BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c115277_g1_i1 len=176 path=[154:0-175]

Length=176
                                                                      Score     E

gb|KHG16221.1|  hypothetical protein F383_07564                         105   9e-26   
ref|XP_006353851.1|  PREDICTED: pentatricopeptide repeat-containi...    104   1e-25   
ref|XP_009624549.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-25   
ref|XP_009796553.1|  PREDICTED: pentatricopeptide repeat-containi...    103   3e-25   
ref|XP_010325002.1|  PREDICTED: pentatricopeptide repeat-containi...    103   3e-25   
ref|XP_008227275.1|  PREDICTED: pentatricopeptide repeat-containi...    102   7e-25   
emb|CAN68786.1|  hypothetical protein VITISV_024068                     101   9e-25   Vitis vinifera
ref|XP_002280518.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-24   Vitis vinifera
ref|XP_007213347.1|  hypothetical protein PRUPE_ppa1027127mg            102   1e-24   
ref|XP_010045065.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-24   
ref|XP_010045074.1|  PREDICTED: pentatricopeptide repeat-containi...    101   2e-24   
ref|XP_010045066.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-24   
ref|XP_009350241.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    5e-24   
ref|XP_007015264.1|  Pentatricopeptide repeat superfamily protein       100   6e-24   
ref|XP_009350240.1|  PREDICTED: pentatricopeptide repeat-containi...    100   8e-24   
ref|XP_010089196.1|  hypothetical protein L484_002561                 97.8    1e-23   
ref|XP_010099796.1|  hypothetical protein L484_004371                 98.2    1e-23   
gb|AES71614.2|  PPR containing plant-like protein                     98.6    2e-23   
ref|XP_003589614.1|  Pentatricopeptide repeat-containing protein      98.6    2e-23   
ref|XP_008776281.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    2e-23   
ref|XP_004498305.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    3e-23   
emb|CDP21164.1|  unnamed protein product                              95.1    3e-23   
ref|XP_003601363.1|  Pentatricopeptide repeat-containing protein      98.6    4e-23   
ref|XP_004498306.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    5e-23   
ref|XP_003530344.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    6e-23   
ref|XP_003552899.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    6e-23   
gb|KHN18618.1|  Pentatricopeptide repeat-containing protein           97.1    6e-23   
emb|CDP08531.1|  unnamed protein product                              97.4    6e-23   
ref|XP_008365027.1|  PREDICTED: pentatricopeptide repeat-containi...  95.1    6e-23   
gb|KHN30124.1|  Pentatricopeptide repeat-containing protein           96.7    8e-23   
ref|XP_007153409.1|  hypothetical protein PHAVU_003G032700g           96.7    9e-23   
ref|XP_010673765.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    1e-22   
ref|XP_010269095.1|  PREDICTED: pentatricopeptide repeat-containi...  96.7    1e-22   
ref|XP_008377537.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    2e-22   
ref|XP_008347469.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    2e-22   
ref|XP_006446306.1|  hypothetical protein CICLE_v10016520mg           95.5    2e-22   
ref|XP_011016161.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    3e-22   
ref|XP_002299976.2|  hypothetical protein POPTR_0001s28180g           95.1    4e-22   Populus trichocarpa [western balsam poplar]
gb|KGN66554.1|  hypothetical protein Csa_1G629110                     92.0    7e-22   
gb|KDO54784.1|  hypothetical protein CISIN_1g0294062mg                92.0    8e-22   
ref|XP_004291779.1|  PREDICTED: pentatricopeptide repeat-containi...  94.4    1e-21   
ref|XP_006353864.1|  PREDICTED: pentatricopeptide repeat-containi...  93.2    1e-21   
ref|XP_006470532.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    1e-21   
ref|XP_008450338.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    1e-21   
ref|XP_004139064.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    2e-21   
ref|XP_002526056.1|  conserved hypothetical protein                   91.3    2e-21   Ricinus communis
gb|KDP43207.1|  hypothetical protein JCGZ_22759                       92.0    2e-21   
ref|XP_004154693.1|  PREDICTED: pentatricopeptide repeat-containi...  92.8    2e-21   
ref|XP_003542050.2|  PREDICTED: pentatricopeptide repeat-containi...  92.0    5e-21   
ref|XP_006595045.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    5e-21   
ref|XP_002888032.1|  hypothetical protein ARALYDRAFT_475108           90.9    6e-21   
ref|XP_010937953.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    7e-21   
ref|XP_006853808.1|  hypothetical protein AMTR_s00056p00222800        90.9    1e-20   
ref|XP_006302719.1|  hypothetical protein CARUB_v10020841mg           90.9    1e-20   
ref|XP_008672311.1|  PREDICTED: uncharacterized protein LOC100217...  91.7    2e-20   
gb|ACN25908.1|  unknown                                               87.8    2e-20   Zea mays [maize]
gb|AAF70836.1|AC003113_3  F2401.8                                     90.5    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28447.1|  unknown                                               89.4    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008672314.1|  PREDICTED: uncharacterized protein LOC100217...  90.9    3e-20   
ref|NP_176425.2|  pentatricopeptide repeat-containing protein         89.4    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008672312.1|  PREDICTED: uncharacterized protein LOC100217...  90.9    3e-20   
ref|XP_008672313.1|  PREDICTED: uncharacterized protein LOC100217...  90.5    4e-20   
gb|ACL53788.1|  unknown                                               89.4    6e-20   Zea mays [maize]
emb|CDX95111.1|  BnaC05g05600D                                        89.0    7e-20   
ref|XP_006379113.1|  hypothetical protein POPTR_0009s07370g           85.1    7e-20   
ref|XP_010519805.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    1e-19   
gb|EYU35946.1|  hypothetical protein MIMGU_mgv1a017987mg              88.6    1e-19   
emb|CDX93605.1|  BnaA06g04430D                                        88.6    1e-19   
ref|XP_009148044.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    1e-19   
gb|EAZ26599.1|  hypothetical protein OsJ_10499                        87.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95454.1|  pentatricopeptide, putative, expressed                87.8    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EPS65226.1|  hypothetical protein M569_09553                       87.8    2e-19   
ref|XP_004985837.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    3e-19   
ref|XP_009412629.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    3e-19   
ref|XP_010430285.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    3e-19   
ref|XP_002458917.1|  hypothetical protein SORBIDRAFT_03g042630        89.7    4e-19   Sorghum bicolor [broomcorn]
ref|XP_006649934.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    4e-19   
ref|XP_010473454.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    6e-19   
ref|XP_006391900.1|  hypothetical protein EUTSA_v10023910mg           85.9    9e-19   
gb|EMS46933.1|  hypothetical protein TRIUR3_15623                     85.1    1e-18   
ref|XP_003558124.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    1e-18   
dbj|BAK01296.1|  predicted protein                                    84.3    3e-18   
ref|XP_010418227.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    4e-18   
ref|XP_011014425.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-15   
gb|EAZ40216.1|  hypothetical protein OsJ_24661                        74.7    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059932.1|  Os07g0549200                                     74.7    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658674.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    1e-14   
ref|XP_003562949.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    2e-14   
ref|XP_011096035.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    2e-14   
ref|NP_001238702.1|  uncharacterized protein LOC100306428             72.4    4e-14   
dbj|BAK03258.1|  predicted protein                                    73.2    4e-14   
gb|EMT03326.1|  hypothetical protein F775_28746                       73.2    4e-14   
gb|KHN21917.1|  Pentatricopeptide repeat-containing protein           72.0    4e-14   
ref|XP_004957960.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    5e-14   
ref|XP_002462989.1|  hypothetical protein SORBIDRAFT_02g035860        72.8    6e-14   Sorghum bicolor [broomcorn]
ref|XP_006591821.1|  PREDICTED: uncharacterized protein LOC100306...  72.4    8e-14   
ref|XP_004507153.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    8e-14   
tpg|DAA41084.1|  TPA: hypothetical protein ZEAMMB73_430161            72.4    8e-14   
ref|XP_003537970.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    1e-13   
ref|XP_002276778.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    1e-13   Vitis vinifera
gb|KEH30195.1|  PPR containing plant-like protein                     71.6    1e-13   
ref|NP_001143431.1|  uncharacterized protein LOC100276080             71.6    1e-13   Zea mays [maize]
ref|XP_010650970.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    1e-13   
ref|XP_008386010.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    1e-13   
emb|CDP11242.1|  unnamed protein product                              71.6    2e-13   
ref|XP_008384905.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    2e-13   
ref|XP_010274028.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    2e-13   
ref|XP_008813168.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    2e-13   
ref|XP_004291520.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    2e-13   
ref|XP_008385091.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    2e-13   
ref|XP_007205757.1|  hypothetical protein PRUPE_ppa010266mg           70.9    3e-13   
ref|XP_006858620.1|  hypothetical protein AMTR_s00066p00023060        70.9    3e-13   
ref|XP_008221843.1|  PREDICTED: pentatricopeptide repeat-containi...  70.9    3e-13   
ref|XP_004145279.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    4e-13   
ref|XP_002517255.1|  conserved hypothetical protein                   70.5    4e-13   Ricinus communis
ref|XP_007132030.1|  hypothetical protein PHAVU_011G060800g           70.1    4e-13   
ref|XP_010106566.1|  hypothetical protein L484_025326                 70.9    5e-13   
ref|XP_011032219.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    5e-13   
ref|XP_009350168.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  69.7    5e-13   
ref|XP_002314145.2|  pentatricopeptide repeat-containing family p...  70.1    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010928561.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    8e-13   
ref|XP_009388869.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    8e-13   
emb|CDY54020.1|  BnaCnng26030D                                        69.3    9e-13   
ref|XP_010515009.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    9e-13   
ref|XP_009149958.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    1e-12   
ref|XP_010426137.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    1e-12   
ref|XP_008457435.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    1e-12   
ref|XP_002875809.1|  pentatricopeptide repeat-containing protein      69.3    1e-12   
ref|XP_006404445.1|  hypothetical protein EUTSA_v10010650mg           69.3    1e-12   
ref|NP_190271.1|  pentatricopeptide repeat-containing protein         68.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291711.1|  hypothetical protein CARUB_v10017876mg           68.9    1e-12   
gb|EPS64983.1|  hypothetical protein M569_09798                       68.6    1e-12   
ref|XP_010507261.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    1e-12   
ref|XP_006424944.1|  hypothetical protein CICLE_v10029104mg           68.9    1e-12   
gb|KHG00145.1|  hypothetical protein F383_18987                       68.6    1e-12   
ref|XP_009350173.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-12   
gb|KFK34007.1|  hypothetical protein AALP_AA5G090100                  68.2    2e-12   
ref|XP_007016286.1|  Pentatricopeptide repeat superfamily protein     68.6    2e-12   
ref|XP_010535440.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    3e-12   
ref|XP_010043480.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    3e-12   
gb|KDP42187.1|  hypothetical protein JCGZ_02917                       68.2    3e-12   
ref|XP_004247885.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    3e-12   
ref|XP_006360926.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    3e-12   
gb|EYU27759.1|  hypothetical protein MIMGU_mgv1a012108mg              67.4    4e-12   
ref|XP_009608579.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    6e-12   
ref|XP_009764479.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    6e-12   
ref|XP_011072170.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    7e-12   
ref|XP_010689026.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    1e-11   
ref|XP_009350174.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    3e-11   
emb|CDY19544.1|  BnaC09g13590D                                        61.6    2e-10   
tpg|DAA63055.1|  TPA: hypothetical protein ZEAMMB73_179106            57.0    6e-09   
ref|XP_002517059.1|  conserved hypothetical protein                   46.2    9e-05   Ricinus communis



>gb|KHG16221.1| hypothetical protein F383_07564 [Gossypium arboreum]
Length=254

 Score =   105 bits (261),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            +IYDEMRRS DPPLSLP+RVILKGL+PY +LREKVKDDFLELFPDMI+YDPPEDLF+D
Sbjct  187  NIYDEMRRSPDPPLSLPFRVILKGLIPYPELREKVKDDFLELFPDMIVYDPPEDLFED  244



>ref|XP_006353851.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006353852.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006353853.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
isoform X3 [Solanum tuberosum]
Length=237

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            HIYDEMRRS DPP+SLPYRV+LKGLLPY +LREKVKDDFLELFPD ++YDPPEDLFD+
Sbjct  171  HIYDEMRRSPDPPMSLPYRVMLKGLLPYPELREKVKDDFLELFPDTVVYDPPEDLFDE  228



>ref|XP_009624549.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Nicotiana tomentosiformis]
Length=246

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            HIYDEMRRS DPP+SLPYRVILKGLLPY +LR KVKDDFLELFPD+++YDPPEDLFD+
Sbjct  179  HIYDEMRRSPDPPMSLPYRVILKGLLPYPELRGKVKDDFLELFPDIVVYDPPEDLFDE  236



>ref|XP_009796553.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Nicotiana sylvestris]
 ref|XP_009796554.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Nicotiana sylvestris]
Length=246

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            HIYDEMRRS DPP+SLPYRVILKGLL Y +LREKVKDDFLELFPD+++YDPPEDLFD+
Sbjct  179  HIYDEMRRSPDPPMSLPYRVILKGLLTYPELREKVKDDFLELFPDIVVYDPPEDLFDE  236



>ref|XP_010325002.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Solanum lycopersicum]
Length=238

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IYDEMRRS DPP+SLPYRV+LKGLLPY +LREKVKDDFLELFPD ++YDPPEDLFDD
Sbjct  171  QIYDEMRRSPDPPMSLPYRVMLKGLLPYPELREKVKDDFLELFPDAVVYDPPEDLFDD  228



>ref|XP_008227275.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Prunus mume]
Length=264

 Score =   102 bits (255),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IYDEMR+S DPP+SLP+RVILKGLLPY +LREKVKDDFLELFPDMIIYDPPEDLF+D
Sbjct  197  EIYDEMRQSPDPPISLPFRVILKGLLPYPELREKVKDDFLELFPDMIIYDPPEDLFED  254



>emb|CAN68786.1| hypothetical protein VITISV_024068 [Vitis vinifera]
 emb|CBI24252.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   101 bits (251),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMRRS DPPLSLPYRVILKGLLPY +LREKVKDDFLELFP MI+YDPPEDLF+D
Sbjct  128  IYEEMRRSPDPPLSLPYRVILKGLLPYPELREKVKDDFLELFPGMIVYDPPEDLFED  184



>ref|XP_002280518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Vitis vinifera]
Length=248

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMRRS DPPLSLPYRVILKGLLPY +LREKVKDDFLELFP MI+YDPPEDLF+D
Sbjct  182  IYEEMRRSPDPPLSLPYRVILKGLLPYPELREKVKDDFLELFPGMIVYDPPEDLFED  238



>ref|XP_007213347.1| hypothetical protein PRUPE_ppa1027127mg [Prunus persica]
 gb|EMJ14546.1| hypothetical protein PRUPE_ppa1027127mg [Prunus persica]
Length=264

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IYDEMR+S DPP+SLP+RVILKGLLPY +LREKVKDDFLELFPDMIIYDPPEDLF+D
Sbjct  197  EIYDEMRQSPDPPISLPFRVILKGLLPYPELREKVKDDFLELFPDMIIYDPPEDLFED  254



>ref|XP_010045065.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X1 [Eucalyptus grandis]
Length=288

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYDEMRRS DPPLSLP+RVILKGL+PY +LRE+VKDDFLELFP MI+YDPPEDLF+D
Sbjct  222  IYDEMRRSPDPPLSLPFRVILKGLIPYPELRERVKDDFLELFPGMIVYDPPEDLFED  278



>ref|XP_010045074.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X3 [Eucalyptus grandis]
 ref|XP_010045075.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X3 [Eucalyptus grandis]
Length=249

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYDEMRRS DPPLSLP+RVILKGL+PY +LRE+VKDDFLELFP MI+YDPPEDLF+D
Sbjct  183  IYDEMRRSPDPPLSLPFRVILKGLIPYPELRERVKDDFLELFPGMIVYDPPEDLFED  239



>ref|XP_010045066.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Eucalyptus grandis]
 ref|XP_010045067.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Eucalyptus grandis]
 ref|XP_010045068.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Eucalyptus grandis]
 ref|XP_010045069.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Eucalyptus grandis]
 ref|XP_010045070.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Eucalyptus grandis]
 ref|XP_010045072.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Eucalyptus grandis]
 ref|XP_010045073.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Eucalyptus grandis]
 gb|KCW87226.1| hypothetical protein EUGRSUZ_B03737 [Eucalyptus grandis]
Length=259

 Score =   100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYDEMRRS DPPLSLP+RVILKGL+PY +LRE+VKDDFLELFP MI+YDPPEDLF+D
Sbjct  193  IYDEMRRSPDPPLSLPFRVILKGLIPYPELRERVKDDFLELFPGMIVYDPPEDLFED  249



>ref|XP_009350241.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X2 [Pyrus x bretschneideri]
Length=195

 Score = 99.4 bits (246),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY EMR+S DPP+SLP+RVILKGLLPY +LREKVKDDFLELFPDMI+YDPPEDLF+D
Sbjct  127  EIYGEMRQSPDPPISLPFRVILKGLLPYPELREKVKDDFLELFPDMIVYDPPEDLFED  184



>ref|XP_007015264.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOY32883.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=248

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMRRS D PLSLP+RVILKGLLPY +LREKVKDDFLELFPDMI+YDPPEDLF D
Sbjct  182  IYEEMRRSPDSPLSLPFRVILKGLLPYPELREKVKDDFLELFPDMIVYDPPEDLFGD  238



>ref|XP_009350240.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
isoform X1 [Pyrus x bretschneideri]
Length=279

 Score =   100 bits (248),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY EMR+S DPP+SLP+RVILKGLLPY +LREKVKDDFLELFPDMI+YDPPEDLF+D
Sbjct  211  EIYGEMRQSPDPPISLPFRVILKGLLPYPELREKVKDDFLELFPDMIVYDPPEDLFED  268



>ref|XP_010089196.1| hypothetical protein L484_002561 [Morus notabilis]
 gb|EXB37462.1| hypothetical protein L484_002561 [Morus notabilis]
Length=164

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYDEMR+S DPP+SLP+RVILKGL+PY +LREKVKDDFLELFP MI+YDPPEDLF+D
Sbjct  98   IYDEMRQSPDPPISLPFRVILKGLIPYPELREKVKDDFLELFPGMIVYDPPEDLFED  154



>ref|XP_010099796.1| hypothetical protein L484_004371 [Morus notabilis]
 gb|EXB80464.1| hypothetical protein L484_004371 [Morus notabilis]
Length=191

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYDEMR+S DPP+SLP+RVILKGL+PY +LREKVKDDFLELFP MI+YDPPEDLF+D
Sbjct  125  IYDEMRQSPDPPISLPFRVILKGLIPYPELREKVKDDFLELFPGMIVYDPPEDLFED  181



>gb|AES71614.2| PPR containing plant-like protein [Medicago truncatula]
Length=236

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREK+KDDFLE+FPDMIIYDPPEDLFDD
Sbjct  167  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKIKDDFLEVFPDMIIYDPPEDLFDD  223



>ref|XP_003589614.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES59865.1| PPR containing plant-like protein [Medicago truncatula]
Length=232

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREK+KDDFLE+FPDMIIYDPPEDLFDD
Sbjct  163  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKIKDDFLEVFPDMIIYDPPEDLFDD  219



>ref|XP_008776281.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Phoenix dactylifera]
Length=187

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYD+MR S DPPLSLP+RVILKGL+PY +LREKVK DFLELFPDMI+YDPPEDLFD+
Sbjct  129  IYDDMRSSPDPPLSLPFRVILKGLIPYPELREKVKQDFLELFPDMIVYDPPEDLFDE  185



>ref|XP_004498305.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
isoform X1 [Cicer arietinum]
Length=238

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY+EMR+S +PPLSLP+RVI+KGL+PY +LREK+KDDFLE+FPDMIIYDPPEDLF+D
Sbjct  168  EIYEEMRQSPEPPLSLPFRVIMKGLIPYPELREKIKDDFLEIFPDMIIYDPPEDLFED  225



>emb|CDP21164.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 95.1 bits (235),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR S DP LSLPYRVILKGLLPY +LREK+KDDFLELFP+MI+YDPPEDLFDD
Sbjct  58   IYEEMRLSPDPLLSLPYRVILKGLLPYPELREKIKDDFLELFPNMIVYDPPEDLFDD  114



>ref|XP_003601363.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=291

 Score = 98.6 bits (244),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREK+KDDFLE+FPDMIIYDPPEDLFDD
Sbjct  222  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKIKDDFLEVFPDMIIYDPPEDLFDD  278



>ref|XP_004498306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
isoform X2 [Cicer arietinum]
Length=176

 Score = 96.3 bits (238),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY+EMR+S +PPLSLP+RVI+KGL+PY +LREK+KDDFLE+FPDMIIYDPPEDLF+D
Sbjct  106  EIYEEMRQSPEPPLSLPFRVIMKGLIPYPELREKIKDDFLEIFPDMIIYDPPEDLFED  163



>ref|XP_003530344.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Glycine max]
Length=232

 Score = 97.1 bits (240),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREKVKDDFLE+FP MIIYDPPEDLF+D
Sbjct  167  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKVKDDFLEIFPGMIIYDPPEDLFED  223



>ref|XP_003552899.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Glycine max]
Length=234

 Score = 97.1 bits (240),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREKVKDDFLE+FP MIIYDPPEDLF+D
Sbjct  165  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKVKDDFLEIFPGMIIYDPPEDLFED  221



>gb|KHN18618.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=219

 Score = 97.1 bits (240),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREKVKDDFLE+FP MIIYDPPEDLF+D
Sbjct  154  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKVKDDFLEIFPGMIIYDPPEDLFED  210



>emb|CDP08531.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 97.4 bits (241),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR S DP LSLPYRVILKGLLPY +LREK+KDDFLELFP+MI+YDPPEDLFDD
Sbjct  183  IYEEMRLSPDPLLSLPYRVILKGLLPYPELREKIKDDFLELFPNMIVYDPPEDLFDD  239



>ref|XP_008365027.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Malus domestica]
Length=145

 Score = 95.1 bits (235),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY EMR+S DPP+SLP+RVILKGLLPY +LREKVKDDFLELFPDMI+YDPPEDL +D
Sbjct  77   EIYGEMRQSPDPPISLPFRVILKGLLPYPELREKVKDDFLELFPDMIVYDPPEDLXED  134



>gb|KHN30124.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=230

 Score = 96.7 bits (239),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREK+KDDFLE+FP MIIYDPPEDLF+D
Sbjct  165  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKIKDDFLEIFPGMIIYDPPEDLFED  221



>ref|XP_007153409.1| hypothetical protein PHAVU_003G032700g [Phaseolus vulgaris]
 gb|ESW25403.1| hypothetical protein PHAVU_003G032700g [Phaseolus vulgaris]
Length=224

 Score = 96.7 bits (239),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY+EMR+S +PPLSLP+RVILKGL+PY +LREKVK +FLE+FPDMIIYDPPEDLF+D
Sbjct  166  EIYEEMRQSPEPPLSLPFRVILKGLIPYPELREKVKHEFLEIFPDMIIYDPPEDLFED  223



>ref|XP_010673765.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Beta vulgaris subsp. vulgaris]
Length=266

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IYDEMR+S DPPLSLP+RVILKGL+PY +LREK+KDDFLELFP   +YDPPEDLFDD
Sbjct  201  EIYDEMRQSPDPPLSLPFRVILKGLIPYPELREKIKDDFLELFPGFSVYDPPEDLFDD  258



>ref|XP_010269095.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Nelumbo nucifera]
Length=263

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y+EMR+S DPP+SLPYRVILKGL+PY +LRE+VK+DFL+LFPDMI+YDPPEDLFD+
Sbjct  197  ELYEEMRQSPDPPISLPYRVILKGLIPYPELRERVKEDFLDLFPDMIVYDPPEDLFDN  254



>ref|XP_008377537.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Malus domestica]
Length=145

 Score = 94.0 bits (232),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY EMR+S DPP+SLP+RVILKGL PY +LREKVKDDFLELFPDMI+YDPPEDL +D
Sbjct  77   EIYGEMRQSPDPPISLPFRVILKGLXPYXELREKVKDDFLELFPDMIVYDPPEDLXED  134



>ref|XP_008347469.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Malus domestica]
Length=145

 Score = 94.0 bits (232),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY EM +S DPP+SLP+RVILKGL PY +LREKVKDDFLELFPDMI+YDPPEDLF+D
Sbjct  77   EIYGEMXQSPDPPISLPFRVILKGLXPYXELREKVKDDFLELFPDMIVYDPPEDLFED  134



>ref|XP_006446306.1| hypothetical protein CICLE_v10016520mg [Citrus clementina]
 gb|ESR59546.1| hypothetical protein CICLE_v10016520mg [Citrus clementina]
Length=234

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY EMR S DPP+SLP+RVILKGL+PY + REKVKDDFL+LFPDMI+YDPPEDLF+D
Sbjct  168  IYHEMRSSPDPPISLPFRVILKGLIPYPEFREKVKDDFLKLFPDMIVYDPPEDLFED  224



>ref|XP_011016161.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Populus euphratica]
Length=246

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S DPP+SLP+RVILKGL+P+ +LRE+VKDDFLELFPDMI+YDP EDLF+D
Sbjct  180  IYEEMRQSPDPPISLPFRVILKGLIPFPELREQVKDDFLELFPDMIVYDPAEDLFED  236



>ref|XP_002299976.2| hypothetical protein POPTR_0001s28180g [Populus trichocarpa]
 gb|EEE84781.2| hypothetical protein POPTR_0001s28180g [Populus trichocarpa]
Length=246

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S DPP+SLP+RVILKGL+P+ +LRE+VKDDFLELFPDMI+YDP EDLF+D
Sbjct  180  IYEEMRQSPDPPISLPFRVILKGLIPFPELREEVKDDFLELFPDMIVYDPAEDLFED  236



>gb|KGN66554.1| hypothetical protein Csa_1G629110 [Cucumis sativus]
Length=124

 Score = 92.0 bits (227),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY EMR S D PLSLP+RVILKGL+PY +LRE+VKDDFLELFPDMI+YDPPEDLF++
Sbjct  58   IYREMRESPDRPLSLPFRVILKGLIPYPELREQVKDDFLELFPDMIVYDPPEDLFEE  114



>gb|KDO54784.1| hypothetical protein CISIN_1g0294062mg, partial [Citrus sinensis]
Length=138

 Score = 92.0 bits (227),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR S   P+SLP+RVILKGL+PY + REKVKDDFLELFPDMI+YDPPEDLF+D
Sbjct  72   IYNEMRSSPATPISLPFRVILKGLIPYPEFREKVKDDFLELFPDMIVYDPPEDLFED  128



>ref|XP_004291779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Fragaria vesca subsp. vesca]
Length=262

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYDEMR+S + P+SL +RVILKGLLPY +LREKVK DF+ELFPDMI+YDPPEDLF+D
Sbjct  195  IYDEMRKSPESPISLAFRVILKGLLPYPELREKVKADFVELFPDMIVYDPPEDLFED  251



>ref|XP_006353864.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Solanum tuberosum]
Length=203

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            HIYDEMR S DPP+SL YRV+LKGLLPY +LREKVKDDFLEL PD ++YDP EDLFD+
Sbjct  136  HIYDEMRHSPDPPMSLRYRVMLKGLLPYPELREKVKDDFLELLPDTVVYDPLEDLFDE  193



>ref|XP_006470532.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Citrus sinensis]
Length=234

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR S   P+SLP+RVILKGL+PY + REKVKDDFLELFPDMI+YDPPEDLF+D
Sbjct  168  IYNEMRSSPATPISLPFRVILKGLIPYPEFREKVKDDFLELFPDMIVYDPPEDLFED  224



>ref|XP_008450338.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Cucumis melo]
Length=256

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY EMR S D PLSLP+RVILKGL+PY +LRE+VKDDFLELFPDMI+YDPPEDLF++
Sbjct  190  IYREMRESPDRPLSLPFRVILKGLIPYPELREQVKDDFLELFPDMIVYDPPEDLFEE  246



>ref|XP_004139064.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Cucumis sativus]
Length=256

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY EMR S D PLSLP+RVILKGL+PY +LRE+VKDDFLELFPDMI+YDPPEDLF++
Sbjct  190  IYREMRESPDRPLSLPFRVILKGLIPYPELREQVKDDFLELFPDMIVYDPPEDLFEE  246



>ref|XP_002526056.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36333.1| conserved hypothetical protein [Ricinus communis]
Length=138

 Score = 91.3 bits (225),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S + PLSLP+RVILKGLLPY DLREKVKDDFLELFP+M +YDP EDLF+D
Sbjct  74   IYEEMRQSPEIPLSLPFRVILKGLLPYPDLREKVKDDFLELFPNMTVYDPAEDLFED  130



>gb|KDP43207.1| hypothetical protein JCGZ_22759 [Jatropha curcas]
Length=192

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            Y+EMR+S D PLSLP+RVILKGL+PY DLRE+VKDDFLELFP+MI+YDP EDLF+D
Sbjct  129  YEEMRKSPDLPLSLPFRVILKGLIPYPDLREQVKDDFLELFPNMIVYDPAEDLFED  184



>ref|XP_004154693.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Cucumis sativus]
Length=241

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY EMR S D PLSLP+RVILKGL+PY +LRE+VKDDFLELFPDMI+YDPPEDLF++
Sbjct  175  IYREMRESPDRPLSLPFRVILKGLIPYPELREQVKDDFLELFPDMIVYDPPEDLFEE  231



>ref|XP_003542050.2| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
isoform X1 [Glycine max]
Length=233

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVK-DDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREK+K DDFLE+FP MIIYDPPEDLF+D
Sbjct  167  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKIKDDDFLEIFPGMIIYDPPEDLFED  224



>ref|XP_006595045.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
isoform X2 [Glycine max]
Length=194

 Score = 91.3 bits (225),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVK-DDFLELFPDMIIYDPPEDLFDD  1
            IY+EMR+S +PPLSLP+RVILKGL+PY +LREK+K DDFLE+FP MIIYDPPEDLF+D
Sbjct  128  IYEEMRQSPEPPLSLPFRVILKGLIPYPELREKIKDDDFLEIFPGMIIYDPPEDLFED  185



>ref|XP_002888032.1| hypothetical protein ARALYDRAFT_475108 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64291.1| hypothetical protein ARALYDRAFT_475108 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score = 90.9 bits (224),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S DPPLSLP+RVILKGL+PY +LREKVKDDFLELFP MI+YDPPEDL ++
Sbjct  127  RLYGEMRDSPDPPLSLPFRVILKGLVPYPELREKVKDDFLELFPGMIVYDPPEDLCEE  184



>ref|XP_010937953.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Elaeis guineensis]
 ref|XP_010937954.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Elaeis guineensis]
Length=255

 Score = 92.0 bits (227),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYD+MR S D PLSLP+RV+LKGL+PY +LREKVK DFLELFPDMI+YDPPED+FD+
Sbjct  197  IYDDMRGSPDLPLSLPFRVMLKGLIPYPELREKVKQDFLELFPDMIVYDPPEDVFDE  253



>ref|XP_006853808.1| hypothetical protein AMTR_s00056p00222800 [Amborella trichopoda]
 gb|ERN15275.1| hypothetical protein AMTR_s00056p00222800 [Amborella trichopoda]
Length=240

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            Y+EMR+S DPPLSLP+RVILKGLLPY +LRE+VK+DFLELFP MI+YDPP DL D 
Sbjct  184  YEEMRQSPDPPLSLPFRVILKGLLPYPELRERVKEDFLELFPGMIVYDPPLDLLDQ  239



>ref|XP_006302719.1| hypothetical protein CARUB_v10020841mg [Capsella rubella]
 ref|XP_006302720.1| hypothetical protein CARUB_v10020841mg [Capsella rubella]
 gb|EOA35617.1| hypothetical protein CARUB_v10020841mg [Capsella rubella]
 gb|EOA35618.1| hypothetical protein CARUB_v10020841mg [Capsella rubella]
Length=252

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S DPPLSLP+RVILKGL+PY +LREKVKDDFLELFP MI+YDPPED+ ++
Sbjct  183  RLYGEMRDSPDPPLSLPFRVILKGLVPYPELREKVKDDFLELFPGMIVYDPPEDICEE  240



>ref|XP_008672311.1| PREDICTED: uncharacterized protein LOC100217295 isoform X1 [Zea 
mays]
Length=388

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            IYD+MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  326  IYDDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPDTLSD  381



>gb|ACN25908.1| unknown [Zea mays]
 tpg|DAA56356.1| TPA: hypothetical protein ZEAMMB73_432076 [Zea mays]
 tpg|DAA56357.1| TPA: hypothetical protein ZEAMMB73_432076 [Zea mays]
 tpg|DAA56358.1| TPA: hypothetical protein ZEAMMB73_432076 [Zea mays]
Length=120

 Score = 87.8 bits (216),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
             IYD+MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  57   EIYDDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPDTLSD  113



>gb|AAF70836.1|AC003113_3 F2401.8 [Arabidopsis thaliana]
Length=281

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S D PLSLP+RVILKGL+PY +LREKVKDDFLELFP MI+YDPPED+ +D
Sbjct  212  RLYGEMRESPDRPLSLPFRVILKGLVPYPELREKVKDDFLELFPGMIVYDPPEDICED  269



>gb|ABK28447.1| unknown [Arabidopsis thaliana]
Length=197

 Score = 89.4 bits (220),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S D PLSLP+RVILKGL+PY +LREKVKDDFLELFP MI+YDPPED+ +D
Sbjct  127  RLYGEMRESPDRPLSLPFRVILKGLVPYPELREKVKDDFLELFPGMIVYDPPEDICED  184



>ref|XP_008672314.1| PREDICTED: uncharacterized protein LOC100217295 isoform X4 [Zea 
mays]
Length=354

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            IYD+MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  292  IYDDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPDTLSD  347



>ref|NP_176425.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q1PFH7.1|PPR89_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g62350 
[Arabidopsis thaliana]
 gb|ABE65734.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEE33957.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=196

 Score = 89.4 bits (220),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S D PLSLP+RVILKGL+PY +LREKVKDDFLELFP MI+YDPPED+ +D
Sbjct  127  RLYGEMRESPDRPLSLPFRVILKGLVPYPELREKVKDDFLELFPGMIVYDPPEDICED  184



>ref|XP_008672312.1| PREDICTED: uncharacterized protein LOC100217295 isoform X2 [Zea 
mays]
Length=378

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            IYD+MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  316  IYDDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPDTLSD  371



>ref|XP_008672313.1| PREDICTED: uncharacterized protein LOC100217295 isoform X3 [Zea 
mays]
Length=361

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            IYD+MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  299  IYDDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPDTLSD  354



>gb|ACL53788.1| unknown [Zea mays]
 gb|ACL54143.1| unknown [Zea mays]
 tpg|DAA56354.1| TPA: hypothetical protein ZEAMMB73_432076 [Zea mays]
 tpg|DAA56355.1| TPA: hypothetical protein ZEAMMB73_432076 [Zea mays]
Length=248

 Score = 89.4 bits (220),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            IYD+MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  186  IYDDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPDTLSD  241



>emb|CDX95111.1| BnaC05g05600D [Brassica napus]
Length=248

 Score = 89.0 bits (219),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDL  10
             +Y EMR S DPPLSLP+RVILKGL+PY +LRE+VKDDFLELFP M++YDPPEDL
Sbjct  179  RLYGEMRDSPDPPLSLPFRVILKGLVPYPELRERVKDDFLELFPGMVVYDPPEDL  233



>ref|XP_006379113.1| hypothetical protein POPTR_0009s07370g [Populus trichocarpa]
 gb|ERP56910.1| hypothetical protein POPTR_0009s07370g [Populus trichocarpa]
Length=66

 Score = 85.1 bits (209),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  IYDEMRRS-TDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+EMRRS  +PP+SL +RVILKGL+P+ +LRE+VKDDFLELFPDM +YDP EDLF+D
Sbjct  3    IYEEMRRSPVEPPISLAFRVILKGLIPFPELREQVKDDFLELFPDMTVYDPAEDLFED  60



>ref|XP_010519805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Tarenaya hassleriana]
 ref|XP_010519806.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Tarenaya hassleriana]
Length=249

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IY+EMR S DPPLSLP+RVILKGL+ Y +LREKVK+DFLELFP M +YDPPEDL ++
Sbjct  190  QIYEEMRASPDPPLSLPFRVILKGLISYPELREKVKEDFLELFPGMFVYDPPEDLSEE  247



>gb|EYU35946.1| hypothetical protein MIMGU_mgv1a017987mg [Erythranthe guttata]
Length=243

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPED  13
             IYDEMR S D PLSLP+RV+LKGL+PY + REKVKDDFLELFPDM +YDPPED
Sbjct  176  RIYDEMRSSPDRPLSLPFRVMLKGLIPYPEFREKVKDDFLELFPDMFVYDPPED  229



>emb|CDX93605.1| BnaA06g04430D [Brassica napus]
Length=248

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S DPPLSLP+RV+LKGL+PY +LRE+VKDDFLELFP M++YDPPEDL ++
Sbjct  179  RLYGEMRDSPDPPLSLPFRVMLKGLVPYPELRERVKDDFLELFPGMVVYDPPEDLCEE  236



>ref|XP_009148044.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Brassica rapa]
Length=247

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S DPPLSLP+RV+LKGL+PY +LRE+VKDDFLELFP M++YDPPEDL ++
Sbjct  178  RLYGEMRDSPDPPLSLPFRVMLKGLVPYPELRERVKDDFLELFPGMVVYDPPEDLCEE  235



>gb|EAZ26599.1| hypothetical protein OsJ_10499 [Oryza sativa Japonica Group]
 gb|EEC75051.1| hypothetical protein OsI_11161 [Oryza sativa Indica Group]
Length=195

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            Y++MR S DPPLSLP+RVILKGL+PY DLREK+K DFLELFPDMI+YDPP+ L D
Sbjct  134  YEDMRSSPDPPLSLPFRVILKGLVPYPDLREKIKQDFLELFPDMIVYDPPDSLSD  188



>gb|ABF95454.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG99916.1| unnamed protein product [Oryza sativa Japonica Group]
Length=247

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            Y++MR S DPPLSLP+RVILKGL+PY DLREK+K DFLELFPDMI+YDPP+ L D
Sbjct  186  YEDMRSSPDPPLSLPFRVILKGLVPYPDLREKIKQDFLELFPDMIVYDPPDSLSD  240



>gb|EPS65226.1| hypothetical protein M569_09553 [Genlisea aurea]
Length=247

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  IYDEMRRST-DPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IYDEMR      PLSLPYRVILKGL+PY  LREKVKD+F+ELFPDM++YDPPE+L DD
Sbjct  172  IYDEMRSCCCGVPLSLPYRVILKGLIPYPRLREKVKDEFMELFPDMVVYDPPEELSDD  229



>ref|XP_004985837.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Setaria italica]
Length=250

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +Y++MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP  L D
Sbjct  188  LYEDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPGSLSD  243



>ref|XP_009412629.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Musa acuminata subsp. malaccensis]
Length=249

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             YD+MR S DPPLSLP+RV+LKGL+PY +LREK+K DFL+LFPDMI+YDPP+DL D+
Sbjct  193  FYDDMRSSPDPPLSLPFRVMLKGLIPYPELREKMKQDFLDLFPDMIVYDPPDDLLDE  249



>ref|XP_010430285.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Camelina sativa]
 ref|XP_010430286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Camelina sativa]
 ref|XP_010430287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Camelina sativa]
Length=250

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S D PLSLP+RV+LKGL+PY +LREKVKDDFLELFP M++YDPPED+ +D
Sbjct  181  RLYGEMRDSPDRPLSLPFRVMLKGLVPYPELREKVKDDFLELFPGMVVYDPPEDICED  238



>ref|XP_002458917.1| hypothetical protein SORBIDRAFT_03g042630 [Sorghum bicolor]
 gb|EES04037.1| hypothetical protein SORBIDRAFT_03g042630 [Sorghum bicolor]
Length=523

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            IY++MR S DPPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  461  IYEDMRSSPDPPLSLPFRVILKGLVPYPELREKIKQDFLELFPDMIVYDPPDTLSD  516



>ref|XP_006649934.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like, 
partial [Oryza brachyantha]
Length=219

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            Y++MR S DPPLSLP+RVILKGL+PY DLREK+K DFLELFPDMI+YDPP+ L D
Sbjct  158  YEDMRSSPDPPLSLPFRVILKGLVPYPDLREKIKQDFLELFPDMIVYDPPDCLSD  212



>ref|XP_010473454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Camelina sativa]
 ref|XP_010473455.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Camelina sativa]
Length=250

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S D PLSLP+RV+LKGL+PY +LREKVKDDFLELFP MI+YDPPED+ ++
Sbjct  181  RLYGEMRDSPDRPLSLPFRVMLKGLVPYPELREKVKDDFLELFPGMIVYDPPEDICEE  238



>ref|XP_006391900.1| hypothetical protein EUTSA_v10023910mg, partial [Eutrema salsugineum]
 gb|ESQ29186.1| hypothetical protein EUTSA_v10023910mg, partial [Eutrema salsugineum]
Length=230

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S D PLSLP+RVILKGL+ Y +LREKVK+DFLELFP M++YDPPEDL D+
Sbjct  161  RLYQEMRDSPDRPLSLPFRVILKGLVSYPELREKVKEDFLELFPGMVVYDPPEDLCDE  218



>gb|EMS46933.1| hypothetical protein TRIUR3_15623 [Triticum urartu]
Length=199

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            Y++MR S +PPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  138  YEDMRSSPEPPLSLPFRVILKGLIPYPELREKIKQDFLELFPDMIVYDPPDSLSD  192



>ref|XP_003558124.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Brachypodium distachyon]
Length=248

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            Y++MR S +PPLSLP+RVILKGL+PY +LREK+K DFLELFPDMI+YDPP+ L D
Sbjct  187  YEDMRSSPEPPLSLPFRVILKGLIPYPELREKIKHDFLELFPDMIVYDPPDSLSD  241



>dbj|BAK01296.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  168  YDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            Y++MR S +PPLSLP+RVILKGL+PY +LREK+K +FLELFPDMI+YDPP+ L D
Sbjct  168  YEDMRSSPEPPLSLPFRVILKGLIPYPELREKIKQEFLELFPDMIVYDPPDSLSD  222



>ref|XP_010418227.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Camelina sativa]
 ref|XP_010418228.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Camelina sativa]
Length=250

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             +Y EMR S D PLSLP+RV+LKGL PY +LREKVKDDFLELFP MI+YDPP+D+ ++
Sbjct  181  RLYGEMRDSPDRPLSLPFRVMLKGLAPYPELREKVKDDFLELFPGMIVYDPPKDICEE  238



>ref|XP_011014425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like 
[Populus euphratica]
Length=139

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  IYDEMRRS-TDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            IY+E R+S  DPP+SLP+ VILKG++P+ +LR++VKDDFL+LFP MI+Y+  EDLF++
Sbjct  76   IYEETRQSPADPPISLPFHVILKGMIPFPELRDQVKDDFLKLFPGMIVYNLAEDLFEN  133



>gb|EAZ40216.1| hypothetical protein OsJ_24661 [Oryza sativa Japonica Group]
Length=256

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY+EM++S DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPPE++F 
Sbjct  198  NIYEEMKKSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPEEIFG  254



>ref|NP_001059932.1| Os07g0549200 [Oryza sativa Japonica Group]
 dbj|BAC57728.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF21846.1| Os07g0549200 [Oryza sativa Japonica Group]
 dbj|BAG98696.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82239.1| hypothetical protein OsI_26409 [Oryza sativa Indica Group]
Length=262

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY+EM++S DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPPE++F 
Sbjct  204  NIYEEMKKSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPEEIFG  260



>ref|XP_006658674.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Oryza brachyantha]
Length=265

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY+EM++S DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPPE++F 
Sbjct  207  NIYEEMKKSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPEEIFG  263



>ref|XP_003562949.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Brachypodium distachyon]
Length=246

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+RS DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPPE++F 
Sbjct  188  NIYEDMKRSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPEEIFG  244



>ref|XP_011096035.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Sesamum indicum]
 ref|XP_011096036.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Sesamum indicum]
Length=261

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  +YDPPE++F 
Sbjct  203  NIYEDMKKSPDPPEQLPFRILLKGLLPHPLLRNKVKQDFEEIFPDQRVYDPPEEIFG  259



>ref|NP_001238702.1| uncharacterized protein LOC100306428 [Glycine max]
 gb|ACU14600.1| unknown [Glycine max]
Length=150

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M+ S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  IYDPP+++F
Sbjct  92   NIYEDMKNSPDPPEELPFRILLKGLLPHPLLRNKVKQDFEEIFPDSSIYDPPQEIF  147



>dbj|BAK03258.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+RS DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPP+D+F 
Sbjct  193  NIYEDMKRSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPDDIFG  249



>gb|EMT03326.1| hypothetical protein F775_28746 [Aegilops tauschii]
Length=251

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+RS DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPP+D+F 
Sbjct  193  NIYEDMKRSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPDDIFG  249



>gb|KHN21917.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=150

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M+ S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  IYDPP+++F
Sbjct  92   NIYEDMKNSPDPPEELPFRILLKGLLPHPLLRNKVKQDFEEIFPDSSIYDPPQEIF  147



>ref|XP_004957960.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Setaria italica]
Length=260

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPPE++F 
Sbjct  202  NIYEDMKKSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPEEIFG  258



>ref|XP_002462989.1| hypothetical protein SORBIDRAFT_02g035860 [Sorghum bicolor]
 gb|EER99510.1| hypothetical protein SORBIDRAFT_02g035860 [Sorghum bicolor]
Length=258

 Score = 72.8 bits (177),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+RV+LKGLLP+  LR +VK DF ELFP+  IYDPPE++F 
Sbjct  200  NIYEDMKKSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEELFPERHIYDPPEEIFG  256



>ref|XP_006591821.1| PREDICTED: uncharacterized protein LOC100306428 isoform X1 [Glycine 
max]
 gb|KHN25233.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=255

 Score = 72.4 bits (176),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M+ S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  IYDPP+++F
Sbjct  197  NIYEDMKNSPDPPEELPFRILLKGLLPHPLLRNKVKQDFEEIFPDSSIYDPPQEIF  252



>ref|XP_004507153.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Cicer arietinum]
Length=261

 Score = 72.4 bits (176),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M+ S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  IYDPP+++F
Sbjct  203  NIYEDMKNSPDPPEELPFRILLKGLLPHPLLRNKVKQDFEEIFPDSSIYDPPQEIF  258



>tpg|DAA41084.1| TPA: hypothetical protein ZEAMMB73_430161 [Zea mays]
Length=254

 Score = 72.4 bits (176),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+RV+LKGLLP+  LR +VK DF E+FP+  IYDPPE++F 
Sbjct  196  NIYEDMKKSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEEMFPERHIYDPPEEIFG  252



>ref|XP_003537970.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Glycine max]
Length=255

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M+ S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  IYDPP+++F
Sbjct  197  NIYEDMKNSPDPPEELPFRILLKGLLPHPLLRNKVKQDFEEIFPDSSIYDPPQEIF  252



>ref|XP_002276778.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Vitis vinifera]
 ref|XP_010650828.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Vitis vinifera]
 ref|XP_010650829.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Vitis vinifera]
 ref|XP_010650830.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Vitis vinifera]
 ref|XP_010650831.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Vitis vinifera]
 ref|XP_010650832.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Vitis vinifera]
 emb|CBI15841.3| unnamed protein product [Vitis vinifera]
Length=252

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK DF E+FPD  +YDPPE++F 
Sbjct  194  NIYEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEEIFPDRHVYDPPEEIFG  250



>gb|KEH30195.1| PPR containing plant-like protein [Medicago truncatula]
Length=261

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            ++Y++M+ S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  IYDPP+++F
Sbjct  203  NVYEDMKNSPDPPEELPFRILLKGLLPHPLLRNKVKQDFEEIFPDSSIYDPPQEIF  258



>ref|NP_001143431.1| uncharacterized protein LOC100276080 [Zea mays]
 gb|ACG32027.1| hypothetical protein [Zea mays]
Length=254

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+RV+LKGLLP+  LR +VK DF E FP+  IYDPPE++F 
Sbjct  196  NIYEDMKKSPDPPEELPFRVLLKGLLPHPLLRNRVKQDFEEFFPERHIYDPPEEIFG  252



>ref|XP_010650970.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Vitis vinifera]
 emb|CBI16043.3| unnamed protein product [Vitis vinifera]
Length=252

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK DF E+FPD  +YDPPE++F 
Sbjct  194  NIYEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEEIFPDRHVYDPPEEIFG  250



>ref|XP_008386010.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Malus domestica]
 ref|XP_008386011.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Malus domestica]
Length=256

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +YDPPE++F 
Sbjct  197  NIYEDMKQSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYDPPEEIFG  253



>emb|CDP11242.1| unnamed protein product [Coffea canephora]
Length=261

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S +PP  LP+R++LKGLLP+  LR +VK DF E+FPD  IYDPPE++F 
Sbjct  203  NIYEDMKKSPEPPEELPFRILLKGLLPHPLLRNRVKQDFEEIFPDRHIYDPPEEIFG  259



>ref|XP_008384905.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Malus domestica]
Length=256

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +Y+PPE++F 
Sbjct  197  NIYEDMKQSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYBPPEEIFG  253



>ref|XP_010274028.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Nelumbo nucifera]
 ref|XP_010274029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Nelumbo nucifera]
Length=254

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            ++Y++M++S DPP  LP+R++LKGLLP+  LR +VK DF E+FPD  +YDPPE++F
Sbjct  196  NVYEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEEIFPDRNVYDPPEEIF  251



>ref|XP_008813168.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Phoenix dactylifera]
 ref|XP_008813169.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Phoenix dactylifera]
Length=255

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR KVK DF ELFP+  IYDPP ++F 
Sbjct  197  NIYEDMKKSPDPPEELPFRILLKGLLPHPLLRNKVKQDFEELFPERHIYDPPAEIFG  253



>ref|XP_004291520.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Fragaria vesca subsp. vesca]
Length=255

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +YDPP+++F  
Sbjct  197  NIYEDMKQSPDPPEQLPFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYDPPQEIFGS  254



>ref|XP_008385091.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Malus domestica]
Length=172

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +Y+PPE++F 
Sbjct  113  NIYEDMKQSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYNPPEEIFG  169



>ref|XP_007205757.1| hypothetical protein PRUPE_ppa010266mg [Prunus persica]
 gb|EMJ06956.1| hypothetical protein PRUPE_ppa010266mg [Prunus persica]
Length=256

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+ S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +YDPPE++F 
Sbjct  197  NIYEDMKNSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYDPPEEIFG  253



>ref|XP_006858620.1| hypothetical protein AMTR_s00066p00023060 [Amborella trichopoda]
 gb|ERN20087.1| hypothetical protein AMTR_s00066p00023060 [Amborella trichopoda]
Length=265

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+ S +PP  LPYRV+LKGLLP+  LR ++K DF E+FPD  +YDPPE++F 
Sbjct  207  NIYEDMKNSPEPPEELPYRVLLKGLLPHPLLRNRIKQDFEEMFPDRHVYDPPEEIFG  263



>ref|XP_008221843.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Prunus mume]
Length=256

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M+ S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +YDPPE++F
Sbjct  197  NIYEDMKNSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYDPPEEIF  252



>ref|XP_004145279.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Cucumis sativus]
 ref|XP_004154371.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Cucumis sativus]
 ref|XP_004163333.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Cucumis sativus]
 gb|KGN65758.1| hypothetical protein Csa_1G525290 [Cucumis sativus]
Length=255

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M++S DPP  LP+R++LKGLLP+  LR +VK DF ELFPD  ++DPPE++F 
Sbjct  197  NVYEDMKKSPDPPDELPFRILLKGLLPHPLLRNRVKQDFEELFPDQHVFDPPEEIFS  253



>ref|XP_002517255.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45155.1| conserved hypothetical protein [Ricinus communis]
Length=258

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK D+ ELFP+  +YDPPE++F
Sbjct  200  NIYEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDYEELFPEKHVYDPPEEIF  255



>ref|XP_007132030.1| hypothetical protein PHAVU_011G060800g [Phaseolus vulgaris]
 gb|ESW04024.1| hypothetical protein PHAVU_011G060800g [Phaseolus vulgaris]
Length=254

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +Y++M+ S DPP  LP+R++LKGLLP+  LR KVK DF E+FPD  IYDPP+++F 
Sbjct  197  VYEDMKNSPDPPDELPFRILLKGLLPHPLLRNKVKQDFEEIFPDSSIYDPPQEIFG  252



>ref|XP_010106566.1| hypothetical protein L484_025326 [Morus notabilis]
 gb|EXC10742.1| hypothetical protein L484_025326 [Morus notabilis]
Length=324

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +YDPPE++F 
Sbjct  266  NIYEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPEKHMYDPPEEIFG  322



>ref|XP_011032219.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Populus euphratica]
 ref|XP_011032220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Populus euphratica]
Length=257

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK D+ ELFP+  +YDPPE++F
Sbjct  199  NIYEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDYEELFPEKHVYDPPEEIF  254



>ref|XP_009350168.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g46870-like, partial [Pyrus x bretschneideri]
Length=212

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+ S DPP  LP+R++LKGLLP+  LR +VK DF ELFP+  +YDPPE++F 
Sbjct  153  NIYEDMKLSPDPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYDPPEEIFG  209



>ref|XP_002314145.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE88100.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=257

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK D+ ELFP+  +YDPPE++F
Sbjct  199  NIYEDMKKSPDPPEELPFRILLKGLLPHPLLRNRVKQDYEELFPEKHVYDPPEEIF  254



>ref|XP_010928561.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Elaeis guineensis]
Length=255

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+ S +PP  LP+R++LKGLLP+  LR KVK DF ELFP+  IYDPP ++F 
Sbjct  197  NIYEDMKNSPEPPKELPFRILLKGLLPHPLLRNKVKQDFEELFPERHIYDPPAEIFG  253



>ref|XP_009388869.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Musa acuminata subsp. malaccensis]
Length=263

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M +S +PP  LP+R++LKGLLP+  LR +VK DF ELFP+  IYDPPE++F 
Sbjct  205  NIYEDMMKSPEPPEELPFRILLKGLLPHPLLRNRVKQDFEELFPERHIYDPPEEIFG  261



>emb|CDY54020.1| BnaCnng26030D [Brassica napus]
Length=256

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  198  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  254



>ref|XP_010515009.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Camelina sativa]
Length=257

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  199  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  255



>ref|XP_009149958.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Brassica rapa]
 emb|CDX99090.1| BnaA06g17810D [Brassica napus]
Length=252

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  194  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  250



>ref|XP_010426137.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Camelina sativa]
Length=257

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  199  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  255



>ref|XP_008457435.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Cucumis melo]
Length=255

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M++S +PP  LP+R++LKGLLP+  LR +VK DF ELFPD  ++DPPE++F 
Sbjct  197  NVYEDMKKSPEPPDELPFRILLKGLLPHPLLRNRVKQDFEELFPDQHVFDPPEEIFS  253



>ref|XP_002875809.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52068.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=257

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  199  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  255



>ref|XP_006404445.1| hypothetical protein EUTSA_v10010650mg [Eutrema salsugineum]
 gb|ESQ45898.1| hypothetical protein EUTSA_v10010650mg [Eutrema salsugineum]
Length=257

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  199  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  255



>ref|NP_190271.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9STF9.1|PP266_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g46870 
[Arabidopsis thaliana]
 pdb|4LEU|A Chain A, Crystal Structure Of Tha8-like Protein From Arabidopsis 
Thaliana
 emb|CAB51178.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42475.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63331.1| At3g46870 [Arabidopsis thaliana]
 gb|AEE78213.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=257

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  199  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  255



>ref|XP_006291711.1| hypothetical protein CARUB_v10017876mg [Capsella rubella]
 ref|XP_006291712.1| hypothetical protein CARUB_v10017876mg [Capsella rubella]
 gb|EOA24609.1| hypothetical protein CARUB_v10017876mg [Capsella rubella]
 gb|EOA24610.1| hypothetical protein CARUB_v10017876mg [Capsella rubella]
Length=257

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  199  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  255



>gb|EPS64983.1| hypothetical protein M569_09798, partial [Genlisea aurea]
Length=203

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            ++Y++M+RS + P  LP+RV+LKGLLP+  LR +VK DF E+FPD  +YDPPE++F
Sbjct  145  NVYEDMKRSPELPEQLPFRVLLKGLLPHPLLRNRVKQDFEEIFPDQRVYDPPEEIF  200



>ref|XP_010507261.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Camelina sativa]
Length=258

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  200  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  256



>ref|XP_006424944.1| hypothetical protein CICLE_v10029104mg [Citrus clementina]
 ref|XP_006488411.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
isoform X1 [Citrus sinensis]
 ref|XP_006488412.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
isoform X2 [Citrus sinensis]
 gb|ESR38184.1| hypothetical protein CICLE_v10029104mg [Citrus clementina]
 gb|KDO66672.1| hypothetical protein CISIN_1g025225mg [Citrus sinensis]
 gb|KDO66673.1| hypothetical protein CISIN_1g025225mg [Citrus sinensis]
 gb|KDO66674.1| hypothetical protein CISIN_1g025225mg [Citrus sinensis]
Length=256

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M +S DPP  LP+R++LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  198  NIYEDMIKSPDPPEELPFRILLKGLLPHPLLRSKVKKDFEELFPEKHAYDPPEEIFG  254



>gb|KHG00145.1| hypothetical protein F383_18987 [Gossypium arboreum]
Length=255

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +IY++M +S DPP  LP+R++LKGLLP+  LR KVK DF ELFP+   YDPPE++F
Sbjct  197  NIYEDMIKSPDPPEELPFRILLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIF  252



>ref|XP_009350173.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Pyrus x bretschneideri]
Length=100

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +I ++M++S DPP  LP+R++LKGLLP+   R +VK DF ELFP+  +YDPPE++F
Sbjct  41   NICEDMKQSPDPPEELPFRILLKGLLPHPLYRNRVKQDFEELFPEQHVYDPPEEIF  96



>gb|KFK34007.1| hypothetical protein AALP_AA5G090100 [Arabis alpina]
Length=256

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  198  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHSYDPPEEIFG  254



>ref|XP_007016286.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOY33905.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=287

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M +S DPP  LP+R++LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  229  NIYEDMIKSPDPPEELPFRILLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  285



>ref|XP_010535440.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
isoform X2 [Tarenaya hassleriana]
Length=350

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M +S DPP  LP+RV+LKGLLP+  LR KVK DF ELFP+   YDPPE++F 
Sbjct  292  NVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFG  348



>ref|XP_010043480.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Eucalyptus grandis]
 gb|KCW85496.1| hypothetical protein EUGRSUZ_B02297 [Eucalyptus grandis]
Length=255

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M+ S DPP  LP+R++LKGL+P+  LR +VK DF ELFP+  +YDPPE++F 
Sbjct  197  NIYEDMKLSPDPPDELPFRILLKGLIPHPLLRNRVKQDFEELFPERHVYDPPEEIFG  253



>gb|KDP42187.1| hypothetical protein JCGZ_02917 [Jatropha curcas]
Length=257

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M++S DPP  LP+R++LKGLLP+  LR +VK D+ ELFP+   YDPPE++F 
Sbjct  199  NIYEDMKKSPDPPDELPFRILLKGLLPHPLLRNRVKQDYEELFPEKHFYDPPEEIFG  255



>ref|XP_004247885.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Solanum lycopersicum]
Length=256

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +I+++M++S  PP  LP+RV+LKGLLP+  LR +VK DF E+FPD  IYDPPE++F
Sbjct  198  NIFEDMKKSPYPPEELPFRVLLKGLLPHPLLRNRVKQDFEEIFPDRHIYDPPEEIF  253



>ref|XP_006360926.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Solanum tuberosum]
Length=256

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +I+++M++S  PP  LP+RV+LKGLLP+  LR +VK DF E+FPD  IYDPPE++F
Sbjct  198  NIFEDMKKSPYPPEELPFRVLLKGLLPHPLLRNRVKQDFEEIFPDRHIYDPPEEIF  253



>gb|EYU27759.1| hypothetical protein MIMGU_mgv1a012108mg [Erythranthe guttata]
Length=261

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            ++Y++M++S + P  LP+R++LKGLLP+  LR KVK DF E+FPD  +YDPPE++F 
Sbjct  203  NVYEDMKKSPELPDQLPFRILLKGLLPHPLLRNKVKQDFEEIFPDQRVYDPPEEIFG  259



>ref|XP_009608579.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Nicotiana tomentosiformis]
Length=257

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +I+++M++S  PP  LP+R++LKGLLP+  LR +VK DF E+FPD  IYDPPE++F
Sbjct  199  NIFEDMKKSPYPPEELPFRILLKGLLPHPLLRNRVKQDFEEIFPDRHIYDPPEEIF  254



>ref|XP_009764479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Nicotiana sylvestris]
Length=257

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLF  7
            +I+++M++S  PP  LP+R++LKGLLP+  LR +VK DF E+FPD  IYDPPE++F
Sbjct  199  NIFEDMKKSPYPPEELPFRILLKGLLPHPLLRNRVKQDFEEIFPDRHIYDPPEEIF  254



>ref|XP_011072170.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 
[Sesamum indicum]
Length=230

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 40/58 (69%), Gaps = 13/58 (22%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFDD  1
             IYDEMR S DPPLSLPYRVILKGL+PY +LREKVKDD             PEDL +D
Sbjct  175  RIYDEMRSSPDPPLSLPYRVILKGLIPYPELREKVKDD-------------PEDLLND  219



>ref|XP_010689026.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010689027.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010689028.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010689029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010689030.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010689031.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 
[Beta vulgaris subsp. vulgaris]
Length=257

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M +S D P  LP+R++LKGLLP+  LR KVK DF ELFP+  +YDPP+++F 
Sbjct  199  NIYEDMLKSPDLPEELPFRILLKGLLPHPLLRNKVKQDFEELFPERSVYDPPQEIFG  255



>ref|XP_009350174.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like 
[Pyrus x bretschneideri]
Length=254

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDLFD  4
            +IY++M +S DPP  L +R++LKGLLP+  LR +VK DF ELFP+  +Y PPE++F 
Sbjct  195  NIYEDMNQSPDPPEELAFRILLKGLLPHPLLRNRVKQDFEELFPEQHVYYPPEEIFG  251



>emb|CDY19544.1| BnaC09g13590D [Brassica napus]
Length=129

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  156  RRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPPEDL  10
            + S DPPL +  RV LKGL+ Y + REKVK+DFLE+FP M +YDPP+DL
Sbjct  81   KGSPDPPLYMLIRVFLKGLVSYHESREKVKEDFLEIFPVMAVYDPPKDL  129



>tpg|DAA63055.1| TPA: hypothetical protein ZEAMMB73_179106 [Zea mays]
Length=74

 Score = 57.0 bits (136),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  171  IYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFP  43
            IY+ M++S DPP  LP+RV+LKGLLP+  LR +VK DF ELFP
Sbjct  32   IYEGMKKSPDPPQELPFRVLLKGLLPHPLLRNRVKQDFEELFP  74



>ref|XP_002517059.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45222.1| conserved hypothetical protein [Ricinus communis]
Length=112

 Score = 46.2 bits (108),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 4/52 (8%)
 Frame = -3

Query  174  HIYDEMRRSTDPPLSLPYRVILKGLLPYTDLREKVKDDFLELFPDMIIYDPP  19
            +IY++M++S D    LP+R   KG  P   LR +VK DF ELFP+  +YD P
Sbjct  54   NIYEDMKKSPD----LPFRTFFKGASPGPLLRNRVKQDFEELFPEKHVYDTP  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524434495707