BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c115074_g1_i1 len=200 path=[178:0-199]

Length=200
                                                                      Score     E

ref|XP_009631926.1|  PREDICTED: uncharacterized protein LOC104121602  55.5    7e-08   
ref|XP_004241127.2|  PREDICTED: uncharacterized protein LOC101268767  45.8    2e-04   



>ref|XP_009631926.1| PREDICTED: uncharacterized protein LOC104121602 [Nicotiana tomentosiformis]
Length=159

 Score = 55.5 bits (132),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -1

Query  200  VTNRFRPKKYSKGVHFQILGNQDYALCCMDLFSELGLGPYDHILLAWDPMRSAFLLRLI  24
            VT    PKKY    +F++L N DYAL C+DL+ + GL   D I L WDP  S F+ + I
Sbjct  102  VTEENNPKKYDN--YFEMLPNDDYALVCLDLYKDRGLSVDDEIGLYWDPRSSTFVFKEI  158



>ref|XP_004241127.2| PREDICTED: uncharacterized protein LOC101268767 [Solanum lycopersicum]
Length=175

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = -1

Query  200  VTNRFRPKKYSKG-VHFQILGNQDYALCCMDLFSELGLGPYDHILLAWDPMRSAFLLRLI  24
            VT    PKKY  G V F+IL N D++L C +L +   L   D I L WDP+ S+ + + +
Sbjct  102  VTEENVPKKYEGGRVWFRILPNDDFSLWCTELINGRRLKVGDEIGLYWDPISSSLVFKFL  161

Query  23   H  21
            +
Sbjct  162  Y  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519166692352