BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1150_g1_i1 len=909 path=[1:0-908]

Length=909
                                                                      Score     E

ref|XP_002299329.2|  hypothetical protein POPTR_0001s13460g             149   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_009624882.1|  PREDICTED: auxin-induced protein 10A5-like         145   4e-39   
ref|XP_011036123.1|  PREDICTED: uncharacterized protein LOC105133729    145   4e-38   
ref|XP_010249111.1|  PREDICTED: uncharacterized protein LOC104591786    142   8e-38   
gb|AFK33528.1|  unknown                                                 142   1e-37   
ref|XP_009770405.1|  PREDICTED: auxin-induced protein 10A5-like         141   2e-37   
ref|XP_007043889.1|  SAUR family protein                                140   4e-37   
ref|XP_002303770.1|  hypothetical protein POPTR_0003s16580g             140   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011020815.1|  PREDICTED: uncharacterized protein LOC105123051    138   5e-36   
ref|XP_009349477.1|  PREDICTED: indole-3-acetic acid-induced prot...    136   1e-35   
ref|XP_004228430.1|  PREDICTED: auxin-induced protein X10A-like         136   2e-35   
ref|XP_006363778.1|  PREDICTED: indole-3-acetic acid-induced prot...    135   3e-35   
gb|AFK48563.1|  unknown                                                 136   3e-35   
ref|XP_008340250.1|  PREDICTED: indole-3-acetic acid-induced prot...    135   3e-35   
ref|XP_003631359.1|  PREDICTED: auxin-induced protein 6B-like           135   4e-35   
ref|XP_002514869.1|  hypothetical protein RCOM_1078910                  135   5e-35   Ricinus communis
ref|XP_008222216.1|  PREDICTED: uncharacterized protein LOC103322112    134   2e-34   
gb|KDO83113.1|  hypothetical protein CISIN_1g030719mg                   132   9e-34   
gb|AGR44724.1|  SAUR family protein                                     132   1e-33   
ref|XP_003552755.1|  PREDICTED: uncharacterized protein LOC100777217    132   1e-33   
ref|XP_007227681.1|  hypothetical protein PRUPE_ppa026219mg             130   6e-33   
ref|XP_006438814.1|  hypothetical protein CICLE_v10032901mg             129   1e-32   
ref|XP_002264638.1|  PREDICTED: uncharacterized protein LOC100245472    129   1e-32   Vitis vinifera
emb|CAN66812.1|  hypothetical protein VITISV_011138                     129   1e-32   Vitis vinifera
ref|XP_004310111.1|  PREDICTED: uncharacterized protein LOC101294039    129   1e-32   
emb|CDP13382.1|  unnamed protein product                                129   2e-32   
ref|XP_009336447.1|  PREDICTED: indole-3-acetic acid-induced prot...    128   2e-32   
ref|XP_010090676.1|  hypothetical protein L484_017482                   129   2e-32   
ref|XP_008389916.1|  PREDICTED: indole-3-acetic acid-induced prot...    128   2e-32   
ref|XP_004491682.1|  PREDICTED: uncharacterized protein LOC101512600    127   1e-31   
ref|XP_006483047.1|  PREDICTED: uncharacterized protein LOC102613185    127   1e-31   
gb|KDP26852.1|  hypothetical protein JCGZ_18010                         124   1e-30   
gb|ADU56197.1|  SAUR family protein                                     122   7e-30   
ref|XP_007038060.1|  Calmodulin binding protein, putative               122   1e-29   
gb|KHN24973.1|  Indole-3-acetic acid-induced protein ARG7               121   1e-29   
ref|XP_002511134.1|  calmodulin binding protein, putative               121   2e-29   Ricinus communis
ref|XP_006436889.1|  hypothetical protein CICLE_v10033363mg             121   3e-29   
ref|XP_003523159.1|  PREDICTED: uncharacterized protein LOC100789525    120   3e-29   
ref|XP_006586283.1|  PREDICTED: uncharacterized protein LOC100799988    120   4e-29   
ref|XP_004140543.1|  PREDICTED: uncharacterized protein LOC101219164    119   5e-29   
ref|XP_008459883.1|  PREDICTED: uncharacterized protein LOC103498869    119   5e-29   
gb|KDP22580.1|  hypothetical protein JCGZ_26411                         119   6e-29   
ref|XP_007139103.1|  hypothetical protein PHAVU_008G001500g             119   8e-29   
ref|XP_007210042.1|  hypothetical protein PRUPE_ppa017538mg             119   1e-28   
ref|XP_009385439.1|  PREDICTED: indole-3-acetic acid-induced prot...    117   2e-28   
ref|XP_006493246.1|  PREDICTED: uncharacterized protein LOC102627134    119   2e-28   
gb|KDO64450.1|  hypothetical protein CISIN_1g029186mg                   119   2e-28   
gb|KHN23965.1|  Indole-3-acetic acid-induced protein ARG7               117   3e-28   
ref|XP_008239631.1|  PREDICTED: uncharacterized protein LOC103338225    116   9e-28   
ref|XP_004298548.1|  PREDICTED: uncharacterized protein LOC101293879    115   1e-27   
ref|XP_009408359.1|  PREDICTED: indole-3-acetic acid-induced prot...    114   2e-27   
ref|XP_010025283.1|  PREDICTED: uncharacterized protein LOC104415655    115   3e-27   
ref|XP_010044854.1|  PREDICTED: uncharacterized protein LOC104433707    114   5e-27   
ref|XP_010668453.1|  PREDICTED: uncharacterized protein LOC104885461    111   8e-26   
ref|XP_002511133.1|  calmodulin binding protein, putative               110   1e-25   Ricinus communis
ref|XP_002318753.2|  hypothetical protein POPTR_0012s10450g             110   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011071313.1|  PREDICTED: uncharacterized protein LOC105156793    109   2e-25   
ref|XP_006844597.1|  hypothetical protein AMTR_s00016p00212020          109   2e-25   
ref|XP_010523232.1|  PREDICTED: uncharacterized protein LOC104801612    109   3e-25   
ref|XP_009383406.1|  PREDICTED: uncharacterized protein LOC103971172    108   5e-25   
ref|XP_009375239.1|  PREDICTED: uncharacterized protein LOC103964074    108   7e-25   
ref|XP_011044095.1|  PREDICTED: uncharacterized protein LOC105139380    108   8e-25   
ref|XP_011042925.1|  PREDICTED: uncharacterized protein LOC105138521    108   1e-24   
ref|XP_008346665.1|  PREDICTED: uncharacterized protein LOC103409638    106   4e-24   
ref|XP_008804094.1|  PREDICTED: auxin-induced protein X15-like          104   7e-24   
ref|XP_004298545.1|  PREDICTED: uncharacterized protein LOC101292997    106   7e-24   
ref|XP_010926791.1|  PREDICTED: auxin-induced protein X15-like          104   1e-23   
gb|KHN32562.1|  Auxin-induced protein X15                               105   1e-23   
gb|AFK42411.1|  unknown                                                 104   1e-23   
ref|XP_011073103.1|  PREDICTED: uncharacterized protein LOC105158157    104   2e-23   
ref|XP_008791133.1|  PREDICTED: auxin-induced protein X15-like          100   2e-22   
ref|XP_008446293.1|  PREDICTED: uncharacterized protein LOC103489067    101   3e-22   
ref|NP_001150755.1|  calmodulin binding protein                         100   4e-22   Zea mays [maize]
gb|ACG40236.1|  calmodulin binding protein                              100   4e-22   Zea mays [maize]
gb|EYU23063.1|  hypothetical protein MIMGU_mgv1a015250mg                100   5e-22   
ref|XP_009600107.1|  PREDICTED: uncharacterized protein LOC104095647    101   7e-22   
gb|EYU43034.1|  hypothetical protein MIMGU_mgv1a014941mg                100   7e-22   
ref|XP_004145218.1|  PREDICTED: uncharacterized protein LOC101219975  99.8    8e-22   
gb|KGN64431.1|  hypothetical protein Csa_1G051690                     99.8    1e-21   
ref|XP_011083566.1|  PREDICTED: uncharacterized protein LOC105166046    100   1e-21   
ref|XP_010929727.1|  PREDICTED: indole-3-acetic acid-induced prot...  99.0    1e-21   
ref|XP_009337547.1|  PREDICTED: uncharacterized protein LOC103929995  99.0    2e-21   
gb|EYU43035.1|  hypothetical protein MIMGU_mgv1a025672mg              99.0    2e-21   
ref|XP_009770249.1|  PREDICTED: uncharacterized protein LOC104220973  98.6    3e-21   
gb|KEH20999.1|  SAUR-like auxin-responsive family protein             98.6    3e-21   
gb|KEH20995.1|  SAUR-like auxin-responsive family protein             97.8    3e-21   
gb|EAZ09691.1|  hypothetical protein OsI_31974                        97.4    4e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004298547.1|  PREDICTED: uncharacterized protein LOC101293586  97.8    5e-21   
ref|XP_009383865.1|  PREDICTED: auxin-induced protein X15-like        96.3    1e-20   
ref|XP_002462640.1|  hypothetical protein SORBIDRAFT_02g029410        95.9    1e-20   Sorghum bicolor [broomcorn]
ref|XP_010093925.1|  hypothetical protein L484_008816                 96.3    2e-20   
ref|XP_003602784.1|  Auxin-induced protein 6B                         95.5    2e-20   
ref|XP_006586323.1|  PREDICTED: uncharacterized protein LOC102667331  95.5    3e-20   
ref|XP_010663898.1|  PREDICTED: auxin-induced protein X10A-like       95.1    4e-20   
ref|XP_004298546.1|  PREDICTED: uncharacterized protein LOC101293297  95.5    4e-20   
gb|EPS74604.1|  hypothetical protein M569_00152                       92.8    4e-20   
ref|XP_010045491.1|  PREDICTED: uncharacterized protein LOC104434216  95.9    5e-20   
ref|XP_010045485.1|  PREDICTED: uncharacterized protein LOC104434209  93.6    5e-20   
ref|XP_010939481.1|  PREDICTED: uncharacterized protein LOC105058300  96.7    6e-20   
ref|XP_002462638.1|  hypothetical protein SORBIDRAFT_02g029390        93.6    6e-20   Sorghum bicolor [broomcorn]
ref|XP_004241451.1|  PREDICTED: uncharacterized protein LOC101265243  94.7    7e-20   
gb|KHN16861.1|  Indole-3-acetic acid-induced protein ARG7             94.4    8e-20   
ref|XP_004235361.1|  PREDICTED: uncharacterized protein LOC101246229  93.6    1e-19   
ref|XP_004501724.1|  PREDICTED: uncharacterized protein LOC101509958  92.4    2e-19   
tpg|DAA40496.1|  TPA: calmodulin binding protein                      92.4    3e-19   
ref|XP_006347628.1|  PREDICTED: uncharacterized protein LOC102598616  91.3    8e-19   
emb|CDY71491.1|  BnaCnng73150D                                        91.7    9e-19   
ref|XP_004503773.1|  PREDICTED: uncharacterized protein LOC101489648  90.9    1e-18   
dbj|BAK03180.1|  predicted protein                                    91.3    1e-18   
ref|XP_007160002.1|  hypothetical protein PHAVU_002G284700g           90.9    1e-18   
ref|XP_008670314.1|  PREDICTED: uncharacterized protein LOC103647576  91.7    1e-18   
ref|NP_001149909.1|  calmodulin binding protein                       90.5    2e-18   Zea mays [maize]
ref|XP_010111738.1|  hypothetical protein L484_008396                 89.4    2e-18   
ref|XP_009134069.1|  PREDICTED: uncharacterized protein LOC103858456  90.1    2e-18   
ref|NP_001172716.1|  Os01g0924966                                     90.1    3e-18   
ref|XP_002280410.1|  PREDICTED: uncharacterized protein LOC100268140  89.4    5e-18   Vitis vinifera
emb|CAN64976.1|  hypothetical protein VITISV_027843                   89.4    5e-18   Vitis vinifera
ref|XP_004957298.1|  PREDICTED: indole-3-acetic acid-induced prot...  88.2    6e-18   
ref|XP_002864075.1|  auxin-responsive family protein                  88.6    1e-17   
ref|XP_010446011.1|  PREDICTED: uncharacterized protein LOC104728772  87.8    1e-17   
gb|EAY77041.1|  hypothetical protein OsI_04997                        88.2    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010482375.1|  PREDICTED: uncharacterized protein LOC104761057  88.2    2e-17   
ref|XP_010555564.1|  PREDICTED: uncharacterized protein LOC104825028  88.2    2e-17   
gb|EMS53827.1|  hypothetical protein TRIUR3_00758                     86.3    2e-17   
ref|XP_004971120.1|  PREDICTED: uncharacterized protein LOC101781779  87.0    3e-17   
ref|XP_003576721.1|  PREDICTED: indole-3-acetic acid-induced prot...  86.7    3e-17   
ref|XP_002459008.1|  hypothetical protein SORBIDRAFT_03g044380        86.7    3e-17   Sorghum bicolor [broomcorn]
ref|NP_001175932.1|  Os09g0507900                                     91.7    4e-17   
gb|EMT16843.1|  hypothetical protein F775_31032                       85.5    5e-17   
gb|EMT16842.1|  hypothetical protein F775_18859                       85.5    5e-17   
ref|NP_199889.1|  SAUR-like auxin-responsive protein                  86.7    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004977952.1|  PREDICTED: uncharacterized protein LOC101773448  87.8    6e-17   
ref|XP_010232765.1|  PREDICTED: uncharacterized protein LOC100825908  86.7    6e-17   
gb|EMT06448.1|  hypothetical protein F775_14394                       84.7    8e-17   
emb|CDM85822.1|  unnamed protein product                              85.5    9e-17   
gb|EMT16846.1|  hypothetical protein F775_03778                       84.7    1e-16   
gb|EMS53831.1|  hypothetical protein TRIUR3_00762                     85.5    1e-16   
ref|XP_010442311.1|  PREDICTED: uncharacterized protein LOC104725349  85.9    1e-16   
ref|XP_006281172.1|  hypothetical protein CARUB_v10027207mg           85.5    1e-16   
gb|KEH20997.1|  SAUR-like auxin-responsive family protein             83.6    1e-16   
ref|XP_002459007.1|  hypothetical protein SORBIDRAFT_03g044370        84.7    2e-16   Sorghum bicolor [broomcorn]
emb|CDY45819.1|  BnaC03g16420D                                        84.7    3e-16   
ref|XP_009132695.1|  PREDICTED: uncharacterized protein LOC103857272  84.7    3e-16   
gb|EMT16845.1|  hypothetical protein F775_03777                       84.3    3e-16   
gb|EMS53829.1|  hypothetical protein TRIUR3_00760                     83.2    3e-16   
gb|EMS53832.1|  hypothetical protein TRIUR3_00763                     86.7    4e-16   
gb|EMS53830.1|  hypothetical protein TRIUR3_00761                     83.2    4e-16   
emb|CDM85823.1|  unnamed protein product                              84.7    7e-16   
emb|CDY34024.1|  BnaC03g27910D                                        83.2    7e-16   
ref|XP_002985683.1|  hypothetical protein SELMODRAFT_49560            80.9    8e-16   
gb|EMT06447.1|  hypothetical protein F775_28320                       81.6    1e-15   
ref|XP_007011526.1|  SAUR family protein                              82.4    1e-15   
gb|EMS53828.1|  hypothetical protein TRIUR3_00759                     81.6    1e-15   
ref|XP_008784357.1|  PREDICTED: auxin-induced protein 15A-like        80.9    2e-15   
ref|XP_004240979.1|  PREDICTED: auxin-induced protein X15             80.1    3e-15   
ref|XP_010243353.1|  PREDICTED: uncharacterized protein LOC104587436  80.5    4e-15   
ref|XP_002446314.1|  hypothetical protein SORBIDRAFT_06g014230        80.9    4e-15   Sorghum bicolor [broomcorn]
gb|EMT25620.1|  hypothetical protein F775_26776                       80.5    4e-15   
ref|XP_009343363.1|  PREDICTED: uncharacterized protein LOC103935...  80.9    6e-15   
ref|XP_009343362.1|  PREDICTED: uncharacterized protein LOC103935...  80.9    6e-15   
ref|XP_002318465.1|  hypothetical protein POPTR_0012s03050g           79.7    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009343361.1|  PREDICTED: uncharacterized protein LOC103935...  80.9    7e-15   
ref|XP_004307934.1|  PREDICTED: auxin-induced protein 10A5-like       79.0    9e-15   
ref|XP_008437649.1|  PREDICTED: auxin-induced protein X15             78.6    1e-14   
ref|XP_006350722.1|  PREDICTED: indole-3-acetic acid-induced prot...  78.6    1e-14   
ref|XP_004235010.1|  PREDICTED: auxin-induced protein X15-like        78.6    1e-14   
ref|XP_002989902.1|  hypothetical protein SELMODRAFT_49701            77.0    1e-14   
ref|XP_006851432.1|  hypothetical protein AMTR_s00040p00095090        78.2    1e-14   
ref|XP_009348905.1|  PREDICTED: uncharacterized protein LOC103940...  79.7    1e-14   
ref|XP_006493175.1|  PREDICTED: auxin-induced protein 10A5-like       78.2    1e-14   
ref|XP_009348904.1|  PREDICTED: uncharacterized protein LOC103940...  79.7    1e-14   
ref|XP_009793038.1|  PREDICTED: auxin-induced protein X15-like        78.2    2e-14   
ref|XP_009348903.1|  PREDICTED: uncharacterized protein LOC103940...  79.7    2e-14   
ref|XP_009348906.1|  PREDICTED: uncharacterized protein LOC103940...  79.3    2e-14   
ref|XP_009123263.1|  PREDICTED: uncharacterized protein LOC103848025  79.0    2e-14   
ref|XP_010035304.1|  PREDICTED: indole-3-acetic acid-induced prot...  78.2    2e-14   
ref|XP_006347637.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.8    2e-14   
ref|XP_006441210.1|  hypothetical protein CICLE_v10022912mg           77.8    2e-14   
ref|XP_011075910.1|  PREDICTED: auxin-induced protein 15A             77.4    2e-14   
ref|XP_004508030.1|  PREDICTED: uncharacterized protein LOC101493355  78.6    2e-14   
ref|XP_008391750.1|  PREDICTED: uncharacterized protein LOC103453...  79.0    3e-14   
ref|XP_008391743.1|  PREDICTED: uncharacterized protein LOC103453...  79.0    3e-14   
gb|KDP33420.1|  hypothetical protein JCGZ_06991                       78.6    3e-14   
ref|XP_008391757.1|  PREDICTED: uncharacterized protein LOC103453...  78.6    3e-14   
ref|XP_002968653.1|  hypothetical protein SELMODRAFT_69737            75.9    3e-14   
ref|XP_008790836.1|  PREDICTED: auxin-induced protein 15A-like        77.4    3e-14   
ref|XP_010050905.1|  PREDICTED: uncharacterized protein LOC104439553  78.2    3e-14   
ref|XP_011006641.1|  PREDICTED: uncharacterized protein LOC105112603  78.2    4e-14   
ref|XP_006382198.1|  auxin-responsive family protein                  78.2    4e-14   
ref|XP_004291305.1|  PREDICTED: uncharacterized protein LOC101314623  78.2    4e-14   
ref|XP_008242287.1|  PREDICTED: uncharacterized protein LOC103340...  78.6    4e-14   
gb|KHN38103.1|  Auxin-induced protein X15                             77.8    4e-14   
ref|XP_008242284.1|  PREDICTED: uncharacterized protein LOC103340...  78.6    5e-14   
ref|XP_007012552.1|  SAUR-like auxin-responsive protein family        77.8    5e-14   
ref|XP_009760450.1|  PREDICTED: uncharacterized protein LOC104212795  77.8    6e-14   
ref|XP_004502720.1|  PREDICTED: uncharacterized protein LOC101503085  77.4    6e-14   
ref|XP_007136076.1|  hypothetical protein PHAVU_009G015600g           77.0    6e-14   
ref|XP_003551054.1|  PREDICTED: uncharacterized protein LOC100795275  77.4    7e-14   
gb|EPS70661.1|  hypothetical protein M569_04099                       77.4    7e-14   
ref|XP_010520521.1|  PREDICTED: uncharacterized protein LOC104799608  77.4    7e-14   
gb|AFG56379.1|  hypothetical protein 0_8672_01                        77.0    7e-14   
ref|XP_002875598.1|  hypothetical protein ARALYDRAFT_484787           77.4    8e-14   
gb|AAM62891.1|  unknown                                               77.4    8e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AEW07678.1|  hypothetical protein 0_8672_01                        77.0    8e-14   
ref|XP_006452874.1|  hypothetical protein CICLE_v10009722mg           77.4    8e-14   
ref|XP_006419133.1|  hypothetical protein EUTSA_v10002695mg           77.0    8e-14   
ref|NP_189898.1|  SAUR-like auxin-responsive protein                  77.0    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008780352.1|  PREDICTED: auxin-induced protein 15A-like        75.9    9e-14   
gb|KDP37315.1|  hypothetical protein JCGZ_06769                       76.6    9e-14   
gb|ABK28585.1|  unknown                                               77.0    9e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KCW48946.1|  hypothetical protein EUGRSUZ_K02555                   76.3    9e-14   
ref|XP_010093746.1|  hypothetical protein L484_019148                 76.3    9e-14   
gb|AFG56380.1|  hypothetical protein 0_8672_01                        76.6    9e-14   
gb|KHG20809.1|  Auxin-induced 15A                                     77.0    9e-14   
ref|XP_007202616.1|  hypothetical protein PRUPE_ppa011868mg           77.8    9e-14   
ref|XP_010493190.1|  PREDICTED: uncharacterized protein LOC104770457  77.0    1e-13   
ref|XP_010514710.1|  PREDICTED: uncharacterized protein LOC104790628  77.0    1e-13   
ref|XP_004242870.1|  PREDICTED: uncharacterized protein LOC101250316  77.0    1e-13   
ref|XP_006452873.1|  hypothetical protein CICLE_v10009722mg           77.0    1e-13   
ref|XP_006474596.1|  PREDICTED: uncharacterized protein LOC102619589  77.0    1e-13   
gb|AFG56382.1|  hypothetical protein 0_8672_01                        76.6    1e-13   
ref|XP_010425808.1|  PREDICTED: uncharacterized protein LOC104710848  77.0    1e-13   
ref|XP_010037266.1|  PREDICTED: indole-3-acetic acid-induced prot...  76.3    1e-13   
gb|KCW48295.1|  hypothetical protein EUGRSUZ_K02026                   76.3    1e-13   
ref|XP_011077689.1|  PREDICTED: uncharacterized protein LOC105161638  77.0    1e-13   
ref|XP_010503025.1|  PREDICTED: uncharacterized protein LOC104780223  76.6    1e-13   
ref|XP_003530361.1|  PREDICTED: indole-3-acetic acid-induced prot...  76.6    1e-13   
ref|XP_003523572.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.9    1e-13   
ref|XP_010036667.1|  PREDICTED: indole-3-acetic acid-induced prot...  76.3    1e-13   
ref|XP_010245477.1|  PREDICTED: auxin-induced protein 15A-like        75.9    1e-13   
ref|XP_008779181.1|  PREDICTED: auxin-induced protein 15A-like        75.5    1e-13   
ref|XP_002321970.1|  hypothetical protein POPTR_0015s00920g           75.5    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009614446.1|  PREDICTED: auxin-induced protein 10A5-like       75.9    1e-13   
ref|XP_011078141.1|  PREDICTED: uncharacterized protein LOC105161958  76.3    1e-13   
ref|XP_004144907.1|  PREDICTED: auxin-induced protein X10A-like       75.1    2e-13   
ref|XP_007135297.1|  hypothetical protein PHAVU_010G117500g           75.1    2e-13   
gb|KDP36945.1|  hypothetical protein JCGZ_08236                       75.9    2e-13   
gb|EMT16844.1|  hypothetical protein F775_03776                       75.9    2e-13   
ref|XP_009618492.1|  PREDICTED: uncharacterized protein LOC104110661  76.3    2e-13   
ref|XP_010526282.1|  PREDICTED: uncharacterized protein LOC104803884  76.3    2e-13   
ref|XP_004160397.1|  PREDICTED: auxin-induced protein X15-like        75.1    2e-13   
ref|XP_011044712.1|  PREDICTED: auxin-induced protein X15             74.7    2e-13   
ref|XP_009131816.1|  PREDICTED: uncharacterized protein LOC103856463  75.9    3e-13   
ref|XP_006381568.1|  auxin-responsive family protein                  75.9    3e-13   
ref|XP_006288810.1|  hypothetical protein CARUB_v10002144mg           75.9    3e-13   
ref|XP_002876644.1|  auxin-responsive family protein                  75.1    3e-13   
ref|XP_011039922.1|  PREDICTED: uncharacterized protein LOC105136...  75.5    3e-13   
ref|XP_004952566.1|  PREDICTED: uncharacterized protein LOC101780971  75.5    3e-13   
ref|XP_004488799.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.5    3e-13   
gb|KHN23320.1|  Auxin-induced protein X15                             75.1    3e-13   
gb|KHN46022.1|  Auxin-induced protein 15A                             74.7    3e-13   
ref|XP_010246428.1|  PREDICTED: auxin-induced protein X15-like        75.1    3e-13   
ref|XP_003537074.1|  PREDICTED: auxin-induced protein 15A-like        74.7    3e-13   
gb|AFK37533.1|  unknown                                               74.3    3e-13   
ref|XP_004974888.1|  PREDICTED: indole-3-acetic acid-induced prot...  74.7    3e-13   
ref|XP_010512568.1|  PREDICTED: auxin-induced protein 15A-like        74.7    3e-13   
ref|XP_011039920.1|  PREDICTED: uncharacterized protein LOC105136...  75.5    3e-13   
ref|XP_009126477.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.5    3e-13   
ref|XP_009618690.1|  PREDICTED: uncharacterized protein LOC104110835  75.1    3e-13   
ref|XP_009346677.1|  PREDICTED: auxin-induced protein 6B-like         75.5    3e-13   
emb|CDX70944.1|  BnaC03g10280D                                        75.5    4e-13   
ref|XP_002277332.1|  PREDICTED: auxin-induced protein 6B-like         75.1    4e-13   Vitis vinifera
ref|XP_010091187.1|  hypothetical protein L484_002582                 75.1    4e-13   
ref|XP_007039174.1|  SAUR family protein                              74.3    4e-13   
gb|AGQ56867.1|  SAUR family protein 22                                74.7    4e-13   
emb|CCH47223.1|  similar to auxin-induced protein 6B                  75.5    4e-13   
ref|XP_010103079.1|  hypothetical protein L484_003321                 75.5    4e-13   
ref|XP_010437568.1|  PREDICTED: uncharacterized protein LOC104721316  75.1    4e-13   
ref|XP_009598038.1|  PREDICTED: uncharacterized protein LOC104093914  75.1    4e-13   
ref|NP_197581.2|  SAUR-like auxin-responsive protein                  75.1    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007218591.1|  hypothetical protein PRUPE_ppa013301mg           74.3    4e-13   
ref|XP_010541681.1|  PREDICTED: uncharacterized protein LOC104815072  75.1    5e-13   
ref|XP_007022464.1|  SAUR-like auxin-responsive protein family        74.7    5e-13   
ref|XP_010049331.1|  PREDICTED: uncharacterized protein LOC104437967  75.1    5e-13   
ref|XP_009361302.1|  PREDICTED: auxin-induced protein 15A             74.3    5e-13   
ref|XP_011083510.1|  PREDICTED: auxin-induced protein 6B-like         74.7    5e-13   
ref|XP_008342622.1|  PREDICTED: uncharacterized protein LOC103405398  75.5    5e-13   
ref|XP_003588611.1|  Auxin-induced protein 6B                         75.1    5e-13   
ref|XP_003602327.1|  Auxin-induced protein 10A5                       74.3    5e-13   
gb|KHN39378.1|  Auxin-induced protein 15A                             74.3    6e-13   
ref|XP_010413332.1|  PREDICTED: auxin-induced protein 15A-like        73.9    6e-13   
gb|EYU19681.1|  hypothetical protein MIMGU_mgv1a016283mg              73.9    6e-13   
emb|CDP07418.1|  unnamed protein product                              74.7    6e-13   
emb|CAN60527.1|  hypothetical protein VITISV_000524                   75.5    6e-13   
ref|XP_008780176.1|  PREDICTED: auxin-induced protein 15A-like        73.2    6e-13   
ref|XP_002871957.1|  hypothetical protein ARALYDRAFT_488986           74.7    6e-13   
emb|CDY16564.1|  BnaC09g37090D                                        74.7    7e-13   
ref|XP_008234672.1|  PREDICTED: auxin-induced protein 15A-like        73.9    7e-13   
gb|ABR17095.1|  unknown                                               74.3    7e-13   
ref|XP_008462190.1|  PREDICTED: uncharacterized protein LOC103500611  74.7    7e-13   
gb|AFK44459.1|  unknown                                               74.7    7e-13   
ref|XP_010049360.1|  PREDICTED: uncharacterized protein LOC104438001  74.7    7e-13   
ref|XP_009367954.1|  PREDICTED: uncharacterized protein LOC103957507  74.7    7e-13   
ref|NP_001031914.1|  SAUR-like auxin-responsive protein               75.1    7e-13   
ref|XP_007131740.1|  hypothetical protein PHAVU_011G038000g           73.9    7e-13   
ref|XP_002977020.1|  hypothetical protein SELMODRAFT_38714            72.4    7e-13   
ref|XP_008376800.1|  PREDICTED: auxin-induced protein 15A             73.9    8e-13   
ref|XP_004136303.1|  PREDICTED: auxin-induced protein 6B-like         74.7    8e-13   
emb|CDX92434.1|  BnaA10g14730D                                        74.7    8e-13   
ref|XP_002444689.1|  hypothetical protein SORBIDRAFT_07g026050        73.6    8e-13   
ref|XP_002275644.1|  PREDICTED: uncharacterized protein LOC100266455  74.7    8e-13   
ref|XP_006586657.1|  PREDICTED: uncharacterized protein LOC100527...  74.7    8e-13   
ref|XP_009120769.1|  PREDICTED: uncharacterized protein LOC103845643  74.3    8e-13   
ref|XP_010103473.1|  hypothetical protein L484_014484                 74.7    8e-13   
emb|CBI27760.3|  unnamed protein product                              74.3    8e-13   
gb|EYU38769.1|  hypothetical protein MIMGU_mgv1a024324mg              74.7    9e-13   
ref|XP_004141833.1|  PREDICTED: indole-3-acetic acid-induced prot...  74.3    9e-13   
gb|KEH37650.1|  SAUR-like auxin-responsive family protein             74.3    9e-13   
emb|CBI23067.3|  unnamed protein product                              73.2    9e-13   
gb|KHN47616.1|  Indole-3-acetic acid-induced protein ARG7             74.3    9e-13   
gb|KHF97540.1|  Auxin-induced 15A                                     74.3    9e-13   
ref|XP_006400646.1|  hypothetical protein EUTSA_v10014872mg           74.3    9e-13   
ref|XP_010469007.1|  PREDICTED: auxin-induced protein 15A-like        73.6    1e-12   
ref|XP_009792726.1|  PREDICTED: uncharacterized protein LOC104239704  73.9    1e-12   
ref|XP_004303802.1|  PREDICTED: uncharacterized protein LOC101309563  74.7    1e-12   
ref|XP_006361587.1|  PREDICTED: uncharacterized protein LOC102596161  74.3    1e-12   
ref|XP_004980297.1|  PREDICTED: uncharacterized protein LOC101759037  73.9    1e-12   
ref|XP_003572558.1|  PREDICTED: uncharacterized protein LOC100829717  74.3    1e-12   
ref|XP_004142814.1|  PREDICTED: uncharacterized protein LOC101207913  74.3    1e-12   
ref|XP_002869128.1|  hypothetical protein ARALYDRAFT_491180           73.9    1e-12   
ref|XP_008383090.1|  PREDICTED: auxin-induced protein X15             73.6    1e-12   
ref|XP_004303544.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.6    1e-12   
emb|CDX79712.1|  BnaC03g20480D                                        73.2    1e-12   
ref|XP_008801409.1|  PREDICTED: uncharacterized protein LOC103715...  73.9    1e-12   
ref|XP_004497595.1|  PREDICTED: auxin-induced protein 6B-like         73.2    1e-12   
gb|ADE76442.1|  unknown                                               74.3    1e-12   
ref|XP_002273092.1|  PREDICTED: auxin-induced protein X15             73.2    1e-12   
ref|XP_009133110.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.2    1e-12   
emb|CDP13586.1|  unnamed protein product                              73.6    1e-12   
gb|KGN57847.1|  hypothetical protein Csa_3G346940                     73.9    1e-12   
ref|NP_191749.1|  SAUR-like auxin-responsive protein                  73.2    1e-12   
ref|NP_001235246.1|  uncharacterized protein LOC100526867             73.2    1e-12   
ref|XP_010669485.1|  PREDICTED: uncharacterized protein DDB_G0283357  75.1    1e-12   
ref|XP_006292206.1|  hypothetical protein CARUB_v10018411mg           73.6    1e-12   
ref|XP_002974386.1|  hypothetical protein SELMODRAFT_19563            71.6    1e-12   
ref|XP_009630044.1|  PREDICTED: uncharacterized protein LOC104120067  73.9    1e-12   
ref|XP_011084554.1|  PREDICTED: auxin-induced protein 10A5-like       73.2    1e-12   
ref|XP_009341716.1|  PREDICTED: auxin-induced protein X15-like        73.2    2e-12   
ref|XP_004289003.1|  PREDICTED: uncharacterized protein LOC101294986  74.3    2e-12   
ref|XP_004238340.1|  PREDICTED: auxin-induced protein 10A5            73.2    2e-12   
ref|XP_009351936.1|  PREDICTED: auxin-induced protein 15A-like        73.2    2e-12   
ref|XP_008663699.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.2    2e-12   
ref|XP_003523333.1|  PREDICTED: auxin-induced protein X15             72.8    2e-12   
ref|XP_007203531.1|  hypothetical protein PRUPE_ppa026695mg           72.8    2e-12   
ref|XP_008343461.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    2e-12   
ref|XP_008243661.1|  PREDICTED: auxin-induced protein X10A            72.8    2e-12   
ref|XP_003553600.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    2e-12   
emb|CAN71368.1|  hypothetical protein VITISV_014692                   72.4    2e-12   
ref|XP_009401534.1|  PREDICTED: uncharacterized protein LOC103985535  73.2    2e-12   
ref|XP_003590390.1|  Auxin-induced protein 6B                         72.8    2e-12   
ref|NP_001236981.1|  uncharacterized protein LOC100527760             73.2    2e-12   
ref|XP_002282286.1|  PREDICTED: auxin-induced protein 15A             72.8    2e-12   
ref|XP_007154547.1|  hypothetical protein PHAVU_003G127800g           75.5    2e-12   
ref|XP_004309365.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.4    2e-12   
ref|XP_006412188.1|  hypothetical protein EUTSA_v10026506mg           73.2    2e-12   
ref|XP_006647269.1|  PREDICTED: auxin-induced protein 15A-like        72.8    2e-12   
ref|NP_001238039.1|  uncharacterized protein LOC100527570             73.6    2e-12   
ref|XP_004488140.1|  PREDICTED: uncharacterized protein LOC101508911  73.2    2e-12   
ref|XP_003546804.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    2e-12   
ref|XP_011095706.1|  PREDICTED: auxin-induced protein X15-like        72.4    2e-12   
ref|XP_010908835.1|  PREDICTED: auxin-induced protein 10A5-like       73.6    2e-12   
ref|XP_006343120.1|  PREDICTED: uncharacterized protein LOC102605261  73.6    2e-12   
gb|KHN07872.1|  Indole-3-acetic acid-induced protein ARG7             73.2    2e-12   
ref|NP_195201.1|  SAUR-like auxin-responsive family protein           73.2    2e-12   
ref|XP_010267445.1|  PREDICTED: auxin-induced protein X15-like        72.0    2e-12   
gb|EYU28302.1|  hypothetical protein MIMGU_mgv1a017169mg              71.6    2e-12   
ref|XP_009625794.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    2e-12   
ref|XP_007137148.1|  hypothetical protein PHAVU_009G103800g           73.2    2e-12   
gb|AEW08460.1|  hypothetical protein 2_10399_01                       72.4    2e-12   
gb|AAR20762.1|  At4g34750                                             72.8    2e-12   
ref|XP_006342029.1|  PREDICTED: auxin-induced protein 10A5-like       72.8    2e-12   
ref|XP_010112436.1|  hypothetical protein L484_013820                 73.2    2e-12   
ref|XP_008460570.1|  PREDICTED: uncharacterized protein LOC103499...  73.2    2e-12   
ref|XP_009379214.1|  PREDICTED: uncharacterized protein LOC103967662  73.6    2e-12   
ref|XP_006435148.1|  hypothetical protein CICLE_v10003150mg           72.8    3e-12   
ref|XP_010271410.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    3e-12   
ref|XP_009396221.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    3e-12   
gb|ABK27017.1|  unknown                                               72.4    3e-12   
emb|CDX75459.1|  BnaA01g02430D                                        72.4    3e-12   
ref|XP_002266248.1|  PREDICTED: auxin-induced protein X15             72.4    3e-12   
ref|XP_009334986.1|  PREDICTED: uncharacterized protein LOC103927766  73.6    3e-12   
ref|XP_008449233.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.0    3e-12   
ref|XP_004498552.1|  PREDICTED: uncharacterized protein LOC101505346  73.2    3e-12   
ref|XP_008801410.1|  PREDICTED: auxin-induced protein X10A-like i...  72.4    3e-12   
ref|XP_009402035.1|  PREDICTED: auxin-induced protein X10A-like       72.0    3e-12   
ref|XP_009591236.1|  PREDICTED: uncharacterized protein LOC104088289  72.4    3e-12   
gb|AFK41725.1|  unknown                                               73.2    3e-12   
ref|XP_006360678.1|  PREDICTED: uncharacterized protein LOC102595713  72.8    3e-12   
gb|KDP29242.1|  hypothetical protein JCGZ_16631                       71.6    3e-12   
ref|XP_010059686.1|  PREDICTED: auxin-induced protein 15A             72.0    3e-12   
ref|XP_003609957.1|  Auxin-induced protein 6B                         72.8    3e-12   
ref|XP_007161535.1|  hypothetical protein PHAVU_001G077500g           72.8    3e-12   
ref|XP_007017754.1|  SAUR-like auxin-responsive protein family        72.4    3e-12   
ref|XP_004147056.1|  PREDICTED: auxin-induced protein X10A-like       72.4    3e-12   
ref|XP_010687567.1|  PREDICTED: uncharacterized protein LOC104901671  72.4    4e-12   
ref|XP_008376188.1|  PREDICTED: auxin-induced protein X15             71.6    4e-12   
ref|XP_003544655.2|  PREDICTED: uncharacterized protein LOC100799598  72.8    4e-12   
ref|XP_004517301.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.0    4e-12   
gb|AFK41129.1|  unknown                                               72.0    4e-12   
ref|XP_010034089.1|  PREDICTED: uncharacterized protein LOC104423276  72.8    4e-12   
gb|KEH38260.1|  SAUR-like auxin-responsive family protein             72.0    4e-12   
ref|XP_007223677.1|  hypothetical protein PRUPE_ppa012903mg           72.4    4e-12   
ref|XP_009142437.1|  PREDICTED: auxin-induced protein 15A-like        71.6    4e-12   
gb|EEC67296.1|  hypothetical protein OsI_34284                        71.6    4e-12   
ref|XP_004963509.1|  PREDICTED: uncharacterized protein LOC101784697  72.8    4e-12   
ref|XP_008457620.1|  PREDICTED: uncharacterized protein LOC103497270  73.2    4e-12   
ref|XP_009366624.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.6    4e-12   
ref|XP_009342826.1|  PREDICTED: auxin-induced protein 6B-like         72.4    4e-12   
ref|XP_009614199.1|  PREDICTED: auxin-induced protein X15-like        71.6    4e-12   
ref|XP_010263292.1|  PREDICTED: uncharacterized protein LOC104601597  72.4    4e-12   
ref|XP_008466269.1|  PREDICTED: uncharacterized protein LOC103503729  72.4    4e-12   
ref|XP_008372027.1|  PREDICTED: auxin-induced protein X15-like        72.0    4e-12   
ref|XP_009595511.1|  PREDICTED: auxin-induced protein 10A5-like       72.0    4e-12   
ref|XP_008228004.1|  PREDICTED: uncharacterized protein LOC103327442  72.8    4e-12   
ref|XP_009398108.1|  PREDICTED: uncharacterized protein LOC103982799  72.8    4e-12   
ref|NP_176011.1|  SAUR-like auxin-responsive protein                  71.2    4e-12   
gb|AAK84451.1|AC087192_12  putative indole-3-acetic acid-regulate...  71.2    4e-12   
ref|XP_006410882.1|  hypothetical protein EUTSA_v10017913mg           71.6    4e-12   
ref|XP_009361828.1|  PREDICTED: auxin-induced protein X15             72.0    4e-12   
ref|XP_006473631.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.0    5e-12   
ref|XP_003529710.1|  PREDICTED: uncharacterized protein LOC100818996  72.0    5e-12   
ref|XP_003521473.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.6    5e-12   
gb|KDP27624.1|  hypothetical protein JCGZ_19629                       72.0    5e-12   
gb|KHN18223.1|  Auxin-induced protein 15A                             72.4    5e-12   
ref|XP_006575305.1|  PREDICTED: auxin-induced protein 15A-like        71.6    5e-12   
ref|XP_008381430.1|  PREDICTED: auxin-induced protein 15A-like        71.6    5e-12   
ref|XP_002323471.1|  hypothetical protein POPTR_0016s09270g           71.6    5e-12   
ref|XP_009400882.1|  PREDICTED: auxin-induced protein 15A-like        71.2    5e-12   
ref|XP_010093028.1|  hypothetical protein L484_016238                 72.0    5e-12   
ref|XP_008460569.1|  PREDICTED: uncharacterized protein LOC103499...  72.8    5e-12   
ref|XP_002513381.1|  Indole-3-acetic acid-induced protein ARG7, p...  71.6    5e-12   
ref|XP_003532931.1|  PREDICTED: auxin-induced protein 15A-like        71.6    5e-12   
ref|XP_006450104.1|  hypothetical protein CICLE_v10010302mg           72.4    5e-12   
ref|XP_006292049.1|  hypothetical protein CARUB_v10018241mg           71.2    5e-12   
ref|XP_002513015.1|  Indole-3-acetic acid-induced protein ARG7, p...  71.6    5e-12   
ref|XP_003631581.1|  PREDICTED: auxin-induced protein 6B-like         71.6    5e-12   
ref|XP_002446101.1|  hypothetical protein SORBIDRAFT_06g001800        71.6    5e-12   
gb|AAN65371.1|  auxin-regulated protein                               72.0    6e-12   
ref|NP_001065037.1|  Os10g0510500                                     71.2    6e-12   
ref|XP_008337812.1|  PREDICTED: uncharacterized protein LOC103400902  72.4    6e-12   
ref|XP_002320219.1|  auxin-responsive family protein                  70.9    6e-12   
ref|XP_008783079.1|  PREDICTED: auxin-induced protein 6B-like         71.6    6e-12   
emb|CDY13423.1|  BnaA03g51410D                                        72.4    6e-12   
ref|XP_004306248.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.2    6e-12   
ref|XP_004240286.1|  PREDICTED: uncharacterized protein LOC101252288  72.0    6e-12   
ref|XP_006483628.1|  PREDICTED: uncharacterized protein LOC102619609  72.0    6e-12   
ref|XP_002968677.1|  hypothetical protein SELMODRAFT_69255            69.7    6e-12   
ref|XP_010060852.1|  PREDICTED: auxin-induced protein X15-like        71.2    6e-12   
ref|XP_006305991.1|  hypothetical protein CARUB_v10011261mg           70.9    6e-12   
ref|XP_009764070.1|  PREDICTED: auxin-induced protein 15A-like is...  70.9    7e-12   
ref|XP_010648451.1|  PREDICTED: uncharacterized protein LOC100250771  72.0    7e-12   
ref|XP_008391870.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.2    7e-12   
ref|XP_003539973.1|  PREDICTED: indole-3-acetic acid-induced prot...  70.5    7e-12   
ref|XP_009138004.1|  PREDICTED: uncharacterized protein LOC103862042  72.8    7e-12   
ref|XP_009337658.1|  PREDICTED: uncharacterized protein LOC103930093  71.6    7e-12   
ref|XP_007216865.1|  hypothetical protein PRUPE_ppa021387mg           72.4    7e-12   
ref|XP_009366726.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.2    7e-12   
ref|XP_011086361.1|  PREDICTED: auxin-induced protein X15-like        71.2    7e-12   
ref|XP_003550112.1|  PREDICTED: uncharacterized protein LOC100779842  72.0    7e-12   
emb|CAN63902.1|  hypothetical protein VITISV_031686                   71.2    7e-12   
ref|XP_003540937.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.2    7e-12   
ref|XP_008800679.1|  PREDICTED: uncharacterized protein LOC103714966  71.6    7e-12   
ref|XP_010048675.1|  PREDICTED: auxin-induced protein 10A5            71.2    7e-12   
ref|XP_009617593.1|  PREDICTED: uncharacterized protein LOC104109910  72.8    7e-12   
ref|XP_008648308.1|  PREDICTED: small auxin up RNA1 isoform X3        72.0    7e-12   
ref|NP_001046940.1|  Os02g0512000                                     71.6    8e-12   
gb|EAY86017.1|  hypothetical protein OsI_07378                        71.6    8e-12   
ref|XP_009417641.1|  PREDICTED: auxin-induced protein 6B-like         70.5    8e-12   
ref|XP_009588676.1|  PREDICTED: auxin-induced protein 15A-like        70.9    8e-12   
ref|XP_007051462.1|  SAUR-like auxin-responsive protein family        70.9    8e-12   
ref|NP_001130827.1|  SAUR56-auxin-responsive SAUR family member       71.2    8e-12   
ref|XP_004147834.1|  PREDICTED: auxin-induced protein 6B-like         71.6    8e-12   
gb|KCW89095.1|  hypothetical protein EUGRSUZ_A01420                   71.2    8e-12   
gb|KHN10252.1|  Auxin-induced protein 15A                             72.0    8e-12   
ref|XP_007027790.1|  SAUR family protein                              70.9    8e-12   
ref|XP_007212217.1|  hypothetical protein PRUPE_ppa013119mg           71.2    8e-12   
ref|XP_009116859.1|  PREDICTED: auxin-induced protein X15             70.9    8e-12   
ref|XP_010100683.1|  hypothetical protein L484_023452                 70.9    8e-12   
ref|NP_001235627.1|  uncharacterized protein LOC100527662             71.6    8e-12   
ref|XP_007136493.1|  hypothetical protein PHAVU_009G049900g           70.9    8e-12   
ref|XP_009386328.1|  PREDICTED: uncharacterized protein LOC103973477  71.6    9e-12   
ref|XP_009359696.1|  PREDICTED: uncharacterized protein LOC103950...  72.0    9e-12   
ref|XP_008466498.1|  PREDICTED: auxin-induced protein 6B              71.2    9e-12   
ref|XP_007149317.1|  hypothetical protein PHAVU_005G060300g           71.2    9e-12   
ref|XP_001781743.1|  predicted protein                                69.3    9e-12   
gb|KDO46694.1|  hypothetical protein CISIN_1g040086mg                 71.2    9e-12   
ref|NP_001058487.2|  Os06g0701900                                     70.9    9e-12   
ref|XP_009359697.1|  PREDICTED: uncharacterized protein LOC103950...  72.0    9e-12   
ref|XP_009790302.1|  PREDICTED: uncharacterized protein LOC104237780  71.6    9e-12   
gb|KDP25041.1|  hypothetical protein JCGZ_22576                       71.6    9e-12   
ref|XP_003534357.1|  PREDICTED: auxin-induced protein 10A5-like       70.9    1e-11   
ref|XP_008380405.1|  PREDICTED: uncharacterized protein LOC103443353  72.0    1e-11   
gb|ACG34454.1|  SAUR56 - auxin-responsive SAUR family member          70.9    1e-11   
emb|CDY29803.1|  BnaC05g31870D                                        70.5    1e-11   
ref|XP_004290367.1|  PREDICTED: auxin-induced protein 10A5-like       71.2    1e-11   
emb|CDX68733.1|  BnaC01g07200D                                        72.0    1e-11   
ref|XP_010917979.1|  PREDICTED: auxin-induced protein 10A5-like       71.2    1e-11   
ref|XP_006342573.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.2    1e-11   
emb|CAN68562.1|  hypothetical protein VITISV_033102                   71.2    1e-11   
ref|NP_001105573.1|  small auxin up RNA1                              71.2    1e-11   



>ref|XP_002299329.2| hypothetical protein POPTR_0001s13460g [Populus trichocarpa]
 gb|EEE84134.2| hypothetical protein POPTR_0001s13460g [Populus trichocarpa]
Length=229

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 103/152 (68%), Gaps = 24/152 (16%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRS-----------------KLGCDDEDGRK--KLRRVAPE  390
            N I+KTW++CKS+G   G +R+                 K+  +D+  RK  + RRVAPE
Sbjct  82   NLIIKTWERCKSIGR--GSKRTSRLVRSLTPKSKSYPHIKVSLEDDHDRKHSRQRRVAPE  139

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC SVYVG + +RFVIKTEY NHPLFKMLLEEAESEYGY + GPL LPC+VD+F +VL+ 
Sbjct  140  GCFSVYVGPQKQRFVIKTEYANHPLFKMLLEEAESEYGYSSEGPLTLPCNVDIFYRVLMA  199

Query  571  VEMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
            VE  + DD I++  GC FA++   +YH LSPS
Sbjct  200  VEDTNIDDKIHL--GCGFAKN-YGSYHLLSPS  228



>ref|XP_009624882.1| PREDICTED: auxin-induced protein 10A5-like [Nicotiana tomentosiformis]
Length=148

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 101/138 (73%), Gaps = 6/138 (4%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEY  450
             I KTW++CKS G       ++     +  RK+ R VA EGC SVYVG++ +RFVI+TEY
Sbjct  13   LIPKTWERCKSFGR-KNSSENRHALTTKKTRKRAR-VATEGCFSVYVGQQKQRFVIRTEY  70

Query  451  VNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFAR  630
            VNHP+FKMLLEEAESE+GY++ GPL LPCD+D+F+KVL  +EMDSD+   + R GC+FAR
Sbjct  71   VNHPIFKMLLEEAESEFGYNSKGPLVLPCDIDIFLKVL--MEMDSDEIIGHHRHGCSFAR  128

Query  631  SPAAAYHHLSPSPF*AFN  684
            + ++  +HL+P+ F A N
Sbjct  129  TYSS--YHLTPTRFVAMN  144



>ref|XP_011036123.1| PREDICTED: uncharacterized protein LOC105133729 [Populus euphratica]
 ref|XP_011036124.1| PREDICTED: uncharacterized protein LOC105133729 [Populus euphratica]
Length=229

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 24/152 (16%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRS-----------------KLGCDDEDGRK--KLRRVAPE  390
            N I+KTW++CKS+G   G +R+                  +  +D++ RK  + RR+APE
Sbjct  82   NLIIKTWERCKSIGR--GSKRTPRLVGSLTPNSNSYPHINVSLEDDNDRKHSRQRRIAPE  139

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC SVYVG + +RFVIK EY NHPLFKMLLEE ESEYGY + GPL LPCDVD+F KVL+ 
Sbjct  140  GCFSVYVGPQKQRFVIKAEYANHPLFKMLLEEVESEYGYTSEGPLTLPCDVDIFYKVLMA  199

Query  571  VEMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
            VE  + DD I++  GC FA++   +YH LSPS
Sbjct  200  VEDANIDDKIHL--GCGFAKN-YGSYHLLSPS  228



>ref|XP_010249111.1| PREDICTED: uncharacterized protein LOC104591786 [Nelumbo nucifera]
Length=161

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (68%), Gaps = 19/154 (12%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRS-------------KLGCDDEDGRKKL-RRVAPEGCLSVY  408
             I+KTW++C+S+G  VG ++S             +     +DG++ + RRVAPEGC SVY
Sbjct  13   LIVKTWERCRSIG--VGGKKSSGITPIAKSKSWPRTPDSSDDGKRGVNRRVAPEGCFSVY  70

Query  409  VGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD  588
            VG + +RFVIKTEYVNHPLFKMLL+EAE EYGY++ GPL LPCDVDLF KVL  +EM SD
Sbjct  71   VGPQKQRFVIKTEYVNHPLFKMLLDEAEMEYGYNSAGPLALPCDVDLFYKVL--LEMGSD  128

Query  589  DDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
            +++I  ++GC F +    +Y  LSPS     N F
Sbjct  129  ENEIIHQQGCNFTKG-YNSYRLLSPSRMALINRF  161



>gb|AFK33528.1| unknown [Lotus japonicus]
Length=171

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
            + I KTW++CKS+G     R ++       G K    VAPEGC SVYVG++ +RFVIKTE
Sbjct  29   SLITKTWERCKSIGRGTTTRITRSKSWPSRG-KSTTVVAPEGCFSVYVGQQMQRFVIKTE  87

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
            YVNHPLFKMLLEEAESEYGY + GP+ LPC+VD+F KVL+E++ ++   D     GCAF 
Sbjct  88   YVNHPLFKMLLEEAESEYGYSSQGPIVLPCNVDVFYKVLMEMDEETSTPDQPQPHGCAFV  147

Query  628  RSPAAAYHHL-SPSPF*AFN  684
            +  + + +HL SPS   A N
Sbjct  148  KQRSRSSYHLPSPSRMLAIN  167



>ref|XP_009770405.1| PREDICTED: auxin-induced protein 10A5-like [Nicotiana sylvestris]
Length=148

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 7/134 (5%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEY  450
             I KTW++CKS G       ++     +  RK++R VA EGC S+YVG + +RFVI+TEY
Sbjct  13   LIPKTWERCKSFGR-KNSSENRHALTTKKTRKRVR-VATEGCFSIYVGPQKQRFVIRTEY  70

Query  451  VNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFAR  630
            VNHP+FKMLLEEAESE+GY++ GPL LPCDVD+F+KVL  +EMDSD+   + RRGC+FAR
Sbjct  71   VNHPIFKMLLEEAESEFGYNSKGPLVLPCDVDIFLKVL--MEMDSDEIG-HPRRGCSFAR  127

Query  631  SPAAAYHHLSPSPF  672
            + ++  +HL+P+ F
Sbjct  128  TYSS--YHLTPTRF  139



>ref|XP_007043889.1| SAUR family protein [Theobroma cacao]
 gb|EOX99720.1| SAUR family protein [Theobroma cacao]
Length=154

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = +1

Query  268  NFIMKTWKKCKSLG---WFVGKRRSKLGCD---DEDGRKKLRRVAPEGCLSVYVGEEGRR  429
            N I+KTW++CKS+G       K +S    D    E+ R +  RVAPEGC SVYVG   +R
Sbjct  13   NLIVKTWERCKSIGRARALSKKSKSWPSMDASLKEEKRTRKNRVAPEGCFSVYVGPRRQR  72

Query  430  FVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVR  609
            FVIKTEY NHPLFK+LLEEAESEYG+++ GPL LPC+VDLF KVL+ +    DD D  +R
Sbjct  73   FVIKTEYANHPLFKILLEEAESEYGFNSEGPLVLPCNVDLFCKVLLAM----DDGDNKIR  128

Query  610  RGCAFARSPAAAYHHLSPSPF*AFN*F  690
            +GC+FA+    +Y  LSP    A N F
Sbjct  129  QGCSFAKG-YGSYRLLSPPRMIAINQF  154



>ref|XP_002303770.1| hypothetical protein POPTR_0003s16580g [Populus trichocarpa]
 gb|EEE78749.1| hypothetical protein POPTR_0003s16580g [Populus trichocarpa]
Length=167

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 102/160 (64%), Gaps = 24/160 (15%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRS-----------------KLGCDDEDGRKKLR--RVAPE  390
            N I+KTW++C S G   G +R+                 K+  +D+  +K  R  RVAPE
Sbjct  13   NLIIKTWERCISFGR--GSKRTSRLERSLTPKSKSCPHIKVSLEDDHDQKHSRKSRVAPE  70

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC SVYVG + +RFVIKTEY NHPLFK+LLEEAESEYGY+  GPL LPC+VD+F KVL+ 
Sbjct  71   GCFSVYVGPQKQRFVIKTEYANHPLFKILLEEAESEYGYNPEGPLTLPCNVDIFYKVLMA  130

Query  571  VEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
            +E    D+ I+  RGC+FA++   +YH LSPS     N F
Sbjct  131  MEDTGIDNKIH--RGCSFAKN-YGSYHLLSPSRMIVLNQF  167



>ref|XP_011020815.1| PREDICTED: uncharacterized protein LOC105123051 [Populus euphratica]
Length=167

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 24/152 (16%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRS-----------------KLGCDDEDGRKKLR--RVAPE  390
            N I+KTW++C S G   G +R+                 K+  +D+  +K  R  RVAPE
Sbjct  13   NLIIKTWERCISFGR--GSKRTSRLERSLTPESKSCPHIKVSLEDDHDQKHSRKSRVAPE  70

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC SVYVG + +RFVIKTEY NHPLFK+LLEEAESEYGY+  GPL LPC+VD+F KVL+ 
Sbjct  71   GCFSVYVGPQKQRFVIKTEYANHPLFKILLEEAESEYGYNPEGPLTLPCNVDIFYKVLMA  130

Query  571  VEMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
            +E    D+ I+  RGC FA++   +YH LSPS
Sbjct  131  MEDTGIDNKIH--RGCRFAKN-YGSYHLLSPS  159



>ref|XP_009349477.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=153

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 100/158 (63%), Gaps = 21/158 (13%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLG------------WFVGKRRS----KLGCDDEDGRKKLRRVAPEGC  396
            +  I +TWK+CKS+G                K +S     LG  +E  R   R+VAPEGC
Sbjct  1    MGLITETWKRCKSIGRGRPTNIHGMVPALTTKSKSCPNINLGIPEEK-RASKRQVAPEGC  59

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +VYVG + +RFV+KTE+ NHPLFKMLLEEAESE+GYD+ GPL LPC+V++F KVL+E++
Sbjct  60   FTVYVGSQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCNVEIFYKVLMEMD  119

Query  577  MDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
               D  D  V +GC  A+    +YHHL+PS   A N F
Sbjct  120  ---DCGDQKVPQGCGLAKR-YGSYHHLTPSRMVAINQF  153



>ref|XP_004228430.1| PREDICTED: auxin-induced protein X10A-like [Solanum lycopersicum]
Length=149

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYV  453
            I KTW++CKS G       ++     +  RK   RV+ +GC SVYVG   +RF IK EYV
Sbjct  15   IPKTWERCKSFGRKNSLENNQHALTTKRSRKSKHRVSTQGCFSVYVGSYKQRFAIKIEYV  74

Query  454  NHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFARS  633
            NHPLFKMLL+EAESE+GY++ GPL LPCDVD F+ +L  +E+DS++ +     GC F+RS
Sbjct  75   NHPLFKMLLDEAESEFGYNSKGPLVLPCDVDFFLNLL--MELDSNEAN---HHGCGFSRS  129

Query  634  PAAAYHHLSPSPF  672
               +YHHL+P+ F
Sbjct  130  --YSYHHLTPTIF  140



>ref|XP_006363778.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=141

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYV  453
            I KTW++CKS G       ++     +  RK   RV+ +GC SVYVG + +RF IKTEYV
Sbjct  15   IPKTWERCKSFGRKNSLENNQHALTTKRARKSRYRVSTQGCFSVYVGSDKQRFAIKTEYV  74

Query  454  NHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFARS  633
            NHPLFKMLL+EAESE+GY++ GPL LPCDVD F+ +L  +E+DS++ +     GC F RS
Sbjct  75   NHPLFKMLLDEAESEFGYNSKGPLVLPCDVDFFLNLL--MELDSNEAN---HHGCGFTRS  129

Query  634  PAAAYHHLSPSPF  672
               +Y+HL+P+ F
Sbjct  130  --YSYYHLTPTIF  140



>gb|AFK48563.1| unknown [Medicago truncatula]
 gb|KEH21449.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=162

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 97/157 (62%), Gaps = 25/157 (16%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLGW-----------FVGKRRSK----LGCDDEDGRKKLRRVAPEGCL  399
            +  I KTW++CKS+G                RRSK    L   +E+ RKK   VAPEGC 
Sbjct  16   IGLITKTWERCKSIGGGHKSKSYSSSVTPTTRRSKSWPGLPRGEENRRKK---VAPEGCF  72

Query  400  SVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEM  579
            SVYVG + +RFVIKTEY NHPLFKMLLEEAESEYGY   GPL LPC+VD+F KVL+E+  
Sbjct  73   SVYVGPQMQRFVIKTEYANHPLFKMLLEEAESEYGYSCQGPLALPCNVDVFYKVLMEM--  130

Query  580  DSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
                D+    +GC F RS  ++YH LSPS     N F
Sbjct  131  ----DNEAPLQGCTFGRS-RSSYHLLSPSRMIVLNNF  162



>ref|XP_008340250.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
 ref|XP_008361853.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=153

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 99/158 (63%), Gaps = 21/158 (13%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLG------------WFVGKRRS----KLGCDDEDGRKKLRRVAPEGC  396
            +  I KTWK+CKS+G                K +S     LG  +E  R   R+VAPEGC
Sbjct  1    MGLITKTWKRCKSIGRGRPTNIHGMVPALTTKSKSCPNINLGIPEEK-RATKRQVAPEGC  59

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +VYVG + +RFV+KTE+ NHPLFKMLLEEAESE+GYD+ GPL LPCDV++F KVL+E++
Sbjct  60   FTVYVGSQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCDVEIFYKVLMEMD  119

Query  577  MDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
               D  D  V +GC  A+    +YH L+PS   A N F
Sbjct  120  ---DCGDQKVPQGCGLAKR-YGSYHLLTPSRMVAINQF  153



>ref|XP_003631359.1| PREDICTED: auxin-induced protein 6B-like [Vitis vinifera]
Length=153

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 95/159 (60%), Gaps = 23/159 (14%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLG-----------------WFVGKRRSKLGCDDEDGRKKLRRVAPEG  393
            +  I KTW +CKS                   W      +     ++D R K  RVAPEG
Sbjct  1    MGLIKKTWNRCKSFSHGRSSENIPRAPKKSKSWPRITAAAAAASLEDDKRVKKGRVAPEG  60

Query  394  CLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEV  573
            C SVYVG E +RFVIKTEY NHPLFK+LLEEAE EYGY++ GPL LPC+V++F KVL  +
Sbjct  61   CFSVYVGPEKQRFVIKTEYANHPLFKILLEEAELEYGYNSEGPLALPCNVEIFHKVL--L  118

Query  574  EMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
            EMDS D    + +GC F RS  ++Y  LSPSP  A N F
Sbjct  119  EMDSSDK---IHQGCTFPRS-HSSYRLLSPSPMIAMNHF  153



>ref|XP_002514869.1| hypothetical protein RCOM_1078910 [Ricinus communis]
 gb|EEF47423.1| hypothetical protein RCOM_1078910 [Ricinus communis]
Length=174

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 102/166 (61%), Gaps = 28/166 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLG-----------WFVGKRRS--------KLGCDDEDGRKKLRR---V  381
            N I+KTW++CKSLG             + K +S         +G DD+       R   V
Sbjct  12   NLIIKTWERCKSLGRGSKRTSRLVGSLITKSKSLPHLHIHPSIGDDDQRSSSSSSRKRRV  71

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
            APEGC SVYVG E +RFVIKTEY NHPLFK+LLEEAESEYGY+  GPL LPC+VD+F KV
Sbjct  72   APEGCFSVYVGPEKQRFVIKTEYANHPLFKVLLEEAESEYGYNPEGPLALPCNVDIFCKV  131

Query  562  LVEVEMDSDDDDI---YVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
            L  V MDS DD+    + R+GC F+++   +Y  LSPS   A N F
Sbjct  132  L--VAMDSSDDEAIHPHRRQGCGFSKN-YGSYRLLSPSRTTALNHF  174



>ref|XP_008222216.1| PREDICTED: uncharacterized protein LOC103322112 [Prunus mume]
Length=165

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 100/160 (63%), Gaps = 24/160 (15%)
 Frame = +1

Query  271  FIMKTWKKCKSLG---------------WFVGKRRS----KLGCDD-EDGRKKLRRVAPE  390
             I+KTW++CKS+G                   K RS     LG  + E+ R   R+VAPE
Sbjct  10   LIVKTWERCKSIGRGRNMTTTTATTMVPALTIKSRSCPHINLGVPEREEKRTSRRQVAPE  69

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC SVYVG + +RFV+KTEY NHPLFKMLLEEAESE+GYD+ GPL LPC+V++F KVL+E
Sbjct  70   GCFSVYVGPQKQRFVVKTEYANHPLFKMLLEEAESEFGYDSQGPLVLPCNVEVFYKVLME  129

Query  571  VEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
            ++   D  +  V +GC  A+    +YH LSPS   A N F
Sbjct  130  MD---DCGNPKVPQGCGLAKR-YGSYHLLSPSRMVAINQF  165



>gb|KDO83113.1| hypothetical protein CISIN_1g030719mg [Citrus sinensis]
Length=172

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 97/165 (59%), Gaps = 28/165 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDED--------------------GRKKLRRVAP  387
            N I+KTW++CKS+G    +    L    +                      +K  RRVAP
Sbjct  12   NLIVKTWERCKSIGRSSKRSAPALRVKSKSWPRIDTRLEEEEEDEEEEKRSKKLKRRVAP  71

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG + +RFVIKTEYVNHPLFK+LLEEAESEYG+ + GPL LPC VD+F +VL+
Sbjct  72   EGCFSVYVGPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSEGPLVLPCRVDVFYRVLL  131

Query  568  EV---EMDSDDDDIYVRR-GCAFARSPAAAYHHLSPSPF*AFN*F  690
             V   + D + +D ++RR GC F +     Y  LSPSP    N F
Sbjct  132  AVDDHDHDHNKEDNFIRRPGCGFGK----GYRLLSPSPMIPINHF  172



>gb|AGR44724.1| SAUR family protein [Morus alba]
Length=182

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 95/166 (57%), Gaps = 27/166 (16%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLR------------------------  375
            N I KTW++CKS+G  + +  S  G     G  K                          
Sbjct  19   NLINKTWQRCKSIGRGL-RSTSPAGRSIGHGMTKKSKSWPRMINAAATHEEEKRERESKK  77

Query  376  -RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
             RVAPEGC SVYVG + +RFV+KT+Y+NHPLFKMLLEEAESE+GYD  GPL LPC+VD+F
Sbjct  78   GRVAPEGCFSVYVGPQRQRFVVKTQYLNHPLFKMLLEEAESEFGYDTQGPLMLPCNVDIF  137

Query  553  VKVLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
             +VL+E++ D    D      C FA+ P  +YH LSPS   A N F
Sbjct  138  YRVLMEMDNDDGGADKIHPGYCGFAKRP-GSYHLLSPSRMVAINQF  182



>ref|XP_003552755.1| PREDICTED: uncharacterized protein LOC100777217 [Glycine max]
 gb|KHN12589.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=172

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 92/157 (59%), Gaps = 23/157 (15%)
 Frame = +1

Query  271  FIMKTWKKCKSLG------------WFVGKRRSKL-----GCDDEDGRKKLRRVAPEGCL  399
             I KTW++CKS+G                  RSK        ++++  K    VAPEGC 
Sbjct  22   LITKTWERCKSIGRSRKEASSNSLNTNTNTMRSKSWPNRNRAENKNKNKNSTIVAPEGCF  81

Query  400  SVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEM  579
            SVYVG + +RFVIKTEY NHPLFKMLLEEAESEYGY++ GPL LPC VD+F KVL  +EM
Sbjct  82   SVYVGPQMQRFVIKTEYANHPLFKMLLEEAESEYGYNSQGPLALPCHVDVFYKVL--MEM  139

Query  580  DSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
            DSD+        CA  +   +AY  L  SP  + N F
Sbjct  140  DSDE----THGSCACVKRSPSAYQLLRTSPMLSINHF  172



>ref|XP_007227681.1| hypothetical protein PRUPE_ppa026219mg [Prunus persica]
 gb|EMJ28880.1| hypothetical protein PRUPE_ppa026219mg [Prunus persica]
Length=160

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 96/151 (64%), Gaps = 23/151 (15%)
 Frame = +1

Query  271  FIMKTWKKCKSLG--------------WFVGKRRS----KLGCDD-EDGRKKLRRVAPEG  393
             I+KTW++CKS+G                  K RS     LG    E+ R   R+VAPEG
Sbjct  10   LIVKTWERCKSIGRGRNMTTTTTTMVPSLTIKSRSCPHINLGVPKREEKRASRRQVAPEG  69

Query  394  CLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEV  573
            C SVYVG + ++FV+KTEY NHPLFKMLLEEAESE+GYD+ GPL LPC+V++F KVL+E+
Sbjct  70   CFSVYVGPQKQKFVVKTEYANHPLFKMLLEEAESEFGYDSQGPLVLPCNVEVFYKVLMEM  129

Query  574  EMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
            +   D  +  V +GC  A+    +YH LSPS
Sbjct  130  D---DCGNPKVPQGCGLAKR-YGSYHLLSPS  156



>ref|XP_006438814.1| hypothetical protein CICLE_v10032901mg [Citrus clementina]
 gb|ESR52054.1| hypothetical protein CICLE_v10032901mg [Citrus clementina]
Length=174

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 97/167 (58%), Gaps = 30/167 (18%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDED--------------------GRKKLRRVAP  387
            N I+KTW++CKS+G    +    L    +                      +K  RRVAP
Sbjct  12   NLIVKTWERCKSIGRSSKRSAPALRVKSKSWPRIDTRLEEEEEDEEEEKRSKKLKRRVAP  71

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG + +RFVIKTEYVNHPLFK+LLEEAESEYG+ + GPL LPC VD+F +VL+
Sbjct  72   EGCFSVYVGPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSEGPLVLPCRVDVFYRVLL  131

Query  568  EV-----EMDSDDDDIYVRR-GCAFARSPAAAYHHLSPSPF*AFN*F  690
             V     + D + +D ++RR GC F +     Y  LSPSP    N F
Sbjct  132  AVDDHDHDHDHNKEDNFIRRPGCGFGK----GYRLLSPSPMIPINHF  174



>ref|XP_002264638.1| PREDICTED: uncharacterized protein LOC100245472 [Vitis vinifera]
 emb|CBI38161.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 92/147 (63%), Gaps = 15/147 (10%)
 Frame = +1

Query  271  FIMKTWKKCKSLGW---------FVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEG  423
             + KTW++ KS G             K +S+ G        K  RVAPEGC SVYVG   
Sbjct  12   LMKKTWEQFKSFGHGRILSRTHHSSMKSKSRPGHTASLEGVKKGRVAPEGCFSVYVGHGK  71

Query  424  RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIY  603
            +RFV+KTEY NHPLF+ LLEEAE EYGY+ GGPL LPC V++F+KVL  +EMDS D+   
Sbjct  72   QRFVVKTEYANHPLFRALLEEAELEYGYNNGGPLVLPCKVEIFLKVL--LEMDSSDE---  126

Query  604  VRRGCAFARSPAAAYHHLSPSPF*AFN  684
            V +GC+FARSP ++Y  L PS     N
Sbjct  127  VHQGCSFARSP-SSYRLLGPSRMITMN  152



>emb|CAN66812.1| hypothetical protein VITISV_011138 [Vitis vinifera]
Length=154

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 92/147 (63%), Gaps = 15/147 (10%)
 Frame = +1

Query  271  FIMKTWKKCKSLGW---------FVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEG  423
             + KTW++ KS G             K +S+ G        K  RVAPEGC SVYVG   
Sbjct  12   LMKKTWEQFKSFGHRRILSRTHHSSMKSKSRPGHTASLEGVKKGRVAPEGCFSVYVGHGK  71

Query  424  RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIY  603
            +RFV+KTEY NHPLF+ LLEEAE EYGY+ GGPL LPC V++F+KVL  +EMDS D+   
Sbjct  72   QRFVVKTEYANHPLFRALLEEAELEYGYNNGGPLVLPCKVEIFLKVL--LEMDSSDE---  126

Query  604  VRRGCAFARSPAAAYHHLSPSPF*AFN  684
            V +GC+FARSP ++Y  L PS     N
Sbjct  127  VHQGCSFARSP-SSYRLLGPSRMITMN  152



>ref|XP_004310111.1| PREDICTED: uncharacterized protein LOC101294039 [Fragaria vesca 
subsp. vesca]
Length=171

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 92/165 (56%), Gaps = 25/165 (15%)
 Frame = +1

Query  268  NFIMKTWKKCKSLG-----WFVGKRRSKLGCDDEDGRKK-------------------LR  375
              I KTW++CKS+G        G   S         + K                    R
Sbjct  8    GLITKTWERCKSIGRKSSITSTGTATSSPAVPALTKKSKSCPHIVLSMTDDDDDRRRHRR  67

Query  376  RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            +VAPEGC SVYVG E +RFV+KTEY NHPLFK+LLEEAESE+GY + GPL LPCDV +F 
Sbjct  68   QVAPEGCFSVYVGSEKQRFVVKTEYANHPLFKLLLEEAESEFGYHSKGPLVLPCDVQVFY  127

Query  556  KVLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
            KVL+E+E    D    V RGC FA+    +YH LSPS   A N F
Sbjct  128  KVLLEMEDCGGDGVDKVSRGCGFAKR-YGSYHLLSPSRMVAINQF  171



>emb|CDP13382.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 96/149 (64%), Gaps = 25/149 (17%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGC----------------DDEDGRKKLRRVAPEGCLS  402
             I+K W++C+S G  +G  RS+                   + +  R K  RVAPEGC S
Sbjct  12   LILKAWERCRSFGG-IGSSRSRHAAKLKSKSWTGSAAASTREADPKRAKNPRVAPEGCFS  70

Query  403  VYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMD  582
            VYVG + +RFVIKTE +NHPL KMLLEEAESEYGY   GPL+LPCDVD FVKVLVE+   
Sbjct  71   VYVGAQKQRFVIKTECLNHPLLKMLLEEAESEYGYTNDGPLELPCDVDHFVKVLVEM---  127

Query  583  SDDDDIYVRRGCAFARSPAAAYHHLSPSP  669
             D D+I+ R  C+F+++ ++  +HL PSP
Sbjct  128  -DCDEIHPR--CSFSKTYSS--YHLLPSP  151



>ref|XP_009336447.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=153

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 21/158 (13%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLG------------WFVGKRRS----KLGCDDEDGRKKLRRVAPEGC  396
            +  I KTWK+CKS+G                K +S    KLG  +E  R   R+VAPEGC
Sbjct  1    MGLITKTWKRCKSIGRGRPTNLHGMVPALTTKSKSCPHIKLGMLEEK-RASKRQVAPEGC  59

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +VYVG + +RFV+KTE+ NHPLFKMLLEEAESE+GYD+ GPL LPC+V++F KVLVE++
Sbjct  60   FTVYVGPQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCNVEIFYKVLVEMD  119

Query  577  MDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
               D  +  V RG   A+    +Y  LSPS   A N F
Sbjct  120  ---DCGEQKVPRGWGLAKR-YGSYSVLSPSRIVAINQF  153



>ref|XP_010090676.1| hypothetical protein L484_017482 [Morus notabilis]
 gb|EXB40340.1| hypothetical protein L484_017482 [Morus notabilis]
Length=179

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 93/166 (56%), Gaps = 27/166 (16%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLR------------------------  375
            N I KTW++CKS+G  + K  S  G     G  K                          
Sbjct  16   NLINKTWQRCKSIGRGL-KSTSPAGRSIGHGMTKKSKSWPRMINAAATHEEEKRERESKK  74

Query  376  -RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
             RVAPEGC SVYVG + +RFV+KT+Y+NHPLFKMLLEEAESE+GYD  GPL LPC+VD+F
Sbjct  75   GRVAPEGCFSVYVGPQRQRFVVKTQYLNHPLFKMLLEEAESEFGYDTQGPLMLPCNVDIF  134

Query  553  VKVLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
             KVL+E++ D    D      C F +    +YH LSPS   A N F
Sbjct  135  YKVLMEMDNDDGGADKIHPGYCGFPKR-HGSYHLLSPSRMVAINQF  179



>ref|XP_008389916.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
 ref|XP_008350962.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=153

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 21/158 (13%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLG------------WFVGKRRS----KLGCDDEDGRKKLRRVAPEGC  396
            +  I KTWK+CKS+G                K +S    KLG  +E  R   R+VAPEGC
Sbjct  1    MGLITKTWKRCKSIGRGRPTNLHGMVPALTTKSKSCPHIKLGMLEEK-RASKRQVAPEGC  59

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +VYVG + +RFV+KTE+ NHPLFKMLLEEAESE+GYD+ GPL LPC+V++F KVLVE++
Sbjct  60   FTVYVGPQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCNVEIFHKVLVEMD  119

Query  577  MDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
               D  +  V RG   A+    +Y  LSPS   A N F
Sbjct  120  ---DCGEQKVPRGWGLAKR-YGSYSVLSPSRMVAINQF  153



>ref|XP_004491682.1| PREDICTED: uncharacterized protein LOC101512600 [Cicer arietinum]
Length=172

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 96/157 (61%), Gaps = 23/157 (15%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWF-------------VGKRRSK---LGCDDEDGRKKLRRVA-PEGCL  399
             I KTW++CKS+G                  RRSK   +   DE G KKL  V  P+G  
Sbjct  18   MITKTWERCKSIGRGGYKSKYSSSTINPTATRRSKSWPIRRGDEKGEKKLGSVVVPQGYF  77

Query  400  SVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEM  579
             VYVG + ++FVIKTEY NHPLFK+LLEEAE+EYGY + GPL LPC+VD+F KVL+E+  
Sbjct  78   CVYVGPQMQKFVIKTEYCNHPLFKILLEEAETEYGYSSQGPLALPCNVDVFYKVLMEM--  135

Query  580  DSDDDDIYVRRGCAFARS--PAAAYHHLSPSPF*AFN  684
              D + +  R+GCAF  +    ++YH LSPS   A N
Sbjct  136  --DSEVMNSRQGCAFRGNYRSRSSYHLLSPSRILALN  170



>ref|XP_006483047.1| PREDICTED: uncharacterized protein LOC102613185 [Citrus sinensis]
Length=178

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 92/171 (54%), Gaps = 34/171 (20%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDED--------------------GRKKLRRVAP  387
            N I+KTW++CKS+G    +    L    +                      +K  RRVAP
Sbjct  12   NLIVKTWERCKSIGRSSKRSAPALRVKSKSWPRIDTRLEEEEEDEEEEKRSKKLKRRVAP  71

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG + +RFVIKTEYVNHPLFK+LLEEAESEYG+ + GPL LPC VD+F +VL+
Sbjct  72   EGCFSVYVGPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSEGPLVLPCRVDVFYRVLL  131

Query  568  EV----------EMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
             V             +  DD   R GC F +     Y  LSPSP    N F
Sbjct  132  AVDDHDHDHDHDHDHNKVDDFIRRPGCGFGK----GYRLLSPSPMIPINHF  178



>gb|KDP26852.1| hypothetical protein JCGZ_18010 [Jatropha curcas]
Length=175

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 100/169 (59%), Gaps = 33/169 (20%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKL----------------------GCDDEDGRKK----  369
            N I+KTW++CKSLG    K+ S++                        DD+D + K    
Sbjct  12   NLIIKTWERCKSLGR-SSKKTSRIVKSLTAKSKSWPRVPPLIHDEGQEDDQDNKNKKCSS  70

Query  370  -LRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVD  546
              R+V PEGC SV VG + +RF IKTEY NHPLFK+LLEEAESEYGY+  GPL LPC+VD
Sbjct  71   RKRKVTPEGCFSVCVGPQKQRFFIKTEYANHPLFKILLEEAESEYGYNPEGPLALPCNVD  130

Query  547  LFVKVLVEVEMDSDDDDIYVR-RGCAFARSPAAAYHHLSPSPF*AFN*F  690
            +FV+VL  +   +D+++   R  GC F+++   +Y  LSPS   A N F
Sbjct  131  IFVEVLSAM---ADNEETTNRIHGCGFSKN-FNSYRLLSPSRMVAINHF  175



>gb|ADU56197.1| SAUR family protein [Jatropha curcas]
Length=182

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 97/161 (60%), Gaps = 33/161 (20%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKL----------------------GCDDEDGRKK----  369
            N I+KTW++CKSLG    K+ S++                        DD+D + K    
Sbjct  12   NLIIKTWERCKSLGR-SSKKTSRIVKSLTAKSKSWPRVPPLIHDEGQEDDQDNKNKKCSS  70

Query  370  -LRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVD  546
              R+V PEGC SV VG + +RF IKTEY NHPLFK+LLEEAESEYGY+  GPL LPC+VD
Sbjct  71   RKRKVTPEGCFSVCVGPQKQRFFIKTEYANHPLFKILLEEAESEYGYNPEGPLALPCNVD  130

Query  547  LFVKVLVEVEMDSDDDDIYVR-RGCAFARSPAAAYHHLSPS  666
            +FV+VL  +   +D+++   R  GC F+++   +Y  LSPS
Sbjct  131  IFVEVLSAM---ADNEETTNRIHGCGFSKN-FNSYRLLSPS  167



>ref|XP_007038060.1| Calmodulin binding protein, putative [Theobroma cacao]
 gb|EOY22561.1| Calmodulin binding protein, putative [Theobroma cacao]
Length=180

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 86/141 (61%), Gaps = 24/141 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCD------------------DEDGRKKLRRVAPEG  393
            N + + W++C SLG   GK+ S   CD                  +ED  KK R+VAPEG
Sbjct  11   NVLFRAWERCWSLG-TGGKKSSGTSCDALRKSKSWHSTTTRSSSLEEDEGKKRRQVAPEG  69

Query  394  CLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEV  573
            C SVYVG + +RFV+KTE+ NHPLFKMLLE+AE EYG+ + GPL LPCDVDLF KVL   
Sbjct  70   CFSVYVGPQRQRFVVKTEFANHPLFKMLLEDAELEYGFSSEGPLLLPCDVDLFYKVL--A  127

Query  574  EMDSDDDDIYVRRGCAFARSP  636
            EMD   +   VR    FA SP
Sbjct  128  EMDGGKEISPVR---GFAYSP  145



>gb|KHN24973.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=176

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 92/153 (60%), Gaps = 23/153 (15%)
 Frame = +1

Query  271  FIMKTWKKCKSLG-------------WFVGKRRSKLGCDDEDGRKKLRR-VAPEGCLSVY  408
             I KTW++CKS+G                 + +S    D E+  K     VAPEGC SVY
Sbjct  21   LITKTWERCKSIGRGRKVTSSSTNTNTNTMRSKSWPRRDRENKNKNSTTIVAPEGCFSVY  80

Query  409  VGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD  588
            VG + +RFVIKTEY NHPLFKMLLEEAESEYGY++ GPL LPC VD+F  VL  +EM SD
Sbjct  81   VGPQMQRFVIKTEYANHPLFKMLLEEAESEYGYNSQGPLALPCHVDVFYMVL--MEMGSD  138

Query  589  DDDIYVRRGCA-FARSPAA----AYHHLSPSPF  672
            +      +GCA   RSP+A     Y H SPS +
Sbjct  139  ETQT-TPQGCACVKRSPSAYQPMKYRH-SPSAY  169



>ref|XP_002511134.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF51736.1| calmodulin binding protein, putative [Ricinus communis]
Length=170

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 90/170 (53%), Gaps = 34/170 (20%)
 Frame = +1

Query  271  FIMKTWKKCKSLG--------------------WFVGKRRSKLGCDDE-DGRKKLRRVAP  387
             I+K W +CKSLG                    W     RS    +D    RKK  +VAP
Sbjct  1    MILKAWARCKSLGSRGNRKCARNVCNSLTNSRSWHCTTTRSSSREEDSIKKRKKKVQVAP  60

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            +GC SVYVG+E +RFV+KTE+ NHPLFK+LLE+AE EYG+++ GPL LPCDVDLF KVL 
Sbjct  61   QGCFSVYVGQEQQRFVMKTEFANHPLFKVLLEDAELEYGFNSEGPLLLPCDVDLFCKVL-  119

Query  568  EVEMDSDDDD-----------IYVRRGCAFARSPAAAYHHLSPSPF*AFN  684
              EMDS ++            +     C      + AY  LSPS     N
Sbjct  120  -AEMDSGEEISTTPSWSSSLLVLCSPSCYTTNKRSGAYRLLSPSKMLKLN  168



>ref|XP_006436889.1| hypothetical protein CICLE_v10033363mg [Citrus clementina]
 gb|ESR50129.1| hypothetical protein CICLE_v10033363mg [Citrus clementina]
Length=199

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 88/160 (55%), Gaps = 31/160 (19%)
 Frame = +1

Query  268  NFIMKTWKKCKSLG-------------------------WFVGKRRSKLGCDDEDGRKKL  372
            N I+KTW++CKSLG                             K  S     + +   K 
Sbjct  11   NLILKTWERCKSLGSSSSSGSGSGSGSSSNNKKPSCVMMMIKSKSWSSSPERNNNYNNKG  70

Query  373  RRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
             +VAPEGC SVYVG + +RFVIKTE+ NHPLFK+LLE+AESEYGY+  GP+ LPCDVDLF
Sbjct  71   CQVAPEGCFSVYVGPQRQRFVIKTEFANHPLFKILLEDAESEYGYENQGPIMLPCDVDLF  130

Query  553  VKVLVEVEM--DSDDDDIYVRRGC----AFARSPAAAYHH  654
             KVL E+E   D DDD     +GC        SPA   +H
Sbjct  131  FKVLAELESTGDEDDDHDIANKGCCSPLVLCSSPARRPNH  170



>ref|XP_003523159.1| PREDICTED: uncharacterized protein LOC100789525 [Glycine max]
Length=168

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
            N I K W+ C+        +   L  +D+D  KK  ++AP GC SV+VG E +RFV+KT+
Sbjct  11   NMISKAWEGCRLTSRRPHLKLKSLSENDDDHEKKGSQIAPHGCFSVHVGPERQRFVVKTK  70

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
            YVNHPLF+MLLEE E EYG+++ GP+ LPC+VDLF KVL E++ + ++++I +     F 
Sbjct  71   YVNHPLFQMLLEETEQEYGFESDGPIWLPCNVDLFYKVLAEMDGEENNNNIIIH---GFR  127

Query  628  RS  633
            RS
Sbjct  128  RS  129



>ref|XP_006586283.1| PREDICTED: uncharacterized protein LOC100799988 [Glycine max]
Length=176

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 92/153 (60%), Gaps = 23/153 (15%)
 Frame = +1

Query  271  FIMKTWKKCKSLG-------------WFVGKRRSKLGCDDEDGRKKLRR-VAPEGCLSVY  408
             I KTW++CKS+G                 + +S    D E+  K     VAPEGC SVY
Sbjct  21   LITKTWERCKSIGRGRKVTSSSTNTNTNTMRSKSWPRRDRENKNKNSTTIVAPEGCFSVY  80

Query  409  VGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD  588
            VG + +RFVIKTEY +HPLFKMLLEEAESEYGY++ GPL LPC VD+F  VL  +EM SD
Sbjct  81   VGPQMQRFVIKTEYASHPLFKMLLEEAESEYGYNSQGPLALPCHVDVFYMVL--MEMGSD  138

Query  589  DDDIYVRRGCA-FARSPAA----AYHHLSPSPF  672
            +      +GCA   RSP+A     Y H SPS +
Sbjct  139  ETQT-TPQGCACVKRSPSAYQPMKYQH-SPSAY  169



>ref|XP_004140543.1| PREDICTED: uncharacterized protein LOC101219164 [Cucumis sativus]
 ref|XP_004167966.1| PREDICTED: uncharacterized protein LOC101228593 [Cucumis sativus]
 gb|KGN46434.1| hypothetical protein Csa_6G092560 [Cucumis sativus]
Length=172

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 27/155 (17%)
 Frame = +1

Query  271  FIMKTWKKCKSLGW-------------FVGKRRSKL-------GCDDEDGRKKLRR----  378
             I+KTW++CKS+G              F+ ++   L       G +DED +++ R     
Sbjct  13   LILKTWERCKSMGRGQRNSPSSTGIKRFLTRKTKSLPRLEVFSGGEDEDEKERRRSRKRR  72

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            VAPEGC +VYVG E +RFVIKTE  NHPLF+ LLEEAE+EYGY+   PL LPCDV+ F  
Sbjct  73   VAPEGCFTVYVGAERQRFVIKTECANHPLFRSLLEEAEAEYGYNCQAPLSLPCDVESFYS  132

Query  559  VLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSP  663
            VL+E++ DS  D   +RRGC +       Y+ LSP
Sbjct  133  VLMEMDDDSAGD---LRRGCGYPTPKRFGYNLLSP  164



>ref|XP_008459883.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
 ref|XP_008459884.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
 ref|XP_008459886.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
 ref|XP_008459887.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
Length=172

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 27/155 (17%)
 Frame = +1

Query  271  FIMKTWKKCKSLGW-------------FVGKRRSKL-------GCDDEDGRKKLRR----  378
             I+KTW++CKS+G              F+ ++   L       G +DED +++ R     
Sbjct  13   LILKTWERCKSMGRGQGNSPSSTRIKRFLTRKTKSLPRLEVFSGGEDEDEKERRRCRKRR  72

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            VAPEGC +VYVG E +RFVIKTE  NHPLF+ LLEEAE+EYGY+   PL LPCDV+ F  
Sbjct  73   VAPEGCFTVYVGAERQRFVIKTECANHPLFRSLLEEAEAEYGYNCQAPLSLPCDVESFYS  132

Query  559  VLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSP  663
            VL+E++ D+  D   +RRGC +       Y+ LSP
Sbjct  133  VLMEMDDDTASD---LRRGCGYPTPKRFGYNLLSP  164



>gb|KDP22580.1| hypothetical protein JCGZ_26411 [Jatropha curcas]
Length=175

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 80/126 (63%), Gaps = 22/126 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLG-------------------WFVGKRRSKLGCDDEDGRK-KLRRVAP  387
            N  +  W++CKSLG                   W     +S  G D+++ RK K ++VAP
Sbjct  11   NIFVNAWERCKSLGSGSPKSARNICSTLMKSRSWHCTNTKSLSGEDNDNKRKNKYQQVAP  70

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG E +RFVIKTE+ NHPLFK LLE+AE EYG+++ GP+ LPCDVDLF KVL 
Sbjct  71   EGCFSVYVGPEKQRFVIKTEFANHPLFKSLLEDAEMEYGFNSEGPILLPCDVDLFYKVL-  129

Query  568  EVEMDS  585
              EMDS
Sbjct  130  -AEMDS  134



>ref|XP_007139103.1| hypothetical protein PHAVU_008G001500g [Phaseolus vulgaris]
 gb|ESW11097.1| hypothetical protein PHAVU_008G001500g [Phaseolus vulgaris]
Length=164

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 78/116 (67%), Gaps = 12/116 (10%)
 Frame = +1

Query  259  VLVNFIMKTWKKCKSLGWFVGK------RRSKLGCDDEDGRKKLRR----VAPEGCLSVY  408
            V+   I KTW++ K +G   GK      RRSK     + G+K        VAP+GC SVY
Sbjct  13   VVKGLITKTWERWKWIG--AGKSSMMMMRRSKSWPGRKGGKKNNSSNSVYVAPQGCFSVY  70

Query  409  VGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            VG E +RF IKTEY NHPLFKMLLEEAESEYGY + GPL LPC+VD+F KVL+E+E
Sbjct  71   VGPEMQRFFIKTEYANHPLFKMLLEEAESEYGYTSQGPLALPCNVDIFYKVLMEME  126



>ref|XP_007210042.1| hypothetical protein PRUPE_ppa017538mg [Prunus persica]
 gb|EMJ11241.1| hypothetical protein PRUPE_ppa017538mg [Prunus persica]
Length=175

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 89/166 (54%), Gaps = 26/166 (16%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLG---------CDDEDGRKKLRRVAPEGCLSVYVGEE  420
            N I K W++C SL      +  KL          C   + +K   +VAP GC SVYVG +
Sbjct  11   NLIAKAWRRC-SLQRESSNKGFKLSSLTKSKSWDCSFGNRKKSKGQVAPNGCFSVYVGPQ  69

Query  421  GRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDI  600
             +RF +KTE+ NHPLFKMLLE+AE+EYGY+  GP+ LPCDVDLFVKVL E+E    D   
Sbjct  70   RQRFAVKTEFANHPLFKMLLEDAETEYGYNWEGPILLPCDVDLFVKVLAEMECTEKDVGT  129

Query  601  ----YVRRGCAFARSPA------------AAYHHLSPSPF*AFN*F  690
                +V  G    RSPA             AY  LSPS     N F
Sbjct  130  PNCGFVNYGSLILRSPARHLSSSINNGYGGAYRLLSPSRMLKINQF  175



>ref|XP_009385439.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Musa 
acuminata subsp. malaccensis]
Length=137

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 86/132 (65%), Gaps = 17/132 (13%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEY  450
             I+KT ++C+SLG                G +K +R  PEGC SVYVG    RFV++TE 
Sbjct  15   LILKTLERCRSLG------------SHRKGDQKRQRT-PEGCFSVYVGPARERFVVRTEC  61

Query  451  VNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFAR  630
            VNHPLFKMLL+EAE E+GY A GPL+LPCDVDLF KVL EVE D+   ++Y  R C F++
Sbjct  62   VNHPLFKMLLDEAEMEFGYSAAGPLELPCDVDLFQKVLWEVEQDA--AELYSPR-CNFSK  118

Query  631  SPAAAYHHLSPS  666
            +  A Y  LSP+
Sbjct  119  A-HAGYLLLSPA  129



>ref|XP_006493246.1| PREDICTED: uncharacterized protein LOC102627134 [Citrus sinensis]
Length=197

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 87/158 (55%), Gaps = 29/158 (18%)
 Frame = +1

Query  268  NFIMKTWKKCKS-----------------------LGWFVGKRRSKLGCDDEDGRKKLRR  378
            N I+KTW++CKS                       +     K  S     + +   K  +
Sbjct  11   NLILKTWERCKSLGSSSSSGSGSGSSSNNKKPSCVMMMIKSKSWSSSPERNNNYNNKGCQ  70

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            VAPEGC SVYVG + +RFVIKTE+ NHPLFK+LLE+AESEYGY+  GP+ LPCDVDLF K
Sbjct  71   VAPEGCFSVYVGPQRQRFVIKTEFANHPLFKILLEDAESEYGYENQGPIMLPCDVDLFFK  130

Query  559  VLVEVEM--DSDDDDIYVRRGC----AFARSPAAAYHH  654
            VL E+E   D DDD     +GC        SPA   +H
Sbjct  131  VLAELESTGDEDDDHDIANKGCCSPLVLCSSPARRPNH  168



>gb|KDO64450.1| hypothetical protein CISIN_1g029186mg [Citrus sinensis]
Length=197

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 87/158 (55%), Gaps = 29/158 (18%)
 Frame = +1

Query  268  NFIMKTWKKCKS-----------------------LGWFVGKRRSKLGCDDEDGRKKLRR  378
            N I+KTW++CKS                       +     K  S     + +   K  +
Sbjct  11   NLILKTWERCKSLGSSSSSGSGSGSSSNNKKPSCVMMMIKSKSWSSSPERNNNYNNKGCQ  70

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            VAPEGC SVYVG + +RFVIKTE+ NHPLFK+LLE+AESEYGY+  GP+ LPCDVDLF K
Sbjct  71   VAPEGCFSVYVGPQRQRFVIKTEFANHPLFKILLEDAESEYGYENQGPIMLPCDVDLFFK  130

Query  559  VLVEVEM--DSDDDDIYVRRGC----AFARSPAAAYHH  654
            VL E+E   D DDD     +GC        SPA   +H
Sbjct  131  VLAELESTGDEDDDHDIANKGCCSPLVLCSSPARRPNH  168



>gb|KHN23965.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=157

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYV  453
            I K W+ C+        +   L  +D+D  KK  ++AP GC SV+VG E +RFV+KT+YV
Sbjct  2    ISKAWEGCRLTSRRPHLKLKSLSENDDDHEKKGSQLAPHGCFSVHVGPERQRFVVKTKYV  61

Query  454  NHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFARS  633
            NHPLF+MLLEE E EYG+++ GP+ LPC+VDLF KVL E++ + ++++I +     F RS
Sbjct  62   NHPLFQMLLEETEQEYGFESDGPIWLPCNVDLFYKVLAEMDGEENNNNIIIH---GFRRS  118



>ref|XP_008239631.1| PREDICTED: uncharacterized protein LOC103338225 [Prunus mume]
Length=175

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 85/147 (58%), Gaps = 17/147 (12%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLGWFVGKRRSKLG---------CDDEDGRKKLRRVAPEGCLSVYVGE  417
            +N I K W++C SL      +  KL          C   + +K   +VAP GC SVYVG 
Sbjct  10   MNLIAKAWRRC-SLQRESSNKGFKLSSLTKCKSWDCSFGNRKKSKGQVAPNGCFSVYVGP  68

Query  418  EGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDD  597
            + +RF +KTE+ NHPLFK+LLE+AE+EYGY+  GP+ LPC VDLFVKVL E+E    D  
Sbjct  69   QRQRFAVKTEFANHPLFKILLEDAETEYGYNWEGPILLPCGVDLFVKVLAEMECSEKDVG  128

Query  598  I----YVRRGCAFARSPAAAYHHLSPS  666
                 +V  G    RSP    HHLS S
Sbjct  129  TPNCGFVNYGSLILRSPT---HHLSSS  152



>ref|XP_004298548.1| PREDICTED: uncharacterized protein LOC101293879 [Fragaria vesca 
subsp. vesca]
Length=152

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 84/149 (56%), Gaps = 25/149 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
            N IMK W+KC        KR+   GC         R +AP+GC SVYVG E +RFV+K E
Sbjct  11   NVIMKAWRKCNLTNQSSSKRKKSKGC---------RVLAPDGCFSVYVGPEKQRFVVKVE  61

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD------DDDIYVR  609
            + NHPLFK+LLE+A  EYGY  GGP+ LPCDVDLF  VL E+E + D       D+ +  
Sbjct  62   FANHPLFKVLLEDAAWEYGYSTGGPILLPCDVDLFCNVLAEMENNVDGDMMSLSDEFFFI  121

Query  610  RGCAFARSPAA----------AYHHLSPS  666
            +  + AR P +          AY  LSPS
Sbjct  122  QCSSPARRPRSDSSMIKGYDGAYMLLSPS  150



>ref|XP_009408359.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Musa 
acuminata subsp. malaccensis]
Length=128

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 85/133 (64%), Gaps = 16/133 (12%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
              I+KT ++C+SLG                G +K R++ PEGC SVYVG E  R+V++TE
Sbjct  4    GLILKTLERCRSLG------------SHRKGDQK-RQMPPEGCFSVYVGPERERYVVRTE  50

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
             VNHPLF+MLL+EAE E+GY A GPL+LPC V+LF +VL EVE D+   +++  R C FA
Sbjct  51   CVNHPLFRMLLDEAEEEFGYAAAGPLELPCGVELFQRVLCEVEQDA--AELHSPR-CNFA  107

Query  628  RSPAAAYHHLSPS  666
            +  A  Y   SP+
Sbjct  108  KGHAGGYLLHSPA  120



>ref|XP_010025283.1| PREDICTED: uncharacterized protein LOC104415655 [Eucalyptus grandis]
Length=179

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 89/164 (54%), Gaps = 35/164 (21%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDD-----------------------------EDG  360
              I KTW++CK+LG   GK  SK                                     
Sbjct  11   GLIFKTWERCKTLG-RAGKSSSKPRLTHGPSLAKKSKSWSGPLPSLLKEVNAPPPRLHGS  69

Query  361  RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCD  540
             K+LR   PEGC SVYVG E +RFV++TE  NHPLF+MLLEEAESE+GY +GGP++LPC+
Sbjct  70   LKQLRAAVPEGCFSVYVGPEKQRFVVRTECANHPLFQMLLEEAESEFGYSSGGPIELPCN  129

Query  541  VDLFVKVLVEVEMDSDDDDIYVRR--GCAFARSPAAAYHHLSPS  666
            VDLF +VL E++ D D D     R  GC +     AAY  LSP+
Sbjct  130  VDLFYRVLTEMDCDGDGDGNGGTRRLGCGYG---IAAYQLLSPA  170



>ref|XP_010044854.1| PREDICTED: uncharacterized protein LOC104433707 [Eucalyptus grandis]
 gb|KCW86967.1| hypothetical protein EUGRSUZ_B03532 [Eucalyptus grandis]
Length=177

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 91/170 (54%), Gaps = 32/170 (19%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKK---------------------LRRVA  384
            + I KTW++CKS+G   G + +         + K                      RRVA
Sbjct  11   SLITKTWERCKSIGRGGGNKAAASSPGRLTRKTKSWNGSSAGAAAAAAMEGGRGGRRRVA  70

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            PEGC SVYVG   ++FVIKTEY NHPLFK LL+EAE+EYGY +GGP++LPCDV +F +VL
Sbjct  71   PEGCFSVYVGPGKQKFVIKTEYANHPLFKALLDEAEAEYGYSSGGPIELPCDVAVFCRVL  130

Query  565  VEVEMDSDDDD--------IYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
              +EMDS DDD           R GC   +     Y  LSPS     N F
Sbjct  131  --MEMDSADDDGGRVGGLGAKRRVGCGVNQG-YGGYRLLSPSRMITINQF  177



>ref|XP_010668453.1| PREDICTED: uncharacterized protein LOC104885461 [Beta vulgaris 
subsp. vulgaris]
Length=180

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = +1

Query  367  KLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVD  546
            +L  ++P+GCLSVYVG + +RFV+K EY NHPLFKMLLE+AE EYG++  GPL LPC+VD
Sbjct  77   RLGSLSPKGCLSVYVGPDRQRFVVKIEYTNHPLFKMLLEKAEMEYGFNVDGPLMLPCEVD  136

Query  547  LFVKVLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
            +F+K+L E+E   DDD+      C F+RS  ++YH L+ S
Sbjct  137  VFIKILYEMEAKDDDDNNNNSSRCKFSRS-RSSYHLLNSS  175



>ref|XP_002511133.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF51735.1| calmodulin binding protein, putative [Ricinus communis]
Length=170

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 79/131 (60%), Gaps = 25/131 (19%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDD----------------------EDGRKKLRRV  381
            +  +K W++CKS       + +++ C+                       E G+KK  RV
Sbjct  12   SIFLKVWERCKSWNAGSKTKTARIACNSLTKSRSWHCPTTRSSSSEEENIEKGKKK-PRV  70

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
            AP GC  VYVGEE +RFVI+TE  NHPLFK+LLE+AE EYG+++ GPL LPCDVDLF KV
Sbjct  71   APAGCFPVYVGEEKQRFVIRTEIANHPLFKILLEDAELEYGFNSEGPLLLPCDVDLFYKV  130

Query  562  LVEVEMDSDDD  594
            L   EMDS ++
Sbjct  131  L--AEMDSGEE  139



>ref|XP_002318753.2| hypothetical protein POPTR_0012s10450g [Populus trichocarpa]
 gb|EEE96973.2| hypothetical protein POPTR_0012s10450g [Populus trichocarpa]
Length=181

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 81/141 (57%), Gaps = 22/141 (16%)
 Frame = +1

Query  298  KSLGWFVGKRRSKLGCDDEDG------RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNH  459
            KS  W   ++ S    D EDG       KK  +VAP+GC SVYVG E +RF +K E+ NH
Sbjct  39   KSNSWHCTRKPS----DQEDGISTNNKSKKKTQVAPDGCFSVYVGAEKQRFAVKAEFANH  94

Query  460  PLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFAR--S  633
             LFKMLLE+AE EYG+++ GP+ LPCDVD F KVL E+E D  DD +     C+     S
Sbjct  95   QLFKMLLEDAELEYGHNSEGPISLPCDVDFFYKVLAEMESDEVDDIMINPPSCSSLALCS  154

Query  634  PA----------AAYHHLSPS  666
            PA           AY  LSPS
Sbjct  155  PARRFKSRKDGHGAYRILSPS  175



>ref|XP_011071313.1| PREDICTED: uncharacterized protein LOC105156793 [Sesamum indicum]
Length=169

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 18/124 (15%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKR----------RSKL---GCDDEDG---RKKLRRVAPEGCLS  402
             I + W++C S    +G++          +SK    G  D  G    KK RRVAPEGC S
Sbjct  14   IISRAWERCISFSGGIGRKARNSSGKLKMKSKSWPRGLTDSVGVEIGKKWRRVAPEGCFS  73

Query  403  VYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMD  582
            +YVG + +RFVIKTEYVNHPLF+ LLEEAESEYGY + GPL LPC+VD F+ VL   +MD
Sbjct  74   IYVGPQKQRFVIKTEYVNHPLFRDLLEEAESEYGYSSEGPLLLPCEVDRFLGVL--DQMD  131

Query  583  SDDD  594
             +D+
Sbjct  132  FEDN  135



>ref|XP_006844597.1| hypothetical protein AMTR_s00016p00212020 [Amborella trichopoda]
 gb|ERN06272.1| hypothetical protein AMTR_s00016p00212020 [Amborella trichopoda]
Length=155

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 7/97 (7%)
 Frame = +1

Query  376  RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            +VAPEGC +VYVG E  RFV+KT+Y+NHPLF++LLEEAE EYG+++ GPL LPC+VD F 
Sbjct  61   KVAPEGCFTVYVGSEKERFVLKTDYINHPLFRVLLEEAEMEYGFNSDGPLVLPCEVDYFN  120

Query  556  KVLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
            +VL+E+  D       +  GCAF +     Y  LSP+
Sbjct  121  QVLIEMHNDK------IHGGCAFPKG-LNGYQLLSPT  150



>ref|XP_010523232.1| PREDICTED: uncharacterized protein LOC104801612 [Tarenaya hassleriana]
Length=163

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 81/126 (64%), Gaps = 4/126 (3%)
 Frame = +1

Query  241  VR*GLGVLVNFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEE  420
            V+ G G   + I+KTWK+CKS+G      ++    DD + R+  R  AP GC +VYVG +
Sbjct  3    VKEGKGKEPSLIVKTWKRCKSMG----NPKTAAAADDGERRRWRRVRAPGGCFTVYVGPQ  58

Query  421  GRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDI  600
             +RFV++TEY NHPLF++LL+EAESE+G+ + GPL LPCDV  F + L  ++      D+
Sbjct  59   RQRFVVRTEYANHPLFRVLLDEAESEFGFTSDGPLMLPCDVVSFREFLAAMDDREIAGDL  118

Query  601  YVRRGC  618
              R GC
Sbjct  119  IGRPGC  124



>ref|XP_009383406.1| PREDICTED: uncharacterized protein LOC103971172 [Musa acuminata 
subsp. malaccensis]
Length=149

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 15/138 (11%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDD------EDGRKKLRRVAPEGCLSVYVGEEGRR  429
            + I+K +++C+SLG     RRS            +  +   R+ APEGC +VYVG    R
Sbjct  12   SIIVKVFERCRSLG----HRRSSAAAATPKSKPWDRSKSTGRQRAPEGCFTVYVGPTKER  67

Query  430  FVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVR  609
            FV++ E VNHPLF+MLL++AE  YG+ + GPL+LPCDVD+F K+L E+     D ++   
Sbjct  68   FVVRMECVNHPLFRMLLDQAEMVYGFTSPGPLQLPCDVDVFNKILCEM-----DQEMMAP  122

Query  610  RGCAFARSPAAAYHHLSP  663
              C+FA+  +  Y  LSP
Sbjct  123  PTCSFAKCYSTGYRLLSP  140



>ref|XP_009375239.1| PREDICTED: uncharacterized protein LOC103964074 [Pyrus x bretschneideri]
 ref|XP_009344297.1| PREDICTED: uncharacterized protein LOC103936179 [Pyrus x bretschneideri]
Length=172

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 68/108 (63%), Gaps = 5/108 (5%)
 Frame = +1

Query  268  NFIMKTWKKCK-----SLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRF  432
            N I   WK+C      S        +SK        RK   +VAP+GC SVYVG + +RF
Sbjct  11   NMIANAWKRCSLQRESSSKVLNLMTKSKSCHCSSTTRKSKGQVAPDGCFSVYVGPQRQRF  70

Query  433  VIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            V+KTE+ NHPLFKMLL++AE EYGY+  GP+ LPCDVDLF  VL E+E
Sbjct  71   VVKTEFANHPLFKMLLDDAEMEYGYNCDGPILLPCDVDLFYNVLAEME  118



>ref|XP_011044095.1| PREDICTED: uncharacterized protein LOC105139380 [Populus euphratica]
Length=181

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 79/137 (58%), Gaps = 14/137 (10%)
 Frame = +1

Query  298  KSLGWFVGKRRSKL--GCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFK  471
            KS  W   +  S L  G    +  KK  +VAP+GC SVYVG E +RF +K E+ NH LFK
Sbjct  39   KSKSWHCTRVPSDLEDGISANNKSKKKTQVAPDGCFSVYVGAEKQRFAVKAEFANHQLFK  98

Query  472  MLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFAR--SPA--  639
            MLLE+AE EYG+++ GP+ LPCDVD F KVL E+E +  DD +     C+     SPA  
Sbjct  99   MLLEDAELEYGHNSEGPIMLPCDVDFFYKVLAEMESEEVDDIMNNPPSCSSLALCSPARR  158

Query  640  --------AAYHHLSPS  666
                     AY  LSPS
Sbjct  159  FNSRKDGYGAYRILSPS  175



>ref|XP_011042925.1| PREDICTED: uncharacterized protein LOC105138521 [Populus euphratica]
Length=181

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 81/141 (57%), Gaps = 22/141 (16%)
 Frame = +1

Query  298  KSLGWFVGKRRSKLGCDDEDG------RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNH  459
            KS  W      +++  D EDG       KK  +VAP+GC SVYVG E +RF +K E+ NH
Sbjct  39   KSKSWHC----TRVPSDQEDGISANNKSKKKTQVAPDGCFSVYVGAEKQRFAVKAEFANH  94

Query  460  PLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFAR--S  633
             LFKMLLE+AE EYG+++ GP+ LPCDVD F KVL E+E +  DD +     C+     S
Sbjct  95   QLFKMLLEDAELEYGHNSEGPIMLPCDVDFFYKVLAEMESEEVDDIMNNPPSCSSLALCS  154

Query  634  PA----------AAYHHLSPS  666
            PA           AY  LSPS
Sbjct  155  PARRFNSRKDGYGAYRILSPS  175



>ref|XP_008346665.1| PREDICTED: uncharacterized protein LOC103409638 [Malus domestica]
Length=157

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 71/113 (63%), Gaps = 15/113 (13%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKR----------RSKLGCDDEDGRKKLRRVAPEGCLSVYVGE  417
            N I   WK+     W + ++          +SK      + RK   +VAP+GC SVYVG 
Sbjct  11   NLIANAWKR-----WSLQRKSSSKVHNSLTKSKSRHCSSNTRKSKGQVAPDGCFSVYVGP  65

Query  418  EGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            + +RF +KTE+ NHPLFKMLL++AE EYGY+  GP+ LPCDVDLF KVL E+E
Sbjct  66   QRQRFAVKTEFANHPLFKMLLDDAEMEYGYNCEGPILLPCDVDLFYKVLAEME  118



>ref|XP_008804094.1| PREDICTED: auxin-induced protein X15-like [Phoenix dactylifera]
Length=130

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 84/133 (63%), Gaps = 19/133 (14%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
              I+KT ++C+S+G   G R+        +G+   R +APEGC +VYVG    RFV++ E
Sbjct  9    GLILKTLERCRSIG---GHRK--------EGK---RHMAPEGCFAVYVGPGKERFVVRME  54

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
             +NHPLF+MLL+EAE EYGY   GPL+LPC+V+LF +VL E+E     + +     C+F 
Sbjct  55   CINHPLFQMLLDEAEMEYGYATEGPLELPCNVELFNRVLWEME----QELVAGTPKCSFT  110

Query  628  RSPAAAYHHLSPS  666
            RS  + Y  LSPS
Sbjct  111  RS-HSGYRLLSPS  122



>ref|XP_004298545.1| PREDICTED: uncharacterized protein LOC101292997 [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 83/167 (50%), Gaps = 34/167 (20%)
 Frame = +1

Query  268  NFIMKTWKKCKSL------------------GWFVGKRRSKLGC-DDEDGRKKLRRVAPE  390
            N I+K WK+C +L                    +     +  G    +  + K  +VAP 
Sbjct  11   NLIIKAWKRCSTLPRQSSSKASTAAASLTRSKSWSSSSTNNTGTWKQKKNKAKTCKVAPV  70

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC +VYVG E +RFV++ E+VNHPLFK LLE+A  EYGY + GP+ LPCDVDLF  VL +
Sbjct  71   GCFTVYVGPEKQRFVVRMEFVNHPLFKTLLEDAALEYGYKSDGPILLPCDVDLFCNVLAQ  130

Query  571  VEMDSDDDDIY---------------VRRGCAFARSPAAAYHHLSPS  666
            +E D  D+D+                 R  C   R    +Y  L+P+
Sbjct  131  MESDDIDEDMVGVSSTCSPISFSPARRRNNCGSNRGYGGSYRMLTPT  177



>ref|XP_010926791.1| PREDICTED: auxin-induced protein X15-like [Elaeis guineensis]
Length=130

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 84/133 (63%), Gaps = 19/133 (14%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
            + I+KT ++C+S+G   G R+         G K+L  +APEGC SVYVG    RFV++ E
Sbjct  9    SLILKTLERCRSIG---GHRK---------GEKRL--MAPEGCFSVYVGPAKERFVVRME  54

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
             +NHPLF+ LL+EAE EYGY   GPL+LPC+V+LF +VL E+E     + +     C+F 
Sbjct  55   CINHPLFQTLLDEAEMEYGYATDGPLELPCNVELFNRVLREME----QELVAGPPRCSFT  110

Query  628  RSPAAAYHHLSPS  666
            RS  + Y  LSPS
Sbjct  111  RS-HSGYCLLSPS  122



>gb|KHN32562.1| Auxin-induced protein X15 [Glycine soja]
Length=169

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKL----RRVAPEGCLSVYVGEEGRRFVIK  441
            I K W++C+       K +S    DD    +K      ++AP GC SV+VG E +RFV+K
Sbjct  2    IFKAWERCRLTSRPHLKLKSLSENDDHHHHEKKKKKNSQIAPHGCFSVHVGPERKRFVVK  61

Query  442  TEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            T+YVNHPLF+MLLEEAE EYG+++ GP+ LPC+VDLF KVL E++
Sbjct  62   TKYVNHPLFQMLLEEAEHEYGFESDGPIWLPCNVDLFYKVLAEMD  106



>gb|AFK42411.1| unknown [Lotus japonicus]
Length=144

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P GC SVYVG E +RFV+KTE+VNHPLFKMLL+EAE EYG+++ GP+ LPC+VDLF KVL
Sbjct  30   PNGCFSVYVGAERQRFVVKTEFVNHPLFKMLLDEAEVEYGFNSDGPIWLPCNVDLFYKVL  89

Query  565  VEVEMDSDDD  594
             E+  D + D
Sbjct  90   AEILADEEYD  99



>ref|XP_011073103.1| PREDICTED: uncharacterized protein LOC105158157 [Sesamum indicum]
Length=170

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  373  RRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
            R+VAP GC SV VG E +RFVIKTE+ NHPLF+MLLE+AE EYG+   GP+ LPC+VDLF
Sbjct  50   RQVAPTGCFSVCVGPEKQRFVIKTEFANHPLFRMLLEDAELEYGFQNDGPIVLPCEVDLF  109

Query  553  VKVLVEVEMDSDDDDIYVRRGCAFARSPAAAYH  651
             KVL E+++  D D+      C FA    + ++
Sbjct  110  CKVLAEMDLGKDIDNY---PPCGFAYGSCSPFN  139



>ref|XP_008791133.1| PREDICTED: auxin-induced protein X15-like [Phoenix dactylifera]
Length=115

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 66/97 (68%), Gaps = 6/97 (6%)
 Frame = +1

Query  376  RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            ++APEG  +VYVG    RFVIK E +NHPLFK LL+EAE EYG+ + GPL+LPCDV+LF 
Sbjct  17   QIAPEGYFTVYVGSNKERFVIKVECMNHPLFKNLLDEAEVEYGFKSEGPLELPCDVELFY  76

Query  556  KVLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
            +VL E+     D ++     C FARS ++ Y   SPS
Sbjct  77   QVLREI-----DQEMMASPKCGFARS-SSGYRIFSPS  107



>ref|XP_008446293.1| PREDICTED: uncharacterized protein LOC103489067 [Cucumis melo]
Length=160

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 71/122 (58%), Gaps = 13/122 (11%)
 Frame = +1

Query  352  EDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
              G K    VAP+GC +VYVG E +RFV++TE+ NHPLF+MLLE+AE EYGY++ GP+ L
Sbjct  39   NSGSKYKTPVAPDGCFAVYVGAERQRFVVRTEFANHPLFQMLLEDAEVEYGYNSQGPILL  98

Query  532  PCDVDLFVKVLVEVEMDSDDDDIYVR-----RGCAFARSPA------AAYHHLSPSPF*A  678
            PC+V +F  VL   EMD   D +  R      GC+  R  +        Y  LSPS    
Sbjct  99   PCEVGMFYNVL--AEMDGGGDGLSSRWTGGESGCSPLRLTSCGSRNGVGYRVLSPSSMLK  156

Query  679  FN  684
             N
Sbjct  157  LN  158



>ref|NP_001150755.1| calmodulin binding protein [Zea mays]
 gb|ACN28791.1| unknown [Zea mays]
 tpg|DAA62156.1| TPA: calmodulin binding protein [Zea mays]
Length=136

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 73/133 (55%), Gaps = 23/133 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
              I KT  +C+S     G RRS              R APEGC +V VG   +RFV++TE
Sbjct  19   GLITKTLGRCRS-----GARRS--------------RPAPEGCFTVCVGAGRQRFVVRTE  59

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
             VNHPLF+ LLEEAE  +GY A GPL LPCD D FV+VL ++E D+       R  C   
Sbjct  60   CVNHPLFRALLEEAEEAFGYAAAGPLALPCDADAFVRVLEQIE-DAGRAAAVAR--CGLV  116

Query  628  RSPAAAYHHLSPS  666
            R   +AY  L P+
Sbjct  117  RG-HSAYRLLVPA  128



>gb|ACG40236.1| calmodulin binding protein [Zea mays]
Length=136

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 73/133 (55%), Gaps = 23/133 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
              I KT  +C+S     G RRS              R APEGC +V VG   +RFV++TE
Sbjct  19   GLITKTLGRCRS-----GARRS--------------RPAPEGCFTVCVGAGRQRFVVRTE  59

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
             VNHPLF+ LLEEAE  +GY A GPL LPCD D FV+VL ++E D+       R  C   
Sbjct  60   CVNHPLFRALLEEAEEAFGYAAAGPLALPCDADAFVRVLEQIE-DAGRAAAVAR--CGLV  116

Query  628  RSPAAAYHHLSPS  666
            R   +AY  L P+
Sbjct  117  RG-HSAYRLLVPA  128



>gb|EYU23063.1| hypothetical protein MIMGU_mgv1a015250mg [Erythranthe guttata]
Length=163

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +1

Query  373  RRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
            ++VAP GC +VYVG E RRF IKTE+ NHPLFKMLLE+AE EYG+   GPL LPC VDLF
Sbjct  28   KKVAPTGCFTVYVGPEKRRFAIKTEFANHPLFKMLLEDAELEYGFANEGPLMLPCGVDLF  87

Query  553  VKVLVEVEMDSDDD  594
             +VL   EMD  D 
Sbjct  88   CRVL--AEMDGGDH  99



>ref|XP_009600107.1| PREDICTED: uncharacterized protein LOC104095647 [Nicotiana tomentosiformis]
Length=209

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYV  453
            I+K  +K  S+  F G   SK             +VAPEGC  VYVG E  RFVIKT+Y 
Sbjct  58   ILKKLEKYLSMNKFSGAILSKSKSWHGSTTNIKSKVAPEGCFWVYVGPEKERFVIKTKYA  117

Query  454  NHPLFKMLLEEAESEYGYD-AGGPLKLPCDVDLFVKVLVEV  573
            NHP+FKMLLE+AE EYGY+ + GP+ LPCDVD F KVL E+
Sbjct  118  NHPMFKMLLEDAEKEYGYNYSQGPILLPCDVDHFYKVLAEI  158



>gb|EYU43034.1| hypothetical protein MIMGU_mgv1a014941mg [Erythranthe guttata]
Length=173

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 5/81 (6%)
 Frame = +1

Query  361  RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCD  540
            + K +  AP GC SVYVG E +RFVIK E  NHPLFKMLLE+AESEYG+   GPL++PC+
Sbjct  56   KNKAKEKAPIGCFSVYVGPENQRFVIKAECANHPLFKMLLEDAESEYGFKVEGPLRIPCE  115

Query  541  VDLFVKVLVEVEMDSDDDDIY  603
            VDLF ++L E+     D +IY
Sbjct  116  VDLFCRILAEM-----DSNIY  131



>ref|XP_004145218.1| PREDICTED: uncharacterized protein LOC101219975 [Cucumis sativus]
 ref|XP_004153127.1| PREDICTED: uncharacterized protein LOC101220090 [Cucumis sativus]
 ref|XP_004166985.1| PREDICTED: uncharacterized LOC101220090 [Cucumis sativus]
Length=156

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 70/126 (56%), Gaps = 17/126 (13%)
 Frame = +1

Query  352  EDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
              G K    VAP+GC +VYVG E +RFV++TE+ NHPLF+MLLE+AE EYGY++ GP+ L
Sbjct  31   NSGPKYKTPVAPDGCFAVYVGAERQRFVVRTEFANHPLFQMLLEDAEVEYGYNSQGPILL  90

Query  532  PCDVDLFVKVLVEVEMDSDDDDIYVR-----RGCAFARSP----------AAAYHHLSPS  666
            PC+V +F  VL   EMD   D I  R      G   A SP             Y  LSPS
Sbjct  91   PCEVGMFYNVL--AEMDDGGDGISNRWTGGESGGLIACSPLRLTSCGSRNGGGYRVLSPS  148

Query  667  PF*AFN  684
                 N
Sbjct  149  SMLKLN  154



>gb|KGN64431.1| hypothetical protein Csa_1G051690 [Cucumis sativus]
Length=167

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 70/126 (56%), Gaps = 17/126 (13%)
 Frame = +1

Query  352  EDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
              G K    VAP+GC +VYVG E +RFV++TE+ NHPLF+MLLE+AE EYGY++ GP+ L
Sbjct  42   NSGPKYKTPVAPDGCFAVYVGAERQRFVVRTEFANHPLFQMLLEDAEVEYGYNSQGPILL  101

Query  532  PCDVDLFVKVLVEVEMDSDDDDIYVR-----RGCAFARSP----------AAAYHHLSPS  666
            PC+V +F  VL   EMD   D I  R      G   A SP             Y  LSPS
Sbjct  102  PCEVGMFYNVL--AEMDDGGDGISNRWTGGESGGLIACSPLRLTSCGSRNGGGYRVLSPS  159

Query  667  PF*AFN  684
                 N
Sbjct  160  SMLKLN  165



>ref|XP_011083566.1| PREDICTED: uncharacterized protein LOC105166046 [Sesamum indicum]
Length=207

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  373  RRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
            +   P GC SVYVG E +RFVI+TE+ NHP FKMLLE+AE EYG+   GPL LPC+VDLF
Sbjct  89   KATTPNGCFSVYVGPEKQRFVIRTEFANHPSFKMLLEDAEIEYGFKNQGPLLLPCEVDLF  148

Query  553  VKVLVEVEMDSDDDDIY  603
             KVL E++   +D D Y
Sbjct  149  CKVLAEMDSCGEDFDQY  165



>ref|XP_010929727.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Elaeis 
guineensis]
Length=148

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 80/138 (58%), Gaps = 16/138 (12%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKL------RRVAPEGCLSVYVGEEGRRF  432
             I+KT ++C SLG     RRS+     +    +L       R+AP G  SVYVG    RF
Sbjct  13   LILKTLERCCSLG----HRRSRPPSMPKSKSWQLSRSSVKHRIAPGGYFSVYVGPNKERF  68

Query  433  VIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRR  612
            VIK E VNHPLFK LL+EAE EYG+ + GPL+LPCDVDLF +VL E+     D ++    
Sbjct  69   VIKMECVNHPLFKDLLDEAEMEYGFKSEGPLELPCDVDLFYRVLCEI-----DQEMAASP  123

Query  613  GCAFARSPAAAYHHLSPS  666
               FA+  +  Y  LSPS
Sbjct  124  KRGFAKI-SNGYRLLSPS  140



>ref|XP_009337547.1| PREDICTED: uncharacterized protein LOC103929995 [Pyrus x bretschneideri]
Length=157

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 15/113 (13%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKR----------RSKLGCDDEDGRKKLRRVAPEGCLSVYVGE  417
            N I   WK+     W + ++          +SK        RK    VAP+GC SVYVG 
Sbjct  11   NLIANAWKR-----WSLQRKSSSKVHNSLTKSKSWHCSSSTRKIKGLVAPDGCFSVYVGP  65

Query  418  EGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            + +RF +KTE+ NH LFKMLL++A+ EYGY+  GP+ LPCDVDLF KVL E+E
Sbjct  66   QRQRFAVKTEFANHSLFKMLLDDAKMEYGYNCEGPILLPCDVDLFYKVLAEME  118



>gb|EYU43035.1| hypothetical protein MIMGU_mgv1a025672mg [Erythranthe guttata]
Length=171

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCD  540
            R K +  AP GC SVYVG E +RFVIK E  NHPLF+ LLE+AESEYG    GPL +PC+
Sbjct  55   RNKTKEKAPIGCFSVYVGPENQRFVIKAECANHPLFRRLLEDAESEYGLKVEGPLHIPCE  114

Query  541  VDLFVKVLVEVEMDSDDDDI-YVRRGCA  621
            VDLF ++L E++ ++ D ++  V  GC+
Sbjct  115  VDLFCRILAEMDSNTGDQELDTVGFGCS  142



>ref|XP_009770249.1| PREDICTED: uncharacterized protein LOC104220973 [Nicotiana sylvestris]
Length=168

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYV  453
            I+K  +K  S+  F G   SK             +VAP+GC  VYVG E  RFVIKT+Y 
Sbjct  17   ILKKLEKYLSMNKFSGTILSKSKSWHGTTTNIKSKVAPDGCFWVYVGPEKERFVIKTKYA  76

Query  454  NHPLFKMLLEEAESEYGYD-AGGPLKLPCDVDLFVKVLVEV  573
            NHP+FKMLLE+AE EYGY+ + GP+ LPCDVD F KVL E+
Sbjct  77   NHPMFKMLLEDAEKEYGYNYSQGPICLPCDVDHFYKVLAEI  117



>gb|KEH20999.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=158

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 64/99 (65%), Gaps = 7/99 (7%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
             P GCL VYVG E +RFVIK +  NHPLFK LLE+ E+EYGY   GPL LPCDVDLF + 
Sbjct  49   TPHGCLCVYVGPERQRFVIKIKIFNHPLFKTLLEDVENEYGYRNDGPLWLPCDVDLFCEA  108

Query  562  LVEVEMDSDDDDIYVRRGCAFARSPAAAYHH--LSPSPF  672
            LVE+E   D D  +V  GC F   P    H+  +S SPF
Sbjct  109  LVEIESAEDHDLGFV--GCNF---PIVHKHNSSVSHSPF  142



>gb|KEH20995.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=143

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +1

Query  334  KLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDA  513
            KL  +    +K   +  P GCL VYVG E +RFVIK +  NHPLFK LLE+ E+EYGY  
Sbjct  29   KLPKESHKKQKDSTKKPPHGCLCVYVGPERQRFVIKIKIFNHPLFKTLLEDVENEYGYRN  88

Query  514  GGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFA  627
             GPL LPCDVDLF + LVE+E   D D  +V  GC F 
Sbjct  89   DGPLWLPCDVDLFCEALVEIESAEDHDLGFV--GCNFP  124



>gb|EAZ09691.1| hypothetical protein OsI_31974 [Oryza sativa Indica Group]
 gb|EAZ45311.1| hypothetical protein OsJ_29954 [Oryza sativa Japonica Group]
Length=138

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 72/136 (53%), Gaps = 26/136 (19%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
              IMKT  +C+   W                    RR A EGCLSVYVG   +RFV++T 
Sbjct  15   GLIMKTLDRCRPPAW--------------------RRPA-EGCLSVYVGAARQRFVVRTA  53

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEV----EMDSDDDDIYVRRG  615
             VNHPLF+ LLEEAE  +GY A GPL+LPCD  +F +VL ++    E  +   D+  RR 
Sbjct  54   SVNHPLFRPLLEEAEEAFGYAAAGPLQLPCDAAVFARVLEQIEEEEEETAAAGDVAARR-  112

Query  616  CAFARSPAAAYHHLSP  663
            C  A    +AY  L P
Sbjct  113  CGLAARGHSAYRLLVP  128



>ref|XP_004298547.1| PREDICTED: uncharacterized protein LOC101293586 [Fragaria vesca 
subsp. vesca]
Length=169

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 67/113 (59%), Gaps = 3/113 (3%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLR--RVAPEGCLSVYVGEEGRRFVIK  441
            N + +  K C +L     KR+S         RKK +  R AP GC   YVG E ++FV+K
Sbjct  23   NLLKQASKVCAALSSLT-KRKSWSCSTSTCSRKKNKAGRAAPAGCFPAYVGPEKQQFVVK  81

Query  442  TEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDI  600
            TE  NHPLFK+LLE+A  +YGY   GPL LPCDVDLF  VL E+E    +D I
Sbjct  82   TEIANHPLFKVLLEDAALKYGYKNDGPLLLPCDVDLFCNVLTEIEGSIVEDMI  134



>ref|XP_009383865.1| PREDICTED: auxin-induced protein X15-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 14/109 (13%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEY  450
             I+KT ++C+S+    G+RR         GR++     PEGC +VYVG +  RFVI+TE 
Sbjct  16   LILKTLERCRSMA---GQRRG--------GRQE---APPEGCFAVYVGPDRERFVIRTEC  61

Query  451  VNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDD  597
            VNHP F++LLEEAE E+GY   GPL+LPC V++F +VL E+E ++ +  
Sbjct  62   VNHPRFRVLLEEAEMEFGYSNSGPLELPCHVEVFHEVLWEMEQEAVESS  110



>ref|XP_002462640.1| hypothetical protein SORBIDRAFT_02g029410 [Sorghum bicolor]
 gb|EER99161.1| hypothetical protein SORBIDRAFT_02g029410 [Sorghum bicolor]
Length=134

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 62/104 (60%), Gaps = 18/104 (17%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKT  444
               IMKT  +C+S       RRSK               APEGC +V VG   +RF+++T
Sbjct  9    AGLIMKTLDRCRS------ARRSKPA------------PAPEGCFTVCVGAGRQRFMVRT  50

Query  445  EYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            E VNHPLF+ LLEEAE  +GY A GPL LPCD D FV+VL ++E
Sbjct  51   ECVNHPLFRALLEEAEEVFGYAAAGPLALPCDADAFVRVLEQIE  94



>ref|XP_010093925.1| hypothetical protein L484_008816 [Morus notabilis]
 gb|EXB54888.1| hypothetical protein L484_008816 [Morus notabilis]
Length=169

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = +1

Query  376  RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            + AP GC  VYVG E ++FV++ E+ NH LFK+LLE+AESEYGY++ GP+ LPCD  LF 
Sbjct  57   QAAPYGCFPVYVGPEKQKFVVRAEFANHQLFKILLEDAESEYGYNSDGPILLPCDAGLFY  116

Query  556  KVLVEVEMDSDDDDIYVRRGCAFAR-SPA-------AAYHHLSPS  666
            KVL E+E   D D       C+F   SP          Y  LSPS
Sbjct  117  KVLAEME-SGDGDFTSTSPSCSFMLCSPNNGIGYKYGGYKLLSPS  160



>ref|XP_003602784.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES73035.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=149

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 76/121 (63%), Gaps = 16/121 (13%)
 Frame = +1

Query  268  NFIMKTWKKCKSLG----------WFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGE  417
            N I+K W+   SLG            + K  SK   ++  GR  + ++ P GC +VYVG 
Sbjct  11   NKILKAWR---SLGRGGDNSNMRSLLLNKSSSKSFSENAKGR--IVKI-PNGCFTVYVGL  64

Query  418  EGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDD  597
            + +RFV+KT++VNHP FKMLL+EAE EYG+   GP++LPC+VD+F +VL E+    +D +
Sbjct  65   QSQRFVVKTKFVNHPKFKMLLDEAEVEYGFQNDGPIRLPCNVDMFYRVLDEMNNIEEDYN  124

Query  598  I  600
            I
Sbjct  125  I  125



>ref|XP_006586323.1| PREDICTED: uncharacterized protein LOC102667331 [Glycine max]
Length=157

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 61/95 (64%), Gaps = 7/95 (7%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
            AP+GC+ VYVG E  RFVIK +  NHPLFK LL+ AE EYGY   GPL LPCDVDLF + 
Sbjct  39   APQGCICVYVGAERERFVIKVKIANHPLFKALLDAAEREYGYRNNGPLWLPCDVDLFSEA  98

Query  562  LVEVEMDSDDDDIYVRRGCA-------FARSPAAA  645
            L ++E    +++     GCA       F RSP++A
Sbjct  99   LKDMENSIQEEEETGSVGCAAFAAGHSFRRSPSSA  133



>ref|XP_010663898.1| PREDICTED: auxin-induced protein X10A-like [Vitis vinifera]
Length=160

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 72/126 (57%), Gaps = 15/126 (12%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSK------LGCDDEDGRKKLRRV-APEGCLSVYVGEEGR  426
            N ++  WK+C+S+      RRSK        C      +  +    P+G   VYVG + +
Sbjct  11   NMMVGAWKRCQSIC-----RRSKKCMPNISPCSSVSNPEAAKPSKTPKGYFPVYVGAQKQ  65

Query  427  RFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYV  606
            RF+IKT++ NHPLF  LLEEAE EYGY  GGP+ LPC VD F +VL   EMD   D+I  
Sbjct  66   RFLIKTQFTNHPLFMTLLEEAELEYGYSNGGPVSLPCHVDTFYEVL--AEMDGGRDEI-S  122

Query  607  RRGCAF  624
            R G +F
Sbjct  123  RPGSSF  128



>ref|XP_004298546.1| PREDICTED: uncharacterized protein LOC101293297 [Fragaria vesca 
subsp. vesca]
Length=174

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            V P G  SVYVG E +RF +K EYVNHPLFK+LLE+A  EYGY   GPL LPCDVDLF  
Sbjct  57   VTPVGYFSVYVGPEKQRFALKMEYVNHPLFKVLLEDAALEYGYRNDGPLLLPCDVDLFYN  116

Query  559  VLVEVE-MDSDDDDI  600
            VL E+E MD  D+++
Sbjct  117  VLAEIESMDDIDEEM  131



>gb|EPS74604.1| hypothetical protein M569_00152, partial [Genlisea aurea]
Length=80

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P G  SVYVG E RRFVI+TE VNHPLF+ LLE+AESEYG+D  GP+ LPC+VD FV+V+
Sbjct  1    PTGRFSVYVGPERRRFVIRTESVNHPLFRALLEDAESEYGFDCNGPIHLPCEVDFFVEVM  60

Query  565  VEVEMDSDDDDIYVRRGCAFARSP  636
              +    DD     R  CA   SP
Sbjct  61   AAL----DDQPKSHRGSCAPFGSP  80



>ref|XP_010045491.1| PREDICTED: uncharacterized protein LOC104434216 [Eucalyptus grandis]
Length=198

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 68/113 (60%), Gaps = 10/113 (9%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLGWFVGKR--RSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEG--RRF  432
            V+ I K+W+        V KR  R  L  +   G  ++  + P GC  VYVGE G   RF
Sbjct  10   VDMIKKSWRIN-----MVMKRLLRKWLKTNKTSG-PEVPALVPAGCFPVYVGEGGGKERF  63

Query  433  VIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDD  591
            V+KTEYVNHPLFK LLE+AESEYG+ + GPL LPC  D F KVL E+E    D
Sbjct  64   VVKTEYVNHPLFKSLLEDAESEYGFCSQGPLSLPCHPDFFFKVLAEMESSHHD  116



>ref|XP_010045485.1| PREDICTED: uncharacterized protein LOC104434209 [Eucalyptus grandis]
Length=119

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +1

Query  265  VNFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGE--EGRRFVI  438
            V+ I K+W+    +   + +   K    +   +     + P GC  VYVGE  +  RFV+
Sbjct  10   VHTIKKSWR----INMMMKRLLRKWLKTNNTSKVATPALVPAGCFPVYVGEGDQKERFVV  65

Query  439  KTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD  588
            K EYVNHPLFK LLE+AE EYG+ + GPL LPC+ D F KVL E+E+ +D
Sbjct  66   KMEYVNHPLFKSLLEDAELEYGFHSQGPLSLPCNSDFFCKVLAEMELRAD  115



>ref|XP_010939481.1| PREDICTED: uncharacterized protein LOC105058300 [Elaeis guineensis]
Length=257

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 73/122 (60%), Gaps = 7/122 (6%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGCDD-EDGRKKLR-RVAPEGCLSVYVGEEGRRFVIKT  444
             I+KT K C+SLG    +  S    +  +  R  ++ R+AP G  SVYVG    R +IK 
Sbjct  13   LILKTIKWCRSLGHRRSRPTSMPKSESWQRSRSTVKHRIAPGGYFSVYVGPNKERLMIKM  72

Query  445  EYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAF  624
            E VNHPLFK LL+EAE EYG+   GPL+LPCDVDLF +VL E+     D ++ V   C F
Sbjct  73   ECVNHPLFKDLLDEAEMEYGFKTEGPLELPCDVDLFHQVLREI-----DQEMTVSPECGF  127

Query  625  AR  630
             +
Sbjct  128  TK  129



>ref|XP_002462638.1| hypothetical protein SORBIDRAFT_02g029390 [Sorghum bicolor]
 gb|EER99159.1| hypothetical protein SORBIDRAFT_02g029390 [Sorghum bicolor]
Length=122

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 61/100 (61%), Gaps = 18/100 (18%)
 Frame = +1

Query  277  MKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVN  456
            MKT  +C+S       RRSK               APEGC +V VG   +RF+++TE VN
Sbjct  1    MKTLDRCRS------ARRSKPA------------PAPEGCFTVCVGAGRQRFMVRTECVN  42

Query  457  HPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            HPLF+ LLEEAE  +GY A GPL LPCD D FV+VL ++E
Sbjct  43   HPLFRALLEEAEDVFGYAAAGPLALPCDADAFVRVLEQIE  82



>ref|XP_004241451.1| PREDICTED: uncharacterized protein LOC101265243 [Solanum lycopersicum]
Length=170

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 8/96 (8%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            +AP+GC  VYVG E  +F IK +Y NHPLFKMLLE+AE EYGY + GP+ LPCDV+LF K
Sbjct  53   LAPQGCFCVYVGPEKEKFTIKAKYANHPLFKMLLEDAEMEYGYCSQGPILLPCDVNLFHK  112

Query  559  VLVEVEMDSDDDDIYVRRGCAFAR----SPAAAYHH  654
            VL +++ + + +      GC  A     SPA    H
Sbjct  113  VLGQMDSEREING----PGCGLASCSPFSPARVLGH  144



>gb|KHN16861.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=157

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 60/95 (63%), Gaps = 7/95 (7%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
            AP+GC+ VYVG E  RFVIK +  NHPLFK LL+ AE EYGY   GPL LPCDVDLF + 
Sbjct  39   APQGCICVYVGAERERFVIKVKIANHPLFKALLDAAEREYGYRNNGPLWLPCDVDLFSEA  98

Query  562  LVEVEMDSDDDDIYVRRGCA-------FARSPAAA  645
            L ++E     ++     GCA       F RSP++A
Sbjct  99   LKDMENSIQGEEETGSVGCAAFAAGHSFRRSPSSA  133



>ref|XP_004235361.1| PREDICTED: uncharacterized protein LOC101246229 [Solanum lycopersicum]
Length=158

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYD-AGGPLKLPCDVDLFV  555
            +APEGC  VYVG    +FVIKT+Y NHP FK LLE+AE EYGY    GP+ LPCDVD F 
Sbjct  38   IAPEGCFWVYVGPNKEKFVIKTKYANHPSFKKLLEDAEKEYGYSYCQGPILLPCDVDYFY  97

Query  556  KVLVEVEMDSDDDDIYVRRGCAFARSPA  639
             VL +V  + ++DD  V   C+   SP+
Sbjct  98   LVLADVINNKENDDSIVCGSCSPLFSPS  125



>ref|XP_004501724.1| PREDICTED: uncharacterized protein LOC101509958 [Cicer arietinum]
Length=131

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            +AP GC SVYVG + +RFV+KT+++NHPLF MLL+EAE EY +   GP+ LPC V+LF K
Sbjct  29   IAPNGCFSVYVGAQRKRFVLKTKFINHPLFMMLLDEAEVEYEFQNDGPILLPCKVELFNK  88

Query  559  VLVEVE  576
            VL E+ 
Sbjct  89   VLAEIN  94



>tpg|DAA40496.1| TPA: calmodulin binding protein [Zea mays]
Length=151

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
            APEGC +V VG   +RFV++TE VNHPLF+ LLEEAE  +GY A GPL LPCD D FV+V
Sbjct  46   APEGCFAVRVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLVLPCDADAFVRV  105

Query  562  LVEVEMDSDD  591
            L +++ + +D
Sbjct  106  LEQIQEEEED  115



>ref|XP_006347628.1| PREDICTED: uncharacterized protein LOC102598616 [Solanum tuberosum]
Length=158

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYD-AGGPLKLPCDVDLFV  555
            +APEGC  VYVG    +FVIKT+Y NHPLFK LLE+AE EYGY  + GP+ LPCDVD F 
Sbjct  38   IAPEGCFWVYVGPNKEKFVIKTKYANHPLFKKLLEDAEKEYGYSYSQGPILLPCDVDYFY  97

Query  556  KVLVEVEMDSDDDDIYVRRGCAFARSPA  639
             VL ++  + + DD      C+   SP+
Sbjct  98   LVLADMVNNKEMDDSIGCGSCSPLFSPS  125



>emb|CDY71491.1| BnaCnng73150D [Brassica napus]
Length=174

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 63/118 (53%), Gaps = 16/118 (14%)
 Frame = +1

Query  277  MKTWKKCKSLG---------------WFVGKRRSKLGCDDEDGR-KKLRRVAPEGCLSVY  408
            M+TW+K KS G               W            +  G  KK     P GC +VY
Sbjct  1    METWRKMKSFGHKSSSITASITKSKSWNGSAHLENANNKESTGNIKKKSPPPPHGCFTVY  60

Query  409  VGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMD  582
            VG   +R V+KT+ +NHPLFK LLEEAE+EYGY   GP+ LPC+VD F KVL  ++ +
Sbjct  61   VGPTKQRVVVKTKLLNHPLFKNLLEEAEAEYGYRRDGPIVLPCEVDFFYKVLANMKFN  118



>ref|XP_004503773.1| PREDICTED: uncharacterized protein LOC101489648 [Cicer arietinum]
Length=157

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 57/80 (71%), Gaps = 5/80 (6%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+GCL VYVG E +RFVIK +  NHPLFK  LE+ E+E+GY   GPL +PCDVDLF + L
Sbjct  49   PQGCLCVYVGPERQRFVIKVKIANHPLFKTFLEDVENEFGYRNDGPLWIPCDVDLFYEAL  108

Query  565  VEVEMDSDDDDIYVRRGCAF  624
            VE+E   DDD  +V  GC F
Sbjct  109  VEIE---DDDLGFV--GCNF  123



>dbj|BAK03180.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 66/114 (58%), Gaps = 15/114 (13%)
 Frame = +1

Query  256  GVLVNFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFV  435
            G   + + +T ++C+S G   G R S               VAP GC SVYVG E  RFV
Sbjct  29   GARKSLVSRTLERCRS-GLNSGGRSSAA-------------VAP-GCFSVYVGPERERFV  73

Query  436  IKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDD  597
            ++ +  NHPLF+ LL++AE EYGY A GPL LPC VD F+ VL  ++ D  D+D
Sbjct  74   VRADRANHPLFRRLLDDAEQEYGYAAQGPLALPCSVDAFLDVLWHMDHDVQDED  127



>ref|XP_007160002.1| hypothetical protein PHAVU_002G284700g [Phaseolus vulgaris]
 gb|ESW31996.1| hypothetical protein PHAVU_002G284700g [Phaseolus vulgaris]
Length=159

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            VAP GCL VYVG E  RF++K +  NHPLFK LL+ AE EYGY   GPL LPC VD F +
Sbjct  43   VAPHGCLCVYVGAERERFIVKIKIANHPLFKELLDGAEREYGYRNDGPLWLPCHVDFFCE  102

Query  559  VLVEVEMDSDDDDI  600
             L E+E+ + ++D+
Sbjct  103  ALTEMEISTTEEDV  116



>ref|XP_008670314.1| PREDICTED: uncharacterized protein LOC103647576 [Zea mays]
Length=203

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
            APEGC +V VG   +RFV++TE VNHPLF+ LLEEAE  +GY A GPL LPCD D FV+V
Sbjct  98   APEGCFAVRVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLVLPCDADAFVRV  157

Query  562  LVEVEMDSDD  591
            L +++ + +D
Sbjct  158  LEQIQEEEED  167



>ref|NP_001149909.1| calmodulin binding protein [Zea mays]
 gb|ACG37162.1| calmodulin binding protein [Zea mays]
Length=153

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
            APEGC +V VG   +RFV++TE VNHPLF+ LLEEAE  +GY A GPL LPCD D FV+V
Sbjct  46   APEGCFAVRVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLVLPCDADAFVRV  105

Query  562  LVEVE  576
            L +++
Sbjct  106  LEQIQ  110



>ref|XP_010111738.1| hypothetical protein L484_008396 [Morus notabilis]
 gb|EXC31600.1| hypothetical protein L484_008396 [Morus notabilis]
Length=121

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 65/119 (55%), Gaps = 11/119 (9%)
 Frame = +1

Query  346  DDEDGRKKLRR---VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGY-DA  513
            DDE   +K RR    AP GC  V VG   +RF IKTEY  HPLFK L+EEAE EYG+ + 
Sbjct  10   DDEKHARKRRRGGHTAPAGCFWVCVGAHKQRFAIKTEYTKHPLFKKLVEEAEKEYGHRNQ  69

Query  514  GGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSPF*AFN*F  690
             GPL LPC V +F   L+++E D   + +   R          +YH +SP    A N F
Sbjct  70   LGPLALPCSVHIFYNALIKMEFDDHANQLSTTRY-------PFSYHPISPFNIYAINQF  121



>ref|XP_009134069.1| PREDICTED: uncharacterized protein LOC103858456 [Brassica rapa]
 emb|CDX83154.1| BnaA03g23520D [Brassica napus]
Length=162

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKL-------GCDDEDGRKKLRRVAP--EGCLSVYVGEEGR  426
            IMKTW+K K+ G      R+         G    +  K    +    + C +VYVG   +
Sbjct  5    IMKTWRKIKTFGQTSSSTRASFTRSKTWNGSAHHEDAKNSESIGKIKKNCFTVYVGPTKQ  64

Query  427  RFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMD  582
            R V+K + +NHPLFK LLE AE+EYGY   GP+ LPC+VD F KVL +++ D
Sbjct  65   RIVVKMKLLNHPLFKNLLEAAENEYGYRRDGPIVLPCEVDFFFKVLADIKSD  116



>ref|NP_001172716.1| Os01g0924966 [Oryza sativa Japonica Group]
 dbj|BAD88039.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH91446.1| Os01g0924966 [Oryza sativa Japonica Group]
Length=173

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC SVYVG E  RFV++TEY NHPLF+ LL++AE EYGY A GPL LPC VD F+ VL +
Sbjct  45   GCFSVYVGPERERFVVRTEYANHPLFRRLLDDAEREYGYAAQGPLALPCAVDAFLDVLWQ  104

Query  571  VE  576
            +E
Sbjct  105  ME  106



>ref|XP_002280410.1| PREDICTED: uncharacterized protein LOC100268140 [Vitis vinifera]
Length=164

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = +1

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            G   VYVG + +RFVIKT+   HPLFK LLEEAE EYGY  GGP+ LPCDVD F +VLV+
Sbjct  58   GYFPVYVGAQKQRFVIKTQLAKHPLFKTLLEEAELEYGYSNGGPVLLPCDVDTFYEVLVQ  117

Query  571  VEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSP  669
            +E     +          + S    +  LSPSP
Sbjct  118  MESGGAQE----------SSSRGGTFSFLSPSP  140



>emb|CAN64976.1| hypothetical protein VITISV_027843 [Vitis vinifera]
Length=164

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = +1

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            G   VYVG + +RFVIKT+   HPLFK LLEEAE EYGY  GGP+ LPCDVD F +VLV+
Sbjct  58   GYFPVYVGAQKQRFVIKTQLAKHPLFKTLLEEAELEYGYSNGGPVLLPCDVDTFYEVLVQ  117

Query  571  VEMDSDDDDIYVRRGCAFARSPAAAYHHLSPSP  669
            +E     +          + S    +  LSPSP
Sbjct  118  MESGGAQE----------SSSRGGTFSFLSPSP  140



>ref|XP_004957298.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Setaria 
italica]
Length=137

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = +1

Query  325  RRSKLGCDDEDGRKKLRRVAPE-----GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEA  489
            RR  L     D  +  RR  P+     GC +V VG   +RFV++TE VNH LF+ LLEEA
Sbjct  14   RRPGLITKTLDRCRSARRSKPQPAPAVGCFTVCVGAGRQRFVVRTECVNHRLFRALLEEA  73

Query  490  ESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCAFARSPAA  642
            E  +GY A GPL LPCD D FV+VL ++E ++   ++  R  C  AR  +A
Sbjct  74   EEAFGYAAAGPLALPCDADAFVRVLEQIEEEAAAGEVVPR--CGLARGHSA  122



>ref|XP_002864075.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40334.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=180

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 67/121 (55%), Gaps = 14/121 (12%)
 Frame = +1

Query  262  LVNFIMKTWKKCKSLGWFV--------------GKRRSKLGCDDEDGRKKLRRVAPEGCL  399
            + N I+KTW+K KS G                 G  R +    +E   K  + +   G  
Sbjct  1    MKNPILKTWRKVKSFGHTSSSTTPSFTRSKSCHGSFRLEDAKSNESKAKSKKELPSHGFF  60

Query  400  SVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEM  579
            +VYVG   +R V+KT+ +NHPLFK LLE+AE+EYGY   GP+ LPC+VD F K L +++ 
Sbjct  61   TVYVGPTKQRIVVKTKLLNHPLFKNLLEDAETEYGYRRDGPIVLPCEVDFFFKTLADMKS  120

Query  580  D  582
            +
Sbjct  121  N  121



>ref|XP_010446011.1| PREDICTED: uncharacterized protein LOC104728772 [Camelina sativa]
Length=158

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = +1

Query  262  LVNFIMKTWKKCKSLGWF-------VGKRRSKLG------CDDEDGRKKLRRV-APE-GC  396
            + N ++KTW+K KS G         V K +S  G       +  + + K+RR  +P+ G 
Sbjct  1    MKNPVVKTWRKMKSFGHTSSSTTATVKKSKSWTGSISLEDANSIESKGKMRRKESPQHGV  60

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +V VG   +R V+KT+ VNHPLF+ LLE+AE+EYGY   GP+ LPC+VD F KVL E+ 
Sbjct  61   FTVCVGPTKQRVVVKTKLVNHPLFRNLLEDAENEYGYRGDGPIVLPCEVDFFFKVLAEMN  120

Query  577  MDSDD  591
                D
Sbjct  121  AGKGD  125



>gb|EAY77041.1| hypothetical protein OsI_04997 [Oryza sativa Indica Group]
Length=176

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GC SVYVG E  RF+++TEY NHPLF+ LL++AE EYGY A GPL LPC VD F+ VL +
Sbjct  48   GCFSVYVGPERERFLVRTEYANHPLFRRLLDDAEREYGYAAQGPLALPCAVDAFLDVLWQ  107

Query  571  VE  576
            +E
Sbjct  108  ME  109



>ref|XP_010482375.1| PREDICTED: uncharacterized protein LOC104761057 [Camelina sativa]
Length=183

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 74/122 (61%), Gaps = 15/122 (12%)
 Frame = +1

Query  262  LVNFIMKTWKKCKSLGWF-------VGKRRSKLG------CDDEDGRKKLRRV-APE-GC  396
            + N ++KTW+K KS G         V K +S  G       +  + + K+RR  +P+ G 
Sbjct  1    MKNPVVKTWRKMKSFGHTNSSTTATVKKSKSWTGSISLEDANSNESKGKMRRKESPQHGF  60

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +V VG   +R V+KT+ VNHPLF+ LLE+AE+EYGY   GP+ LPC+VD F KVL E++
Sbjct  61   FTVCVGPTKQRVVVKTKLVNHPLFRNLLEDAENEYGYRGDGPIVLPCEVDFFFKVLAEMK  120

Query  577  MD  582
             +
Sbjct  121  SN  122



>ref|XP_010555564.1| PREDICTED: uncharacterized protein LOC104825028 [Tarenaya hassleriana]
Length=207

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 68/137 (50%), Gaps = 37/137 (27%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRR------------------------------SKLGCD---  348
            N I+KTWKK KSLG    + +                              S L  D   
Sbjct  13   NPILKTWKKMKSLGHMSNRNKKNKTPDPCSSPLPSSSYSAPSFAKSRSWHCSALQSDLHE  72

Query  349  ----DEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAG  516
                  D R +    AP GC +VYVG +  RFV++T+  +HP+FK+LLE AE E+GY + 
Sbjct  73   EKKSPNDKRDRTAMFAPRGCFTVYVGPKKERFVVRTKLASHPMFKILLEGAEEEFGYRSE  132

Query  517  GPLKLPCDVDLFVKVLV  567
            GP+ LPC+VD F+KVL 
Sbjct  133  GPIVLPCEVDFFLKVLA  149



>gb|EMS53827.1| hypothetical protein TRIUR3_00758 [Triticum urartu]
Length=129

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 4/82 (5%)
 Frame = +1

Query  343  CDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGP  522
            C     R K      EGC SVYVG + +R+V++TE +NHPLF  LLEEAE  +GY   GP
Sbjct  23   CRSTTARNK----PAEGCFSVYVGADRQRYVVRTECLNHPLFHALLEEAEEAFGYADAGP  78

Query  523  LKLPCDVDLFVKVLVEVEMDSD  588
            L+LPC+ + F KVL +++M+  
Sbjct  79   LELPCNTEAFAKVLEKIQMEKQ  100



>ref|XP_004971120.1| PREDICTED: uncharacterized protein LOC101781779 [Setaria italica]
Length=157

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +1

Query  376  RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLP-CDVDLF  552
            R +P GC SVYVG E  RFV++ E  NHPLF+ LL++AE EYGY A GPL LP CDVD F
Sbjct  38   RASPAGCFSVYVGTERERFVVRAECANHPLFRRLLDDAEREYGYAAQGPLALPGCDVDAF  97

Query  553  VKVLVEVE  576
            + VL ++E
Sbjct  98   LDVLWQME  105



>ref|XP_003576721.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brachypodium 
distachyon]
Length=143

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 64/128 (50%), Gaps = 22/128 (17%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
              I KT ++C+S                       R+   EGC SVYVG   +RFV++TE
Sbjct  19   GLITKTLERCRST-------------------PTARQKPAEGCFSVYVGAGRQRFVVRTE  59

Query  448  YVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVR---RGC  618
             VNHPLF  LLEEAE  +GY A GPL+LPC+ + F  VL ++  +            +GC
Sbjct  60   CVNHPLFVALLEEAEEVFGYAATGPLQLPCNAEAFTGVLEQIREEKQAAACRKAAAGKGC  119

Query  619  AFARSPAA  642
              AR  +A
Sbjct  120  GLARGQSA  127



>ref|XP_002459008.1| hypothetical protein SORBIDRAFT_03g044380 [Sorghum bicolor]
 gb|EES04128.1| hypothetical protein SORBIDRAFT_03g044380 [Sorghum bicolor]
Length=156

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 13/102 (13%)
 Frame = +1

Query  394  CLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLP-CDVDLFVKVLVE  570
            C SVYVG E  RFV++ E  NHPLF+ LL++AE EYGY A GPL LP CDVD F+ VL +
Sbjct  46   CFSVYVGSERERFVVRAECANHPLFRRLLDDAEREYGYAAQGPLALPGCDVDAFLDVLWQ  105

Query  571  VEMDSDDDDIYVRRGCAFARSP-----------AAAYHHLSP  663
            +E ++D DD   ++    A SP           AA Y  LSP
Sbjct  106  ME-NADADDGGQQQVAGAASSPICGLHSGSKGRAAGYRMLSP  146



>ref|NP_001175932.1| Os09g0507900 [Oryza sativa Japonica Group]
 dbj|BAH94660.1| Os09g0507900 [Oryza sativa Japonica Group]
Length=665

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 59/101 (58%), Gaps = 21/101 (21%)
 Frame = +1

Query  271  FIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEY  450
             IMKT  +C+   W                    RR A EGCLSVYVG   +RFV++T  
Sbjct  16   LIMKTLDRCRPPAW--------------------RRPA-EGCLSVYVGAARQRFVVRTAS  54

Query  451  VNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEV  573
            VNHPLF+ LLEEAE  +GY A GPL+LPCD  +F +VL ++
Sbjct  55   VNHPLFRPLLEEAEEAFGYAAAGPLQLPCDAAVFARVLEQI  95



>gb|EMT16843.1| hypothetical protein F775_31032 [Aegilops tauschii]
Length=130

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG   +RFV++TE +NHPLF+ LLEEAE  +GY   GPL+LPC+ + F KVL 
Sbjct  35   EGCFSVYVGAGRQRFVVRTECLNHPLFRALLEEAEEAFGYADAGPLELPCNTEAFTKVLE  94

Query  568  EVE  576
            ++E
Sbjct  95   KIE  97



>gb|EMT16842.1| hypothetical protein F775_18859 [Aegilops tauschii]
Length=129

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  RRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
            R    EGC SVYVG + +R+V++TE +NHPLF+ LLEEAE  +GY   GPL+LPC+ + F
Sbjct  29   RNKPAEGCFSVYVGADKQRYVVRTECLNHPLFQALLEEAEEAFGYADAGPLELPCNTEAF  88

Query  553  VKVLVEVEMDSD  588
             KVL ++E +  
Sbjct  89   TKVLEKIEKEKQ  100



>ref|NP_199889.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 dbj|BAA96989.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAQ56846.1| At5g50760 [Arabidopsis thaliana]
 gb|AED95989.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=183

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 14/121 (12%)
 Frame = +1

Query  262  LVNFIMKTWKKCKSLGWFV--------------GKRRSKLGCDDEDGRKKLRRVAPEGCL  399
            + N I+KTW+K KS G                 G  R +    +E   K  +     G  
Sbjct  1    MKNPILKTWRKVKSFGHTSSSTTPSFTKSKSCHGSFRLEDAKSNESKGKPKKESPSHGFF  60

Query  400  SVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEM  579
            +VYVG   +R V+KT+ +NHPLFK LLE+AE+EYGY   GP+ LPC+VD F K L +++ 
Sbjct  61   TVYVGPTKQRIVVKTKLLNHPLFKNLLEDAETEYGYRRDGPIVLPCEVDFFFKALADMKS  120

Query  580  D  582
            +
Sbjct  121  N  121



>ref|XP_004977952.1| PREDICTED: uncharacterized protein LOC101773448 [Setaria italica]
Length=262

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 13/110 (12%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGY--DAGGPLKLPCDVDLF  552
             AP GC +V VG E  RFV++ E  NHPLF+ LL+EAE+EYG+   A GPL LPC  + F
Sbjct  142  AAPPGCFAVLVGPERERFVVRAERANHPLFRALLDEAEAEYGFPHPAAGPLVLPCSAEEF  201

Query  553  VKVLVEVEMDSDDDDIYVRRGCAF-ARSPA----------AAYHHLSPSP  669
             +V+ EVE D D +   V RG +  A SPA          A Y  +SP P
Sbjct  202  RRVMSEVERDEDGEKEDVARGASVAASSPAWRFFSGGGDHAGYVKMSPEP  251



>ref|XP_010232765.1| PREDICTED: uncharacterized protein LOC100825908 [Brachypodium 
distachyon]
Length=184

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLP-  534
            GR  +  VAP GC SVYVG E  RFV++ +  +HP F+ LL++AESEYGY A GPL LP 
Sbjct  44   GRASMAAVAPAGCFSVYVGPERERFVVRADRASHPRFRRLLDDAESEYGYSAHGPLALPS  103

Query  535  CDVDLFVKVLVEVEMDSDDDD  597
            C V+ F+ VL  ++ D++ DD
Sbjct  104  CAVEDFLDVLWHMDHDAEIDD  124



>gb|EMT06448.1| hypothetical protein F775_14394 [Aegilops tauschii]
Length=123

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG + +R+V++TE +NHPLF+ LLEEAE  +GY   GPL+LPC+ + F KVL 
Sbjct  34   EGCFSVYVGADRQRYVVRTECLNHPLFQALLEEAEEAFGYADAGPLELPCNTEAFAKVLE  93

Query  568  EVEMDSD  588
            ++E +  
Sbjct  94   KIEKEKQ  100



>emb|CDM85822.1| unnamed protein product [Triticum aestivum]
Length=158

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 15/103 (15%)
 Frame = +1

Query  256  GVLVNFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFV  435
            G   + + +T ++C+S G   G R S               VAP GC SVYVG E  RFV
Sbjct  6    GARKSLVSRTLERCRS-GLASGGRSSAA-------------VAP-GCFSVYVGPERERFV  50

Query  436  IKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            ++ +  NHPLF+ LL++AE EYGY A GPL LPC VD F+ VL
Sbjct  51   VRADRANHPLFRRLLDDAEQEYGYAAQGPLALPCSVDAFLDVL  93



>gb|EMT16846.1| hypothetical protein F775_03778 [Aegilops tauschii]
Length=129

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = +1

Query  370  LRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDL  549
            +R    EGC SVYVG   +RFV++TE VNHPLF+ LL+EAE  +GY   GPL+LPC+ + 
Sbjct  28   MRNKPAEGCFSVYVGAGRQRFVVRTECVNHPLFRALLKEAEEVFGYADAGPLELPCNAEA  87

Query  550  FVKVLVEVEMDSDDDDIYVRRGCAFAR  630
            F  VL ++E   ++  +   R C  AR
Sbjct  88   FAGVLEQIE---EEKQMAGGRRCGLAR  111



>gb|EMS53831.1| hypothetical protein TRIUR3_00762 [Triticum urartu]
Length=173

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG   +RFV++TE VNHPLF+ LLEEAE  +GY   GPL+LPC+ + F +VL 
Sbjct  35   EGCFSVYVGAGKQRFVVRTECVNHPLFRALLEEAEEVFGYADAGPLELPCNAEAFARVLQ  94

Query  568  EVEMDSDDDDIYVRRGCAF  624
            +++   ++  +   R C F
Sbjct  95   QIK---EEKQMVAGRRCTF  110



>ref|XP_010442311.1| PREDICTED: uncharacterized protein LOC104725349 [Camelina sativa]
Length=183

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 74/122 (61%), Gaps = 15/122 (12%)
 Frame = +1

Query  262  LVNFIMKTWKKCKSLGWF-------VGKRRSKLG------CDDEDGRKKLRRV-APE-GC  396
            + N ++KTW++ KS G         V K +S  G       +  + + K+RR  +P+ G 
Sbjct  1    MKNPVVKTWRRMKSFGHTSSSTTATVKKSKSWTGSISLEDANSIESKGKMRRKESPQHGF  60

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +V VG   +R V+KT+ VNHPLF+ LLE+AE+EYGY   GP+ LPC+VD F KVL E++
Sbjct  61   FTVCVGPTKQRVVVKTKLVNHPLFRNLLEDAENEYGYRGDGPIVLPCEVDFFFKVLAEMK  120

Query  577  MD  582
             +
Sbjct  121  SN  122



>ref|XP_006281172.1| hypothetical protein CARUB_v10027207mg [Capsella rubella]
 gb|EOA14070.1| hypothetical protein CARUB_v10027207mg [Capsella rubella]
Length=184

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 65/122 (53%), Gaps = 15/122 (12%)
 Frame = +1

Query  262  LVNFIMKTWKKCKSLGWFV---------------GKRRSKLGCDDEDGRKKLRRVAPEGC  396
            + N IM TW+K KS G                  G  R +    +E   K  +     G 
Sbjct  1    MKNPIMTTWRKVKSFGHTSSTTTTPSLTKSKSCYGSFRLEDAKSEEPKGKTKKESPSHGF  60

Query  397  LSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
             +VYVG   +R V+KT+ +NHPLFK LLE+AE+EYGY   GP+ LPC+VD F K L +++
Sbjct  61   FTVYVGPTKQRIVVKTKLLNHPLFKNLLEDAETEYGYRHDGPIVLPCEVDFFFKALADMK  120

Query  577  MD  582
             +
Sbjct  121  SN  122



>gb|KEH20997.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=111

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
             P G + VYVG E +RF+IK +  NHPLFK LLE+ E+EYGY   GPL  PCDVDLF ++
Sbjct  46   PPHGYICVYVGPERQRFIIKIKIFNHPLFKTLLEDVENEYGYRNDGPLWFPCDVDLFCEI  105

Query  562  LVEVE  576
            LV++E
Sbjct  106  LVDIE  110



>ref|XP_002459007.1| hypothetical protein SORBIDRAFT_03g044370 [Sorghum bicolor]
 gb|EES04127.1| hypothetical protein SORBIDRAFT_03g044370 [Sorghum bicolor]
Length=158

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 59/102 (58%), Gaps = 12/102 (12%)
 Frame = +1

Query  394  CLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLP-CDVDLFVKVLVE  570
            C SVYVG E  RFV++ E  NHPLF+ LL++AE EYGY   GPL LP CDVD F+ VL +
Sbjct  46   CFSVYVGPERERFVVRAECANHPLFRRLLDDAEREYGYATQGPLALPGCDVDAFLDVLWQ  105

Query  571  VEMDSDDDDIYVRRGCAFARSP-----------AAAYHHLSP  663
            +E   D D+   ++    A SP           AA Y  LSP
Sbjct  106  MERGDDADEGGHQQVAGSASSPICGLHSGSKGRAAGYRMLSP  147



>emb|CDY45819.1| BnaC03g16420D [Brassica napus]
Length=175

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 65/119 (55%), Gaps = 17/119 (14%)
 Frame = +1

Query  277  MKTWKKCKSLGW-------FVGKRRSKLGCDD-EDGRKK---------LRRVAPEGCLSV  405
            M+TW+K KS G         + K +S  G    E+   K              P GC +V
Sbjct  1    METWRKMKSFGHKSSSSTASITKSKSWNGSAHLENANNKESTGKIKKKSPPPPPHGCFTV  60

Query  406  YVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMD  582
            YVG    R V+KT+ +NHPLFK LLEEAE+EYGY   GP+ LPC+VD F KVL  ++ +
Sbjct  61   YVGPTKERVVVKTKLLNHPLFKNLLEEAEAEYGYRRDGPIVLPCEVDFFYKVLANMKFN  119



>ref|XP_009132695.1| PREDICTED: uncharacterized protein LOC103857272 [Brassica rapa]
Length=175

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 65/119 (55%), Gaps = 17/119 (14%)
 Frame = +1

Query  277  MKTWKKCKSLGW-------FVGKRRSKLGCDD-EDGRKK---------LRRVAPEGCLSV  405
            M+TW+K KS G         + K +S  G    E+   K              P GC +V
Sbjct  1    METWRKMKSFGHKSSSSTASITKSKSWNGSAHLENANNKESTGKIKKKSPPPPPHGCFTV  60

Query  406  YVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMD  582
            YVG    R V+KT+ +NHPLFK LLEEAE+EYGY   GP+ LPC+VD F KVL  ++ +
Sbjct  61   YVGPTKERVVVKTKLLNHPLFKNLLEEAEAEYGYRRDGPIVLPCEVDFFYKVLANMKFN  119



>gb|EMT16845.1| hypothetical protein F775_03777 [Aegilops tauschii]
Length=165

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG   +RFV++TE VNHPLF+ LLEEAE  +GY   GPL+LPC+ + F  VL 
Sbjct  35   EGCFSVYVGAGRQRFVVRTECVNHPLFRALLEEAEEVFGYADAGPLELPCNTEAFAGVLQ  94

Query  568  EVE  576
            ++E
Sbjct  95   QIE  97



>gb|EMS53829.1| hypothetical protein TRIUR3_00760 [Triticum urartu]
Length=130

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG   +RFV++ E +NHPLF+ LLEEAE  +GY   GPL+LPC+ + F KVL 
Sbjct  35   EGCFSVYVGAGRQRFVVRMECLNHPLFRALLEEAEEAFGYADSGPLELPCNTEAFTKVLE  94

Query  568  EVE  576
            ++E
Sbjct  95   KIE  97



>gb|EMS53832.1| hypothetical protein TRIUR3_00763 [Triticum urartu]
Length=334

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  370  LRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDL  549
            +R    EGC SVYVG   +RFV++T  VNHPLF+ LLEEAE  +GY A GPL+LPC+ ++
Sbjct  28   MRNKPAEGCFSVYVGAGRQRFVVRTVCVNHPLFRALLEEAEEVFGYAAAGPLELPCNAEM  87

Query  550  FVKVLVEVE  576
            F  VL ++E
Sbjct  88   FAGVLEQIE  96



>gb|EMS53830.1| hypothetical protein TRIUR3_00761 [Triticum urartu]
Length=131

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG   +RF+++TE VNHPLF++LL EAE  +GY A GPL+LPC+ + F  VL 
Sbjct  43   EGCFSVYVGMGRQRFIVRTECVNHPLFRVLLAEAEEMFGYAATGPLELPCNSEAFAGVLE  102

Query  568  EVE  576
            ++E
Sbjct  103  QIE  105



>emb|CDM85823.1| unnamed protein product [Triticum aestivum]
Length=242

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  352  EDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
              G K    VAP GC SVYVG E  RFV++ +  NHPLF+ LL++AE EYGY A GPL L
Sbjct  24   NSGGKSSAAVAP-GCFSVYVGPERERFVVRADRANHPLFRRLLDDAEQEYGYAAQGPLTL  82

Query  532  PCDVDLFVKVL  564
            PC VD F+ VL
Sbjct  83   PCSVDAFLDVL  93


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +1

Query  424  RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            RR  I T   +HPLF+ LL++AE EYGY A GPL LPC VD F+ VL
Sbjct  133  RRAEISTS--DHPLFRRLLDDAEQEYGYAAQGPLTLPCSVDAFLDVL  177



>emb|CDY34024.1| BnaC03g27910D [Brassica napus]
Length=162

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 63/113 (56%), Gaps = 11/113 (10%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKR----------RSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEG  423
            IMKTW+K K+ G                      +D    + + ++  + C +VYVG   
Sbjct  5    IMKTWRKIKTFGQTSSSTTASFTRSKTWNGSAHLEDAKNSESIGKIK-KKCFTVYVGPMK  63

Query  424  RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMD  582
            +R V+K + +NHPLFK LLE AE+EYGY   GP+ LPC+VD F KVL +++ D
Sbjct  64   QRIVVKMKLLNHPLFKNLLEAAENEYGYRRDGPIVLPCEVDFFFKVLADIKSD  116



>ref|XP_002985683.1| hypothetical protein SELMODRAFT_49560, partial [Selaginella moellendorffii]
 gb|EFJ13261.1| hypothetical protein SELMODRAFT_49560, partial [Selaginella moellendorffii]
Length=82

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
             P+G L+VYVGEEGRRFVI   Y+NHPLF+ LL+++E E+GY   G + LPC++ +F +V
Sbjct  15   VPKGSLAVYVGEEGRRFVIPISYLNHPLFQELLKKSEEEFGYTHYGAMHLPCNILVFYRV  74

Query  562  LVEVEMD  582
            L  +E +
Sbjct  75   LERIESE  81



>gb|EMT06447.1| hypothetical protein F775_28320 [Aegilops tauschii]
Length=127

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYVG + +R+V++ E +NHPLF+ LLEEAE  +GY   GPL+LPC+   F KVL 
Sbjct  32   EGCFSVYVGADRQRYVVRMECLNHPLFQALLEEAEEAFGYADAGPLELPCNTKAFAKVLE  91

Query  568  EVE  576
            ++E
Sbjct  92   KIE  94



>ref|XP_007011526.1| SAUR family protein [Theobroma cacao]
 gb|EOY29145.1| SAUR family protein [Theobroma cacao]
Length=161

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 74/149 (50%), Gaps = 17/149 (11%)
 Frame = +1

Query  259  VLVNFIMKTWKK----------CKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVY  408
            V +  I+K W+K          C S    +   +  L   D   R+      P+G L+V 
Sbjct  13   VRLQQILKKWRKLANTSKSSSNCNSGSKSIKFLKRTLSLSDNSVREASSNTVPKGYLAVS  72

Query  409  VGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD  588
            VGEE +RF+I TEY++H  F +LL EAE E+G+   G L++PC+V +F  +   V+M  +
Sbjct  73   VGEEQKRFIIPTEYLSHHAFHLLLREAEEEFGFQQAGVLRIPCEVSIFESI---VKMVEE  129

Query  589  DDDIYVRRG----CAFARSPAAAYHHLSP  663
              D++  +     CA       ++H  SP
Sbjct  130  KKDLFFMQESLGYCASESQRTPSHHPQSP  158



>gb|EMS53828.1| hypothetical protein TRIUR3_00759 [Triticum urartu]
Length=129

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +1

Query  361  RKKLRRVAP-EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPC  537
            R  + R  P EGC SVYVG + +R++++TE ++HPLF+ LLEEAE  +GY   GPL+LPC
Sbjct  24   RSTVARNKPTEGCFSVYVGVDRQRYMVRTECLSHPLFQALLEEAEEAFGYADAGPLELPC  83

Query  538  DVDLFVKVLVEVEMDSDDDDIYVRR  612
            + + F KVL ++E   ++  +  RR
Sbjct  84   NTEAFAKVLEKIE---EEKQMVARR  105



>ref|XP_008784357.1| PREDICTED: auxin-induced protein 15A-like [Phoenix dactylifera]
Length=132

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = +1

Query  325  RRSKLGCD-DEDGRKKLRRVA--PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAES  495
            R + + CD DE+G +        P+GC+ +YVG E RRFV+ T Y++HP FK+LLE+AE 
Sbjct  31   RNACISCDSDEEGCRSPEPPPDVPKGCIPIYVGPEHRRFVVPTSYLSHPAFKLLLEKAEE  90

Query  496  EYGYDAGGPLKLPCDVDLFVKVL  564
            E+G++ GG + +PC+++ F  +L
Sbjct  91   EFGFEHGGAITIPCEIETFKYIL  113



>ref|XP_004240979.1| PREDICTED: auxin-induced protein X15 [Solanum lycopersicum]
 gb|AFO37698.1| SAUR59, partial [Solanum lycopersicum]
Length=115

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 5/91 (5%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
            G+++LR V P+GCL++ VG  EE +RFVI   Y+NHPLF  LL+E+E EYG+D  GP+ +
Sbjct  23   GKRELRNV-PKGCLAITVGQGEEQQRFVIPVIYINHPLFMQLLKESEDEYGFDHNGPINI  81

Query  532  PCDVDLF--VKVLVEVEMDSDDDDIYVRRGC  618
            PC V+ F  V+ ++  E  S     +    C
Sbjct  82   PCHVEEFRHVQGIIHKETTSQHHHAHNNPWC  112



>ref|XP_010243353.1| PREDICTED: uncharacterized protein LOC104587436 [Nelumbo nucifera]
Length=144

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPC  537
            G++KL    P G L+V VG+ GRRFVI+  Y+NHPLF+ LL++A  EYG+   GPL LPC
Sbjct  32   GKRKLPIDVPPGHLAVIVGDAGRRFVIRASYLNHPLFRQLLDQAYEEYGHSHSGPLALPC  91

Query  538  DVDLFVKVL  564
            D  LF ++L
Sbjct  92   DEFLFQEIL  100



>ref|XP_002446314.1| hypothetical protein SORBIDRAFT_06g014230 [Sorghum bicolor]
 gb|EES10642.1| hypothetical protein SORBIDRAFT_06g014230 [Sorghum bicolor]
Length=172

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 59/105 (56%), Gaps = 15/105 (14%)
 Frame = +1

Query  268  NFIMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTE  447
             F+ KT ++C SLG   G RR          R +     P GC  V VG E  RF ++ E
Sbjct  24   GFLAKTLERCWSLG---GGRR----------RPRWPTTTPPGCFVVLVGPERERFAVRAE  70

Query  448  YVNHPLFKMLLEEAESEYGY--DAGGPLKLPCDVDLFVKVLVEVE  576
              NHPLF+ LL+EAE+EYG+   A  PL LPC  D F++V+ EVE
Sbjct  71   GANHPLFRALLDEAEAEYGFPRPAAEPLLLPCAADEFLRVMSEVE  115



>gb|EMT25620.1| hypothetical protein F775_26776 [Aegilops tauschii]
Length=158

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  352  EDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
              G K    VAP GC SVYVG E  RF+++ +  +HPLF+ LL++AE EYGY A GPL L
Sbjct  24   NSGGKSSAAVAP-GCFSVYVGPERERFLVRADRADHPLFRRLLDDAEQEYGYAAKGPLTL  82

Query  532  PCDVDLFVKVL  564
            PC VD F+ VL
Sbjct  83   PCSVDAFLDVL  93



>ref|XP_009343363.1| PREDICTED: uncharacterized protein LOC103935326 isoform X3 [Pyrus 
x bretschneideri]
Length=183

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DED--GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  75   ISKRLTNVPCDSDEDICHSPEPPPDVPQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  134

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE EYG+D GG L +PC+ + F  +L  +E    +  DDI
Sbjct  135  AEEEYGFDHGGGLTIPCETETFKYLLKCMENHQKAHPDDI  174



>ref|XP_009343362.1| PREDICTED: uncharacterized protein LOC103935326 isoform X2 [Pyrus 
x bretschneideri]
Length=184

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DED--GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  76   ISKRLTNVPCDSDEDICHSPEPPPDVPQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  135

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE EYG+D GG L +PC+ + F  +L  +E    +  DDI
Sbjct  136  AEEEYGFDHGGGLTIPCETETFKYLLKCMENHQKAHPDDI  175



>ref|XP_002318465.1| hypothetical protein POPTR_0012s03050g [Populus trichocarpa]
 gb|EEE96685.1| hypothetical protein POPTR_0012s03050g [Populus trichocarpa]
Length=135

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 5/82 (6%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
            G+K+L+ + P+GCL+V VG  EE +RFVI   Y+NHPLF  LL+EAE E+G+D  GP+ +
Sbjct  35   GKKQLKDI-PKGCLAVMVGQGEEQQRFVIPVIYINHPLFMQLLKEAEEEFGFDQEGPITI  93

Query  532  PCDVDLF--VKVLVEVEMDSDD  591
            PC V+ F  V+ ++E E  S D
Sbjct  94   PCHVEEFRNVQGMIEEEKSSQD  115



>ref|XP_009343361.1| PREDICTED: uncharacterized protein LOC103935326 isoform X1 [Pyrus 
x bretschneideri]
Length=190

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DED--GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  82   ISKRLTNVPCDSDEDICHSPEPPPDVPQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  141

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE EYG+D GG L +PC+ + F  +L  +E    +  DDI
Sbjct  142  AEEEYGFDHGGGLTIPCETETFKYLLKCMENHQKAHPDDI  181



>ref|XP_004307934.1| PREDICTED: auxin-induced protein 10A5-like [Fragaria vesca subsp. 
vesca]
Length=122

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+GC++V VGEE +RFVI   ++NHPLF  LL+EAE EYG+D  GP+ +PC V+ F+ V 
Sbjct  33   PKGCMAVMVGEEQKRFVIPVAHINHPLFYHLLKEAEKEYGFDHDGPITIPCHVEEFLAVE  92

Query  565  VEV  573
             E+
Sbjct  93   GEI  95



>ref|XP_008437649.1| PREDICTED: auxin-induced protein X15 [Cucumis melo]
Length=120

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
             P+GCL++ VG+E +RFVI   YVNHPLF  LL+EAE EYG+D  GP+ +PC VD F
Sbjct  35   TPKGCLAILVGQEQQRFVIPVIYVNHPLFVQLLKEAEDEYGFDQKGPISIPCPVDDF  91



>ref|XP_006350722.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=122

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
            G+++L+ + P+GCL++ VG  EE +RFVI   Y+NHPLF  LL+EAE EYG+D  GP+ +
Sbjct  30   GKRELKDI-PKGCLAITVGQGEEQQRFVIPVIYINHPLFMQLLKEAEEEYGFDHNGPINI  88

Query  532  PCDVDLF--VKVLVEVEMDSDDDDIYVRRGC  618
            PC ++ F  V+ +++ E  S     +    C
Sbjct  89   PCHIEEFRHVQGIIDKETTSQHQHTHNNPWC  119



>ref|XP_004235010.1| PREDICTED: auxin-induced protein X15-like [Solanum lycopersicum]
Length=114

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +1

Query  349  DEDGRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGP  522
               G+K+L+ + P+GCL+V VG  EE +RFVI   Y+NHPLF  LL+EAE E+G+D  GP
Sbjct  21   HNHGKKELKNI-PKGCLAVIVGQGEEQQRFVIPVNYINHPLFLQLLKEAEKEFGFDHKGP  79

Query  523  LKLPCDVDLF  552
            + +PC V+ F
Sbjct  80   INIPCHVEQF  89



>ref|XP_002989902.1| hypothetical protein SELMODRAFT_49701, partial [Selaginella moellendorffii]
 gb|EFJ08915.1| hypothetical protein SELMODRAFT_49701, partial [Selaginella moellendorffii]
Length=61

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G  +VY GEE RRF+++ E++NHPLF+ LLE+A  EYG+D  G L +PC+  LF  VL
Sbjct  2    PQGSFAVYAGEERRRFLVRMEHLNHPLFRALLEKAAEEYGFDHAGALSIPCEAVLFEHVL  61



>ref|XP_006851432.1| hypothetical protein AMTR_s00040p00095090 [Amborella trichopoda]
 gb|ERN13013.1| hypothetical protein AMTR_s00040p00095090 [Amborella trichopoda]
Length=116

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 65/109 (60%), Gaps = 3/109 (3%)
 Frame = +1

Query  277  MKTWKKCKSLGWFVGKRRSKLGC-DDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYV  453
            M++ KK       +G+R+++  C  D  G   +    P GC++VYVGEE RR+V+   ++
Sbjct  1    MESLKKIAKRVQSLGRRKTRYECLFDASGDTPV--TTPPGCVAVYVGEERRRYVVPMNFL  58

Query  454  NHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDI  600
            +HPLF+MLLE+A+ E+G+D    L +PC V  F +V+  +E      D+
Sbjct  59   SHPLFRMLLEKAQDEFGFDQKEGLVVPCSVFSFEQVVCAIESSHGQFDL  107



>ref|XP_009348905.1| PREDICTED: uncharacterized protein LOC103940510 isoform X3 [Pyrus 
x bretschneideri]
Length=183

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DED--GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  75   ISKRLTNVLCDSDEDICHSPEPPPDVPQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  134

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE EYG+D GG L +PC+ + F  +L  +E    +  DDI
Sbjct  135  AEEEYGFDHGGGLTIPCETETFKYLLKCMENHQKAHPDDI  174



>ref|XP_006493175.1| PREDICTED: auxin-induced protein 10A5-like [Citrus sinensis]
Length=121

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVGEEG---RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLK  528
            G+K+  R  P+GCL++ VG+EG   ++FVI   Y+NHPLF  LL+EAE EYG+D  GP+ 
Sbjct  24   GKKEEMRNIPKGCLAILVGQEGEEQQKFVIPVIYINHPLFMQLLKEAEEEYGFDQKGPIT  83

Query  529  LPCDVDLFVKV  561
            LPC V+ F  V
Sbjct  84   LPCHVEEFRTV  94



>ref|XP_009348904.1| PREDICTED: uncharacterized protein LOC103940510 isoform X2 [Pyrus 
x bretschneideri]
Length=184

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DED--GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  76   ISKRLTNVLCDSDEDICHSPEPPPDVPQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  135

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE EYG+D GG L +PC+ + F  +L  +E    +  DDI
Sbjct  136  AEEEYGFDHGGGLTIPCETETFKYLLKCMENHQKAHPDDI  175



>ref|XP_009793038.1| PREDICTED: auxin-induced protein X15-like [Nicotiana sylvestris]
Length=115

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = +1

Query  346  DDEDGRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGG  519
            +   G+K+L+ + P+GCL++ VG  EE +RFVI   Y+NHPLF  LL+EAE EYG+   G
Sbjct  20   NHGHGKKELKDI-PKGCLAITVGYGEEHQRFVIPVTYINHPLFMQLLKEAEEEYGFGHKG  78

Query  520  PLKLPCDVDLF--VKVLVEVEMDSDDDD  597
            P+K+PC ++ F  V+ +++ E  S +  
Sbjct  79   PIKIPCHIEEFRHVQGVIDKEAASHNHH  106



>ref|XP_009348903.1| PREDICTED: uncharacterized protein LOC103940510 isoform X1 [Pyrus 
x bretschneideri]
Length=190

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DED--GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  82   ISKRLTNVLCDSDEDICHSPEPPPDVPQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  141

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE EYG+D GG L +PC+ + F  +L  +E    +  DDI
Sbjct  142  AEEEYGFDHGGGLTIPCETETFKYLLKCMENHQKAHPDDI  181



>ref|XP_009348906.1| PREDICTED: uncharacterized protein LOC103940510 isoform X4 [Pyrus 
x bretschneideri]
Length=176

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DED--GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  68   ISKRLTNVLCDSDEDICHSPEPPPDVPQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  127

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE EYG+D GG L +PC+ + F  +L  +E    +  DDI
Sbjct  128  AEEEYGFDHGGGLTIPCETETFKYLLKCMENHQKAHPDDI  167



>ref|XP_009123263.1| PREDICTED: uncharacterized protein LOC103848025 [Brassica rapa]
 emb|CDY12336.1| BnaA06g20080D [Brassica napus]
Length=159

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            PEG L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  79   PEGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKYLL  138

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  139  NCIENHPKDD  148



>ref|XP_010035304.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Eucalyptus 
grandis]
Length=131

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +1

Query  385  PEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            P GCL+V VG  EE RRFVI   YVNHPLF  LL EAE EYG+D  GP+ +PC VD F  
Sbjct  42   PRGCLAVSVGQGEEQRRFVIPVAYVNHPLFVELLREAEDEYGFDQKGPINIPCHVDEFRN  101

Query  559  VLVEVEMD  582
            V   ++ D
Sbjct  102  VQDSIDRD  109



>ref|XP_006347637.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=117

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
            G+K+L+ + P+GCL+V VG  EE +RFVI   Y+NHPLF  LL+EAE E+G+D  GP+ +
Sbjct  27   GKKELKNI-PKGCLAVIVGQGEEQQRFVIPVNYINHPLFLQLLKEAEKEFGFDHKGPINI  85

Query  532  PCDVDLF  552
            PC V+ F
Sbjct  86   PCHVEQF  92



>ref|XP_006441210.1| hypothetical protein CICLE_v10022912mg [Citrus clementina]
 gb|ESR54450.1| hypothetical protein CICLE_v10022912mg [Citrus clementina]
 gb|KDO44254.1| hypothetical protein CISIN_1g035928mg [Citrus sinensis]
Length=118

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVGEEG---RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLK  528
            G+K   R  P+GCL++ VG+EG   ++FVI   Y+NHPLF  LL+EAE EYG+D  GP+ 
Sbjct  24   GKKDEMRNIPKGCLAILVGQEGEEQQKFVIPVIYINHPLFMQLLKEAEEEYGFDQKGPIT  83

Query  529  LPCDVDLFVKV  561
            LPC V+ F  V
Sbjct  84   LPCHVEEFRTV  94



>ref|XP_011075910.1| PREDICTED: auxin-induced protein 15A [Sesamum indicum]
Length=111

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 5/80 (6%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVGE--EGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
            GR + R + P+GCL++ VG+  E +RFVI   YVNHPLF  LL+EAE EYG+D  GP+ +
Sbjct  11   GRSEARSI-PKGCLAITVGQGAEQQRFVIPVIYVNHPLFTQLLKEAEEEYGFDQKGPINI  69

Query  532  PCDVDLFVKV--LVEVEMDS  585
            PC V+ F  V  L++ E  S
Sbjct  70   PCHVEEFCHVRGLIDKETTS  89



>ref|XP_004508030.1| PREDICTED: uncharacterized protein LOC101493355 [Cicer arietinum]
Length=153

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 5/99 (5%)
 Frame = +1

Query  313  FVGKRRSKLG-CD-DED---GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKML  477
             + KR + L  CD DED      K     P+G L+VYVG E RRF+I T Y++H LFKML
Sbjct  44   MINKRLNNLVYCDSDEDSCNNSPKPPHDVPKGYLAVYVGPELRRFIIPTSYLSHSLFKML  103

Query  478  LEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDD  594
            LE+A  E+G+D  G L +PC+++ F  +L  +E   D+D
Sbjct  104  LEKAADEFGFDQSGGLTIPCEIETFKYLLSCMENHHDND  142



>ref|XP_008391750.1| PREDICTED: uncharacterized protein LOC103453925 isoform X2 [Malus 
domestica]
 ref|XP_008344160.1| PREDICTED: uncharacterized protein LOC103406972 isoform X2 [Malus 
domestica]
Length=183

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T Y++H LFK+LLE+AE EYG+D GG L +PC+ + F  +L
Sbjct  101  PQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCETETFKYLL  160

Query  565  --VEVEMDSDDDDI  600
              +E    +  DDI
Sbjct  161  KCMENHQKAHPDDI  174



>ref|XP_008391743.1| PREDICTED: uncharacterized protein LOC103453925 isoform X1 [Malus 
domestica]
 ref|XP_008344159.1| PREDICTED: uncharacterized protein LOC103406972 isoform X1 [Malus 
domestica]
Length=184

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T Y++H LFK+LLE+AE EYG+D GG L +PC+ + F  +L
Sbjct  102  PQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCETETFKYLL  161

Query  565  --VEVEMDSDDDDI  600
              +E    +  DDI
Sbjct  162  KCMENHQKAHPDDI  175



>gb|KDP33420.1| hypothetical protein JCGZ_06991 [Jatropha curcas]
Length=168

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 9/118 (8%)
 Frame = +1

Query  328  RSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGY  507
            R  L   +   +       P+G L++ VGEE +RF+I TEY+ HP F  LL EAE E+G+
Sbjct  51   RRTLSLSETSSQSTPSNAVPKGYLAICVGEELKRFIIPTEYLGHPAFHFLLREAEEEFGF  110

Query  508  DAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRR------GCAFARSPAAAYHHLSP  663
               G L++PC+V +F  +L  VE   ++ D+Y  +       C+       ++H  SP
Sbjct  111  QQTGVLRIPCEVAVFESILKLVE---ENKDVYFTQDSVGLAHCSSKNHQTPSHHPQSP  165



>ref|XP_008391757.1| PREDICTED: uncharacterized protein LOC103453925 isoform X3 [Malus 
domestica]
 ref|XP_008344161.1| PREDICTED: uncharacterized protein LOC103406972 isoform X3 [Malus 
domestica]
Length=176

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T Y++H LFK+LLE+AE EYG+D GG L +PC+ + F  +L
Sbjct  94   PQGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEKAEEEYGFDHGGGLTIPCETETFKYLL  153

Query  565  --VEVEMDSDDDDI  600
              +E    +  DDI
Sbjct  154  KCMENHQKAHPDDI  167



>ref|XP_002968653.1| hypothetical protein SELMODRAFT_69737, partial [Selaginella moellendorffii]
 gb|EFJ29769.1| hypothetical protein SELMODRAFT_69737, partial [Selaginella moellendorffii]
Length=61

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G  +VY GEE  RF+++ E++NHPLF+ LLE+A  EYG+D  G L +PC+  LF  VL
Sbjct  2    PQGSFAVYAGEERHRFLVRMEHLNHPLFRALLEKAAEEYGFDHAGALSIPCEAVLFEHVL  61



>ref|XP_008790836.1| PREDICTED: auxin-induced protein 15A-like [Phoenix dactylifera]
Length=117

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GCL VYVGEE +RFVI T++++HPLF+MLLE A  EYG++    L LPC+V +F +VL  
Sbjct  40   GCLPVYVGEERQRFVIPTDFLSHPLFRMLLERAYREYGFEQRSGLMLPCNVSVFQEVLSA  99

Query  571  VEMDSDDDDI  600
            V+      D+
Sbjct  100  VKCSHGQFDL  109



>ref|XP_010050905.1| PREDICTED: uncharacterized protein LOC104439553 [Eucalyptus grandis]
Length=165

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = +1

Query  313  FVGKRRSKLGCDDEDGRKKLRR------VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKM  474
            F+ +  S L  +D D     +       V P+G L+VYVGEE  RF+  T Y+ HP+F+ 
Sbjct  49   FLKRTISSLSSEDNDCNNYNKHSSGNSNVVPKGYLAVYVGEELERFIFPTRYLGHPVFRF  108

Query  475  LLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            LL EAE E+G+   G L++PCDV +F  VL  VE
Sbjct  109  LLREAEEEFGFQQTGVLRIPCDVSVFQSVLEMVE  142



>ref|XP_011006641.1| PREDICTED: uncharacterized protein LOC105112603 [Populus euphratica]
 ref|XP_011008683.1| PREDICTED: uncharacterized protein LOC105113999 [Populus euphratica]
Length=169

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 16/121 (13%)
 Frame = +1

Query  337  LGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAG  516
            L   D   ++      P+G L+V VGEE +RF+I T+Y++HP F +LL EAE E+G+   
Sbjct  50   LSISDNSAKETSSNAVPKGYLAVGVGEEQKRFIIPTDYLSHPAFLVLLREAEEEFGFQQA  109

Query  517  GPLKLPCDVDLFVKVLVEVE------------MDSDDDDIYVRRGCAFARSPAAAYHHLS  660
            G L++PC+V +F  +L  VE            +D D+  +Y    C+       ++H  S
Sbjct  110  GVLRIPCEVAVFESILKLVEEKKDLFFMQECRLDVDNIAVY----CSSKSQQTPSHHPQS  165

Query  661  P  663
            P
Sbjct  166  P  166



>ref|XP_006382198.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ERP59995.1| auxin-responsive family protein [Populus trichocarpa]
Length=169

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 16/121 (13%)
 Frame = +1

Query  337  LGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAG  516
            L   +   ++      P+G L+V VGEE +RF+I TEY++HP F +LL EAE E+G+   
Sbjct  50   LSIPENSAKETSSNAVPKGYLAVGVGEEQKRFIIPTEYLSHPAFLILLREAEEEFGFQQA  109

Query  517  GPLKLPCDVDLFVKVLVEVE------------MDSDDDDIYVRRGCAFARSPAAAYHHLS  660
            G L++PC+V +F  +L  VE            +D D+  +Y    C+       ++H  S
Sbjct  110  GVLRIPCEVAVFESILKLVEEKKDLFFMQECRLDVDNIAVY----CSSKSQQTPSHHPQS  165

Query  661  P  663
            P
Sbjct  166  P  166



>ref|XP_004291305.1| PREDICTED: uncharacterized protein LOC101314623 [Fragaria vesca 
subsp. vesca]
Length=160

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
             P+G L+V VG+E +RFVI T+Y+  P F+ LL EAE E+G+   G L++PC+V +F ++
Sbjct  68   VPKGYLAVCVGDELKRFVIPTDYLGRPAFQFLLREAEEEFGFQQTGVLRIPCEVSVFEEL  127

Query  562  LVEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSP  663
            L  VE   +D D +  +GC ++ S    YH  SP
Sbjct  128  LKMVE---EDRDTFFMQGC-YSESQLNFYHPESP  157



>ref|XP_008242287.1| PREDICTED: uncharacterized protein LOC103340628 isoform X2 [Prunus 
mume]
Length=186

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = +1

Query  316  VGKRRSKLGCD-DEDGRKKLRRVA--PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED  +     A  PEG L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  79   ISKRLTNIICDSDEDNGQSPEPPADVPEGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  138

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL  564
            AE E+G+D  G L +PC+ + F  +L
Sbjct  139  AEEEFGFDHSGGLTIPCETETFKYLL  164



>gb|KHN38103.1| Auxin-induced protein X15 [Glycine soja]
Length=154

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 69/138 (50%), Gaps = 11/138 (8%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSK--------LGCDDEDGRKKLRRVAPEGCLSVYVGEEGRR  429
            I+K WKK  +         SK        L   D       + + P+G L+V VG+E +R
Sbjct  18   ILKKWKKVATASNNNNSSSSKGIKFLKRTLSFTDVSSTNTNQDIVPKGFLAVCVGKELKR  77

Query  430  FVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYVR  609
            F+I T+Y+ H  F+MLL+EAE E+G+   G LK+PC V +F K+L  VE +    D +  
Sbjct  78   FIIPTDYLRHQAFEMLLQEAEEEFGFQQEGVLKIPCQVSVFEKILNAVEDNKQPLDEF--  135

Query  610  RGCAFARSPAAAYHHLSP  663
             G   +     + HH  P
Sbjct  136  -GFNASDCEVTSPHHAQP  152



>ref|XP_008242284.1| PREDICTED: uncharacterized protein LOC103340628 isoform X1 [Prunus 
mume]
Length=187

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = +1

Query  316  VGKRRSKLGCD-DEDGRKKLRRVA--PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED  +     A  PEG L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  79   ISKRLTNIICDSDEDNGQSPEPPADVPEGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  138

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL  564
            AE E+G+D  G L +PC+ + F  +L
Sbjct  139  AEEEFGFDHSGGLTIPCETETFKYLL  164



>ref|XP_007012552.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
 gb|EOY30171.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
Length=159

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (61%), Gaps = 4/99 (4%)
 Frame = +1

Query  316  VGKRRSKLGCDDED----GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLE  483
            V KR + + C D D       +     P+G L+VYVG E RRF+I T Y++HP+FK+LLE
Sbjct  50   VNKRLTNVMCCDSDEESCHSPEPPPDVPKGYLAVYVGPELRRFIIPTSYLSHPVFKILLE  109

Query  484  EAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDI  600
            +AE E+GY+  G L LPC+++ F  +L  +E +     I
Sbjct  110  KAEEEFGYNHNGGLTLPCEIETFKYLLKCIENNHKGHPI  148



>ref|XP_009760450.1| PREDICTED: uncharacterized protein LOC104212795 [Nicotiana sylvestris]
Length=166

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  349  DEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLK  528
            DE  +    R  P G L+VYVG E RRFVI T ++N P+F  LL++AE E+G+   G L 
Sbjct  44   DEPAQAGSNRRTPSGSLAVYVGPERRRFVIPTRFLNLPVFISLLDKAEEEFGFQPSGGLV  103

Query  529  LPCDVDLFVKVLVEVEMD  582
            LPC+V+ F ++L  +EMD
Sbjct  104  LPCEVEFFSEILRLLEMD  121



>ref|XP_004502720.1| PREDICTED: uncharacterized protein LOC101503085 [Cicer arietinum]
Length=146

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +1

Query  385  PEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
            P+GCL+V VG  EE +RFVI   Y+NHPLF  LL+EAE EYG+D  GP+ +PC V+ F  
Sbjct  64   PKGCLAVMVGQGEEQQRFVIPVIYINHPLFMELLKEAEEEYGFDQKGPITIPCHVEEFRT  123

Query  559  VLVEVEMDSDDDDIYVRRGC  618
            V   ++ D +    +    C
Sbjct  124  VQYMIDSDREKSHHHHHAWC  143



>ref|XP_007136076.1| hypothetical protein PHAVU_009G015600g [Phaseolus vulgaris]
 gb|ESW08070.1| hypothetical protein PHAVU_009G015600g [Phaseolus vulgaris]
Length=136

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P G ++V VG   RRFV++  Y+NHP+FK LL EAE EYG+   GPL +PCD  LF ++L
Sbjct  46   PAGHVAVCVGSNSRRFVVRATYLNHPVFKKLLVEAEEEYGFSNHGPLAIPCDETLFEQLL  105

Query  565  VEVEMDSDDDDIYV  606
              +   +  D+ ++
Sbjct  106  RFISRSNRSDECHL  119



>ref|XP_003551054.1| PREDICTED: uncharacterized protein LOC100795275 [Glycine max]
 gb|KHN17751.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=157

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query  313  FVGKRRSKLG-CD-DEDG--RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLL  480
             + KR + +  CD DEDG    +     P+G L+VYVG E RRF+I T Y++HPLFK+LL
Sbjct  51   MINKRLTNIVYCDSDEDGCYSPQPPHDVPKGYLAVYVGPELRRFIIPTTYLSHPLFKVLL  110

Query  481  EEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDD  594
            E+A  E+G+D  G L +PC+++ F  +L  +E   D  
Sbjct  111  EKAAEEFGFDQSGGLTIPCEIETFKYLLNCIENHDDSS  148



>gb|EPS70661.1| hypothetical protein M569_04099 [Genlisea aurea]
Length=156

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P G L VYVG E RRF+I T Y++ PLFK+LLE+ E E+G+D GG L +PCD++ F  +L
Sbjct  75   PRGYLPVYVGPENRRFIIPTSYLSDPLFKLLLEKVEEEFGFDHGGALTIPCDIETFKYLL  134

Query  565  VEVEMDS  585
              +E+ +
Sbjct  135  QCMELHT  141



>ref|XP_010520521.1| PREDICTED: uncharacterized protein LOC104799608 [Tarenaya hassleriana]
Length=163

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            PEG L+VYVG E RRF+I T Y++H LFK+LLE+AE E+G+D  G L +PC+V+ F  +L
Sbjct  79   PEGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDHSGALTIPCEVETFKFLL  138

Query  565  VEVEMDSDD  591
              +E  S D
Sbjct  139  KCMENQSKD  147



>gb|AFG56379.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56384.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
Length=150

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +1

Query  385  PEGCLSVYVGEEG---RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            P+GC++VYVG EG   +RFVI   YVNHPLF+ LL+EAE EYG++  G + +PC V  F 
Sbjct  74   PKGCVAVYVGSEGEEPQRFVIPAVYVNHPLFQKLLKEAEEEYGFEQKGAITIPCQVSHFK  133

Query  556  KV  561
            KV
Sbjct  134  KV  135



>ref|XP_002875598.1| hypothetical protein ARALYDRAFT_484787 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51857.1| hypothetical protein ARALYDRAFT_484787 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  80   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKYLL  139

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  140  KCIENHPKDD  149



>gb|AAM62891.1| unknown [Arabidopsis thaliana]
Length=160

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  80   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKYLL  139

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  140  KCIENHPKDD  149



>gb|AEW07678.1| hypothetical protein 0_8672_01, partial [Pinus radiata]
Length=150

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +1

Query  385  PEGCLSVYVGEEG---RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            P+GC++VYVG EG   +RFVI   YVNHPLF+ LL+EAE EYG++  G + +PC V  F 
Sbjct  74   PKGCVAVYVGSEGEEPQRFVIPAVYVNHPLFQKLLKEAEEEYGFEQKGAITIPCQVSHFK  133

Query  556  KV  561
            KV
Sbjct  134  KV  135



>ref|XP_006452874.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
 gb|ESR66114.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
Length=167

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DEDG--RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DE+     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  51   INKRLANVPCDSDEESCYSPEPPHDVPKGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  110

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDD--DDI  600
            AE E+G+D  G L +PC+++ F  +L  +E    D  DDI
Sbjct  111  AEEEFGFDHCGALTIPCEIETFKYLLKCIESHQKDHSDDI  150



>ref|XP_006419133.1| hypothetical protein EUTSA_v10002695mg [Eutrema salsugineum]
 gb|ESQ37569.1| hypothetical protein EUTSA_v10002695mg [Eutrema salsugineum]
Length=159

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  79   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKFLL  138

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  139  KCIENHPKDD  148



>ref|NP_189898.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 emb|CAB86483.1| putative protein [Arabidopsis thaliana]
 gb|ABE65986.1| auxin-responsive protein-like protein [Arabidopsis thaliana]
 gb|AEE77766.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=160

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  80   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKYLL  139

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  140  KCIENHPKDD  149



>ref|XP_008780352.1| PREDICTED: auxin-induced protein 15A-like, partial [Phoenix dactylifera]
Length=101

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  391  GCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVE  570
            GCL VYVGEE +RFVI T++++HPLF+MLLE A  EYG++    L LPC+V +F +V+  
Sbjct  24   GCLPVYVGEERQRFVIPTDFLSHPLFRMLLERAYREYGFEQRSGLMLPCNVSVFQEVVSA  83

Query  571  VEMDSDDDDI  600
            V+      D+
Sbjct  84   VKCSHGQFDL  93



>gb|KDP37315.1| hypothetical protein JCGZ_06769 [Jatropha curcas]
Length=146

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +1

Query  352  EDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
            ED     RR  P G  +VYVGEE  RFV+ T +++HPLFKMLLE++++E+G+     L +
Sbjct  56   EDASSLTRRTTPTGFFAVYVGEEMERFVVPTGFLSHPLFKMLLEKSQNEFGFGQTDKLVV  115

Query  532  PCDVDLFVKVLVEVE  576
            PC V  F +V+  VE
Sbjct  116  PCSVSTFQEVVNAVE  130



>gb|ABK28585.1| unknown [Arabidopsis thaliana]
Length=161

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  80   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKYLL  139

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  140  KCIENHPKDD  149



>gb|KCW48946.1| hypothetical protein EUGRSUZ_K02555 [Eucalyptus grandis]
Length=130

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
              P GC +VYVGEE +RF++ TE++ HPLFKMLLE+A  E+G++    L +PC V  F +
Sbjct  49   TTPTGCFAVYVGEERQRFLVPTEFLCHPLFKMLLEKARKEFGFEQRNGLTVPCSVPAFRE  108

Query  559  VLVEVE  576
            VL  VE
Sbjct  109  VLNAVE  114



>ref|XP_010093746.1| hypothetical protein L484_019148 [Morus notabilis]
 gb|EXB54579.1| hypothetical protein L484_019148 [Morus notabilis]
Length=131

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +1

Query  325  RRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYG  504
            R   LG  +EDG +  +   P G L+VYVG+E +RFV+ T +++HPLFKMLLE+A +E+G
Sbjct  34   RECLLGEFEEDGSQTTK--TPTGFLAVYVGDERQRFVVPTNFLSHPLFKMLLEKAYNEFG  91

Query  505  YDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDI  600
            +     L +PC V  F +V+  VE  +   D 
Sbjct  92   FQQRNGLVVPCSVSTFQEVVSAVECSNGKFDF  123



>gb|AFG56380.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56381.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56385.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56386.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56387.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56389.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
Length=150

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +1

Query  385  PEGCLSVYVGEEG---RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            P+GC++VYVG EG   +RFVI   YVNHPLF+ LL+EAE EYG++  G + +PC V  F 
Sbjct  74   PKGCVAVYVGSEGEELQRFVIPAVYVNHPLFQKLLKEAEEEYGFEQKGAITIPCQVSHFK  133

Query  556  KV  561
            KV
Sbjct  134  KV  135



>gb|KHG20809.1| Auxin-induced 15A [Gossypium arboreum]
Length=161

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKV  561
             P+G L+VYVG E RRF+I T Y++HP+F +LLE+AE E+GYD  G L LPC+++ F  +
Sbjct  78   VPKGYLAVYVGPELRRFIIPTSYLSHPVFTILLEKAEEEFGYDHNGGLTLPCEIETFKYL  137

Query  562  LVEVEMDSDDDDI  600
            L  +E   ++  +
Sbjct  138  LKCIENHPNNHPV  150



>ref|XP_007202616.1| hypothetical protein PRUPE_ppa011868mg [Prunus persica]
 gb|EMJ03815.1| hypothetical protein PRUPE_ppa011868mg [Prunus persica]
Length=192

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +1

Query  316  VGKRRSKLGCD-DEDGRKKLRRVA--PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DED        A  PEG L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  84   ISKRLTNIICDSDEDNGHSPEPPADVPEGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  143

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL  564
            AE E+G+D  G L +PC+ + F  +L
Sbjct  144  AEEEFGFDHSGGLTIPCETETFKYLL  169



>ref|XP_010493190.1| PREDICTED: uncharacterized protein LOC104770457 [Camelina sativa]
 ref|XP_010493191.1| PREDICTED: uncharacterized protein LOC104770457 [Camelina sativa]
 ref|XP_010493192.1| PREDICTED: uncharacterized protein LOC104770457 [Camelina sativa]
Length=167

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  376  RVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            R  P+G L+VYVG E RRF+I T Y++H LFK+LLE+AE E+G+D  G L +PC+V+ F 
Sbjct  77   RDVPKGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDQSGALTIPCEVETFK  136

Query  556  KVLVEVEMDSDD  591
             +L  +E + +D
Sbjct  137  YLLKCMENNPND  148



>ref|XP_010514710.1| PREDICTED: uncharacterized protein LOC104790628 [Camelina sativa]
Length=160

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  80   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKFLL  139

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  140  KCIENHPKDD  149



>ref|XP_004242870.1| PREDICTED: uncharacterized protein LOC101250316 [Solanum lycopersicum]
Length=159

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 62/111 (56%), Gaps = 12/111 (11%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKLGCDDEDGRKKL------RRVAPEGCLSVYVGEEGRRFV  435
            ++K WK  KSL     KRR  L     D  + +      RR  P G L+VYVG E  RFV
Sbjct  20   VVKRWKH-KSL-----KRRGVLSYSSSDSDEPVLPGSNRRRRTPSGSLAVYVGPERTRFV  73

Query  436  IKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD  588
            I T ++N P+F  LL++AE E+GY   G L LPC+VD F ++L  +  D D
Sbjct  74   IPTRFLNLPVFISLLDKAEEEFGYQRTGGLVLPCEVDYFSEILRLLNRDED  124



>ref|XP_006452873.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
 gb|ESR66113.1| hypothetical protein CICLE_v10009722mg [Citrus clementina]
 gb|KDO73802.1| hypothetical protein CISIN_1g044419mg [Citrus sinensis]
Length=160

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DEDG--RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DE+     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  51   INKRLANVPCDSDEESCYSPEPPHDVPKGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  110

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDD--DDI  600
            AE E+G+D  G L +PC+++ F  +L  +E    D  DDI
Sbjct  111  AEEEFGFDHCGALTIPCEIETFKYLLKCIESHQKDHSDDI  150



>ref|XP_006474596.1| PREDICTED: uncharacterized protein LOC102619589 [Citrus sinensis]
Length=160

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 5/100 (5%)
 Frame = +1

Query  316  VGKRRSKLGCD-DEDG--RKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEE  486
            + KR + + CD DE+     +     P+G L+VYVG E RRF+I T Y++H LFK+LLE+
Sbjct  51   ISKRLANVPCDSDEESCYSPEPPHDVPKGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEK  110

Query  487  AESEYGYDAGGPLKLPCDVDLFVKVL--VEVEMDSDDDDI  600
            AE E+G+D  G L +PC+++ F  +L  +E       DDI
Sbjct  111  AEEEFGFDHCGALTIPCEIETFKYLLKCIESHQKDHSDDI  150



>gb|AFG56382.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56383.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56388.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
 gb|AFG56390.1| hypothetical protein 0_8672_01, partial [Pinus taeda]
Length=150

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +1

Query  385  PEGCLSVYVGEEG---RRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFV  555
            P+GC++VYVG EG   +RFVI   YVNHPLF+ LL+EAE EYG++  G + +PC V  F 
Sbjct  74   PKGCVAVYVGSEGEEPQRFVIPAVYVNHPLFQKLLKEAEEEYGFEQKGAITIPCQVSHFK  133

Query  556  KV  561
            KV
Sbjct  134  KV  135



>ref|XP_010425808.1| PREDICTED: uncharacterized protein LOC104710848 [Camelina sativa]
 ref|XP_010425809.1| PREDICTED: uncharacterized protein LOC104710848 [Camelina sativa]
Length=160

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  80   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKFLL  139

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  140  KCIENHPKDD  149



>ref|XP_010037266.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Eucalyptus 
grandis]
Length=139

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
              P GC +VYVGEE +RF++ TE++ HPLFKMLLE+A  E+G++    L +PC V  F +
Sbjct  58   TTPTGCFAVYVGEERQRFLVPTEFLCHPLFKMLLEKARKEFGFEQRNGLTVPCSVPAFRE  117

Query  559  VLVEVE  576
            VL  VE
Sbjct  118  VLNAVE  123



>gb|KCW48295.1| hypothetical protein EUGRSUZ_K02026 [Eucalyptus grandis]
Length=130

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
              P GC +VYVGEE +RF++ TE++ HPLFKMLLE+A  E+G++    L +PC V  F +
Sbjct  49   TTPTGCFAVYVGEERQRFLVPTEFLCHPLFKMLLEKARKEFGFEQRNGLTVPCSVPAFRE  108

Query  559  VLVEVE  576
            VL  VE
Sbjct  109  VLNAVE  114



>ref|XP_011077689.1| PREDICTED: uncharacterized protein LOC105161638 [Sesamum indicum]
Length=171

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 10/109 (9%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKRRSKL---GCD-DEDGRKKLRRVAPEGCLSVYVGEEGRRFVIK  441
            +++ WK  KSL     +RR+ L    C  D D      R  P G ++VYVG E RRFVI 
Sbjct  20   VVRRWKS-KSL-----RRRTVLCYSSCSSDPDEPAGSSRRTPSGSVAVYVGPERRRFVIP  73

Query  442  TEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSD  588
            T ++N P+F  LL+EAE E+G+   G L LPCD   F+ +L  +E D +
Sbjct  74   TRFLNLPVFLALLDEAEEEFGFQTTGGLALPCDTGFFINILQLLEEDEE  122



>ref|XP_010503025.1| PREDICTED: uncharacterized protein LOC104780223 [Camelina sativa]
 ref|XP_010503026.1| PREDICTED: uncharacterized protein LOC104780223 [Camelina sativa]
Length=160

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T +++H LFK+LLE+AE EYG+D  G L +PC+V+ F  +L
Sbjct  80   PKGYLAVYVGPELRRFIIPTNFLSHSLFKVLLEKAEEEYGFDHSGALTIPCEVETFKFLL  139

Query  565  VEVEMDSDDD  594
              +E    DD
Sbjct  140  KCIENHPKDD  149



>ref|XP_003530361.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine 
max]
Length=155

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (50%), Gaps = 12/139 (9%)
 Frame = +1

Query  274  IMKTWKKCKSLGWF---------VGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGR  426
            I+K WKK  +             +   +  L   D       + + P+G L+V VG+E +
Sbjct  18   ILKKWKKVATASNNNNNSSSSKGIKFLKRTLSFTDVSSTNTNQDIVPKGFLAVCVGKELK  77

Query  427  RFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDIYV  606
            RF+I T+Y+ H  F+MLL+EAE E+G+   G LK+PC V +F K+L  VE +    D + 
Sbjct  78   RFIIPTDYLRHQAFEMLLQEAEEEFGFQQEGVLKIPCQVSVFEKILNAVEDNKQPLDEF-  136

Query  607  RRGCAFARSPAAAYHHLSP  663
              G   +     + HH  P
Sbjct  137  --GFNASDCEVTSPHHAQP  153



>ref|XP_003523572.1| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Glycine 
max]
 gb|KHN45913.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=128

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P G ++V VG   +RFV++T Y+NHP+FK LL EAE EYG+   GPL +PCD  +F ++L
Sbjct  40   PAGHVAVCVGNNSKRFVVRTTYLNHPVFKRLLVEAEEEYGFSNHGPLAIPCDEAIFEQLL  99

Query  565  VEVEMDSDDDDIYVRRGCAF  624
              V   SDD  + +R    F
Sbjct  100  RFVS-HSDDCHVPLRNNLDF  118



>ref|XP_010036667.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Eucalyptus 
grandis]
Length=139

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  379  VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVK  558
              P GC +VYVGEE +RF++ TE++ HPLFKMLLE+A  E+G++    L +PC V  F +
Sbjct  58   TTPTGCFAVYVGEERQRFLVPTEFLCHPLFKMLLEKARKEFGFEQRNGLTVPCSVPAFRE  117

Query  559  VLVEVE  576
            VL  VE
Sbjct  118  VLNAVE  123



>ref|XP_010245477.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=124

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  319  GKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESE  498
            G+  S   C   D    +    P G L++YVGEE +RFV+ T +++HPLFKMLLE+A +E
Sbjct  23   GRESSHYECLLSDSEDSISATTPNGFLAIYVGEERQRFVVPTGFLSHPLFKMLLEKAYNE  82

Query  499  YGYDAGGPLKLPCDVDLFVKVL  564
            +G++    L +PC V  F +V+
Sbjct  83   FGFEQRNGLVVPCTVSTFQEVM  104



>ref|XP_008779181.1| PREDICTED: auxin-induced protein 15A-like [Phoenix dactylifera]
Length=117

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +1

Query  274  IMKTWKKCKSLGWFVGKR-RSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEY  450
            +MK  +K K L      R R  LG  +E     +      GCL VYVGEE +RFVI T++
Sbjct  4    VMKLVQKAKVLESLEPLRHRWLLGSSEELPLNAISV----GCLPVYVGEERQRFVIPTDF  59

Query  451  VNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDDI  600
            ++HPLF+MLLE A  EYG++    L LPC+V +F +V+  V+      D+
Sbjct  60   LSHPLFRMLLERAYREYGFEQRSGLMLPCNVSVFQEVVNAVKCSHGQFDL  109



>ref|XP_002321970.1| hypothetical protein POPTR_0015s00920g [Populus trichocarpa]
 gb|EEF06097.1| hypothetical protein POPTR_0015s00920g [Populus trichocarpa]
Length=118

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +1

Query  361  RKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLP  534
            RKK  +  P+GCL+V VG  EE +RFVI   Y+NHPLF  LL+EAE E+G+D  GP+ +P
Sbjct  26   RKKELKDIPKGCLAVMVGQGEEQQRFVIPVIYINHPLFMHLLKEAEEEFGFDQQGPITIP  85

Query  535  CDVDLFVKVL  564
            C V+ F  ++
Sbjct  86   CHVEEFRNIV  95



>ref|XP_009614446.1| PREDICTED: auxin-induced protein 10A5-like [Nicotiana tomentosiformis]
Length=142

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPC  537
             R+++    P G ++V VG   +RFV++  Y+NHP+FK LL  AE E+G+   GPL +PC
Sbjct  28   ARRRVPTDVPSGHMAVTVGASCKRFVVRATYLNHPMFKKLLSRAEEEFGFTNSGPLAIPC  87

Query  538  DVDLFVKVL-VEVEMDSDDDDIYVR  609
            D  LF ++L      DS ++DI  R
Sbjct  88   DEYLFEELLRYLARFDSPNNDIMAR  112



>ref|XP_011078141.1| PREDICTED: uncharacterized protein LOC105161958 [Sesamum indicum]
 ref|XP_011078142.1| PREDICTED: uncharacterized protein LOC105161958 [Sesamum indicum]
Length=159

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +1

Query  325  RRSKLGCD-DEDGRKKLRRVA--PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAES  495
            R S + CD DED  + L   +  P G L+VYVG E RRF+I T Y++ PLFK+LLE+ E 
Sbjct  60   RNSSVRCDSDEDSCQSLEMPSDVPRGYLAVYVGPELRRFIIPTSYLSDPLFKVLLEKVEE  119

Query  496  EYGYDAGGPLKLPCDVDLFVKVLVEVE  576
            E+G+D  G L +PCD++ F  +L  +E
Sbjct  120  EFGFDHSGGLTIPCDIETFKYLLQCME  146



>ref|XP_004144907.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 ref|XP_004162916.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 gb|KGN43208.1| hypothetical protein Csa_7G009040 [Cucumis sativus]
Length=100

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +1

Query  385  PEGCLSVYVGEE-GRRFVIKTEYVNHPLFKMLLEEAESEYGYD-AGGPLKLPCDVDLFVK  558
            P+GC +VYVGEE  +RFVI   Y+NHPLF+ LL +AE E+GYD A G + +PC+ D FV 
Sbjct  33   PKGCFTVYVGEEQKKRFVISLSYLNHPLFQDLLSQAEEEFGYDYAMGGITIPCNEDTFVN  92

Query  559  VL  564
            ++
Sbjct  93   LI  94



>ref|XP_007135297.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris]
 gb|ESW07291.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris]
Length=108

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  355  DGRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLK  528
            DG+K+  R  P+GC+++ VG  EE +RFV+   Y+NHPLF  LL+EAE EYG+D  G + 
Sbjct  17   DGKKQEFRGVPKGCMAIKVGQGEEQQRFVVPVMYINHPLFMQLLKEAEEEYGFDQKGTIT  76

Query  529  LPCDVDLFVKV  561
            +PC V+ F  V
Sbjct  77   IPCHVEEFRNV  87



>gb|KDP36945.1| hypothetical protein JCGZ_08236 [Jatropha curcas]
Length=150

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P G ++V VG  GRRFV++  Y+NHP+FK LL +AE EYG+   GPL +PCD  +F +VL
Sbjct  40   PAGHVAVCVGTTGRRFVVRATYLNHPVFKKLLVQAEEEYGFSNQGPLAIPCDETVFEEVL  99

Query  565  VEVEMDSDDDDI  600
              +      + I
Sbjct  100  RYISRSESGNSI  111



>gb|EMT16844.1| hypothetical protein F775_03776 [Aegilops tauschii]
Length=138

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  EGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVLV  567
            EGC SVYV    +RFV++TE VNHPLF +LLEEA+  +GY A G L+LPC+ + F  VL 
Sbjct  43   EGCFSVYVDVGRQRFVVRTECVNHPLFGVLLEEAKEMFGYAATGALELPCNSEAFAGVLE  102

Query  568  EVE  576
            ++E
Sbjct  103  QIE  105



>ref|XP_009618492.1| PREDICTED: uncharacterized protein LOC104110661 [Nicotiana tomentosiformis]
Length=166

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  349  DEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLK  528
            DE  +  L R  P G L+VYVG E RRFVI T ++N P+F  LL++AE E+G+   G L 
Sbjct  44   DEPAQPGLNRRTPSGSLAVYVGPERRRFVIPTRFLNLPVFISLLDKAEEEFGFQPSGGLV  103

Query  529  LPCDVDLFVKVLVEVEMD  582
            LP +V+ F ++L  +EMD
Sbjct  104  LPFEVEFFSEILRLLEMD  121



>ref|XP_010526282.1| PREDICTED: uncharacterized protein LOC104803884 [Tarenaya hassleriana]
Length=173

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+GCL+V VGEE +R+ I TEY++H  F+ LL+EAE E+G+   G L++PC+V +F  +L
Sbjct  66   PKGCLAVSVGEEQKRYTIPTEYLSHQAFQALLQEAEEEFGFQQAGVLRIPCEVAVFENIL  125

Query  565  VEVEMDSDDDDIYVRRGCAFARSPAAAYHHLSPS  666
                M+   D   + + C F      +Y    PS
Sbjct  126  --KIMEEKKDGYLMIQDCRFIADEPLSYRLPLPS  157



>ref|XP_004160397.1| PREDICTED: auxin-induced protein X15-like [Cucumis sativus]
 gb|KGN49830.1| hypothetical protein Csa_5G139100 [Cucumis sativus]
Length=121

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  382  APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF  552
             P+GCL++ VG+E +RF I   YVNHPLF  LL++AE EYG+D  GP+ +PC VD F
Sbjct  36   TPKGCLAILVGQEQQRFFIPVIYVNHPLFVQLLKKAEDEYGFDQKGPISIPCPVDDF  92



>ref|XP_011044712.1| PREDICTED: auxin-induced protein X15 [Populus euphratica]
Length=116

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  358  GRKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKL  531
            G+K+L+ + P+GCL+V VG  EE +RFVI   Y+NHPLF  LL+EAE E+G+D  GP+ +
Sbjct  24   GKKELQEI-PKGCLAVMVGQGEEQQRFVIPVIYINHPLFMDLLKEAEEEFGFDQRGPITI  82

Query  532  PCDVDLFVKVLVEVEMDSDD  591
            PC V+ F  V   +E ++  
Sbjct  83   PCHVEEFRNVQGMIEEENSQ  102



>ref|XP_009131816.1| PREDICTED: uncharacterized protein LOC103856463 [Brassica rapa]
 emb|CDX88840.1| BnaA03g08090D [Brassica napus]
Length=170

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  346  DDEDGRKKLRRV-APEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGP  522
            DDE+ +     V  P G L+VYVG E RRF+I T Y+ H LFK+LLE+AE E+G+D  G 
Sbjct  66   DDENCQSPEPPVDVPRGYLAVYVGPELRRFIIPTSYLGHSLFKVLLEKAEEEFGFDQSGA  125

Query  523  LKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGCA  621
            L +PC+V+ F K LV+  M+++  D +   G A
Sbjct  126  LTIPCEVETF-KFLVKC-MENNSKDHHPDDGSA  156



>ref|XP_006381568.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ERP59365.1| auxin-responsive family protein [Populus trichocarpa]
Length=160

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = +1

Query  316  VGKRRSKLGC--DDEDGRKKLRRVA--PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLE  483
            V KR + + C   DED        A  P+G L+VYVG E RRF+I T Y++H LFK+LLE
Sbjct  50   VNKRLNSVKCCDSDEDSCHSPEPPADVPKGYLAVYVGPELRRFIIPTSYLSHSLFKVLLE  109

Query  484  EAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDD  597
            + E E+G+D  G L +PC+++ F  +L  +E    D D
Sbjct  110  KVEEEFGFDHTGALTIPCEIETFKFLLKCMESHPKDHD  147



>ref|XP_006288810.1| hypothetical protein CARUB_v10002144mg [Capsella rubella]
 gb|EOA21708.1| hypothetical protein CARUB_v10002144mg [Capsella rubella]
Length=162

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  385  PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLFVKVL  564
            P+G L+VYVG E RRF+I T Y++H LFK+LLE+AE E+G+D  G L +PC+V+ F  +L
Sbjct  75   PKGYLAVYVGPELRRFIIPTSYLSHSLFKVLLEKAEEEFGFDQSGALTIPCEVETFKYLL  134

Query  565  VEVEMDSDD  591
              +E +  D
Sbjct  135  KCMENNPKD  143



>ref|XP_002876644.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52903.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=139

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = +1

Query  385  PEGCLSVYVG---EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLPCDVDLF-  552
            P+GCL++ VG   EE +RFV+   YVNHPLF  LL EAE EYG++  G + +PC V++F 
Sbjct  31   PKGCLAIKVGSKEEEKQRFVVPVFYVNHPLFMQLLREAEEEYGFEQKGTITIPCHVEVFR  90

Query  553  -VKVLVEVEMDSDDDD  597
             V+ ++  E   DDDD
Sbjct  91   YVQDMINRERSLDDDD  106



>ref|XP_011039922.1| PREDICTED: uncharacterized protein LOC105136325 isoform X2 [Populus 
euphratica]
Length=160

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = +1

Query  316  VGKRRSKLGC--DDEDGRKKLRRVA--PEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLE  483
            V KR + + C   DED        A  P+G L+VYVG E RRF+I T Y++H LFK+LLE
Sbjct  50   VNKRLNSVKCCDSDEDSCHSPEPPADVPKGYLAVYVGPELRRFIIPTSYLSHSLFKVLLE  109

Query  484  EAESEYGYDAGGPLKLPCDVDLFVKVLVEVEMDSDDDD  597
            + E E+G+D  G L +PC+++ F  +L  +E    D D
Sbjct  110  KVEEEFGFDHTGALTIPCEIETFKFLLKCMESHPKDHD  147



>ref|XP_004952566.1| PREDICTED: uncharacterized protein LOC101780971 [Setaria italica]
Length=156

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 8/133 (6%)
 Frame = +1

Query  268  NFIMKTWKKCK-SLGWFVGKRRSKLGCDDEDGRKKLRRVAPEGCLSVYVGEEGRRFVIKT  444
            N + KT ++C+ SL     +R       D         V   G  +V VG E  RF ++ 
Sbjct  9    NILAKTLQRCRTSLAAAHRRRPPPAQAPDRSASWGGAAVPAAGYFTVLVGPEKERFGVRA  68

Query  445  EYVNHPLFKMLLEEAESEYGYDAG--GPLKLPCDVDLFVKVLVEVEMDSDDDDIYVRRGC  618
               NHPLF+ LL+EAE+EYG+ AG  GPL+LPC VD F++V+ E+E      D     GC
Sbjct  69   RCANHPLFRALLDEAETEYGF-AGCDGPLELPCAVDDFMQVMWEME----QGDPTASPGC  123

Query  619  AFARSPAAAYHHL  657
                + ++  HHL
Sbjct  124  GRFAAGSSRGHHL  136



>ref|XP_004488799.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cicer 
arietinum]
Length=145

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  364  KKLRR---VAPEGCLSVYVGEEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLP  534
             K+RR   V PEG + +YVG+E  RFV+  E +NHP+F  LL ++  EYGY+  G L+LP
Sbjct  43   SKIRRSSSVVPEGHVPIYVGDEMARFVVSAELLNHPIFVKLLNQSAQEYGYEQKGVLRLP  102

Query  535  CDVDLFVKVLVEVEMDSDDDDI  600
            C+V +F +VL  +++  D   I
Sbjct  103  CNVCVFERVLEALKLGQDTRHI  124



>gb|KHN23320.1| Auxin-induced protein X15 [Glycine soja]
Length=136

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  361  RKKLRRVAPEGCLSVYVG--EEGRRFVIKTEYVNHPLFKMLLEEAESEYGYDAGGPLKLP  534
            +K+ R+  P+GCL++ VG  EE +RFV+   Y+NHPLF  LL+EAE EYG+D  GP+ +P
Sbjct  44   KKEDRKDIPKGCLAILVGQGEEQQRFVVPVMYMNHPLFMQLLKEAEEEYGFDQKGPITIP  103

Query  535  CDVDLFVKV  561
            C V+ F  V
Sbjct  104  CHVEHFRTV  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1887598073020