref|XP_007051241.1|  TolB protein-related isoform 2                   56.6    1e-07   
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844  56.2    2e-07   
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949  55.8    2e-07   
ref|XP_007051240.1|  TolB protein-related isoform 1                   55.8    2e-07   
emb|CDP01464.1|  unnamed protein product                              55.8    2e-07   
emb|CDX74396.1|  BnaA03g26510D                                        55.8    2e-07   
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800  55.8    2e-07   
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997  55.5    3e-07   
ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342  55.1    4e-07   
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg              54.7    5e-07   
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                   54.3    7e-07   
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605  54.3    7e-07   
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                   54.3    8e-07   
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                   53.9    8e-07   
ref|XP_010091406.1|  hypothetical protein L484_013861                 53.1    2e-06   
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421  51.6    7e-06   
ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859  51.6    7e-06   
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858  51.2    8e-06   
ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107  51.2    8e-06   
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036  50.8    1e-05   
gb|EPS68684.1|  hypothetical protein M569_06083                       50.4    1e-05   
ref|XP_003637684.1|  Protein tolB                                     49.3    4e-05   
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039  48.9    5e-05   
ref|XP_003637686.1|  Protein tolB                                     48.5    7e-05   
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938  48.1    8e-05   
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g           48.1    1e-04   
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982  47.8    1e-04   
ref|XP_002515210.1|  conserved hypothetical protein                   45.8    5e-04   Ricinus communis



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  PSFDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            P FD+++ +KI+KSDG K W L+ DR AF +AWSPTE  VIFTS+G
Sbjct  421  PDFDANAGIKIVKSDGSKCWNLIKDRAAFYNAWSPTEKHVIFTSLG  466



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F+++S LKIIKSDG K WTL   RTAFC++WSP E  VIFTSIG
Sbjct  405  FNANSGLKIIKSDGSKKWTLFRGRTAFCNSWSPAEPNVIFTSIG  448



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  PSFDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            P F  D  L I+KSDG K WTL+ DRTAF ++WSPTE  VIFTS+G
Sbjct  410  PQFIVDGGLNIVKSDGSKRWTLIKDRTAFYNSWSPTEKHVIFTSLG  455



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F++D+ +KI+KSDG K W L+ DR AF +AWSPTE  VIFTS+G
Sbjct  372  FNADAGIKIVKSDGSKRWNLIKDRAAFYNAWSPTEKHVIFTSLG  415



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  PSF-DSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            P F DS   LK++KS+G K WTL+ DR AFC++WSPTE  VIFTS+G
Sbjct  372  PDFVDSSGGLKVVKSNGSKRWTLIKDRVAFCNSWSPTEKHVIFTSLG  418



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F+++S L+IIKSDG K WTL   RTAFC++WSP E  VIFTS+G
Sbjct  406  FNANSGLEIIKSDGSKKWTLFKGRTAFCNSWSPAEPDVIFTSVG  449



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD++  +K++KSDG K WTL+ +RTAF ++WSPTE  VI+TS+G
Sbjct  358  FDANGGIKVVKSDGSKRWTLIKNRTAFYNSWSPTERHVIYTSLG  401



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F++   LKI+KSDG K WT++ DRTAF ++WSPTE  VI+TS+G
Sbjct  386  FEAKGGLKIVKSDGSKRWTVLKDRTAFYNSWSPTEKHVIYTSVG  429



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +KI KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  358  FDINGGIKIAKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  401



>ref|XP_010456117.1| PREDICTED: uncharacterized protein LOC104737601 [Camelina sativa]
Length=426

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  161  FDINGGIKVAKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  204



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  360  FDINGGIKVAKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  403



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  359  FDINGGIKVAKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  402



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  359  FDINGGIKVAKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  402



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            L+I+KSDG K WTL+ DRT+FC++WSP E  VIFTSIG
Sbjct  373  LEIVKSDGSKKWTLIKDRTSFCNSWSPAEPGVIFTSIG  410



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  365  FDINGGIKVSKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  408



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  360  FDINGGIKVSKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  403



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F  +  +KI+KSDG K WTL+ DRTAF ++WSPTE  VI+TS+G
Sbjct  355  FGINGGIKIVKSDGSKRWTLIKDRTAFYNSWSPTERHVIYTSLG  398



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            L+I+KSDG K WTL+ DRT+FC++WSP E  VI+TSIG
Sbjct  375  LEIVKSDGSKKWTLIKDRTSFCNSWSPAEPHVIYTSIG  412



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F++   LKI+KSDG K WT++ DRTAF ++WSPTE  VI+TS G
Sbjct  386  FEAKGGLKIVKSDGSKRWTVLKDRTAFYNSWSPTEKHVIYTSXG  429



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ KSDG K WTL+ DRTAF ++WSPTE  VI+ S+G
Sbjct  311  FDVNGGIKVAKSDGSKRWTLIKDRTAFYNSWSPTERHVIYASLG  354



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F+ ++ +KI KSDG K WTL+ DRTAF ++WSPTE  VI+TS G
Sbjct  408  FELNAGIKIAKSDGSKRWTLIKDRTAFYNSWSPTEKHVIYTSTG  451



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F+ ++ +KI KSDG K WTL+ DRTAF ++WSPTE  VI+TS G
Sbjct  408  FELNAGIKIAKSDGSKRWTLIKDRTAFYNSWSPTEKHVIYTSTG  451



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F+ ++ +KI KSDG K WTL+ DRTAF ++WSPTE  VI+TS G
Sbjct  350  FELNAGIKIAKSDGSKRWTLIKDRTAFYNSWSPTEKHVIYTSTG  393



>ref|XP_007051241.1| TolB protein-related isoform 2, partial [Theobroma cacao]
 gb|EOX95398.1| TolB protein-related isoform 2, partial [Theobroma cacao]
Length=481

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  PSFDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            P+ D    +K++KS+G K WTL+  RTAF ++WSPTE  VI+TS+G
Sbjct  410  PTLDESGGIKVVKSNGSKRWTLIKGRTAFYNSWSPTEKHVIYTSLG  455



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
             D +S +K+IKSDG K W L+  R AF +AWSPTE  VI+TS+G
Sbjct  426  LDENSGIKVIKSDGSKRWNLIKGRAAFYNAWSPTEKHVIYTSVG  469



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
             D D  +K+IKSDG K W L+  R AF +AWSPTE  VI+TS+G
Sbjct  372  LDGDXGIKVIKSDGSKRWNLIKGRAAFYNAWSPTEKHVIYTSVG  415



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  PSFDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            P+ D    +K++KS+G K WTL+  RTAF ++WSPTE  VI+TS+G
Sbjct  410  PTLDESGGIKVVKSNGSKRWTLIKGRTAFYNSWSPTEKHVIYTSLG  455



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  PSFDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            P F+++S LK+IKSDG K W L  +R  F  +WSP E  VIFTSIG
Sbjct  421  PDFEANSGLKVIKSDGSKRWVLFRNRVTFYLSWSPVEKNVIFTSIG  466



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ +SDG K WTL+ DRTAF ++WSPTE  VI+ S+G
Sbjct  357  FDINGGIKVARSDGSKRWTLIKDRTAFYNSWSPTERHVIYASLG  400



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  +K+ +SDG K WTL+ DRTAF ++WSPTE  VI+ S+G
Sbjct  357  FDINGGIKVARSDGSKRWTLIKDRTAFYNSWSPTERHVIYASLG  400



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD +  L+I+++DG   WTL  DRTAF +AWSP +  VIFTSIG
Sbjct  364  FDLNPGLRIVRADGSNRWTLFEDRTAFYNAWSPADENVIFTSIG  407



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F+++S LKI+KSDG K WTL   RT F ++WSP E  VIFTS+G
Sbjct  372  FNANSGLKIVKSDGSKRWTLFKGRTTFGNSWSPAEPNVIFTSVG  415



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD  + LKI+KSDG K WTL  +RT F ++WSP +  VIFTSIG
Sbjct  364  FDLKAGLKIVKSDGSKRWTLFENRTTFYNSWSPADKNVIFTSIG  407



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            +KI++SDG + WT++ DRTAF ++WSPTE  VI+TSIG
Sbjct  373  VKIVRSDGSRRWTVIKDRTAFYNSWSPTEKNVIYTSIG  410



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            +KI++SDG + WT++ DRTAF ++WSPTE  VI+TSIG
Sbjct  417  VKIVRSDGSRRWTVIKDRTAFYNSWSPTEKNVIYTSIG  454



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            +KI++SDG   WTL+ DRTAF ++WSPTE  VI+TSIG
Sbjct  363  VKIVRSDGSSRWTLIKDRTAFYNSWSPTEKNVIYTSIG  400



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            +KII+SDG + WTL+ DR AF ++WSPTE  VI+TSIG
Sbjct  364  VKIIRSDGSRRWTLIKDRIAFYNSWSPTEKNVIYTSIG  401



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            L I+KSDG K WTL+  RTAF ++WSPTE  VI+TSIG
Sbjct  367  LSIVKSDGSKRWTLIRGRTAFHNSWSPTEKHVIYTSIG  404



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F +   L +I+SDG K WTL+ + +AF  AWSPTEN VIFTSIG
Sbjct  362  FLTSPGLMVIRSDGFKRWTLLKEPSAFYTAWSPTENGVIFTSIG  405



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            F++ S LKI+KSDG K WTL   RT F ++WSP E  VI TS+G
Sbjct  409  FNAYSGLKIVKSDGSKRWTLFKGRTTFGNSWSPAEPNVILTSVG  452



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            L+I+K DG K  T++ DRTAFC++WSPTE  VI+TS+G
Sbjct  361  LQIVKFDGSKCRTVLKDRTAFCNSWSPTEKNVIYTSLG  398



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  FDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            FD+++ +KI++SDG + W+++ DRTAF  +W+ TE  VI++S+G
Sbjct  422  FDANAGIKIVRSDGSRRWSILKDRTAFYTSWNRTEKNVIYSSVG  465



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            +KI+KS+G K WTL+  RT F +AWSPTE  VI+TS+G
Sbjct  419  VKIVKSNGSKRWTLLKGRTCFHNAWSPTEKNVIYTSVG  456



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            L I++SDG K WTL+ +R  F ++WSPT+N VIFT+IG
Sbjct  363  LHIVRSDGSKRWTLLKNRVIFGNSWSPTDNNVIFTTIG  400



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  SDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            ++S +KIIKS+G K W L+  R  F HAWS TE  +I+T+IG
Sbjct  363  NNSGVKIIKSNGSKRWNLIKGRMCFGHAWSATEKNIIYTTIG  404



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            L ++KSDG K WTL+ +  AF  AWSPTE  VI+TSIG
Sbjct  368  LMVLKSDGSKRWTLLKESAAFYTAWSPTEKGVIYTSIG  405



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            +KII+S+G K W+L+  RT F ++WSPTE  VI+TSIG
Sbjct  365  VKIIRSNGSKRWSLLKGRTCFGNSWSPTEKNVIYTSIG  402



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            L ++KSDG K WTL+ +  AF  AWSPTE  VI+TSIG
Sbjct  368  LMVLKSDGSKRWTLLKESGAFYTAWSPTEKGVIYTSIG  405



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = -3

Query  137  SFDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            + ++   +K+++S+G + WTL+  RT F +AWSPTEN VI+TSIG
Sbjct  398  TLEATGGVKVVRSNGSQRWTLLKGRTCFHNAWSPTEN-VIYTSIG  441



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -3

Query  140  PSFDSDSCLKIIKSDGPKGWTLVGDRTAFCHAWSPTENIVIFTSIG  3
            P+F+    L+I+K DG K  T++ DRTAF ++WSPTE  VI+TS+G
Sbjct  356  PNFNG---LQIVKFDGSKCRTVLKDRTAFYNSWSPTEKNVIYTSLG  398



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = -3

Query  116  LKIIKSDGPKGWTLVG-DRTAFCHAWSPTENIVIFTSIG  3
            L I++S+G K WTL   DRTAF  +WSPTE  VI+T++G
Sbjct  308  LHIVRSNGSKRWTLFSRDRTAFYTSWSPTEKNVIYTTLG  346



Lambda      K        H        a         alpha
   0.315    0.134    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507653521284