BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1149_g1_i1 len=1808 path=[1824:0-1466 20:1467-1807]

Length=1808
                                                                      Score     E

gb|AGZ94899.1|  MYC transcription factor 2                              390   7e-123   
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2               389   2e-122   
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like          378   6e-118   
emb|CAF74710.1|  MYC transcription factor                               376   3e-117   Solanum tuberosum [potatoes]
gb|AGL98100.1|  transcription factor MYC2                               365   2e-113   
gb|ADH04269.1|  MYC2a transcription factor                              363   7e-113   
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like          362   2e-112   
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like          363   2e-112   
gb|ADH04263.1|  bHLH2 transcription factor                              361   6e-112   
gb|ADH04267.1|  MYC1a transcription factor                              357   3e-110   
ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like          357   3e-110   
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like          352   1e-108   
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like          352   4e-108   
gb|ADH04268.1|  MYC1b transcription factor                              351   7e-108   
gb|ADH04262.1|  bHLH1 transcription factor                              344   2e-105   
gb|AAQ14332.1|AF283507_1  MYC2                                          342   3e-104   Catharanthus roseus [chatas]
gb|AGL98101.1|  transcription factor MYC2-like protein                  340   5e-104   
emb|CDP13028.1|  unnamed protein product                                339   5e-103   
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like          338   5e-103   Vitis vinifera
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like          332   6e-101   
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2               333   7e-101   
gb|KDP34321.1|  hypothetical protein JCGZ_12669                         330   5e-100   
emb|CAF74711.1|  MYC transcription factor                               328   1e-99    Solanum tuberosum [potatoes]
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like          327   3e-99    
ref|XP_002519814.1|  Transcription factor AtMYC2, putative              327   4e-99    Ricinus communis
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg             327   1e-98    
ref|NP_001288107.1|  uncharacterized protein LOC101261048               323   1e-97    
ref|XP_009344509.1|  PREDICTED: transcription factor MYC2-like          317   2e-97    
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg                321   8e-97    
ref|XP_010104300.1|  hypothetical protein L484_023250                   320   8e-96    
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2               315   3e-94    
ref|XP_010058170.1|  PREDICTED: transcription factor MYC2               315   6e-94    
gb|KCW71784.1|  hypothetical protein EUGRSUZ_E00277                     315   8e-94    
gb|AHN63211.1|  transcription factor MYC2                               311   1e-93    
gb|AIO09733.1|  transcription factor MYC2                               309   8e-93    
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like          311   1e-92    
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...    306   9e-91    
gb|AGQ80897.1|  MYC1                                                    305   1e-90    
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2               303   1e-89    
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like          303   2e-89    
gb|ADL36595.1|  BHLH domain class transcription factor                  303   2e-89    
gb|EPS57820.1|  hypothetical protein M569_16997                         298   6e-89    
gb|ACO53628.1|  bHLH domain protein                                     301   8e-89    Gossypium hirsutum [American cotton]
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like          301   9e-89    
gb|ACN21638.1|  putative basic helix-loop-helix protein BHLH22          298   3e-88    Lotus japonicus
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like          298   4e-88    
gb|AAC28907.1|  phaseolin G-box binding protein PG2                     297   4e-88    Phaseolus vulgaris [French bean]
ref|XP_011018569.1|  PREDICTED: transcription factor MYC2-like          297   9e-88    
gb|KHN38923.1|  Transcription factor MYC2                               292   1e-87    
ref|XP_004148475.1|  PREDICTED: transcription factor MYC2-like          297   2e-87    
gb|KGN60384.1|  Transcription factor AtMYC2                             297   2e-87    
ref|XP_004166734.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    297   2e-87    
ref|XP_004509726.1|  PREDICTED: transcription factor MYC2-like          293   4e-86    
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g             295   4e-86    
ref|XP_006368399.1|  phaseolin G-box binding protein PG2                292   7e-86    
gb|KHN04880.1|  Transcription factor MYC2                               286   2e-85    
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                   292   2e-85    
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg             291   4e-85    
ref|XP_006385657.1|  phaseolin G-box binding protein PG2                288   3e-84    
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like          290   4e-84    
gb|AFZ93650.1|  transcription factor MYC2                               274   2e-83    
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like          285   3e-83    
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like          284   1e-82    
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like          281   2e-81    
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g             280   4e-81    
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like          279   9e-81    
gb|AAB00686.1|  phaseolin G-box binding protein PG1                     278   1e-80    Phaseolus vulgaris [French bean]
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein     276   3e-79    Rheum australe [Himalayan rhubarb]
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like          273   1e-78    
gb|ABD59338.1|  G-box element binding protein                           273   1e-78    Pisum sativum [garden pea]
gb|AIT39751.1|  transcription factor MYC2                               271   4e-78    
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4               271   9e-78    
ref|XP_010933462.1|  PREDICTED: transcription factor MYC4-like          271   1e-77    
ref|XP_003531962.1|  PREDICTED: transcription factor MYC2               269   5e-77    
ref|XP_003612909.1|  BHLH transcription factor                          268   2e-76    
gb|KHM99168.1|  Transcription factor MYC2                               261   2e-76    
ref|XP_003516794.1|  PREDICTED: transcription factor MYC2-like          266   3e-76    
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like          267   4e-76    
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...    265   1e-75    
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like          263   1e-74    
ref|XP_003628820.1|  Transcription factor MYC2                          262   2e-74    
gb|EEC67493.1|  hypothetical protein OsI_34761                          262   2e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4               262   3e-74    
gb|AAK00453.1|AC060755_23  putative MYC transcription factor            261   9e-74    Oryza sativa [red rice]
ref|NP_001065478.1|  Os10g0575000                                       260   1e-73    Oryza sativa Japonica Group [Japonica rice]
gb|AAF04917.1|AF011557_1  jasmonic acid 3                               250   2e-73    Solanum lycopersicum
gb|EPS60924.1|  hypothetical protein M569_13876                         255   6e-73    
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like          255   2e-72    
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like          255   2e-72    
ref|XP_002893732.1|  ATMYC2                                             254   9e-72    
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2               253   2e-71    
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg             252   4e-71    
ref|XP_008786336.1|  PREDICTED: transcription factor MYC2-like          252   9e-71    
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...    250   2e-70    
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4           249   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193522.1|  transcription factor MYC4                             249   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like          250   3e-70    
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                    248   6e-70    
ref|XP_010053608.1|  PREDICTED: transcription factor MYC2-like          248   7e-70    
ref|NP_174541.1|  transcription factor MYC2                             249   8e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6           248   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like          249   2e-69    
ref|XP_002868032.1|  basic helix-loop-helix family protein              247   2e-69    
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like          247   3e-69    
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like          247   3e-69    
dbj|BAJ33793.1|  unnamed protein product                                246   4e-69    
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like          246   4e-69    
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like          246   5e-69    
gb|ABS11038.1|  MYC                                                     246   5e-69    Brassica oleracea var. gemmifera
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3               245   5e-69    
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg             246   5e-69    
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg             247   6e-69    
ref|XP_009131125.1|  PREDICTED: transcription factor MYC4-like          234   1e-68    
ref|XP_006838603.1|  hypothetical protein AMTR_s00002p00225810          246   1e-68    
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5           244   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3             244   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    244   2e-68    
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like          244   3e-68    
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752             243   6e-68    
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like          243   9e-68    
dbj|BAA25078.1|  RD22BP1                                                243   1e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDY58502.1|  BnaA06g40330D                                          238   2e-67    
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg             242   2e-67    
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like          243   4e-67    
ref|XP_006414178.1|  hypothetical protein EUTSA_v10024688mg             241   5e-67    
gb|AAD15818.1|  transcription factor MYC7E                              243   5e-67    Zea mays [maize]
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4               243   5e-67    
gb|KHN18804.1|  Transcription factor MYC4                               231   7e-67    
gb|KHM99167.1|  Transcription factor MYC4                               228   7e-67    
emb|CDX77688.1|  BnaC07g19420D                                          236   9e-67    
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like          239   1e-66    
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg             237   9e-66    
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...    236   1e-65    Brassica oleracea
gb|KFK31432.1|  hypothetical protein AALP_AA6G111200                    236   2e-65    
dbj|BAJ91022.1|  predicted protein                                      236   6e-65    
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like          237   6e-65    
dbj|BAJ91674.1|  predicted protein                                      236   6e-65    
emb|CDY03195.1|  BnaC09g19610D                                          233   7e-65    
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like          236   1e-64    
dbj|BAJ86015.1|  predicted protein                                      235   2e-64    
emb|CDX78808.1|  BnaA01g08750D                                          233   2e-64    
emb|CDY35179.1|  BnaA09g18160D                                          232   3e-64    
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3               233   4e-64    
emb|CDY44507.1|  BnaC01g10420D                                          232   4e-64    
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like          232   4e-64    
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like          234   4e-64    
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2               234   6e-64    
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like          231   3e-63    
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                    226   4e-62    
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230          229   5e-62    Sorghum bicolor [broomcorn]
gb|EPS71023.1|  hypothetical protein M569_03732                         222   9e-61    
emb|CDX73261.1|  BnaC05g28450D                                          217   7e-60    
emb|CDY26910.1|  BnaA05g18020D                                          216   1e-59    
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like          218   3e-58    
emb|CDX84081.1|  BnaC08g07580D                                          214   5e-58    
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like          216   5e-58    
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like          216   6e-58    
ref|XP_009396848.1|  PREDICTED: transcription factor MYC4-like          216   3e-57    
gb|AEB35595.1|  MYC2                                                    194   9e-55    
gb|AEB35606.1|  MYC2                                                    194   9e-55    
gb|AEB35578.1|  MYC2                                                    193   1e-54    
gb|AEB35671.1|  MYC2                                                    193   1e-54    
gb|AEB35565.1|  MYC2                                                    193   1e-54    
gb|AEB35580.1|  MYC2                                                    193   2e-54    
gb|AEB35676.1|  MYC2                                                    193   2e-54    
gb|AEB35597.1|  MYC2                                                    193   2e-54    
gb|AEB35601.1|  MYC2                                                    193   2e-54    
gb|AEB35575.1|  MYC2                                                    193   2e-54    
gb|AEB35706.1|  MYC2                                                    193   2e-54    
gb|AEB35592.1|  MYC2                                                    192   3e-54    
gb|AEB35568.1|  MYC2                                                    192   3e-54    
gb|AEB35674.1|  MYC2                                                    192   3e-54    
gb|AEB35596.1|  MYC2                                                    192   3e-54    
gb|AEB35587.1|  MYC2                                                    192   4e-54    
gb|AEB35567.1|  MYC2                                                    192   4e-54    
gb|AEB35656.1|  MYC2                                                    192   5e-54    
gb|AEB35692.1|  MYC2                                                    192   5e-54    
gb|AEB35577.1|  MYC2                                                    192   5e-54    
gb|AEB35658.1|  MYC2                                                    192   6e-54    
ref|XP_006398377.1|  hypothetical protein EUTSA_v10000853mg             203   8e-54    
gb|AEB35604.1|  MYC2                                                    191   1e-53    
gb|AEB35703.1|  MYC2                                                    191   1e-53    
gb|AEB35660.1|  MYC2                                                    191   1e-53    
gb|AEB35694.1|  MYC2                                                    191   2e-53    
gb|AEB35678.1|  MYC2                                                    190   2e-53    
ref|XP_009391048.1|  PREDICTED: transcription factor MYC2-like          202   2e-53    
gb|AEB35640.1|  MYC2                                                    190   2e-53    
gb|AEB35571.1|  MYC2                                                    189   4e-53    
gb|AEB35649.1|  MYC2                                                    189   5e-53    
gb|AEB35570.1|  MYC2                                                    189   5e-53    
gb|EEE51454.1|  hypothetical protein OsJ_32566                          203   6e-53    Oryza sativa Japonica Group [Japonica rice]
gb|AEB35657.1|  MYC2                                                    189   8e-53    
ref|XP_009114324.1|  PREDICTED: transcription factor bHLH28-like        199   1e-52    
emb|CDY35183.1|  BnaA09g18200D                                          199   1e-52    
gb|AGO03813.1|  JAMYC2                                                  192   3e-52    
emb|CDY59973.1|  BnaA09g53560D                                          198   3e-52    
ref|XP_009114323.1|  PREDICTED: transcription factor bHLH28-like        196   1e-51    
emb|CDY03185.1|  BnaC09g19710D                                          193   7e-51    
emb|CDY03183.1|  BnaC09g19730D                                          194   7e-51    
gb|EMS55891.1|  Transcription factor MYC4                               189   2e-50    
gb|AEB35573.1|  MYC2                                                    182   2e-50    
gb|ACM48567.1|  JAMYC                                                   194   7e-50    Taxus cuspidata [ichii]
ref|XP_006279851.1|  hypothetical protein CARUB_v10028430mg             186   2e-48    
ref|XP_010441529.1|  PREDICTED: transcription factor bHLH28-like        185   4e-48    
ref|XP_010494874.1|  PREDICTED: transcription factor bHLH28-like        186   4e-48    
ref|XP_002865159.1|  predicted protein                                  186   4e-48    
ref|XP_010481407.1|  PREDICTED: transcription factor bHLH28-like        184   8e-48    
gb|AEJ88337.1|  putative MYC protein                                    185   2e-47    
gb|AEB35693.1|  MYC2                                                    171   1e-46    
gb|ABR16623.1|  unknown                                                 182   2e-46    Picea sitchensis
gb|AGO03814.1|  JAMYC4                                                  177   5e-46    
ref|NP_199495.1|  calcium-binding transcription factor NIG1             179   9e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101672.1|  PREDICTED: transcription factor bHLH28-like        172   2e-45    
ref|XP_009385748.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    179   3e-45    
gb|KFK31426.1|  hypothetical protein AALP_AA6G110400                    178   3e-45    
emb|CDY33482.1|  BnaA06g35910D                                          170   1e-44    
gb|AEB35566.1|  MYC2                                                    166   1e-44    
emb|CDX77699.1|  BnaC07g19530D                                          170   2e-44    
gb|AEB35681.1|  MYC2                                                    165   3e-44    
ref|XP_006294316.1|  hypothetical protein CARUB_v10023324mg             173   3e-44    
ref|XP_010412880.1|  PREDICTED: transcription factor MYC2-like          173   4e-44    
gb|AEB35699.1|  MYC2                                                    164   5e-44    
gb|AEB35702.1|  MYC2                                                    164   6e-44    
ref|XP_010513049.1|  PREDICTED: transcription factor MYC2-like          172   9e-44    
ref|XP_010507550.1|  PREDICTED: transcription factor MYC2-like          171   2e-43    
gb|AEB35704.1|  MYC2                                                    160   1e-42    
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2               162   5e-40    
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...    162   5e-40    
gb|KHN15898.1|  Transcription factor bHLH14                             161   7e-40    
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like          161   8e-40    
gb|KDO86574.1|  hypothetical protein CISIN_1g046178mg                   162   1e-39    
ref|XP_006444764.1|  hypothetical protein CICLE_v10019749mg             161   1e-39    
emb|CBI34590.3|  unnamed protein product                                157   2e-39    
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like          160   3e-39    
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like        159   3e-39    
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like          159   4e-39    
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like          159   5e-39    Vitis vinifera
gb|ABK94979.1|  unknown                                                 159   8e-39    Populus trichocarpa [western balsam poplar]
ref|XP_002301432.1|  basic helix-loop-helix family protein              159   1e-38    Populus trichocarpa [western balsam poplar]
ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...    159   1e-38    
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2               159   1e-38    
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2-like          158   1e-38    
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg             158   2e-38    
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like          157   2e-38    
ref|XP_010100678.1|  hypothetical protein L484_023447                   157   5e-38    
ref|XP_011039024.1|  PREDICTED: transcription factor MYC2 isoform X1    157   5e-38    
ref|XP_011039030.1|  PREDICTED: transcription factor MYC2 isoform X2    156   6e-38    
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g             155   8e-38    
ref|XP_011094312.1|  PREDICTED: transcription factor MYC2               155   2e-37    
gb|ABR16436.1|  unknown                                                 155   3e-37    Picea sitchensis
ref|XP_006830285.1|  hypothetical protein AMTR_s00121p00026620          153   6e-37    
ref|XP_002320222.1|  basic helix-loop-helix family protein              151   2e-36    Populus trichocarpa [western balsam poplar]
gb|KDP28433.1|  hypothetical protein JCGZ_14204                         151   2e-36    
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...    151   3e-36    
gb|KCW83845.1|  hypothetical protein EUGRSUZ_B00713                     151   4e-36    
ref|XP_010031905.1|  PREDICTED: transcription factor MYC2-like          151   4e-36    
gb|EMT33615.1|  Transcription factor MYC2                               150   4e-36    
emb|CDP08631.1|  unnamed protein product                                149   5e-36    
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4               150   6e-36    Vitis vinifera
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like          149   8e-36    
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like          148   2e-35    
ref|XP_002529965.1|  DNA binding protein, putative                      149   2e-35    Ricinus communis
ref|XP_010909816.1|  PREDICTED: transcription factor MYC4-like          147   2e-35    
gb|KDP25207.1|  hypothetical protein JCGZ_20363                         147   9e-35    
ref|XP_009412473.1|  PREDICTED: transcription factor MYC3-like          146   1e-34    
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...    145   1e-34    
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like          146   1e-34    
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like          145   2e-34    
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...    145   2e-34    
ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like          145   3e-34    
ref|XP_004309579.1|  PREDICTED: transcription factor MYC2-like          144   3e-34    
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2               144   4e-34    
gb|ACI16505.1|  MYC2 transcription factor                               135   5e-34    Cucumis sativus [cucumbers]
ref|XP_010100202.1|  hypothetical protein L484_015347                   144   6e-34    
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...    144   6e-34    
ref|XP_004159750.1|  PREDICTED: transcription factor MYC4-like          143   8e-34    
ref|XP_004146202.1|  PREDICTED: transcription factor MYC4-like          143   1e-33    
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like          144   1e-33    
gb|KGN55667.1|  hypothetical protein Csa_3G002860                       143   1e-33    
ref|XP_002518914.1|  DNA binding protein, putative                      143   1e-33    
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like          142   2e-33    
ref|XP_008780029.1|  PREDICTED: transcription factor MYC4-like          142   2e-33    
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like          143   2e-33    
ref|XP_010267440.1|  PREDICTED: transcription factor MYC2               143   2e-33    
ref|XP_002529968.1|  transcription factor, putative                     139   2e-33    
ref|XP_008448555.1|  PREDICTED: transcription factor MYC3-like          142   2e-33    
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg             142   3e-33    
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                   142   3e-33    
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like          142   3e-33    
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like          142   4e-33    
ref|XP_007151965.1|  hypothetical protein PHAVU_004G090300g             140   4e-33    
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like          141   4e-33    
ref|XP_009592442.1|  PREDICTED: transcription factor MYC2-like          141   5e-33    
gb|AHG95274.1|  mys transcription factor                                132   6e-33    
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like          140   1e-32    
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like          140   1e-32    
ref|XP_009420803.1|  PREDICTED: transcription factor MYC3-like          139   1e-32    
gb|AHG95269.1|  mys transcription factor                                131   1e-32    
gb|AHG95271.1|  mys transcription factor                                131   1e-32    
ref|XP_001765254.1|  predicted protein                                  143   1e-32    
gb|AFB33098.1|  hypothetical protein 0_9408_01                          132   1e-32    
gb|AFB33094.1|  hypothetical protein 0_9408_01                          132   2e-32    
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like        140   2e-32    
gb|AEG74014.1|  lMYC4                                                   140   2e-32    
ref|XP_011023168.1|  PREDICTED: transcription factor bHLH13-like        141   2e-32    
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like        139   3e-32    
ref|XP_009418327.1|  PREDICTED: transcription factor MYC4-like          138   3e-32    
gb|AEW07706.1|  hypothetical protein 0_9408_01                          131   3e-32    
gb|AFB33089.1|  hypothetical protein 0_9408_01                          131   3e-32    
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like          139   3e-32    
ref|XP_002302637.2|  basic helix-loop-helix family protein              140   4e-32    
gb|AEW07707.1|  hypothetical protein 0_9408_01                          131   4e-32    
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...    139   4e-32    
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...    138   5e-32    
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...    139   5e-32    
ref|XP_009360190.1|  PREDICTED: transcription factor MYC2-like          138   6e-32    
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...    138   6e-32    
ref|XP_006491293.1|  PREDICTED: transcription factor bHLH13-like        140   6e-32    
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like          138   7e-32    
ref|XP_006444826.1|  hypothetical protein CICLE_v10019339mg             140   7e-32    
gb|KDP28477.1|  hypothetical protein JCGZ_14248                         139   9e-32    
gb|AEG74015.1|  lMYC5                                                   137   1e-31    
gb|ACF19982.1|  MYC2                                                    137   1e-31    
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like          137   1e-31    
gb|AEG74013.1|  lMYC3                                                   137   2e-31    
gb|AHG95270.1|  mys transcription factor                                128   2e-31    
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg             136   3e-31    
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g             136   3e-31    
gb|ACF05947.1|  MYC1                                                    135   4e-31    
gb|EYU32289.1|  hypothetical protein MIMGU_mgv1a007575mg                134   5e-31    
ref|XP_010100724.1|  hypothetical protein L484_023493                   137   6e-31    
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14             135   6e-31    
ref|XP_002320871.2|  hypothetical protein POPTR_0014s09520g             137   8e-31    
ref|XP_008233131.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    135   1e-30    
gb|KHG04474.1|  Transcription factor bHLH13 -like protein               136   2e-30    
ref|XP_009617148.1|  PREDICTED: transcription factor MYC4-like          132   2e-30    
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...    134   2e-30    
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...    134   2e-30    
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like          133   2e-30    
gb|ADK56287.1|  LMYC1                                                   134   2e-30    
ref|XP_003520013.2|  PREDICTED: transcription factor MYC2-like          132   2e-30    
gb|ADK91082.1|  LMYC2                                                   133   4e-30    
ref|XP_010256776.1|  PREDICTED: transcription factor bHLH13             134   4e-30    
ref|XP_006361006.1|  PREDICTED: transcription factor MYC4-like          132   5e-30    
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like          132   6e-30    
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like          131   6e-30    
ref|XP_011038317.1|  PREDICTED: transcription factor bHLH13-like        134   6e-30    
ref|XP_010055004.1|  PREDICTED: transcription factor bHLH13             134   7e-30    
ref|XP_001765161.1|  predicted protein                                  135   7e-30    
ref|XP_004248095.1|  PREDICTED: transcription factor MYC2-like          131   7e-30    
ref|XP_006352213.1|  PREDICTED: transcription factor ATR2-like          132   8e-30    
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg             132   9e-30    
gb|KEH24682.1|  ABA-inducible bHLH-type transcription factor            133   1e-29    
ref|XP_009775258.1|  PREDICTED: transcription factor MYC2-like          130   1e-29    
gb|KDP22548.1|  hypothetical protein JCGZ_26379                         131   1e-29    
ref|XP_006339721.1|  PREDICTED: transcription factor bHLH13-like        133   1e-29    
gb|KEH18633.1|  ABA-inducible bHLH-type transcription factor            133   1e-29    
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g             131   2e-29    
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like          131   2e-29    
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like        130   2e-29    
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like          130   2e-29    
ref|XP_007220204.1|  hypothetical protein PRUPE_ppa002985mg             133   2e-29    
ref|XP_008376082.1|  PREDICTED: transcription factor bHLH13             132   2e-29    
ref|XP_004244656.1|  PREDICTED: transcription factor bHLH14-like        130   2e-29    
ref|XP_007051527.1|  Myc2 bHLH protein isoform 1                        132   2e-29    
ref|XP_008810069.1|  PREDICTED: transcription factor MYC4-like          130   2e-29    
ref|NP_001267974.1|  Myc2 bHLH protein                                  132   2e-29    
ref|XP_008437879.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    132   3e-29    
emb|CDP08667.1|  unnamed protein product                                132   3e-29    
ref|XP_009401987.1|  PREDICTED: transcription factor bHLH13-like        132   4e-29    
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like        130   4e-29    
ref|XP_007210117.1|  hypothetical protein PRUPE_ppa022165mg             129   4e-29    
ref|XP_009627739.1|  PREDICTED: transcription factor bHLH13-like        132   4e-29    
gb|KGN56417.1|  hypothetical protein Csa_3G119500                       131   4e-29    
emb|CBI33883.3|  unnamed protein product                                128   4e-29    
ref|XP_007210118.1|  hypothetical protein PRUPE_ppa022201mg             130   5e-29    
ref|XP_004172828.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    131   6e-29    
ref|XP_002523332.1|  DNA binding protein, putative                      131   6e-29    
ref|XP_004133809.1|  PREDICTED: transcription factor bHLH13-like        131   7e-29    
gb|KHN06316.1|  Transcription factor bHLH13                             131   7e-29    
ref|XP_010242395.1|  PREDICTED: transcription factor bHLH13-like        131   8e-29    
ref|XP_004229991.1|  PREDICTED: transcription factor bHLH13-like        131   8e-29    
ref|XP_003528790.1|  PREDICTED: transcription factor bHLH13-like        131   8e-29    
ref|XP_010910582.1|  PREDICTED: transcription factor MYC4-like          129   8e-29    
ref|XP_008790159.1|  PREDICTED: transcription factor bHLH13-like        130   9e-29    
ref|XP_010940945.1|  PREDICTED: transcription factor MYC4-like          129   9e-29    
emb|CDY70013.1|  BnaCnng66320D                                          125   1e-28    
ref|XP_008352118.1|  PREDICTED: transcription factor bHLH13-like        130   1e-28    
ref|XP_009770264.1|  PREDICTED: transcription factor bHLH13-like        130   2e-28    
ref|XP_004510665.1|  PREDICTED: transcription factor bHLH13-like        130   2e-28    
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg             128   2e-28    
ref|XP_009608279.1|  PREDICTED: transcription factor bHLH13-like        130   2e-28    
ref|XP_004306657.1|  PREDICTED: transcription factor bHLH13-like        130   2e-28    
dbj|BAH20404.1|  AT1G01260                                              127   2e-28    
ref|XP_009393178.1|  PREDICTED: transcription factor MYC3-like          127   2e-28    
ref|XP_010451453.1|  PREDICTED: transcription factor bHLH3-like         125   2e-28    
ref|XP_008238769.1|  PREDICTED: transcription factor MYC2-like          128   3e-28    
ref|XP_001754025.1|  predicted protein                                  129   3e-28    
ref|XP_007135266.1|  hypothetical protein PHAVU_010G114800g             129   3e-28    
ref|XP_009415334.1|  PREDICTED: transcription factor bHLH13-like        129   3e-28    
ref|XP_009781532.1|  PREDICTED: transcription factor bHLH13-like        129   4e-28    
ref|XP_002892077.1|  basic helix-loop-helix family protein              128   4e-28    
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like          126   5e-28    
ref|XP_009412249.1|  PREDICTED: transcription factor bHLH13-like        128   6e-28    
ref|XP_008356558.1|  PREDICTED: transcription factor MYC2-like          127   6e-28    
ref|XP_008385225.1|  PREDICTED: transcription factor MYC2-like          127   6e-28    
emb|CDY34468.1|  BnaC01g21650D                                          126   6e-28    
ref|XP_010691764.1|  PREDICTED: transcription factor MYC2-like          126   6e-28    
ref|XP_006307052.1|  hypothetical protein CARUB_v10008640mg             128   7e-28    
ref|XP_006397843.1|  hypothetical protein EUTSA_v10001374mg             127   7e-28    
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...    126   7e-28    
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...    126   7e-28    
ref|XP_010058363.1|  PREDICTED: transcription factor MYC2-like          125   1e-27    
ref|XP_010457144.1|  PREDICTED: transcription factor bHLH13             127   1e-27    
ref|XP_010480459.1|  PREDICTED: transcription factor bHLH13-like        127   1e-27    
ref|XP_010474717.1|  PREDICTED: transcription factor bHLH13-like        127   1e-27    
ref|XP_010696336.1|  PREDICTED: transcription factor bHLH13-like        127   1e-27    
emb|CDX90021.1|  BnaA10g00610D                                          126   1e-27    
gb|KCW72574.1|  hypothetical protein EUGRSUZ_E01043                     125   2e-27    
gb|AAM10932.1|AF488559_1  putative bHLH transcription factor            127   2e-27    
ref|NP_171634.1|  transcription factor bHLH13                           127   2e-27    
ref|XP_009146001.1|  PREDICTED: transcription factor bHLH3              125   2e-27    
emb|CDY32242.1|  BnaA01g17420D                                          125   2e-27    
gb|KFK37416.1|  hypothetical protein AALP_AA4G254100                    125   2e-27    
ref|XP_009119682.1|  PREDICTED: transcription factor bHLH13             126   3e-27    
gb|KDP26171.1|  hypothetical protein JCGZ_22265                         121   3e-27    
ref|XP_004166899.1|  PREDICTED: transcription factor ATR2-like          124   3e-27    
ref|XP_006852614.1|  hypothetical protein AMTR_s00021p00226670          125   3e-27    
ref|XP_004140617.1|  PREDICTED: transcription factor ATR2-like          124   4e-27    
gb|KHN16427.1|  Transcription factor bHLH13                             125   4e-27    
emb|CDX90525.1|  BnaA03g42560D                                          124   4e-27    
ref|XP_003520875.1|  PREDICTED: transcription factor bHLH13-like        125   4e-27    
ref|XP_006443887.1|  hypothetical protein CICLE_v10019816mg             124   4e-27    
gb|KDO68498.1|  hypothetical protein CISIN_1g010728mg                   124   4e-27    
ref|XP_009336761.1|  PREDICTED: transcription factor bHLH13 isofo...    125   5e-27    
ref|XP_009336762.1|  PREDICTED: transcription factor bHLH13 isofo...    125   5e-27    
ref|XP_010506659.1|  PREDICTED: transcription factor ABA-INDUCIBL...    125   5e-27    
ref|XP_007210924.1|  hypothetical protein PRUPE_ppa027182mg             124   5e-27    
gb|EPS66389.1|  hypothetical protein M569_08391                         124   5e-27    
ref|XP_003548357.1|  PREDICTED: transcription factor bHLH13-like        125   6e-27    
ref|XP_010912147.1|  PREDICTED: transcription factor bHLH13             125   7e-27    
ref|XP_010924915.1|  PREDICTED: transcription factor bHLH13-like        125   7e-27    
ref|XP_004301652.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    122   9e-27    
ref|XP_007147321.1|  hypothetical protein PHAVU_006G114000g             125   9e-27    
ref|XP_010554450.1|  PREDICTED: transcription factor bHLH3              123   9e-27    
ref|XP_010440158.1|  PREDICTED: transcription factor bHLH3-like i...    123   9e-27    
ref|XP_007200616.1|  hypothetical protein PRUPE_ppa008004mg             121   1e-26    
emb|CDP03717.1|  unnamed protein product                                123   1e-26    
ref|XP_010440156.1|  PREDICTED: transcription factor bHLH3-like i...    123   1e-26    
ref|XP_008803328.1|  PREDICTED: transcription factor MYC3-like          122   1e-26    
ref|XP_010434826.1|  PREDICTED: transcription factor bHLH3              123   1e-26    
ref|XP_009385592.1|  PREDICTED: transcription factor bHLH13-like        124   1e-26    
ref|XP_011093944.1|  PREDICTED: transcription factor bHLH13-like        124   1e-26    
ref|XP_010508006.1|  PREDICTED: transcription factor ABA-INDUCIBL...    124   1e-26    
ref|XP_010252341.1|  PREDICTED: transcription factor bHLH3              123   1e-26    
ref|XP_010522910.1|  PREDICTED: transcription factor bHLH13-like        124   1e-26    
ref|XP_006836904.1|  hypothetical protein AMTR_s00099p00127980          124   1e-26    
gb|KEH23875.1|  ABA-inducible bHLH-type transcription factor            123   1e-26    
ref|XP_001752627.1|  predicted protein                                  125   1e-26    
gb|KHN44989.1|  Transcription factor bHLH3                              121   2e-26    
ref|NP_566078.1|  transcription factor ABA-INDUCIBLE bHLH-TYPE          123   2e-26    
ref|XP_006282965.1|  hypothetical protein CARUB_v10007725mg             122   2e-26    
ref|XP_008235723.1|  PREDICTED: transcription factor bHLH3              122   2e-26    
ref|XP_011093025.1|  PREDICTED: transcription factor bHLH13-like ...    123   3e-26    
ref|XP_011093027.1|  PREDICTED: transcription factor bHLH13-like ...    123   3e-26    
gb|KFK26541.1|  hypothetical protein AALP_AA8G262400                    121   3e-26    
dbj|BAK08014.1|  predicted protein                                      123   3e-26    
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like          122   4e-26    
emb|CCQ71910.1|  transcription factor MYC2                              119   4e-26    
ref|XP_008806486.1|  PREDICTED: transcription factor bHLH13-like        123   4e-26    
ref|XP_002282584.2|  PREDICTED: transcription factor bHLH3              121   4e-26    
ref|XP_010518324.1|  PREDICTED: transcription factor ABA-INDUCIBL...    122   4e-26    
ref|XP_006414350.1|  hypothetical protein EUTSA_v10025122mg             121   5e-26    
ref|XP_010100069.1|  hypothetical protein L484_005743                   121   5e-26    
emb|CBI17963.3|  unnamed protein product                                121   5e-26    
gb|EMS56188.1|  Transcription factor bHLH13                             122   6e-26    
gb|EYU32259.1|  hypothetical protein MIMGU_mgv1a021930mg                121   6e-26    
gb|AAU08787.1|  bHLH transcription factor                               118   6e-26    
ref|XP_008353557.1|  PREDICTED: transcription factor MYC4-like          118   6e-26    
gb|AAM19778.1|  At2g46510/F13A10.4                                      122   7e-26    
ref|XP_006594010.1|  PREDICTED: transcription factor bHLH3-like         121   7e-26    
ref|XP_010456176.1|  PREDICTED: transcription factor bHLH14-like ...    119   7e-26    
gb|AIU98517.1|  bHLH transcription factor                               122   7e-26    
ref|XP_006418406.1|  hypothetical protein EUTSA_v10007139mg             122   7e-26    
ref|XP_002870159.1|  basic helix-loop-helix family protein              120   8e-26    
ref|NP_001145780.1|  uncharacterized protein LOC100279287               120   8e-26    
ref|XP_003566142.1|  PREDICTED: transcription factor bHLH13             122   8e-26    
emb|CDY09695.1|  BnaC07g33660D                                          120   9e-26    
ref|XP_008245388.1|  PREDICTED: transcription factor MYC2-like          120   9e-26    
ref|XP_010321507.1|  PREDICTED: transcription factor bHLH13-like        121   9e-26    
ref|XP_010559123.1|  PREDICTED: transcription factor ABA-INDUCIBL...    122   9e-26    
ref|XP_002882073.1|  basic helix-loop-helix family protein              121   9e-26    
emb|CDP12229.1|  unnamed protein product                                120   9e-26    
ref|XP_006287856.1|  hypothetical protein CARUB_v10001082mg             119   9e-26    
ref|XP_004289915.1|  PREDICTED: transcription factor bHLH3-like         120   1e-25    
ref|NP_193376.1|  transcription factor bHLH3                            119   1e-25    
ref|XP_004494832.1|  PREDICTED: transcription factor bHLH13-like        121   1e-25    
ref|XP_009136765.1|  PREDICTED: transcription factor bHLH3-like         119   1e-25    
ref|XP_009407318.1|  PREDICTED: transcription factor bHLH13-like        120   2e-25    
gb|KHG22989.1|  Transcription factor bHLH3 -like protein                120   2e-25    



>gb|AGZ94899.1| MYC transcription factor 2 [Solanum lycopersicum]
Length=689

 Score =   390 bits (1003),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 276/399 (69%), Positives = 310/399 (78%), Gaps = 29/399 (7%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNTNVQGNSFPSSIT-KQIVFGNENPNPA----------T  1670
             DPSALWLTDP   G EV++S+NT VQ NS PSS + KQI +GNEN +P+           
Sbjct  295   DPSALWLTDPSSSGMEVRESLNT-VQTNSVPSSNSNKQIAYGNENNHPSGNGQSCYNQQQ  353

Query  1669  VETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSAC  1490
              +         LF R LNFSEFG DG  ++ RN  SS+SCK ESGEILNFGD + K+SA 
Sbjct  354   QKNPPQQQTQGLFTRELNFSEFGFDG--SSNRNGNSSVSCKPESGEILNFGD-STKKSAS  410

Query  1489  SGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vpsaggagga  1322
             S N  +F+GQ  F A +ENNN NK   R+ TSRGSN+EGMLSFVSG V         GG 
Sbjct  411   SANVNLFTGQSQFGAGEENNNKNKK--RSATSRGSNEEGMLSFVSGTVLPSSGMKSGGGG  468

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
               DS+HSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  469   GEDSEHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  527

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpp  962
             RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  ES +EDLK+Q+E +KKESR P 
Sbjct  528   RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPG  587

Query  961   pppppepPLKLA----GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDV  794
             PPPPP   LK++    GKIVD+D+DVKIIGWDAMIRIQC+KKNHPAARLM AL +LDLDV
Sbjct  588   PPPPPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDV  647

Query  793   HHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             HHASVSVVNDLMIQQATVKMGS  Y +E+LR+ALTS IA
Sbjct  648   HHASVSVVNDLMIQQATVKMGSRNYTEEQLRVALTSKIA  686



>ref|XP_004245895.2| PREDICTED: transcription factor MYC2 [Solanum lycopersicum]
Length=689

 Score =   389 bits (1000),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 275/399 (69%), Positives = 309/399 (77%), Gaps = 29/399 (7%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNTNVQGNSFPSSIT-KQIVFGNENPNPA----------T  1670
             DPSALWLTDP   G EV++S+NT VQ NS PSS + KQI +GNEN +P+           
Sbjct  295   DPSALWLTDPSSSGMEVRESLNT-VQTNSVPSSNSNKQIAYGNENNHPSGNGQSCYNQQQ  353

Query  1669  VETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSAC  1490
              +          F R LNFSEFG DG  ++ RN  SS+SCK ESGEILNFGD + K+SA 
Sbjct  354   QKNPPQQQTQGFFTRELNFSEFGFDG--SSNRNGNSSVSCKPESGEILNFGD-STKKSAS  410

Query  1489  SGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vpsaggagga  1322
             S N  +F+GQ  F A +ENNN NK   R+ TSRGSN+EGMLSFVSG V         GG 
Sbjct  411   SANVNLFTGQSQFGAGEENNNKNKK--RSATSRGSNEEGMLSFVSGTVLPSSGMKSGGGG  468

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
               DS+HSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  469   GEDSEHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  527

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpp  962
             RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  ES +EDLK+Q+E +KKESR P 
Sbjct  528   RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPG  587

Query  961   pppppepPLKLA----GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDV  794
             PPPPP   LK++    GKIVD+D+DVKIIGWDAMIRIQC+KKNHPAARLM AL +LDLDV
Sbjct  588   PPPPPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDV  647

Query  793   HHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             HHASVSVVNDLMIQQATVKMGS  Y +E+LR+ALTS IA
Sbjct  648   HHASVSVVNDLMIQQATVKMGSRHYTEEQLRVALTSKIA  686



>ref|XP_006352856.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=702

 Score =   378 bits (971),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 276/406 (68%), Positives = 309/406 (76%), Gaps = 42/406 (10%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNTNVQGNSFPSSIT-KQIVFGNENPNPATVETQSNNNNS  1640
             DPSALWLT+P   G EV++S+NT VQ NS PSS + KQI +GNEN +      QS N  S
Sbjct  303   DPSALWLTEPSSSGMEVRESLNT-VQTNSVPSSNSNKQIAYGNENNH------QSGNGQS  355

Query  1639  -----------------QLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDN  1511
                                F R LNFSEFG DG   + +NE +SLSCK ESGEILNFGD 
Sbjct  356   CYNQQQQQNNPPQQQTQGFFTRELNFSEFGFDGN--SNKNENASLSCKPESGEILNFGD-  412

Query  1510  AVKRSACSGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vps  1343
             + K+SA S N  +F+GQ  F A +ENNNN   K R+ TSRGSN+EGMLSFVSG V     
Sbjct  413   STKKSASSANVNLFTGQSQFGAVEENNNNKNKK-RSATSRGSNEEGMLSFVSGTVLPSSG  471

Query  1342  aggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQ  1163
                 GG   DS+HSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQ
Sbjct  472   MKSGGGRGEDSEHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQ  530

Query  1162  RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK  983
             RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  ES +EDLK+Q+E +K
Sbjct  531   RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLK  590

Query  982   KESRHpppppppepPLKLA----GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVAL  815
             KESR  P PPPP   LK++    GKIVD+D+DVKIIGWDAMIRIQC+KKNHPAARLM AL
Sbjct  591   KESRR-PGPPPPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAAL  649

Query  814   KDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
              +LDLDVHHASVSVVNDLMIQQATVKMGS  Y +E+LR+ALTS IA
Sbjct  650   MELDLDVHHASVSVVNDLMIQQATVKMGSRHYTEEQLRVALTSKIA  695



>emb|CAF74710.1| MYC transcription factor [Solanum tuberosum]
Length=692

 Score =   376 bits (965),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 273/397 (69%), Positives = 305/397 (77%), Gaps = 28/397 (7%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNTNVQGNSFPSSIT-KQIVFGNENPNPATVETQSNNN--  1646
             DPSALWLT+P   G EV++S+NT VQ NS PSS + KQI + NEN N  +   QS  N  
Sbjct  297   DPSALWLTEPSSSGMEVRESLNT-VQTNSVPSSNSNKQIAYANEN-NHQSGNGQSCYNLQ  354

Query  1645  ----------NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
                           F R LNFSEFG DG  ++ RN  +SLSCK ESGEILNFGD + K+S
Sbjct  355   QQQNNPPQQQTQGFFTRELNFSEFGFDG--SSNRNGNASLSCKPESGEILNFGD-STKKS  411

Query  1495  ACSGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vpsaggag  1328
             A S N  +F+GQ  F A +ENNNN   K R+ TSRGSN+EGMLSFVSG V         G
Sbjct  412   ASSANVNLFTGQSQFGAVEENNNNKNKK-RSATSRGSNEEGMLSFVSGTVLPSSGMKSGG  470

Query  1327  gatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKL  1148
             G   DS+HSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKL
Sbjct  471   GGGEDSEHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKL  529

Query  1147  NQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRH  968
             NQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  ES +EDLK+Q+E +KKESR 
Sbjct  530   NQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRR  589

Query  967   pppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHH  788
              P PPPP   LK+ GKIVD+D+DVKIIGWDAMI IQC+KKNHPAARLM AL +LDLDVHH
Sbjct  590   -PGPPPPNQDLKIGGKIVDVDIDVKIIGWDAMIGIQCNKKNHPAARLMAALMELDLDVHH  648

Query  787   ASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             ASVSVVNDLMIQQATVKMGS  Y +E+LR+AL S IA
Sbjct  649   ASVSVVNDLMIQQATVKMGSRHYTEEQLRVALKSKIA  685



>gb|AGL98100.1| transcription factor MYC2 [Nicotiana attenuata]
Length=656

 Score =   365 bits (937),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 256/391 (65%), Positives = 296/391 (76%), Gaps = 27/391 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSS-ITKQIVFGNENPNPATVETQSNNNNS  1640
             DPSALWLTDP     EVKDS       N+ PSS  +KQ+VFGNEN       +++ N NS
Sbjct  282   DPSALWLTDPASSAVEVKDS-------NTVPSSNSSKQLVFGNEN-------SENGNQNS  327

Query  1639  Q----LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
             Q     F R LNFSE+G DG      N  SS SCK ESGEILNFGD + KRSA S N ++
Sbjct  328   QQTQGFFTRELNFSEYGFDGSNTRNGNANSSRSCKPESGEILNFGD-STKRSASSANGSL  386

Query  1471  FSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv-vpsaggaggatgdsdhs  1301
             FSGQ  F       N NKNKKR+  SRGSNDEGMLSFVSGV+   S  G  G  GDSD S
Sbjct  387   FSGQSQFGPGSAEENKNKNKKRSPASRGSNDEGMLSFVSGVILPSSNTGKSGGGGDSDQS  446

Query  1300  DLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRA  1121
             DLEASVV+EADSSRVV +PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA
Sbjct  447   DLEASVVKEADSSRVV-DPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  505

Query  1120  VVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppep  941
             VVPNVSKMDKASLLGDAI++INELKSK+Q ++S +E+L+ Q+ES++KE  +        P
Sbjct  506   VVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKEELRNQIESLRKELANKGSNYTGPP  565

Query  940   PLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             P     KI+D+D+DVK+IGWDAMIRIQ +KKNHPAARLM AL +LDLDVHHASVSVVN+L
Sbjct  566   PSNQDLKILDMDIDVKVIGWDAMIRIQSNKKNHPAARLMAALMELDLDVHHASVSVVNEL  625

Query  760   MIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             MIQQATVKMGS +Y QE+LR++LTS IA +R
Sbjct  626   MIQQATVKMGSRLYTQEQLRISLTSRIAESR  656



>gb|ADH04269.1| MYC2a transcription factor [Nicotiana tabacum]
Length=659

 Score =   363 bits (933),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 256/392 (65%), Positives = 295/392 (75%), Gaps = 26/392 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ  1637
             DPSALWLTDP     EVKDS NT    N+     +KQ+VFGNEN       +++ N NSQ
Sbjct  282   DPSALWLTDPASSVVEVKDSSNTVPSRNT-----SKQLVFGNEN-------SENVNQNSQ  329

Query  1636  ----LFPRGLNFSEFGLDGGGAAVRN--ETSSLSCKRESGEILNFGDNAVKRSACSGNDA  1475
                  F R LNFSE+G DG      N    SS SCK ESGEILNFGD + KRSACS N +
Sbjct  330   QTQGFFTRELNFSEYGFDGSNTRYGNGNANSSRSCKPESGEILNFGD-STKRSACSANGS  388

Query  1474  IFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv-vpsaggaggatgdsdh  1304
             +FSGQ  F       N NKNKKR+  SRGSNDEG+LSFVSGV+   S  G  G  GDSD 
Sbjct  389   LFSGQSQFGPGPAEENKNKNKKRSPASRGSNDEGILSFVSGVILPSSNTGKSGGGGDSDQ  448

Query  1303  sDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALR  1124
             SDLEASVV+EADSSRVV +PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALR
Sbjct  449   SDLEASVVKEADSSRVV-DPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  507

Query  1123  AVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppe  944
             AVVPNVSKMDKASLLGDAI++INELKSK+Q ++S +EDL+ Q+ES++ E  +        
Sbjct  508   AVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKEDLRNQIESLRNELANKGSNYTGP  567

Query  943   pPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVND  764
             PP     KIVD+D+DVK+IGWDAMIRIQ +KKNHPAARLM AL +LDLDVHHASVSVVN+
Sbjct  568   PPSNQELKIVDMDIDVKVIGWDAMIRIQSNKKNHPAARLMTALMELDLDVHHASVSVVNE  627

Query  763   LMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             LMIQQATVKMGS +Y QE+LR++LTS IA +R
Sbjct  628   LMIQQATVKMGSRLYTQEQLRISLTSRIAESR  659



>ref|XP_009800420.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=659

 Score =   362 bits (930),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 255/392 (65%), Positives = 295/392 (75%), Gaps = 26/392 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ  1637
             DPSALWLTDP     EVKDS NT    N+     +KQ+VFGNEN       +++ N NSQ
Sbjct  282   DPSALWLTDPASSVVEVKDSSNTVPSRNT-----SKQLVFGNEN-------SENGNQNSQ  329

Query  1636  ----LFPRGLNFSEFGLDGGGAAVRN--ETSSLSCKRESGEILNFGDNAVKRSACSGNDA  1475
                  F R LNFSE+G DG      N    SS SCK ESGEILNFGD + KRSACS N +
Sbjct  330   QTQGFFTRELNFSEYGFDGSNTRYGNGNANSSRSCKPESGEILNFGD-STKRSACSANGS  388

Query  1474  IFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv-vpsaggaggatgdsdh  1304
             +FSGQ  F       N NKNKKR+  SRGSNDEG+LSFVSGV+   S  G  G  GDSD 
Sbjct  389   LFSGQSQFGPGPAEENKNKNKKRSPASRGSNDEGILSFVSGVILPSSNTGKSGGGGDSDQ  448

Query  1303  sDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALR  1124
             SDLEASVV+EADSSRVV +PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALR
Sbjct  449   SDLEASVVKEADSSRVV-DPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  507

Query  1123  AVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppe  944
             AVVPNVSKMDKASLLGDAI++INELKSK+Q ++S +E+L+ Q+ES++ E  +        
Sbjct  508   AVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKEELRNQIESLRNELANKGSNYTGP  567

Query  943   pPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVND  764
             PP     KIVD+D+DVK+IGWDAMIRIQ +KKNHPAARLM AL +LDLDVHHASVSVVN+
Sbjct  568   PPSNQELKIVDMDIDVKVIGWDAMIRIQSNKKNHPAARLMTALMELDLDVHHASVSVVNE  627

Query  763   LMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             LMIQQATVKMGS +Y QE+LR++LTS IA +R
Sbjct  628   LMIQQATVKMGSRLYTQEQLRISLTSRIAESR  659



>ref|XP_011082365.1| PREDICTED: transcription factor MYC4-like [Sesamum indicum]
Length=670

 Score =   363 bits (931),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 294/393 (75%), Gaps = 28/393 (7%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVN----TNVQGNSFPSSIT-KQIVFGNENPNPATVETQSN  1652
             DPSALWLTDP   GP+VKDS+N    TN Q +SFPS++T KQ+VF NENPN +T+     
Sbjct  293   DPSALWLTDPSSSGPDVKDSLNNNSATNAQASSFPSTLTSKQLVFSNENPNSSTLTENPQ  352

Query  1651  NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
               +     R LNFSEFG +G      N  +S +CKRE+GEILNFG+++ +RS CSGN  +
Sbjct  353   LQSQGFVARELNFSEFGYNGSS----NGRNSGTCKRETGEILNFGESS-RRSVCSGNGNL  407

Query  1471  FSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vpsaggaggatgdsdhsD  1298
              + Q          +K+KKR++ SRGSNDEGMLSF SGV+              +SDHSD
Sbjct  408   LAVQ---------EDKSKKRSSKSRGSNDEGMLSFTSGVILPSSGVKADNVGAVESDHSD  458

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+E +SSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  459   LEASVVKEVESSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  517

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SRHpppppppe  944
             VPNVSKMDKASLLGDAI+YINELKSK+Q+ ES +E+L++QLE +KKE  ++     PPP 
Sbjct  518   VPNVSKMDKASLLGDAIAYINELKSKVQSVESDKEELRSQLELVKKELGTKDMRSAPPPA  577

Query  943   pPLKLAGkivdidv-dvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVN  767
               L ++  +      DVKIIGWDAMIR+QCSKKNHPAA+LM+AL++LDLDVHHASVSVVN
Sbjct  578   HDLNMSSNVKVDMDIDVKIIGWDAMIRVQCSKKNHPAAKLMLALRELDLDVHHASVSVVN  637

Query  766   DLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             DLMIQQATVKM    Y+Q++LR+AL S +A  R
Sbjct  638   DLMIQQATVKMEGRFYSQDQLRVALISKVAETR  670



>gb|ADH04263.1| bHLH2 transcription factor [Nicotiana benthamiana]
Length=657

 Score =   361 bits (927),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 254/390 (65%), Positives = 295/390 (76%), Gaps = 24/390 (6%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ  1637
             D SALWLTDP     EVKDS NT    NS     +KQ+VFGNEN       +++ N NSQ
Sbjct  282   DTSALWLTDPASSAVEVKDSSNTVPSSNS-----SKQLVFGNEN-------SENGNQNSQ  329

Query  1636  ----LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIF  1469
                  F R LNFSE+G DG      N  SS SC+ ESGEILNFGD + KRSA S N ++F
Sbjct  330   QTQGFFTRELNFSEYGFDGSNTRNGNVNSSRSCQPESGEILNFGD-STKRSASSANGSLF  388

Query  1468  SGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvv-psaggaggatgdsdhsD  1298
             SGQ  F       N NKNKKR+  SRGSNDEGMLSFVSGV++  S  G  G  GDSD SD
Sbjct  389   SGQSQFGPGPAEENKNKNKKRSPASRGSNDEGMLSFVSGVILPSSNTGKSGGGGDSDQSD  448

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EADSSRVV +PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  449   LEASVVKEADSSRVV-DPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  507

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP  938
             VPNVSKMDKASLLGDAI++INELKSK+Q ++S +E+L+ Q+ES++ E  +        PP
Sbjct  508   VPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKEELRNQIESLRNELANKGSNYTGPPP  567

Query  937   LKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLM  758
             L    KIVD+D+DVK+IGWDAMIRIQ +KKNHPAA+LM AL +LDLDVHHASVSVVN+LM
Sbjct  568   LNQELKIVDMDIDVKVIGWDAMIRIQSNKKNHPAAKLMAALMELDLDVHHASVSVVNELM  627

Query  757   IQQATVKMGSHVYNQEELRLALTSSIAANR  668
             IQQATVKMGS +Y QE+LR++LTS IA +R
Sbjct  628   IQQATVKMGSRLYTQEQLRISLTSRIAESR  657



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score =   357 bits (917),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 265/403 (66%), Positives = 303/403 (75%), Gaps = 36/403 (9%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSS-ITKQIVFGNENPNPATVETQSNNNNS  1640
             DPSALWLTDP     +VKD +NT V+ NS PSS  +KQ+VF NEN N  + + Q  +++ 
Sbjct  292   DPSALWLTDPSSAAVQVKD-LNT-VEANSVPSSNSSKQVVFDNEN-NGHSCDNQQQHHSR  348

Query  1639  Q----LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
             Q     F R LNFSEFG DG  +  RN  SSLSCK ESGEILNFGD+  K    S N  +
Sbjct  349   QQTQGFFTRELNFSEFGFDGS-SNNRNGNSSLSCKPESGEILNFGDSTKK----SANGNL  403

Query  1471  FSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat-----gd  1313
             FSGQ  F A +EN        R+  SRGSN+EGMLSFVSG ++P+A GA  ++       
Sbjct  404   FSGQSHFGAGEENKKKK----RSPASRGSNEEGMLSFVSGTILPAASGAMKSSGCVGEDS  459

Query  1312  sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFY  1133
             SDHSDLEASVV+EA+SSRVV EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  460   SDHSDLEASVVKEAESSRVV-EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  518

Query  1132  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-----SRH  968
             ALRAVVPNVSKMDKASLLGDAISYINELK KLQT E+ +EDLK+Q+E +KKE     SR 
Sbjct  519   ALRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRR  578

Query  967   ppp---ppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
             P P       +       KIVD+D+DVKIIGWDAMIRIQC+KKNHPAARLMVALK+LDLD
Sbjct  579   PGPPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  638

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             VHHASVSVVNDLMIQQATVKMGS +Y +E+LR+ALTS +A  R
Sbjct  639   VHHASVSVVNDLMIQQATVKMGSRLYTEEQLRIALTSRVAETR  681



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score =   357 bits (917),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 265/403 (66%), Positives = 303/403 (75%), Gaps = 36/403 (9%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSS-ITKQIVFGNENPNPATVETQSNNNNS  1640
             DPSALWLTDP     +VKD +NT V+ NS PSS  +KQ+VF NEN N  + + Q  +++ 
Sbjct  292   DPSALWLTDPSSAAVQVKD-LNT-VEANSVPSSNSSKQVVFDNEN-NGHSCDNQQQHHSR  348

Query  1639  Q----LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
             Q     F R LNFSEFG DG  +  RN  SSLSCK ESGEILNFGD+  K    S N  +
Sbjct  349   QQTQGFFTRELNFSEFGFDGS-SNNRNGNSSLSCKPESGEILNFGDSTKK----SANGNL  403

Query  1471  FSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat-----gd  1313
             FSGQ  F A +EN        R+  SRGSN+EGMLSFVSG ++P+A GA  ++       
Sbjct  404   FSGQSHFGAGEENKKKK----RSPASRGSNEEGMLSFVSGTILPAASGAMKSSGCVGEDS  459

Query  1312  sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFY  1133
             SDHSDLEASVV+EA+SSRVV EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  460   SDHSDLEASVVKEAESSRVV-EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  518

Query  1132  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-----SRH  968
             ALRAVVPNVSKMDKASLLGDAISYINELK KLQT E+ +EDLK+Q+E +KKE     SR 
Sbjct  519   ALRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRR  578

Query  967   ppp---ppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
             P P       +       KIVD+D+DVKIIGWDAMIRIQC+KKNHPAARLMVALK+LDLD
Sbjct  579   PGPPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  638

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             VHHASVSVVNDLMIQQATVKMGS +Y +E+LR+ALTS +A  R
Sbjct  639   VHHASVSVVNDLMIQQATVKMGSRLYTEEQLRIALTSRVAETR  681



>ref|XP_009587276.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
 gb|ADH04270.1| MYC2b transcription factor [Nicotiana tabacum]
Length=658

 Score =   352 bits (904),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 254/392 (65%), Positives = 295/392 (75%), Gaps = 26/392 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ  1637
             DPS LWLTDP     EVKDS NT    NS     +KQ+VFGNEN       +++ N NSQ
Sbjct  281   DPSTLWLTDPPSSVVEVKDSSNTVPSSNS-----SKQLVFGNEN-------SENVNQNSQ  328

Query  1636  ----LFPRGLNFSEFGLDGGG--AAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDA  1475
                  F R LNFSE+G DG    +   N  SS SCK ESGEILNFGD + KR+A S N +
Sbjct  329   QTQGFFTRELNFSEYGFDGSNTRSGNGNVNSSRSCKPESGEILNFGD-STKRNASSANGS  387

Query  1474  IFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv-vpsaggaggatgdsdh  1304
             +FSGQ  F       N NKNKKR+  SRGSN+EGMLSFVSGV+   S  G  G  GDSDH
Sbjct  388   LFSGQSQFGPGPAEENKNKNKKRSPASRGSNEEGMLSFVSGVILPSSNTGKSGGGGDSDH  447

Query  1303  sDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALR  1124
             SDLEASVV+EADSSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALR
Sbjct  448   SDLEASVVKEADSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  506

Query  1123  AVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppe  944
             AVVPNVSKMDKASLLGDAI++INELKSK+Q ++S +++L+ Q+ES++ E  +        
Sbjct  507   AVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKDELRNQIESLRNELANKGSNYTGP  566

Query  943   pPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVND  764
             PP     KIVD+D+DVK+IGWDAMIRIQ +KKNHPAARLM AL +LDLDVHHASVSVVN+
Sbjct  567   PPPNQDLKIVDMDIDVKVIGWDAMIRIQSNKKNHPAARLMAALMELDLDVHHASVSVVNE  626

Query  763   LMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             LMIQQATVKMGS +Y QE+LR++LTS IA +R
Sbjct  627   LMIQQATVKMGSRLYTQEQLRISLTSRIAESR  658



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score =   352 bits (903),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 262/406 (65%), Positives = 298/406 (73%), Gaps = 43/406 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSS-ITKQIVFGNENPNPATVETQ---SNN  1649
             DPSALWLTDP     EV+D +NT V+ NS PSS  +KQ+VF NEN   ++   Q   S +
Sbjct  291   DPSALWLTDPSSAAVEVQD-LNT-VKANSVPSSNSSKQVVFDNENNGHSSDNQQQQHSKH  348

Query  1648  NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIF  1469
                  F R LNFSEFG DG  +  RN  SSLSCK ESGEILNFGD+  K    S N  +F
Sbjct  349   ETQGFFTRELNFSEFGFDGS-SNNRNGNSSLSCKPESGEILNFGDSTKK----SANGNLF  403

Query  1468  SGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat----gdsd  1307
             SGQ  F A +EN N      R+  SRGSN+EGMLSFVSG ++P+A GA  ++     DSD
Sbjct  404   SGQSHFGAGEENKNKK----RSPASRGSNEEGMLSFVSGTILPAASGAMKSSGGVGEDSD  459

Query  1306  hsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYAL  1127
             HSDLEASVV+EA+SSRVV EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL
Sbjct  460   HSDLEASVVKEAESSRVV-EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  518

Query  1126  RAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE----------  977
             RAVVPNVSKMDKASLLGDAISYINELK KLQ  E+ +E+LK+Q+E +KKE          
Sbjct  519   RAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELASKDSRRPG  578

Query  976   ---SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDL  806
                S H               KIVD+D+DVKIIGWDAMIRIQC+KKNHPAARLMVALK+L
Sbjct  579   PPPSNHDHKMSSHT-----GSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKEL  633

Query  805   DLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             DLDVHHASVSVVNDLMIQQATVKMGS +Y +E+LR+ALTS +A  R
Sbjct  634   DLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRIALTSRVAETR  679



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score =   351 bits (901),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 262/406 (65%), Positives = 298/406 (73%), Gaps = 43/406 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSS-ITKQIVFGNENPNPATVETQ---SNN  1649
             DPSALWLTDP     EV+D +NT V+ NS PSS  +KQ+VF NEN   ++   Q   S +
Sbjct  291   DPSALWLTDPSSAAVEVQD-LNT-VKANSVPSSNSSKQVVFDNENNGHSSDNQQQQHSKH  348

Query  1648  NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIF  1469
                  F R LNFSEFG DG  +  RN  SSLSCK ESGEILNFGD+  K    S N  +F
Sbjct  349   ETQGFFTRELNFSEFGFDGS-SNNRNGNSSLSCKPESGEILNFGDSTKK----SANGNLF  403

Query  1468  SGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat----gdsd  1307
             SGQ  F A +EN N      R+  SRGSN+EGMLSFVSG ++P+A GA  ++     DSD
Sbjct  404   SGQSHFGAGEENKNKK----RSPASRGSNEEGMLSFVSGTILPAASGAMKSSGGVGEDSD  459

Query  1306  hsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYAL  1127
             HSDLEASVV+EA+SSRVV EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL
Sbjct  460   HSDLEASVVKEAESSRVV-EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  518

Query  1126  RAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE----------  977
             RAVVPNVSKMDKASLLGDAISYINELK KLQ  E+ +E+LK+Q+E +KKE          
Sbjct  519   RAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELVSKDSRRPG  578

Query  976   ---SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDL  806
                S H               KIVD+D+DVKIIGWDAMIRIQC+KKNHPAARLMVALK+L
Sbjct  579   PPPSNHDHKMSSHT-----GSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKEL  633

Query  805   DLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             DLDVHHASVSVVNDLMIQQATVKMGS +Y +E+LR+ALTS +A  R
Sbjct  634   DLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRIALTSRVAETR  679



>gb|ADH04262.1| bHLH1 transcription factor [Nicotiana benthamiana]
Length=680

 Score =   344 bits (883),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 254/408 (62%), Positives = 289/408 (71%), Gaps = 46/408 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFP-SSITKQIVFGNENPNPATVETQSNNNNS  1640
             DPSALWLTDP P    VKD +NT V+ NS P S+ +KQ+VF NEN        QS +N  
Sbjct  291   DPSALWLTDPSPAAVPVKD-LNT-VEANSVPPSNSSKQLVFDNEN------NGQSCDNQQ  342

Query  1639  Q---------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACS  1487
             Q          F R LNFSEFG DG    +RN  SS+SCK ESGEILNF D+  K    S
Sbjct  343   QHHSQQQTQGFFTRELNFSEFGFDGCNN-IRNGNSSVSCKPESGEILNFCDSPKK----S  397

Query  1486  GNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs-----gvvvpsaggag  1328
              N  +FS Q  F A +EN N      R+  SRGSN+EGMLSFVS                
Sbjct  398   ANGNLFSCQSHFGAGEENKNKK----RSAASRGSNEEGMLSFVSGTILPAASGAMKSIGC  453

Query  1327  gatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKL  1148
              A G SDHSDLEAS+V+EA+SSRVV EPEKRPKKRGRKPANGREEPLNHVEAERQRREKL
Sbjct  454   VAEGSSDHSDLEASLVKEAESSRVV-EPEKRPKKRGRKPANGREEPLNHVEAERQRREKL  512

Query  1147  NQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE---  977
             NQRFYALRAVVPNVSKMDKASLLGDAISYINELK KLQ  E+ +E+LK+Q+E +KKE   
Sbjct  513   NQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDRENLKSQIEDLKKELAS  572

Query  976   --SRHp---ppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALK  812
               SR P   PP    +       K+VD+D+DVK+IGWDAMI +QC+K NHPAARLMVALK
Sbjct  573   KDSRRPGPPPPNQDHKMSSHTGSKVVDVDIDVKVIGWDAMISVQCNKNNHPAARLMVALK  632

Query  811   DLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             +LDLDVHHASVSVVNDLMIQQATVKMGS +Y +E+LR+ALTS +A  R
Sbjct  633   ELDLDVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRIALTSRVAETR  680



>gb|AAQ14332.1|AF283507_1 MYC2 [Catharanthus roseus]
Length=699

 Score =   342 bits (877),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 247/416 (59%), Positives = 291/416 (70%), Gaps = 47/416 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGPE---VKDSVNTN----VQGNSFPSSITKQIVFGNENPNPATVE-----  1664
             DPS+LWLTDP P    VK+ VNTN    VQGNS PS   +Q+VFGN + +P T       
Sbjct  288   DPSSLWLTDPSPSGVGVKEGVNTNNNTSVQGNSIPSGNKQQLVFGNNDNHPTTSTLTDHP  347

Query  1663  ----TQSNNNNSQ--------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNF  1520
                   S NN+SQ         F R LNFSE+G +      R+   + +CK ESGEILNF
Sbjct  348   GAGAVNSYNNSSQNAQQPQGSFFTRELNFSEYGFE------RSSVKNGNCKPESGEILNF  401

Query  1519  GDNAV-KRSACSGNDAIFS--GQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsg---  1358
             G  +V K+++ SGN  +FS   QF A +EN N  +    +  SRGSNDEGMLSF SG   
Sbjct  402   GGESVTKKNSVSGNGNLFSVQSQFGAGEENKNKKRP---SPVSRGSNDEGMLSFTSGVVL  458

Query  1357  -vvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNH  1181
                       GG  GDSDHSDLEASVV+EA+SSRVV +PEKRP+KRGRKPANGREEPLNH
Sbjct  459   PSTGVVKSSGGGGGGDSDHSDLEASVVKEAESSRVV-DPEKRPRKRGRKPANGREEPLNH  517

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELK+KLQT E+ +++LK 
Sbjct  518   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKAKLQTTETDKDELKN  577

Query  1000  QLESIKKE--SRHpppppppepPLKLAGkivd----idvdvkiIGWDAMIRIQCSKKNHP  839
             QL+S+KKE  S+       P+  LK + K       +D+DVKIIG +AMIR+Q SK NHP
Sbjct  578   QLDSLKKELASKESRLLSSPDQDLKSSNKQSVGNLDMDIDVKIIGREAMIRVQSSKNNHP  637

Query  838   AARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             AAR+M ALKDLDL++ HASVSVVNDLMIQQ TV+MGS  Y QE+LR+ALTS IA N
Sbjct  638   AARVMGALKDLDLELLHASVSVVNDLMIQQNTVRMGSRFYTQEQLRIALTSRIAGN  693



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score =   340 bits (873),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 250/407 (61%), Positives = 286/407 (70%), Gaps = 50/407 (12%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPAT---VETQSNNN  1646
             DPSALWLTDP P   +VKD +NT    NS     +KQ+VF NEN         +  S   
Sbjct  283   DPSALWLTDPSPAAVQVKD-LNTVPSSNS-----SKQVVFDNENNGHICDNQQQHHSQQQ  336

Query  1645  NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFS  1466
                 F R LNFSEFG DG  +  RN  SS+SCK ESGEILNFGD+  K    S N  +FS
Sbjct  337   TQGFFTRELNFSEFGFDGS-SNNRNGNSSVSCKPESGEILNFGDSTKK----SANGNLFS  391

Query  1465  GQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat-----gdsd  1307
             GQ  F A +EN N      R+  SRGSN+EGMLSFVSG ++P+A GA  ++       SD
Sbjct  392   GQSHFGAGEENKNKK----RSPASRGSNEEGMLSFVSGTILPAASGAMKSSGCVGEDSSD  447

Query  1306  hsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYAL  1127
             HSDLEASVV+EA+SSRVV EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL
Sbjct  448   HSDLEASVVKEAESSRVV-EPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  506

Query  1126  RAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE----------  977
             RAVVPNVSKMDKASLLGDAISYINELK KLQ  E+ +EDLK+Q+E +KKE          
Sbjct  507   RAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREDLKSQIEDLKKELASEDSWRPG  566

Query  976   ----SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKD  809
                   H          + +       D+DVKIIGWDAM+RIQC+KKNHPAARLMVALK+
Sbjct  567   PPPNQDHKMSSHTGSKIVDV-------DIDVKIIGWDAMVRIQCNKKNHPAARLMVALKE  619

Query  808   LDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             LDL+VHHASVSVVNDLMIQQATVKMGS +Y +E+LR+ALTS +A  R
Sbjct  620   LDLEVHHASVSVVNDLMIQQATVKMGSRLYTEEQLRIALTSRVAETR  666



>emb|CDP13028.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   339 bits (869),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 243/411 (59%), Positives = 288/411 (70%), Gaps = 42/411 (10%)
 Frame = -2

Query  1807  DPSALWLTDPGPE---VKDSVNTNV----QGNSFPSSIT-KQIVFGNEN-PNPATVETQS  1655
             DPSALWLTDP      VK+SVN N     QG+S PSS   KQ++FGN+N P+ +T+    
Sbjct  294   DPSALWLTDPSSSAAGVKESVNNNNNTTGQGSSIPSSANNKQMLFGNDNNPSSSTLTDNP  353

Query  1654  NN------NNSQ----LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
              N      N+SQ     + R LNFSE+G +G   +VRN T    CK E+GEILNFG  + 
Sbjct  354   RNILNAHHNSSQQSGGFYTRELNFSEYGFEGN--SVRNAT----CKPETGEILNFGGEST  407

Query  1504  KRSACSGNDAIFSGQFP--AADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv--vvpsag  1337
              + +CS N  +FSGQ P    DE+ +      R+  SRGSNDEGMLSF SGV        
Sbjct  408   AKRSCSANGNLFSGQSPFGVGDESKSKK----RSPVSRGSNDEGMLSFTSGVILPSSGVV  463

Query  1336  gaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRR  1157
              + G  GDSDHSDLEASV +EADSSRVV +PEK+P+KRGRKPANGREEPLNHVEAERQRR
Sbjct  464   KSSGGGGDSDHSDLEASVAKEADSSRVV-DPEKKPRKRGRKPANGREEPLNHVEAERQRR  522

Query  1156  EKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE  977
             EKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKL   ES +E+L+ Q++S+KKE
Sbjct  523   EKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLHNMESDKEELRNQIDSLKKE  582

Query  976   ----SRHpppppppepPLKLAGkivdidvdv----kiIGWDAMIRIQCSKKNHPAARLMV  821
                       PPPP+  LKLA       +D+    KIIGW+AMIR+Q SK NHPAAR+M 
Sbjct  583   LTSKEARNFAPPPPDKDLKLASHQGSKSLDMDIDVKIIGWEAMIRVQSSKNNHPAARIMG  642

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             ALKDLDL++ HASVSVVNDLMIQQ TV+MG   Y QE+L++ALTS +A  R
Sbjct  643   ALKDLDLELLHASVSVVNDLMIQQNTVRMGKRFYTQEQLKIALTSRVAETR  693



>ref|XP_002280253.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=663

 Score =   338 bits (866),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 247/411 (60%), Positives = 283/411 (69%), Gaps = 47/411 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGP--EVKDSVNTNVQGNSFP---SSITKQIVFGN-------ENP----NP  1676
             DPS+LW++DP    E+KDSVN    G S P      +K I F N       ENP    NP
Sbjct  269   DPSSLWISDPTSNVEIKDSVNATATGASNPIGNQQNSKSIQFENPSSSSLTENPSIMHNP  328

Query  1675  AT---VETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
                  + TQ        F R LNFSEFG DG      N  S    K ESGEILNFGD+  
Sbjct  329   QQQQQIHTQG------FFTRELNFSEFGFDGNNGRNGNLHS---LKPESGEILNFGDS--  377

Query  1504  KRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vpsagga  1331
             KRS+CS N  +FSG      E N       R+ TSRGS +EGMLSF SGV+        +
Sbjct  378   KRSSCSANGNMFSGHSQVVAEENKKR----RSPTSRGSAEEGMLSFTSGVILPSSCVVKS  433

Query  1330  ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREK  1151
              G  GDSDHSDLEASVVREADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREK
Sbjct  434   SGGGGDSDHSDLEASVVREADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREK  492

Query  1150  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--  977
             LNQRFYALRAVVPNVSKMDKASLLGDAISYINEL++KLQ+AES +EDL+ ++ S+KKE  
Sbjct  493   LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKEVNSMKKELA  552

Query  976   ---SRHppppppp-epPLKLAGkivdidvdv----kiIGWDAMIRIQCSKKNHPAARLMV  821
                S++     PP +  LK++       V++    KIIGWDAMIRIQCSKKNHPAA+LM 
Sbjct  553   SKDSQYSGSSRPPPDQDLKMSNHHGSKLVEMDIDVKIIGWDAMIRIQCSKKNHPAAKLMG  612

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             ALK+LDLDV+HASVSVVNDLMIQQATVKMGS  Y Q++LRLAL+S  A +R
Sbjct  613   ALKELDLDVNHASVSVVNDLMIQQATVKMGSRFYTQDQLRLALSSKFADSR  663



>ref|XP_010275210.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=666

 Score =   332 bits (852),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 241/414 (58%), Positives = 297/414 (72%), Gaps = 48/414 (12%)
 Frame = -2

Query  1807  DPSALWLTDPGP--EVKDSVNTNVQGNSF------PSS--ITKQIVFGNENP-----NPA  1673
             DPS+LWL+DP    E+KDSVNT    ++       PS+  ITK I F N++P     NP+
Sbjct  267   DPSSLWLSDPSSMIEIKDSVNTAPAASAAAAATVTPSNQEITKPIQFENQSPSSLTENPS  326

Query  1672  TVETQSNNNNSQ-------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGD  1514
             T+  Q+ + N          F R LNFSEFG +G  A  RN  S+ SCK ESGEILN+G+
Sbjct  327   TISVQTQHQNHHHQQQTQSFFTRELNFSEFGYEGSSA--RN-GSAQSCKPESGEILNYGE  383

Query  1513  NAVKRSACSGNDAIFSG---QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvps  1343
                K+++CS N  +FS    QF A D+         R+ +S+G N+EGMLSF SGVV+PS
Sbjct  384   R--KKNSCSANGNLFSNNSQQFVADDKKK-------RSASSKGGNNEGMLSFTSGVVLPS  434

Query  1342  aggagga--tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAE  1169
             +     +  T DSD SDL+ASV REA+SSRV  EPEKRP+KRGRKPANGREEPLNHVEAE
Sbjct  435   SCVVKSSGGTADSDQSDLDASV-REAESSRVG-EPEKRPRKRGRKPANGREEPLNHVEAE  492

Query  1168  RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLES  989
             RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINEL++KLQ AES +E L++Q++S
Sbjct  493   RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELRTKLQAAESNKEGLQSQVDS  552

Query  988   IKKE---SRHpppppppepPLKLAGkivdi----dvdvkiIGWDAMIRIQCSKKNHPAAR  830
             +KKE   SR+   PP  +  LK++   V      +++VKI+GW+AMIRIQC+KKNHPAAR
Sbjct  553   LKKELAASRYSGSPPQADQDLKISNHQVSKLLDMEIEVKILGWEAMIRIQCNKKNHPAAR  612

Query  829   LMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             LM ALK+LDLDVH+ASVSVV DLMIQQATVKM S VY QE+LR+AL+S +   R
Sbjct  613   LMTALKELDLDVHYASVSVVKDLMIQQATVKMSSRVYTQEQLRIALSSKVGDAR  666



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score =   333 bits (853),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 282/409 (69%), Gaps = 38/409 (9%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVN----TNVQGNSFPSSITKQIVFGNENP-------NPAT  1670
             DPS+LW+ DP     EVKD VN    T+   ++    ++K I F +  P       NP+ 
Sbjct  286   DPSSLWINDPSSTTIEVKDPVNMTPVTSAPTSTSTQPVSKPIQFESHQPSSSSLSENPSA  345

Query  1669  VETQSNNNNSQ-----LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
             ++ Q +    Q      F R LNFS++G DG   +    ++S S K ESGEIL+FG++  
Sbjct  346   IQLQQSQQQVQQQTQSFFTRELNFSDYGYDG---SSVKNSNSNSLKPESGEILSFGES--  400

Query  1504  KRSACSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs---gvvvpsa  1340
             KRS+ S N  +FSG  Q  AA++NN+  K   R+  SRGSNDEG+LSF S          
Sbjct  401   KRSSYSANGKLFSGHSQIAAAEDNNSKKK---RSPPSRGSNDEGILSFSSGVILPSSGVV  457

Query  1339  ggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQR  1160
                GG   DSDHSDLEASVVRE DSSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQR
Sbjct  458   KSGGGGAADSDHSDLEASVVRETDSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQR  516

Query  1159  REKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKK  980
             REKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELK+KLQT ES +EDL+ QLES+ +
Sbjct  517   REKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKAKLQTVESDKEDLQKQLESMNQ  576

Query  979   ESRHpppppppepPLKLAGkivdid-----vdvkiIGWDAMIRIQCSKKNHPAARLMVAL  815
             +          +  LK++            +DVKIIGWDAMIRIQC KKNHPAARLM +L
Sbjct  577   DLGCKDSSSLSDQDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMASL  636

Query  814   KDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             K+LDLDVHHAS+SVVNDLMIQQATVKMGS +Y Q++LRLAL+S I  +R
Sbjct  637   KELDLDVHHASISVVNDLMIQQATVKMGSRIYTQDQLRLALSSKIGDSR  685



>gb|KDP34321.1| hypothetical protein JCGZ_12669 [Jatropha curcas]
Length=674

 Score =   330 bits (847),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 254/408 (62%), Positives = 290/408 (71%), Gaps = 37/408 (9%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNT------NVQGNSFPSSITKQIVFGNENPNPAT-----  1670
             D S+LW++DP   G E+KD  +T      N   NS   + +K I  GN N +  T     
Sbjct  271   DTSSLWISDPSQSGIEMKDGNSTVPSSVCNNTNNSNNQNGSKGIPLGNPNSSSLTETPNM  330

Query  1669  ------VETQSNNNNSQLFPRGLNFSEF-GLDGGGAAVRNETSSLSCKRESGEILNFGDN  1511
                      Q        F R LNF ++ G DG  A  RN  S+L  K ESGEILNFG++
Sbjct  331   QQNHQQQNQQQMTQTQSFFTRELNFGDYSGFDGSSA--RNGNSNL-LKPESGEILNFGES  387

Query  1510  AVKRSACSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv--vvps  1343
               KRS+CS N   FSG  QF A D NNNN+  KKR+ TSRGSN+EGMLSF SGV      
Sbjct  388   --KRSSCSANGNFFSGHSQFTAEDNNNNNSNKKKRSPTSRGSNEEGMLSFTSGVILPSSG  445

Query  1342  aggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQ  1163
                + G TGDSDHSDLEASVVRE DSSRV+ EPEKRP+KRGRKPANGREEPLNHVEAERQ
Sbjct  446   VVKSSGGTGDSDHSDLEASVVRETDSSRVI-EPEKRPRKRGRKPANGREEPLNHVEAERQ  504

Query  1162  RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK  983
             RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI EL++KLQTAES +E+L+ Q+ESIK
Sbjct  505   RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIKELRTKLQTAESEKEELEKQVESIK  564

Query  982   KE-----SRHpppppppepPLKLAGki-vdidvdvkiIGWDAMIRIQCSKKNHPAARLMV  821
             KE     SR  PPPP  E  +   G   +++D+DVKIIGWDAMIRIQC KKNHPAARLM 
Sbjct  565   KEFASKDSRPGPPPPDQELKMSSGGSKLIEMDIDVKIIGWDAMIRIQCCKKNHPAARLMA  624

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             ALK+LDLDVHHASVSVVNDLMIQQATVKMGS  Y QE+LRLAL++ + 
Sbjct  625   ALKELDLDVHHASVSVVNDLMIQQATVKMGSRFYTQEQLRLALSTKVG  672



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score =   328 bits (842),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 277/386 (72%), Gaps = 19/386 (5%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQLFP  1628
             DPSALWLTDP   V ++ ++ +      SS   Q+VFGNEN    T   Q +      F 
Sbjct  274   DPSALWLTDPSSSVVEAKDSLINS----SSRDVQLVFGNENSENGTQNQQHSQQTQGFFT  329

Query  1627  RGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQFPAA  1448
             + LNFS +G DG     +N  SS+SCK E+ EILNFGD++ K  +     + F       
Sbjct  330   KELNFSGYGFDGSSTRNKNGNSSISCKPETREILNFGDSSKKSGSLFSGQSQFGPGTGLG  389

Query  1447  DEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvv-psaggaggatgdsdhsDLEASVVREA  1271
                 N N NKKR+  SRG+N++GMLSFVSGV++  S  G  G  G+ DHSDLEASVV+EA
Sbjct  390   LMEENKNNNKKRSLASRGNNEKGMLSFVSGVILPTSTMGKSGGGGNFDHSDLEASVVKEA  449

Query  1270  DSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  1091
                  +VEPE++P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK
Sbjct  450   -----IVEPERKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  504

Query  1090  ASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-----SRHpppppppepPLKLA  926
             ASLLGDAI+YINELKSK+Q ++  +E+L++Q+ES++KE     S +    PP    LK+ 
Sbjct  505   ASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSSPPSNQDLKIV  564

Query  925   GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQA  746
                 D+D+DVK+IGWDAMIRIQCSKKNHPAARLM ALKDLDLDVHHASVSVVNDLMIQQA
Sbjct  565   ----DMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDLMIQQA  620

Query  745   TVKMGSHVYNQEELRLALTSSIAANR  668
             TVKMGS +Y QE+L +ALTS  A +R
Sbjct  621   TVKMGSRLYAQEQLTIALTSKFAESR  646



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score =   327 bits (839),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 239/396 (60%), Positives = 286/396 (72%), Gaps = 35/396 (9%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQLFP  1628
             DPSALWLTDP   V ++ ++ +      SS   Q+VF NEN    T   Q +      F 
Sbjct  274   DPSALWLTDPSSSVVEAKDSLINS----SSRDVQLVFVNENSENGTQNQQHSQQTQGFFT  329

Query  1627  RGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQ----  1460
             + LNFS +G DG     +N  SS+SCK E+ EILNFGD++ KRS      ++FSGQ    
Sbjct  330   KELNFSGYGFDGSSTRNKNGNSSISCKPETREILNFGDSS-KRSG-----SLFSGQSQFG  383

Query  1459  ------FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvv-psaggaggatgdsdhs  1301
                       ++N NNN NKKR+  SRG+N+EGMLSFVSGV++  S  G  G  GDSDHS
Sbjct  384   PGTGLGLMEENKNKNNNNNKKRSLASRGNNEEGMLSFVSGVILPTSTMGKSGGGGDSDHS  443

Query  1300  DLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRA  1121
             DLEASVV+EA     +VEPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA
Sbjct  444   DLEASVVKEA-----IVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  498

Query  1120  VVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-----SRHpppp  956
             VVPNVSKMDKASLLGDAI+YINELKSK+Q ++  +E+L++Q+ES++KE     S +    
Sbjct  499   VVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSS  558

Query  955   pppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVS  776
             PP    LK+     D+D+DVK+IGWDAMIRIQCSKKNHPAARLM ALKDLDLDVHHASVS
Sbjct  559   PPSNQDLKIV----DMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVS  614

Query  775   VVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             VVNDLMIQQATVKMGS +Y QE+L +ALTS  A +R
Sbjct  615   VVNDLMIQQATVKMGSRLYAQEQLTIALTSKFAESR  650



>ref|XP_002519814.1| Transcription factor AtMYC2, putative [Ricinus communis]
 gb|EEF42418.1| Transcription factor AtMYC2, putative [Ricinus communis]
Length=663

 Score =   327 bits (839),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 244/402 (61%), Positives = 281/402 (70%), Gaps = 41/402 (10%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNT-------NVQGNSFPSSITKQIVFGNENPNPATVE--  1664
             DPS+LW++DP   G E+KD  +T        V  NS   S   Q V    NPN + V   
Sbjct  276   DPSSLWISDPSQSGIEIKDGNSTVPSSGVGGVNNNSQHGSKGIQSV----NPNSSCVTDN  331

Query  1663  ---TQSNNNNSQLFPRGLNFSEF-GLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
                T   N     F R LNF E+ G DG     RN  +++  K ESGEILNFG++  KRS
Sbjct  332   PSGTHMQNQQQSFFTRELNFGEYNGFDG-----RNGNTNV-LKPESGEILNFGES--KRS  383

Query  1495  ACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vpsaggagga  1322
             + S N  +F G    A E  N  K   R+ TSRGSN+EGMLSF SGVV        + G 
Sbjct  384   SYSANGNLFPGHSQFATEEKNTKK---RSPTSRGSNEEGMLSFTSGVVLPSSGGVKSSGG  440

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
             TGDSDHSDLEASVVRE +SSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  441   TGDSDHSDLEASVVRETESSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  499

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE---SR  971
             RFYALRAVVPNVSKMDKASLLGDAISYI EL++KLQTAES +E+L+ ++ES+KKE     
Sbjct  500   RFYALRAVVPNVSKMDKASLLGDAISYIKELRTKLQTAESDKEELEKEVESMKKEFLSKD  559

Query  970   HpppppppepPLKLAGkivdidvdv----kiIGWDAMIRIQCSKKNHPAARLMVALKDLD  803
               P  PPP+  LK++       +D+    KIIGWDAMIRIQCSKKNHPAARLM ALKDLD
Sbjct  560   SRPGSPPPDKELKMSNNHGSKAIDMDIDVKIIGWDAMIRIQCSKKNHPAARLMAALKDLD  619

Query  802   LDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             LDVHHASVSVVNDLMIQQATVKMGS +Y QE+LRLAL++ + 
Sbjct  620   LDVHHASVSVVNDLMIQQATVKMGSRIYTQEQLRLALSTKVG  661



>ref|XP_007210309.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
 gb|EMJ11508.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
Length=676

 Score =   327 bits (838),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 236/411 (57%), Positives = 282/411 (69%), Gaps = 39/411 (9%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVN----TNVQGNSFPSSITKQIVFGNENP-------NPAT  1670
             DPS+LW+ DP     EVKD VN    T+   ++    ++K I F +  P       NP+ 
Sbjct  274   DPSSLWINDPSSTTIEVKDPVNMAPVTSAPTSTSTQPVSKPIQFESHQPSSSSLSENPSA  333

Query  1669  VETQSNNNNSQ-------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDN  1511
             ++ Q +    Q        F R LNFS++G DG  +   + ++S S K ESGEIL+FG++
Sbjct  334   IQLQQSQQQQQVQQQTQSFFTRELNFSDYGYDGS-SGKNSNSNSHSLKPESGEILSFGES  392

Query  1510  AVKRSACSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs---gvvvp  1346
               KRS+ S N  +FSG  Q  AA++NN+  K   R+ TSRGSNDEG+LSF S        
Sbjct  393   --KRSSYSANGKLFSGHSQIAAAEDNNSKKK---RSPTSRGSNDEGILSFSSGVILPSSG  447

Query  1345  saggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAER  1166
                  GG   DSDHSDLEASVVRE DSSRVV +PEKRP+KRGRKPANGREEPLNHVEAER
Sbjct  448   VVKSGGGGAADSDHSDLEASVVRETDSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAER  506

Query  1165  QRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESI  986
             QRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELK+KLQT ES +EDL+ QLES+
Sbjct  507   QRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKAKLQTTESDKEDLQKQLESM  566

Query  985   KKESRHpppppppepPLKLAGkivdid-----vdvkiIGWDAMIRIQCSKKNHPAARLMV  821
              ++             LK++            +DVKIIGWDAMIRIQC KKNHPAARLM 
Sbjct  567   NQD-LGCKDSSSLSDDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMA  625

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             +LK+LDLDVHHAS+SVVNDLMIQQATVKMGS +Y Q++LRLAL S I  +R
Sbjct  626   SLKELDLDVHHASISVVNDLMIQQATVKMGSRIYTQDQLRLALLSKIGDSR  676



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score =   323 bits (827),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 232/387 (60%), Positives = 277/387 (72%), Gaps = 37/387 (10%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQLFP  1628
             DPSALWLTDP   V +  ++ +      SS   Q+V+GNEN        Q        F 
Sbjct  274   DPSALWLTDPSSSVVEPKDSLIHS----SSRDVQLVYGNENSENQQQHCQG------FFT  323

Query  1627  RGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQFPAA  1448
             + LNFS +G DG  ++ RN+T  +SCK ES EILNFGD++ +          FSGQ    
Sbjct  324   KELNFSGYGFDG--SSNRNKTG-ISCKPESREILNFGDSSKR----------FSGQSQLG  370

Query  1447  ------DEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEAS  1286
                   +EN N NKNKKR+  SRG+N+EGMLSFVSGV++P++        D     LEAS
Sbjct  371   PGPGLMEENKNKNKNKKRSLGSRGNNEEGMLSFVSGVILPTSTMGKSGDSDHSD--LEAS  428

Query  1285  VVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  1106
             VV+EA     VVEPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV
Sbjct  429   VVKEA-----VVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  483

Query  1105  SKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-SRHpppppppepPLKL  929
             SKMDKASLLGDAI+YINELKSK+Q ++  +E+L++Q+E ++KE +          PPL  
Sbjct  484   SKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIECLRKELTNKGSSNYSASPPLNQ  543

Query  928   AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQ  749
               KIVD+D+DVK+IGWDAMIRIQCSKKNHPAARLM ALKDLDLDVHHASVSVVNDLMIQQ
Sbjct  544   DVKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDLMIQQ  603

Query  748   ATVKMGSHVYNQEELRLALTSSIAANR  668
             ATVKMGS +Y QE+LR+ALTS IA +R
Sbjct  604   ATVKMGSRLYAQEQLRIALTSKIAESR  630



>ref|XP_009344509.1| PREDICTED: transcription factor MYC2-like, partial [Pyrus x bretschneideri]
Length=461

 Score =   317 bits (812),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 236/404 (58%), Positives = 277/404 (69%), Gaps = 30/404 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSN-----  1652
             DPS+ WL DP     E KD VNT+   N+    I+K   F N   + +  E  S      
Sbjct  62    DPSSFWLNDPSTTIMEAKDPVNTSATTNTSNQLISKLAQFDNHPSSSSLSENPSPIQVPQ  121

Query  1651  --------NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
                           F   LNFS++    G +   + ++S S K ESGEILNFG++  KRS
Sbjct  122   LQQQVQQQQQTQSFFTMELNFSDYDGYDGSSVKNSNSNSHSLKPESGEILNFGES--KRS  179

Query  1495  ACSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvv-psaggagg  1325
             + S N  +FSG  Q  AA++NN+  K   R+  SRGSNDEG+LSF SGV++  S      
Sbjct  180   SYSANGKLFSGHSQITAAEDNNSKKK---RSPPSRGSNDEGILSFSSGVILPSSCVVKSS  236

Query  1324  atgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLN  1145
                DSDHSDLEASVVREADSSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  237   GGADSDHSDLEASVVREADSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  295

Query  1144  QRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK-----K  980
             QRFYALRAVVPNVSKMDKASLLGDAISYINELK KLQT E+ +E+L+ QLES+      K
Sbjct  296   QRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCK  355

Query  979   ESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDL  800
             +SR        E     + K++D+D+DVKIIG DAMIRIQC KKNHPAARLM ALK+LD+
Sbjct  356   DSRSSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDM  415

Query  799   DVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             DVHHASVSVVNDLMIQQATVKMGS +Y Q+ LRLAL S +  NR
Sbjct  416   DVHHASVSVVNDLMIQQATVKMGSRIYTQDHLRLALHSKVGENR  459



>gb|EYU44086.1| hypothetical protein MIMGU_mgv1a002808mg [Erythranthe guttata]
Length=635

 Score =   321 bits (822),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 235/391 (60%), Positives = 275/391 (70%), Gaps = 26/391 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGPEV--KDSVNTNVQGN----SFPSSIT-KQIVFGNENPNPATVETQSN-  1652
             DP+ALWLTDP      KDS N     N    S P SIT KQ+ FGNENPNP +     N 
Sbjct  258   DPAALWLTDPSSSTMDKDSFNNINNNNTTTNSVPCSITSKQVAFGNENPNPCSSTLTDNP  317

Query  1651  ----NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSG  1484
                  NN     R LNFSEFG  G  + VRN   +  CKRESGEILNFG+ ++K S    
Sbjct  318   HNQTTNNPGYLNRELNFSEFGAHGS-SNVRN---AGLCKRESGEILNFGE-SIKTSPFGA  372

Query  1483  NDAIFSGQFPAADEnnnnnknkKRTT-TSRGSNDEGMLSFvsgvvvpsaggaggatgdsd  1307
                   G+    + +NNNNKNKK+T+ TSRGSNDEGMLSF SG+V    GG G    D  
Sbjct  373   Q-----GENNNNNNSNNNNKNKKKTSPTSRGSNDEGMLSFTSGMVKNGGGGGGVVDSDQS  427

Query  1306  hsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYAL  1127
                LEASVV+E +SSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYAL
Sbjct  428   D--LEASVVKEVESSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  484

Query  1126  RAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHppppppp  947
             RAVVPNVSKMDKASLLGDAI+YINELKSKLQ  E  +++L+ QLES     +        
Sbjct  485   RAVVPNVSKMDKASLLGDAIAYINELKSKLQNVELDKDELRRQLESSSSSMQKKKDKEYS  544

Query  946   epPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVN  767
                 + +  IVD+++DVKIIGWDAMIR+QCSKKNHPAA++MVAL++LDLDVHHASVSVVN
Sbjct  545   SAKEESSKGIVDMEIDVKIIGWDAMIRVQCSKKNHPAAKMMVALRELDLDVHHASVSVVN  604

Query  766   DLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             DLMIQQATVKM    ++Q++LR AL S + +
Sbjct  605   DLMIQQATVKMEGRFFSQDQLRAALISKLVS  635



>ref|XP_010104300.1| hypothetical protein L484_023250 [Morus notabilis]
 gb|EXB99720.1| hypothetical protein L484_023250 [Morus notabilis]
Length=683

 Score =   320 bits (819),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 235/412 (57%), Positives = 276/412 (67%), Gaps = 44/412 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGP--EVKDSVNTNVQGNSFPSSITKQIVFGN--------ENPN-------  1679
             DPS+ W+++P    E+KDS N +   N   SS +  + F N        ENP+       
Sbjct  284   DPSSFWISEPSSAVELKDSANPSSNTNQQISSKSTVVQFENNPSSSSLTENPSATAAVAA  343

Query  1678  -------PATVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNF  1520
                    P    T +NN     F R LNFSE+G DG         S  + K ESGEILNF
Sbjct  344   AAGSIQKPNGNSTNNNNQTQSFFTRELNFSEYGFDGNSV-----KSGGNLKPESGEILNF  398

Query  1519  GDNAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv---vv  1349
             G++  KRS  S N  +F+ Q P A         KKR+ TSRGS++EGMLSF SGV     
Sbjct  399   GES--KRS--SNNGGLFANQTPFA--VVEETNKKKRSPTSRGSHEEGMLSFTSGVILPSS  452

Query  1348  psaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAE  1169
                  +   T DSD+SDLEASVVREADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAE
Sbjct  453   GVMKSSNNGTADSDNSDLEASVVREADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAE  511

Query  1168  RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLES  989
             RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ AES +EDL+ Q++S
Sbjct  512   RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQGAESDKEDLQKQIDS  571

Query  988   IKKESRHpppppppepPLKLAGkivdid-----vdvkiIGWDAMIRIQCSKKNHPAARLM  824
             +K+ +      PP +P L ++            +DVKIIGWDAMIR+QCSKKNHPAAR M
Sbjct  572   VKELAGKDSSRPPTDPDLSMSNHHGSSKLIDLDIDVKIIGWDAMIRMQCSKKNHPAARFM  631

Query  823   VALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
              ALK+LDLDV+HASVSVVNDLMIQQATVKMGS  Y Q++LRLAL++ +   R
Sbjct  632   SALKELDLDVNHASVSVVNDLMIQQATVKMGSRFYTQDQLRLALSAKVGDAR  683



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score =   315 bits (808),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 237/404 (59%), Positives = 279/404 (69%), Gaps = 30/404 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSN-----  1652
             DPS+ WL DP     E KD VNT+   N+    I+K   F N   + +  E  S      
Sbjct  288   DPSSFWLNDPSTTTMEAKDPVNTSATTNTSNQLISKPAQFDNHPSSSSLSENPSPIQVPQ  347

Query  1651  --------NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
                           F   LNFS +    G +   + ++S S K ESGEILNFG++  KRS
Sbjct  348   LQQQVQQQQQTQSFFTMELNFSNYDGYDGSSVKNSNSNSHSLKPESGEILNFGES--KRS  405

Query  1495  ACSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagga  1322
             + S N  +FSG  Q  AA++NN+  K   R+  SRGSNDEG+LSF SGV++PS+     +
Sbjct  406   SYSANGKLFSGHSQITAAEDNNSKKK---RSPPSRGSNDEGILSFSSGVILPSSCVVKSS  462

Query  1321  t-gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLN  1145
                DSDHSDLEASVVREADSSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  463   GGADSDHSDLEASVVREADSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  521

Query  1144  QRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK-----K  980
             QRFYALRAVVPNVSKMDKASLLGDAISYINELK KLQT E+ +E+L+ QLES+      K
Sbjct  522   QRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCK  581

Query  979   ESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDL  800
             +SR        E     + K++D+D+DVKIIG DAMIRIQC KKNHPAARLM ALK+LD+
Sbjct  582   DSRSSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDM  641

Query  799   DVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             DVHHASVSVVNDLMIQQATVKMGS +Y Q+ LRLAL S +  NR
Sbjct  642   DVHHASVSVVNDLMIQQATVKMGSRIYTQDHLRLALHSKVGENR  685



>ref|XP_010058170.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
Length=699

 Score =   315 bits (807),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 242/415 (58%), Positives = 280/415 (67%), Gaps = 52/415 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGP--EVKDSV---------NTNVQGNSFPSSITKQIVFGN--------EN  1685
             DPS+LWL DP    EVKDS          ++N  G++  S   K I   N        E 
Sbjct  299   DPSSLWLNDPAGTVEVKDSAVAGAAAVTGSSNYNGSNHGS---KSIQLENNHVLSSMGEK  355

Query  1684  P------NPATVETQSNNN--NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
             P      NP     QSN        F R LNFSEFG DG  ++ RN  S    K ESGEI
Sbjct  356   PTAIHRDNPRHNYPQSNQQMQGQSFFTRELNFSEFGFDG--SSARNGNSH-PMKPESGEI  412

Query  1528  LNFGDNAVKRSACSGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv  1355
             L+FG++  KR +C+GN  ++SGQ    A +E+        R+ TSRGSN+EGMLSF SGV
Sbjct  413   LSFGES--KRVSCNGNGNLYSGQSQLTAVEESKKR-----RSPTSRGSNEEGMLSFTSGV  465

Query  1354  v--vpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNH  1181
             V        + G  GDSDHSDLEASVV+EADSSRV+ EPEKRP+KRGRKPANGREEPLNH
Sbjct  466   VLPSSGMVKSSGGAGDSDHSDLEASVVKEADSSRVI-EPEKRPRKRGRKPANGREEPLNH  524

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI EL SKLQT ES +E+L+ 
Sbjct  525   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQK  584

Query  1000  QLESIKKE-----SRHpppppppepPLK--LAGkivdidvdvkiIGWDAMIRIQCSKKNH  842
             Q+ES+KKE     SR   P    +  +      K++++DVDVKIIGWD MIRIQ SKKNH
Sbjct  585   QMESLKKELTNKDSRSALPQSDKDLSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNH  644

Query  841   PAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             PAA+LM AL +LDLDVHHASVSVVNDLMIQQATVKM    Y QE+LRLAL+S I 
Sbjct  645   PAAKLMQALMELDLDVHHASVSVVNDLMIQQATVKMSGRFYTQEQLRLALSSKIG  699



>gb|KCW71784.1| hypothetical protein EUGRSUZ_E00277 [Eucalyptus grandis]
Length=713

 Score =   315 bits (807),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 242/415 (58%), Positives = 280/415 (67%), Gaps = 52/415 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGP--EVKDSV---------NTNVQGNSFPSSITKQIVFGN--------EN  1685
             DPS+LWL DP    EVKDS          ++N  G++  S   K I   N        E 
Sbjct  313   DPSSLWLNDPAGTVEVKDSAVAGAAAVTGSSNYNGSNHGS---KSIQLENNHVLSSMGEK  369

Query  1684  P------NPATVETQSNNN--NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
             P      NP     QSN        F R LNFSEFG DG  ++ RN  S    K ESGEI
Sbjct  370   PTAIHRDNPRHNYPQSNQQMQGQSFFTRELNFSEFGFDG--SSARNGNSH-PMKPESGEI  426

Query  1528  LNFGDNAVKRSACSGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv  1355
             L+FG++  KR +C+GN  ++SGQ    A +E+        R+ TSRGSN+EGMLSF SGV
Sbjct  427   LSFGES--KRVSCNGNGNLYSGQSQLTAVEESKKR-----RSPTSRGSNEEGMLSFTSGV  479

Query  1354  v--vpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNH  1181
             V        + G  GDSDHSDLEASVV+EADSSRV+ EPEKRP+KRGRKPANGREEPLNH
Sbjct  480   VLPSSGMVKSSGGAGDSDHSDLEASVVKEADSSRVI-EPEKRPRKRGRKPANGREEPLNH  538

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YI EL SKLQT ES +E+L+ 
Sbjct  539   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQK  598

Query  1000  QLESIKKE-----SRHpppppppepPLK--LAGkivdidvdvkiIGWDAMIRIQCSKKNH  842
             Q+ES+KKE     SR   P    +  +      K++++DVDVKIIGWD MIRIQ SKKNH
Sbjct  599   QMESLKKELTNKDSRSALPQSDKDLSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNH  658

Query  841   PAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             PAA+LM AL +LDLDVHHASVSVVNDLMIQQATVKM    Y QE+LRLAL+S I 
Sbjct  659   PAAKLMQALMELDLDVHHASVSVVNDLMIQQATVKMSGRFYTQEQLRLALSSKIG  713



>gb|AHN63211.1| transcription factor MYC2 [Salvia miltiorrhiza f. alba]
Length=592

 Score =   311 bits (798),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 263/382 (69%), Gaps = 57/382 (15%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVE-TQSNNNNSQ-L  1634
             DPSALWLTDP     D +NT         S T  I F NENPNP++   T+S N  SQ  
Sbjct  266   DPSALWLTDPSSSTAD-INT---------SATLPIKF-NENPNPSSSSLTESPNVQSQGF  314

Query  1633  FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQFP  1454
             F + LNFSE G        RN   S++CKRESGEILNFG++A KRS     D +   +  
Sbjct  315   FNKELNFSEIGF-------RN---SVNCKRESGEILNFGESA-KRS-----DVVVVKE--  356

Query  1453  AADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVRE  1274
                              S  + +EGMLSF SGV++ +      +        LEASVV+E
Sbjct  357   -------------SKKRSPMAAEEGMLSFTSGVLLKADNNTIESDHSD----LEASVVKE  399

Query  1273  ADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  1094
             ADSSRVV  PEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD
Sbjct  400   ADSSRVV-NPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  458

Query  1093  KASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkiv  914
             KASLLGDAI+YINELKSK+Q AES +++L+++LES+K+ +  P P          A   +
Sbjct  459   KASLLGDAIAYINELKSKVQNAESDKDELRSELESLKRATPAPAP--------APAPAKI  510

Query  913   didvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKM  734
             D+D+DVKIIGWDAMIR+QCSKKNHPAA+LMVAL++LDLDVHHASVSVV DLMIQQATVKM
Sbjct  511   DMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVVKDLMIQQATVKM  570

Query  733   GSHVYNQEELRLALTSSIAANR  668
                +Y QE+LRLAL S +A +R
Sbjct  571   EGRLYTQEQLRLALISKVAESR  592



>gb|AIO09733.1| transcription factor MYC2 [Salvia miltiorrhiza]
Length=602

 Score =   309 bits (792),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 263/382 (69%), Gaps = 55/382 (14%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVE-TQSNNNNSQ-L  1634
             DPSALWLTDP     D +NT         S T  I F NENPNP++   T+S N  SQ  
Sbjct  274   DPSALWLTDPSSSTAD-INT---------SATLPIKF-NENPNPSSSSLTESPNVQSQGF  322

Query  1633  FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQFP  1454
             F + LNFSE G        RN   S++CKRESGEILNFG++A KRS     D +   +  
Sbjct  323   FNKELNFSEIGF-------RN---SVNCKRESGEILNFGESA-KRS-----DVVVVKE--  364

Query  1453  AADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVRE  1274
                              S  + +EGMLSF SGV++ +      +        LEASVV+E
Sbjct  365   -------------SKKRSPMAAEEGMLSFTSGVLLKADNNTIESDHSD----LEASVVKE  407

Query  1273  ADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  1094
             ADSSRVV  PEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD
Sbjct  408   ADSSRVV-NPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD  466

Query  1093  KASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkiv  914
             KASLLGDAI+YINELKSK+Q AES +++L+++LES+K+ +  P P P        A   +
Sbjct  467   KASLLGDAIAYINELKSKVQNAESDKDELRSELESLKRATPAPAPAP------APAPAKI  520

Query  913   didvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKM  734
             D+D+DVKIIGWDAMIR+QCSKKNHPAA+LMVAL++LDLDVHHASVSVV DLMIQQATVKM
Sbjct  521   DMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVVKDLMIQQATVKM  580

Query  733   GSHVYNQEELRLALTSSIAANR  668
                +Y QE+LRLAL S +A  R
Sbjct  581   EGRLYTQEQLRLALISKVAEIR  602



>ref|XP_008341963.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=688

 Score =   311 bits (796),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 282/406 (69%), Gaps = 32/406 (8%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSN-----  1652
             DPS+LWL DP     E+KD VNT+   N+    I+K + F N   + +  E  S      
Sbjct  287   DPSSLWLNDPSTTTMEMKDPVNTSATTNTSNQLISKPVQFDNHPSSSSLSENPSPIQVPQ  346

Query  1651  --------NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLS--CKRESGEILNFGDNAVK  1502
                           F   LNFS++ +  G +   + ++S S   K ESGEILNFG++  K
Sbjct  347   LQQQVQQQQQTQSFFTGELNFSDYNVYDGSSVKNSNSNSNSHSLKPESGEILNFGES--K  404

Query  1501  RSACSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggag  1328
             RS+ S N  +F G  Q  AA++NN+  K   R+  SRGSNDEG+LSF SGV++PS+    
Sbjct  405   RSSYSANGKLFLGHSQMTAAEDNNSKKK---RSPPSRGSNDEGILSFSSGVILPSSCVVK  461

Query  1327  gat-gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREK  1151
              +   DSDHSDLEASVVREADSSRVV + EKRP+KRGRKPANGREEPLNHVEAERQRREK
Sbjct  462   SSGGADSDHSDLEASVVREADSSRVV-DQEKRPRKRGRKPANGREEPLNHVEAERQRREK  520

Query  1150  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK----  983
             LNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK KLQT E+ +E+L+ QLES+     
Sbjct  521   LNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKLKLQTVETDKEELQNQLESMNKDLP  580

Query  982   -KESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDL  806
              K+SR        +     + K++D+D+DVKIIG DAMIRIQC KKNHPAARLM ALK+L
Sbjct  581   CKDSRSSGSIMSEDELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKEL  640

Query  805   DLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             D+DVH+ASVSVVNDLMIQQATVKMGS +Y Q+ LRLAL S +  NR
Sbjct  641   DMDVHYASVSVVNDLMIQQATVKMGSRIYTQDHLRLALHSKVGDNR  686



>ref|XP_007039493.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOY23994.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=669

 Score =   306 bits (783),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 239/403 (59%), Positives = 285/403 (71%), Gaps = 34/403 (8%)
 Frame = -2

Query  1807  DPSALWLTDP--GPEVKDSVNTNVQGNSFPSS--ITKQIVFGNENP-------NPATVET  1661
             DPS+LW+ DP  G E+K+S N +   N+   +  I K I F  +NP       NP+++  
Sbjct  278   DPSSLWINDPNNGIELKESNNNSNNNNTSHQNQQIQKSIQFC-DNPSSSSLTENPSSIHV  336

Query  1660  QSNNNNSQLFPRG---LNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSAC  1490
              ++             LNFS++G DG  +     +SS   K ESGEILNFG++  KRS  
Sbjct  337   GNHQQQQNHQQGHSFCLNFSDYGFDGSSSVRNGNSSSHLLKPESGEILNFGES--KRS--  392

Query  1489  SGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv--vpsaggaggatg  1316
              GN  +FSG      E N       R+ TSRGSN+EGMLSF SGV+        + G  G
Sbjct  393   -GNGNLFSGNSQIGVEENKKK----RSPTSRGSNEEGMLSFTSGVILPSSGVVKSSGGAG  447

Query  1315  dsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRF  1136
             DSDHSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRF
Sbjct  448   DSDHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  506

Query  1135  YALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-----SR  971
             YALRAVVPNVSKMDKASLLGDAISYINEL++KLQ A+S +E+L+ +LE++KKE     SR
Sbjct  507   YALRAVVPNVSKMDKASLLGDAISYINELRTKLQNADSEKEELQKELEAMKKELSSKDSR  566

Query  970   HpppppppepPLK--LAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
               PP P  +  +   L  K+V++++DVKIIGWDAMIRIQC+KKNHPAARLM ALK+LDLD
Sbjct  567   SAPPAPDQDLKMSNHLGNKLVELEIDVKIIGWDAMIRIQCNKKNHPAARLMAALKELDLD  626

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             VHHASVSVVNDLMIQQATVKMGS  Y QE+LR+ALTS     R
Sbjct  627   VHHASVSVVNDLMIQQATVKMGSRFYTQEQLRIALTSKFGDAR  669



>gb|AGQ80897.1| MYC1 [Lithospermum erythrorhizon]
Length=636

 Score =   305 bits (780),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 225/392 (57%), Positives = 266/392 (68%), Gaps = 44/392 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATV-ETQSNNNNSQ--  1637
             DPS  WL DP P         V+G    +++ KQI  GNEN + +T+ E  S+ + +Q  
Sbjct  271   DPSKFWLNDPAPAA-------VKG----TNVCKQIPLGNENNSFSTLTENHSSIDVAQNL  319

Query  1636  -LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGD----NAVKRSACSGNDAI  1472
                 + LNFS FG++G     RN  +  +CK ESGEILNFG+    N   R+   G  ++
Sbjct  320   GHLTKELNFSGFGINGNNC--RNGENENNCKSESGEILNFGESNRSNDGNRNMVYGK-SV  376

Query  1471  FSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLE  1292
             F G+           K KKR+  SRGSNDEGMLSF S +V  S   A     D      E
Sbjct  377   FGGE--------GEIKAKKRSLASRGSNDEGMLSFTSAMVKSSGCVADSYDSDH-----E  423

Query  1291  ASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  1112
             ASVV+EA+SS V V+PEKRP+KRGRKPANGR EPLNHVEAERQRREKLNQRFYALRAVVP
Sbjct  424   ASVVKEAESSMVAVDPEKRPRKRGRKPANGRLEPLNHVEAERQRREKLNQRFYALRAVVP  483

Query  1111  NVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKK-------ESRHppppp  953
             NVSKMDKASLL DAISYI ELKSKLQ +ESA+EDLK+Q+E +KK       ESR    PP
Sbjct  484   NVSKMDKASLLADAISYITELKSKLQKSESAREDLKSQVEFLKKDLSSSTKESRKGSAPP  543

Query  952   ppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSV  773
                       KIVDID+DVKIIGWDAMIRIQ SK+NHPAA+LM AL++ DL+VHHASVSV
Sbjct  544   TSRGTKNT--KIVDIDIDVKIIGWDAMIRIQSSKRNHPAAKLMAALQEHDLEVHHASVSV  601

Query  772   VNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             VNDLMIQQATVKMG  ++ QE+LR ALTS +A
Sbjct  602   VNDLMIQQATVKMGGRIFTQEQLRSALTSRVA  633



>ref|XP_008373574.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=689

 Score =   303 bits (776),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 233/404 (58%), Positives = 278/404 (69%), Gaps = 31/404 (8%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ  1637
             DPS LWL DP     EVKD VN +   ++    I+K I F N   + +  E  S     Q
Sbjct  291   DPS-LWLNDPSTTTMEVKDPVNASAPTSTSNQPISKPIQFDNHPSSSSLSENPSPVQVPQ  349

Query  1636  -------------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
                           F R LNFS++      +   + ++S S K ESGEILNFG++  KRS
Sbjct  350   LQQQVQQQQQTQSFFTRELNFSDYNGYDRSSVKNSXSNSHSLKPESGEILNFGES--KRS  407

Query  1495  ACSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagga  1322
             + S N  +FSG  Q  AA++NN+  K   R+  S GSN+EG+LSF SGV++PS+G    +
Sbjct  408   SYSANGKLFSGHSQIAAAEDNNSKKK---RSPPSLGSNEEGILSFSSGVILPSSGVGKSS  464

Query  1321  -tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLN  1145
                DSDHSDLEASVVREADSSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  465   GVADSDHSDLEASVVREADSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  523

Query  1144  QRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SR  971
             QRFYALRAVVPNVSKMDKASLLGDAISYINELK KLQT E+ +E+L+ QLES+ K+  S+
Sbjct  524   QRFYALRAVVPNVSKMDKASLLGDAISYINELKXKLQTVETDKEELQKQLESMNKDLPSK  583

Query  970   HpppppppepPLKLAGkivd---idvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDL  800
                         ++ G       +D+DVKIIG DAMIRIQC KKNHPAARLM ALK+LDL
Sbjct  584   DSRSSGSTVXEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDL  643

Query  799   DVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             +VHHASVSVVNDLMIQQATVK GS +Y Q++LRLAL S +   R
Sbjct  644   EVHHASVSVVNDLMIQQATVKAGSRIYTQDQLRLALHSKVGDAR  687



>ref|XP_004300239.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=682

 Score =   303 bits (775),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 229/410 (56%), Positives = 280/410 (68%), Gaps = 38/410 (9%)
 Frame = -2

Query  1807  DPSALWLTD-PGPE---VKDSVNTNVQGNSFPSS----ITKQ-IVFGNENP-------NP  1676
             DPS+LW+ D P      VK+SVN      S PS+    I+K  I F N +P       NP
Sbjct  281   DPSSLWINDNPSSTIEVVKESVNI-APATSGPSTSNHHISKNPIPFDNNHPSSSGLSDNP  339

Query  1675  ATV----------ETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEIL  1526
             + V            Q        F R LNFS++    G +   + ++S S K ESGEIL
Sbjct  340   SAVLQVSHHQQQQPQQQVTQTQSFFTRELNFSDYNGYDGSSVKNSNSNSHSMKPESGEIL  399

Query  1525  NFGDNAVKRSACSGNDA-IFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv--  1355
             NFG++  KR++ S N+  +FS Q   A E+ N  K   R+ +SRGS +EG+LSF SGV  
Sbjct  400   NFGES--KRTSYSANNGKLFSAQSQIAAEDTNKKK---RSPSSRGS-EEGILSFTSGVIL  453

Query  1354  -vvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHV  1178
                     +     DSDHSDLEASV +EADSSRVV +PEKRP+KRGRKPANGREEPLNHV
Sbjct  454   PSSSGVVKSSAGPADSDHSDLEASVAKEADSSRVV-DPEKRPRKRGRKPANGREEPLNHV  512

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELK+KLQT ES +ED++ Q
Sbjct  513   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQTTESDKEDMQKQ  572

Query  997   LESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVA  818
             +E++ KE +        +  LK + K++D+D+DVKI+GWDA I+IQCSKKNHPAARLM A
Sbjct  573   VETLSKELQESRSCSGLDQELKGSTKLIDLDIDVKILGWDARIQIQCSKKNHPAARLMAA  632

Query  817   LKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             L +LDLDVHHASVSVVNDLMIQQATV+MGS +Y QE+LRLAL++ +   R
Sbjct  633   LMELDLDVHHASVSVVNDLMIQQATVRMGSRIYTQEQLRLALSAKVGDAR  682



>gb|ADL36595.1| BHLH domain class transcription factor [Malus domestica]
Length=691

 Score =   303 bits (775),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 230/403 (57%), Positives = 273/403 (68%), Gaps = 30/403 (7%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ  1637
             DPS LWL DP     EVKD VN +   ++    I+K I F N   + +  E  S     Q
Sbjct  294   DPS-LWLNDPSTTTMEVKDPVNASAPTSTSNQPISKPIQFDNHPSSSSLSENPSPVQVPQ  352

Query  1636  ------------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSA  1493
                          F R LNFS++      +   + ++S S K ESGEILNFG++  KRS+
Sbjct  353   LQQQVQQQQTQSFFTRELNFSDYNGYDRSSVKNSNSNSHSLKPESGEILNFGES--KRSS  410

Query  1492  CSGNDAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs-gvvvpsaggagga  1322
              S N  +FSG  Q  AA++NN+  K   R+  S GSN+EG+LSF S  ++  S  G    
Sbjct  411   YSANGKLFSGHSQIAAAEDNNSKKK---RSPPSLGSNEEGILSFSSGVILPSSGVGKSSG  467

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
               DSDHSDLEASVVREADSSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  468   GADSDHSDLEASVVREADSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  526

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SRH  968
             RFYALRAVVPNVSKMDKASLLGDAISYINELK KLQT E+ +E+L+ QLES+ K+  S+ 
Sbjct  527   RFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNKDLPSKD  586

Query  967   pppppppepPLKLAGkivd---idvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
                        ++ G       +D+DVKIIG DAMIRIQC KKNHPAARLM ALK+LDL+
Sbjct  587   SRSSGSTMSEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLE  646

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             VHHASVSVVNDLMIQQATVK GS +Y Q++LRLAL S +   R
Sbjct  647   VHHASVSVVNDLMIQQATVKAGSRIYTQDQLRLALHSKVGDAR  689



>gb|EPS57820.1| hypothetical protein M569_16997, partial [Genlisea aurea]
Length=562

 Score =   298 bits (762),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 220/388 (57%), Positives = 260/388 (67%), Gaps = 46/388 (12%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSS----ITKQIVFGNENPNPATVETQSNNNNS  1640
             DP+ALWLTD                  PSS      +Q+VFGNENP          +N+ 
Sbjct  210   DPAALWLTD-----------------HPSSSGVEAKQQMVFGNENPKSMA------DNSI  246

Query  1639  QLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQ  1460
              L  R LNFS+F   G  AA    T+   CK ESGEILNFG+      A S    +F+ Q
Sbjct  247   FLSSRDLNFSDFRFGGSIAATMKNTAP-PCKPESGEILNFGE------ATSTKTNLFTPQ  299

Query  1459  FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagga-------tgdsdhs  1301
                 + N   +K KKR+  SRGSN+EG+LSF S V+ PS+ G               DHS
Sbjct  300   --PDNNNTTVSKTKKRSPQSRGSNEEGILSFTSAVIAPSSSGIPKTDNTGGCNVESDDHS  357

Query  1300  DLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRA  1121
             DLEAS+V+ ADSSRV  +PEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA
Sbjct  358   DLEASIVKGADSSRVF-DPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  416

Query  1120  VVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppep  941
             VVPNVSKMDKASLLGDAISYINELKSKLQ +E   ++L++QLES+KKE  H    PP   
Sbjct  417   VVPNVSKMDKASLLGDAISYINELKSKLQNSEMDVDELRSQLESLKKE--HNDSDPPTGY  474

Query  940   PLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
                 A   V +D++VKIIG DAMI++QC K+NHPAA+LM A ++LDLDVHHASVSVVN+L
Sbjct  475   TTASATNNVSVDIEVKIIGRDAMIQVQCGKRNHPAAQLMTAFRELDLDVHHASVSVVNEL  534

Query  760   MIQQATVKMGSHVYNQEELRLALTSSIA  677
             MIQQATVKMGS  + Q+ LRLAL S +A
Sbjct  535   MIQQATVKMGSKYFTQDHLRLALMSKLA  562



>gb|ACO53628.1| bHLH domain protein [Gossypium hirsutum]
Length=674

 Score =   301 bits (770),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 232/401 (58%), Positives = 283/401 (71%), Gaps = 34/401 (8%)
 Frame = -2

Query  1807  DPSALWLTDP--GPEVKDSVNTNVQGNSFPSS---ITKQIVFGN--------ENPN--PA  1673
             DPS+LW++DP  G E K+S NT    N   +      K I F +        ENP+  PA
Sbjct  287   DPSSLWISDPHAGVEFKESSNTTTTTNHTSNQNQQTQKSIQFCDNRSSSSLTENPSSIPA  346

Query  1672  TVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSA  1493
                 Q   ++ Q     LNFS++G D   +     +SS   K ESGEILNFG++  KRS 
Sbjct  347   GNHHQQQQSHQQGQSLCLNFSDYGFDESSSVRNGNSSSHLLKPESGEILNFGES--KRS-  403

Query  1492  CSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagga--t  1319
               GN  +F+G  P A EN        R+  SRGSN+E MLSF SGV++PS+G    +   
Sbjct  404   --GNGNLFTGNSPFAVENKK------RSPNSRGSNEEAMLSFTSGVILPSSGVVKSSGGA  455

Query  1318  gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQR  1139
             GDSDHSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ+
Sbjct  456   GDSDHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQK  514

Query  1138  FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHppp  959
             FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ+A+  +E++++QLE++KK +     
Sbjct  515   FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQSADLEKEEMQSQLEALKK-NLSSKA  573

Query  958   ppppepPLKLAGkivdi----dvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVH  791
             PPP +  LK++    +     +++VKIIGWDAMI+IQCSKKNHPAA+LMVALK+LDLDVH
Sbjct  574   PPPHDQDLKISNHTGNKLIDLEIEVKIIGWDAMIQIQCSKKNHPAAKLMVALKELDLDVH  633

Query  790   HASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             HASVSVV DLMIQQA VKMGS  + QE+L+ ALT+ +   R
Sbjct  634   HASVSVVKDLMIQQANVKMGSRFFTQEQLKSALTTKLGDAR  674



>ref|XP_008465979.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=689

 Score =   301 bits (770),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 232/422 (55%), Positives = 276/422 (65%), Gaps = 54/422 (13%)
 Frame = -2

Query  1807  DPSALWLTDPG--------PEVKDSVNTNVQGNSFP-SSITKQIVFGNENPNPATV----  1667
             DPS+LW+++P         P    S  T    NS P S IT + +   ENPN ++V    
Sbjct  280   DPSSLWISEPSSNAIEITNPVPSASAPTPSTTNSQPISKITTETI---ENPNKSSVVVET  336

Query  1666  --------------ETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
                           ++Q N   S    R LNFSE G + G    RN TS    K ESGEI
Sbjct  337   PSSSVPPPSQKTHRQSQPNQTQSFFTNRELNFSELGFENGRLKDRNSTS---LKPESGEI  393

Query  1528  LNFGDNAVKRSACSGNDAIFSG-QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv  1352
             LNFG++    S  + ++ + SG      DEN        R+ TSRGSN+EGMLSF SGV+
Sbjct  394   LNFGESKRSSSYPNTDNNLPSGNSLFGGDENKKK-----RSPTSRGSNEEGMLSFTSGVI  448

Query  1351  vpsa--ggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHV  1178
             +PS+    +G   GDSDHSDLEASV+RE +SSRVV EPEKRP+KRGRKPANGREEPLNHV
Sbjct  449   LPSSGGVKSGVCAGDSDHSDLEASVIREVESSRVV-EPEKRPRKRGRKPANGREEPLNHV  507

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+ KLQTAES +EDL+ Q
Sbjct  508   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQ  567

Query  997   LESIKKESRHpppppppepPLK------------LAGkivdidvdvkiIGWDAMIRIQCS  854
             L+S+KK                            +    ++ D+DVKII WDAMIRIQ S
Sbjct  568   LDSVKKMMMSSSSKDSCVSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSS  627

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             KKNHPAARLM AL++LDLD++HAS+SVVNDLMIQQATVKMGS +Y QE+LR+AL+S I A
Sbjct  628   KKNHPAARLMAALEELDLDINHASISVVNDLMIQQATVKMGSRLYTQEQLRIALSSKIGA  687

Query  673   NR  668
              R
Sbjct  688   TR  689



>gb|ACN21638.1| putative basic helix-loop-helix protein BHLH22 [Lotus japonicus]
Length=641

 Score =   298 bits (763),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 227/414 (55%), Positives = 271/414 (65%), Gaps = 54/414 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNT---NVQGNSFPS------SITKQIVFGNENPNPATVE---  1664
             DPSALWL DP P+ +DSV+T        S PS      SI K + F  E P  +T+    
Sbjct  242   DPSALWLADPDPDGRDSVSTVAPTTASVSIPSHHNNDQSIAKTLQF--ETPVSSTLTETP  299

Query  1663  ---------TQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDN  1511
                      +Q+  N S  F R +NFSE+  D    +  ++      K ESGEIL+FGD+
Sbjct  300   SAVNLTNQPSQNQRNQSSFFSREMNFSEYSFDAKNGSSNHQ----HLKPESGEILSFGDS  355

Query  1510  AVKRSACSGNDAIFSGQ---FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvv-ps  1343
               KR+        FSGQ    PA +ENNN  K   R+  SR SND+GMLSF SGV++  S
Sbjct  356   --KRTPN-----FFSGQSQFVPAVEENNNGKK---RSPNSRSSNDDGMLSFTSGVILPSS  405

Query  1342  aggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQ  1163
                +    GDS+HSDLEASVV+EADSSR+V EPEKRP+KRGRKPANGREEPLNHVEAERQ
Sbjct  406   NLKSSTGGGDSEHSDLEASVVKEADSSRLV-EPEKRPRKRGRKPANGREEPLNHVEAERQ  464

Query  1162  RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK  983
             RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELK+KLQ++ES +  L+ Q +++K
Sbjct  465   RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQSSESDKTGLQKQFDAMK  524

Query  982   KESRHpppp------------pppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHP  839
             KE                            + +I+  D+DVKIIGWDAMIR+QCSKKNHP
Sbjct  525   KELEKTSEQSSSPTPPPPNKNKSFSSSSSSSNQILVEDIDVKIIGWDAMIRVQCSKKNHP  584

Query  838   AARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             AA LM AL +LDL+V+HASVSVVND MIQQATVKMGS  Y QE+LR AL+S   
Sbjct  585   AAILMAALMELDLEVNHASVSVVNDTMIQQATVKMGSRFYTQEQLRSALSSKFG  638



>ref|XP_011028179.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=659

 Score =   298 bits (764),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 274/402 (68%), Gaps = 37/402 (9%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQI---------------VFGNENPNPA  1673
             DPS+LWLTDP  E KD  N  +Q  + P+  T                  +   +N +  
Sbjct  273   DPSSLWLTDP--ETKDG-NAGIQSTT-PAHQTGNSNNHHSSSSLTDHSGGIHHVQNHHSH  328

Query  1672  TVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSA  1493
               + Q   +   LF R LNF E     G + VRN  S L  K ESGEILNFG++  KRS 
Sbjct  329   QQQQQQQMHTQSLFTRELNFGEHSTYDG-STVRNGNSHL-LKPESGEILNFGES--KRST  384

Query  1492  CSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsg---vvvpsaggagga  1322
              S N   +SG           +  KK++  SRG  +EGMLSF SG           +GG 
Sbjct  385   SSANGNFYSGLV------TEESNKKKKSPASRGGKEEGMLSFTSGVILSSSGLVKSSGGT  438

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
              GDSDHSD+EASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  439   VGDSDHSDVEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  497

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpp  962
             RFYALRAVVPNVSKMDKASLLGDAISYINELK+KLQ+AES++E+L+ Q+E++K+E     
Sbjct  498   RFYALRAVVPNVSKMDKASLLGDAISYINELKTKLQSAESSKEELENQVETMKRELVSKD  557

Query  961   pppppepPLKLA----GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDV  794
               PPP   LK++    G+++D+D+DVKI GWDAMIRIQC K NHPAARLM ALKDLDLDV
Sbjct  558   SSPPPNQELKMSNDHGGRLIDMDIDVKISGWDAMIRIQCCKMNHPAARLMSALKDLDLDV  617

Query  793   HHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
              +A+V+V+NDLMIQQATVKMG+  Y QEEL++A+++ +   R
Sbjct  618   QYANVTVMNDLMIQQATVKMGNRYYTQEELKVAISTKVGDAR  659



>gb|AAC28907.1| phaseolin G-box binding protein PG2, partial [Phaseolus vulgaris]
Length=614

 Score =   297 bits (761),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 227/421 (54%), Positives = 261/421 (62%), Gaps = 54/421 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSI-----------TKQIVFGNENPNPATV-E  1664
             DPS LWL DP  EV+DS+NT     S   S+           T Q+    + P  +T+ E
Sbjct  207   DPSTLWLNDP--EVRDSINTAAATPSVSVSVPPHNSTHGISKTMQLESSIQTPGSSTLTE  264

Query  1663  TQSN----NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
             T S+      N  +F R LNFSE+G D       N+ S    K ES EIL+F D+  KR+
Sbjct  265   TPSSIHAVPQNQSVFSRELNFSEYGFDPKSGNTHNQHS---LKPESCEILSFSDS--KRT  319

Query  1495  ACSGNDAIFSG-------------QFP---AADEnnnnnknkKRTTTSRGSNDEGMLSFv  1364
             +  G                    Q P    ADENNNNN  K+R+  SRGSND+GMLSF 
Sbjct  320   SYGGGGGGGGVNGNSNSNSNFFSGQSPFVAVADENNNNNNGKRRSPNSRGSNDDGMLSFT  379

Query  1363  sgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLN  1184
             S  ++P+        GDSDHSDLEASVV++      VVEPEKRP+KRGRKPANGREEPLN
Sbjct  380   SRAILPATNLKSAGGGDSDHSDLEASVVKDP-----VVEPEKRPRKRGRKPANGREEPLN  434

Query  1183  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLK  1004
             HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELKSKLQ  ES ++ L+
Sbjct  435   HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQ  494

Query  1003  TQLESIKKESRHpppppppepPLKLAGkivdidvdvk---------iIGWDAMIRIQCSK  851
              QLE +KKE              K  G       +           IIGWDAMIRIQCSK
Sbjct  495   KQLEGVKKE-LEKSSDNVSSNHTKHGGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSK  553

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             KNHPAARLM AL +LDLDVHHASVSVVNDLMIQQATVKMGS  Y QE+LR AL++ +   
Sbjct  554   KNHPAARLMAALMELDLDVHHASVSVVNDLMIQQATVKMGSRFYTQEQLRSALSAKVGDV  613

Query  670   R  668
             R
Sbjct  614   R  614



>ref|XP_011018569.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=647

 Score =   297 bits (761),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 267/401 (67%), Gaps = 46/401 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDS---VNTNVQGN-----------SFPSSITKQI--VFGNENPNP  1676
             DPS+ WLTDP  E KD    +  N+ GN              SS+T  +  +   +N   
Sbjct  268   DPSSFWLTDP--ETKDGNGGIPWNLNGNDQNKNNHHSSNQSSSSLTDHLGGIHHVQNHQQ  325

Query  1675  ATVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
               +  QS      LF R LNF E     G ++VRN  S L  K ESGEILNFG++  KR+
Sbjct  326   QPIHAQS------LFTRELNFGERSTYDG-SSVRNGNSHL-MKPESGEILNFGES--KRT  375

Query  1495  ACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv---vvpsaggagg  1325
             A S N   +SG     +                G N+EGMLSF SGV          +GG
Sbjct  376   ASSANGNFYSGLVTEENNKKKRA----------GGNEEGMLSFTSGVILPSSCILKSSGG  425

Query  1324  atgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLN  1145
               GDSDHSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  426   TGGDSDHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  484

Query  1144  QRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHp  965
             QRFYALRAVVPNVSKMDKASLLGDAISYI+EL++KLQ+AES++E+L+ Q+ES+K+E    
Sbjct  485   QRFYALRAVVPNVSKMDKASLLGDAISYIDELRTKLQSAESSKEELEKQVESMKRELVSK  544

Query  964   ppppppepPLKLAGkivdidvdv----kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
                PPP+  LK++       +D+    KI GWDAMIRIQC KKNHPAARLM AL+DLDLD
Sbjct  545   NSSPPPKEELKMSNNQGVKLIDMDIDVKISGWDAMIRIQCCKKNHPAARLMSALRDLDLD  604

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             V +A+VSV+NDLMIQQATVKMGS  Y QEELR+A+++ +  
Sbjct  605   VQYANVSVMNDLMIQQATVKMGSRFYTQEELRVAISTKVGG  645



>gb|KHN38923.1| Transcription factor MYC2 [Glycine soja]
Length=471

 Score =   292 bits (747),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 274/423 (65%), Gaps = 57/423 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNT-----------NVQGNSFPSSITKQIVFGNENPNPATV-E  1664
             DPS+LWL+DP  EV+DSVNT             QG S   S T Q+    + P  +T+ E
Sbjct  63    DPSSLWLSDP--EVRDSVNTAAATPSVMVPAQTQGISI--SKTMQLESSIQTPGSSTLTE  118

Query  1663  TQSNNN----NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
             T S+ +    N  +F R LNFSE+G D       N  +  S K ESGEIL+FG++  +R+
Sbjct  119   TPSSIHAIPQNQSVFSRELNFSEYGFDPKSG---NNQNHHSLKPESGEILSFGES--RRT  173

Query  1495  ACSGNDA-----------IFSGQFP---AADEnnnnnkn---kKRTTTSRGSNDEGMLSF  1367
             +  G +             FSGQ P   A DEN  NN +   KKR+  SRGSND+GMLSF
Sbjct  174   SYGGVNGNTNTNTNSNSHFFSGQSPFVAAVDENKKNNMSNNGKKRSPNSRGSNDDGMLSF  233

Query  1366  vsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPL  1187
              SGV++P+     G  GDSDHSDLEASVV++      VVEPEKRP+KRGRKPANGREEPL
Sbjct  234   TSGVIIPATNLKSGGGGDSDHSDLEASVVKDP-----VVEPEKRPRKRGRKPANGREEPL  288

Query  1186  NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDL  1007
             NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELKSKLQT ES ++ L
Sbjct  289   NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKDVL  348

Query  1006  KTQLESIKKESRHpppppppepPLKLA----------GkivdidvdvkiIGWDAMIRIQC  857
               QLE +KKE                             I  +++DVKIIGWDAMI I C
Sbjct  349   HKQLEGVKKELEKTTDNVSSNHACNNNNNNKLSSNQPALIDLVEMDVKIIGWDAMITITC  408

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             SKKNHPAA LM AL +LDLDVH+A+V++VNDLMIQQATVKMGS  Y QE+LR AL++ + 
Sbjct  409   SKKNHPAATLMTALMELDLDVHYATVTLVNDLMIQQATVKMGSRFYTQEQLRAALSAKVG  468

Query  676   ANR  668
               R
Sbjct  469   DVR  471



>ref|XP_004148475.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
Length=688

 Score =   297 bits (761),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 274/420 (65%), Gaps = 54/420 (13%)
 Frame = -2

Query  1807  DPSALWLTDPG--------PEVKDSVNTNVQGNSFP-SSITKQIVFGNENPNPATV----  1667
             DPS+LW+++P         P    S  T    NS P S IT + +   ENPN ++V    
Sbjct  278   DPSSLWISEPSSNAIEIANPVPSASAPTPSTTNSQPISKITTETI---ENPNKSSVVVET  334

Query  1666  --------------ETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
                           ++Q     S    R LNFSEFG + G      E +S S K ESGEI
Sbjct  335   PSSSVPPPSQKTHRQSQPTQTQSFFTNRELNFSEFGYENGRL---KEGNSTSLKPESGEI  391

Query  1528  LNFGDNAVKRSACSGNDAIFSG-QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv  1352
             LNFG++    S  + ++ + SG      DEN        R+ TSRGSN+EGMLSF S V+
Sbjct  392   LNFGESKRSSSYPNTDNNLPSGNSLFGGDENKKK-----RSPTSRGSNEEGMLSFTSVVI  446

Query  1351  vpsa--ggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHV  1178
             +PS+    +G   GDSDHSDLEASV+REA+SSRVV EPEKRP+KRGRKPANGREEPLNHV
Sbjct  447   LPSSGGVKSGVCAGDSDHSDLEASVIREAESSRVV-EPEKRPRKRGRKPANGREEPLNHV  505

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+ KLQTAES +EDL+ Q
Sbjct  506   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQ  565

Query  997   LESIKKESRHpppppppepPLK------------LAGkivdidvdvkiIGWDAMIRIQCS  854
             L+S+KK                            +    ++ D+DVKII WDAMIRIQ S
Sbjct  566   LDSVKKMMMSSSSKDSCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSS  625

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             KKNHPAARLM AL++LDLD++HAS+SVVNDLMIQQATVKMGS +Y QE+LR+AL S I A
Sbjct  626   KKNHPAARLMAALEELDLDINHASISVVNDLMIQQATVKMGSRLYTQEQLRIALLSKIGA  685



>gb|KGN60384.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=679

 Score =   297 bits (760),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 274/420 (65%), Gaps = 54/420 (13%)
 Frame = -2

Query  1807  DPSALWLTDPG--------PEVKDSVNTNVQGNSFP-SSITKQIVFGNENPNPATV----  1667
             DPS+LW+++P         P    S  T    NS P S IT + +   ENPN ++V    
Sbjct  269   DPSSLWISEPSSNAIEIANPVPSASAPTPSTTNSQPISKITTETI---ENPNKSSVVVET  325

Query  1666  --------------ETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
                           ++Q     S    R LNFSEFG + G      E +S S K ESGEI
Sbjct  326   PSSSVPPPSQKTHRQSQPTQTQSFFTNRELNFSEFGYENGRL---KEGNSTSLKPESGEI  382

Query  1528  LNFGDNAVKRSACSGNDAIFSG-QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv  1352
             LNFG++    S  + ++ + SG      DEN        R+ TSRGSN+EGMLSF S V+
Sbjct  383   LNFGESKRSSSYPNTDNNLPSGNSLFGGDENKKK-----RSPTSRGSNEEGMLSFTSVVI  437

Query  1351  vpsa--ggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHV  1178
             +PS+    +G   GDSDHSDLEASV+REA+SSRVV EPEKRP+KRGRKPANGREEPLNHV
Sbjct  438   LPSSGGVKSGVCAGDSDHSDLEASVIREAESSRVV-EPEKRPRKRGRKPANGREEPLNHV  496

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+ KLQTAES +EDL+ Q
Sbjct  497   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQ  556

Query  997   LESIKKESRHpppppppepPLK------------LAGkivdidvdvkiIGWDAMIRIQCS  854
             L+S+KK                            +    ++ D+DVKII WDAMIRIQ S
Sbjct  557   LDSVKKMMMSSSSKDSCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSS  616

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             KKNHPAARLM AL++LDLD++HAS+SVVNDLMIQQATVKMGS +Y QE+LR+AL S I A
Sbjct  617   KKNHPAARLMAALEELDLDINHASISVVNDLMIQQATVKMGSRLYTQEQLRIALLSKIGA  676



>ref|XP_004166734.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Cucumis sativus]
Length=686

 Score =   297 bits (761),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 232/426 (54%), Positives = 276/426 (65%), Gaps = 67/426 (16%)
 Frame = -2

Query  1807  DPSALWLTDPG--------PEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATV-----  1667
             DPS+LW+++P         P    S  T    NS P S  +Q +   ENPN ++V     
Sbjct  277   DPSSLWISEPSSNAIEIANPVPSASAPTPSTTNSQPISKLQQRI---ENPNKSSVVVETP  333

Query  1666  -------------ETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEIL  1526
                          ++Q     S    R LNFSEFG + G      E +S S K ESGEIL
Sbjct  334   SSSVPPPSQKTHRQSQPTQTQSFFTNRELNFSEFGYENGRL---KEGNSTSLKPESGEIL  390

Query  1525  NFGDNAVKRSACSGN--------DAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLS  1370
             NFG++  KRS+   N        +++F G     DEN        R+ TSRGSN+EGMLS
Sbjct  391   NFGES--KRSSSYPNTDNNLPSGNSLFGG-----DENKKK-----RSPTSRGSNEEGMLS  438

Query  1369  Fvsgvvvpsa--ggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGRE  1196
             F S V++PS+    +G   GDSDHSDLEASV+REA+SSRVV EPEKRP+KRGRKPANGRE
Sbjct  439   FTSVVILPSSGGVKSGVCAGDSDHSDLEASVIREAESSRVV-EPEKRPRKRGRKPANGRE  497

Query  1195  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQ  1016
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+ KLQTAES +
Sbjct  498   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDK  557

Query  1015  EDLKTQLESIKKESRHpppppppepPLK------------LAGkivdidvdvkiIGWDAM  872
             EDL+ QL+S+KK                            +    ++ D+DVKII WDAM
Sbjct  558   EDLQKQLDSVKKMMMSSSSKDSCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAM  617

Query  871   IRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             IRIQ SKKNHPAARLM AL++LDLD++HAS+SVVNDLMIQQATVKMGS +Y QE+LR+AL
Sbjct  618   IRIQSSKKNHPAARLMAALEELDLDINHASISVVNDLMIQQATVKMGSRLYTQEQLRIAL  677

Query  691   TSSIAA  674
              S I A
Sbjct  678   LSKIGA  683



>ref|XP_004509726.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=657

 Score =   293 bits (750),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 224/412 (54%), Positives = 274/412 (67%), Gaps = 58/412 (14%)
 Frame = -2

Query  1807  DPSALWLTDP----GPEVKDSVN---TNVQGNSFPSSITKQIVFGNENPNPATVETQSNN  1649
             DPS+LWL DP    G E+KDSVN   T V  N+   +I K + F  +    ++  T++ N
Sbjct  272   DPSSLWLNDPSGSAGIEIKDSVNAVNTTVSANA---AIGKSLQFETQTHGSSSTLTETPN  328

Query  1648  ------------NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
                          N   FP+ LNFS                  S K ESGEILNFG++  
Sbjct  329   VIHVHNAQRNQNQNQSFFPKELNFSS-----------------SMKPESGEILNFGES--  369

Query  1504  KRSACS-----GNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsa  1340
             K+S+ S     GN   FSGQ P A         K+R+  SR S D+G+LSF SGV++P++
Sbjct  370   KKSSYSAVNGNGNGNFFSGQSPFA---AGEENRKRRSPVSRSSVDDGILSFTSGVLLPAS  426

Query  1339  ggagg----atgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEA  1172
                        GDSD SDLE SVV+EADSSRV+ EPEKRP+KRGRKPANGREEPLNHVEA
Sbjct  427   NMKSSGGIGTGGDSDQSDLEVSVVKEADSSRVI-EPEKRPRKRGRKPANGREEPLNHVEA  485

Query  1171  ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLE  992
             ERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELK KLQ  ES++ +L+ QL+
Sbjct  486   ERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKEKLQGLESSKGELEKQLD  545

Query  991   SIKKE----SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLM  824
             + KKE    S   P  P  +  LK   K++D+D++VK+IGWDAMIR+QCSKKNHPAA+LM
Sbjct  546   TTKKELELASNKNPLLPLDKEKLKTNCKLIDLDIEVKVIGWDAMIRVQCSKKNHPAAKLM  605

Query  823   VALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             VALK+LD++V+HASVSVVNDLMIQQATV MG+  Y +E+L   L+S I   R
Sbjct  606   VALKELDVEVNHASVSVVNDLMIQQATVNMGNQFYTKEQLLSVLSSKIGDAR  657



>ref|XP_007158304.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
 gb|ESW30298.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
Length=728

 Score =   295 bits (754),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 232/422 (55%), Positives = 270/422 (64%), Gaps = 58/422 (14%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSI-----------TKQIVFGNENPNPATV-E  1664
             DPS LWL DP  EV+DS+NT     S   S+           T Q+    + P  +T+ E
Sbjct  323   DPSTLWLNDP--EVRDSINTAAATPSVSVSVPPHNSTHGISKTMQLESSIQTPGSSTLTE  380

Query  1663  TQSN----NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
             T S+      N  +F R LNFSE+G D       N+ S    K ES EI +F D+  KR+
Sbjct  381   TPSSIHAVPQNQSVFSRELNFSEYGFDPKSGNTHNQHS---LKPESCEIFSFSDS--KRT  435

Query  1495  ACSGNDAIFSG-----------QFP---AADEnnnnnknkKRTTTSRGSNDEGMLSFvsg  1358
             +  G     +G           Q P    ADENNNNN  K+R+  SRGSND+GMLSF S 
Sbjct  436   SYGGGGGGVNGNSNSNSNFFSGQSPFVAVADENNNNNNGKRRSPNSRGSNDDGMLSFTSR  495

Query  1357  vvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHV  1178
              ++P+        GDSDHSDLEASVV++      VVEPEKRP+KRGRKPANGREEPLNHV
Sbjct  496   AILPATNLKSAGGGDSDHSDLEASVVKDP-----VVEPEKRPRKRGRKPANGREEPLNHV  550

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELKSKLQ  ES ++ L+ Q
Sbjct  551   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQ  610

Query  997   LESIKKE------------SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCS  854
             LE +KKE            ++H            L     D+D+DVKIIGWDAMIRIQCS
Sbjct  611   LEGVKKELEKSSDNVSSNHTKHGGNSNIKSSNQALI----DLDIDVKIIGWDAMIRIQCS  666

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             KKNHPAARLM AL +LDLDVHHASVSVVNDLMIQQATVKMGS  Y QE+LR AL++ +  
Sbjct  667   KKNHPAARLMAALMELDLDVHHASVSVVNDLMIQQATVKMGSRFYTQEQLRSALSAKVGD  726

Query  673   NR  668
              R
Sbjct  727   VR  728



>ref|XP_006368399.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP64968.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=647

 Score =   292 bits (748),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 220/396 (56%), Positives = 268/396 (68%), Gaps = 36/396 (9%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ---  1637
             DPS+ WLTDP  E KD  N  +  N   S   K     +   + +  +     +++Q   
Sbjct  268   DPSSFWLTDP--ETKDG-NGGIPWNLNGSDQNKNNHHSSNQSSSSLTDHLGGIHHAQNHQ  324

Query  1636  --------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGN  1481
                     LF R LNF E     G ++VRN  S L+ K ESGEILNFG++  KR+A S N
Sbjct  325   QQPIHARSLFTRELNFGECSTYDG-SSVRNGNSHLT-KPESGEILNFGES--KRTASSAN  380

Query  1480  DAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv---vvpsaggaggatgds  1310
                +SG     +          +   S G N+EGMLSF SGV          +GG  GDS
Sbjct  381   GNFYSGLVTEENN---------KKKRSVG-NEEGMLSFTSGVILPSSCILKSSGGTGGDS  430

Query  1309  dhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYA  1130
             DHSDLEASVV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYA
Sbjct  431   DHSDLEASVVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  489

Query  1129  LRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppp  950
             LRAVVPNVSKMDKASLLGDAISYI+EL++KLQ+AES++E+L+ Q+ES+K+E       PP
Sbjct  490   LRAVVPNVSKMDKASLLGDAISYIDELRTKLQSAESSKEELEKQVESMKRELVSKDSSPP  549

Query  949   pepPLKLAGkivdidvdv----kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHAS  782
             P+  LK++       +D+    KI GWDAMIRIQC KKNHPAARLM AL+DLDLDV +A+
Sbjct  550   PKEELKMSNNEGVKLIDMDIDVKISGWDAMIRIQCCKKNHPAARLMSALRDLDLDVQYAN  609

Query  781   VSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             VSV+NDLMIQQATVKMGS  Y QEELR+A+++++  
Sbjct  610   VSVMNDLMIQQATVKMGSRFYTQEELRVAISTNVGG  645



>gb|KHN04880.1| Transcription factor MYC2, partial [Glycine soja]
Length=487

 Score =   286 bits (733),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 218/421 (52%), Positives = 265/421 (63%), Gaps = 70/421 (17%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNT-----------NVQGNSFPSSITKQIVFGNENPNPATV-E  1664
             DPS+LWL+DP  EV+DS+NT             QG S   S T Q+    + P  +T+ E
Sbjct  96    DPSSLWLSDP--EVRDSINTVAATPSVSVPAQTQGISI--SKTMQLESSIQTPGSSTLTE  151

Query  1663  TQSN----NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
             T S+      N  +F R LNFSE+G D       N  +  S K ESGEIL+FG++  KR+
Sbjct  152   TPSSIHAIPQNQSVFSRELNFSEYGFD---PKTGNNQNHHSLKPESGEILSFGES--KRT  206

Query  1495  ACSG-------NDAIFSGQFP---AADEnnnnnknkKR----TTTSRGSNDEGMLSFvsg  1358
             +  G       N   FSGQ P   AADEN N N         +  SRGSND+GMLSF SG
Sbjct  207   SYGGVNGNSNSNSHFFSGQSPFVAAADENTNKNNINNNGKTKSPNSRGSNDDGMLSFTSG  266

Query  1357  vvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHV  1178
             V++P++                ASVV++      VVEPEKRP+KRGRKPANGREEPLNHV
Sbjct  267   VILPAS---------------NASVVKDP-----VVEPEKRPRKRGRKPANGREEPLNHV  306

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELKSKLQT ES ++ ++ Q
Sbjct  307   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKDGMQKQ  366

Query  997   LESIKKE---------SRHpppppppepPLKLAGki--vdidvdvkiIGWDAMIRIQCSK  851
             LE +KKE         S H           KL+ +     +++DVKI+GWDAMIRI CSK
Sbjct  367   LEGVKKELEKTTENVSSNHAGNSSSCNNNNKLSNQKLIDVLEMDVKILGWDAMIRIHCSK  426

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             KNHP ARL+ AL +LDLDVHHA+V++VND+ + QATVKMGS  Y QE+LR AL + +   
Sbjct  427   KNHPGARLLTALMELDLDVHHANVNLVNDMTMLQATVKMGSRFYTQEQLRAALAAKVGDA  486

Query  670   R  668
             R
Sbjct  487   R  487



>gb|KDO44754.1| hypothetical protein CISIN_1g005651mg [Citrus sinensis]
Length=685

 Score =   292 bits (747),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 228/419 (54%), Positives = 284/419 (68%), Gaps = 57/419 (14%)
 Frame = -2

Query  1807  DPSALWLTDPGP---------EVKDSVNTNVQ-------------GNSFPSSITKQIVFG  1694
             DPS+ W+ DP P         E+KDS                   G+   S+++K I F 
Sbjct  279   DPSS-WINDPSPTPAPTAGFIEIKDSTAAATTTTTTTTTTTTPAIGSGSASNLSKGIHF-  336

Query  1693  NENPNPATVETQSNNNNSQL------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGE  1532
              E P+  ++    +  + Q+      F R LNFSE+  D    +V+N +S L  K ESGE
Sbjct  337   -ELPSSVSLTESVDLQHQQIPQTQSFFTRELNFSEYAYDHN--SVKNGSSRL-FKPESGE  392

Query  1531  ILNFGDNAVKRSACSGN--DAIFS--GQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFv  1364
             ILNF ++  KRS+C+GN  +++ S   QF A D     +  KKR+ TSRGS +EGMLSF 
Sbjct  393   ILNFAES--KRSSCTGNGNNSLLSNHSQFVAED-----SNKKKRSPTSRGSTEEGMLSFT  445

Query  1363  sgvv--vpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEP  1190
             SGV+        + G  GDSDHSDLEASVV++ DSSRV  EPEK+P+KRGRKPANGREEP
Sbjct  446   SGVILPSSGVVKSSGGAGDSDHSDLEASVVKDPDSSRV--EPEKKPRKRGRKPANGREEP  503

Query  1189  LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQED  1010
             LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL++KLQ+AES +ED
Sbjct  504   LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKED  563

Query  1009  LKTQLESIKKE-----SRHpppppppepPLKL---AGkivdidvdvkiIGWDAMIRIQCS  854
             L+ +L S+KKE           P   +  LK+   A K++D+D++VKIIGWDAMIRIQ S
Sbjct  564   LQKELASVKKELAGGGKDSHSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSS  623

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             KKNHPAA+LM ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  Y QE+L+  L + + 
Sbjct  624   KKNHPAAKLMQALKELDLEVNHASMSVVNDLMIQQATVKMGSRFYTQEQLKNVLAAKVG  682



>ref|XP_006428423.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
 ref|XP_006491734.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
 gb|ESR41663.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
Length=685

 Score =   291 bits (745),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 228/419 (54%), Positives = 285/419 (68%), Gaps = 57/419 (14%)
 Frame = -2

Query  1807  DPSALWLTDPGP---------EVKDSVNTN-------------VQGNSFPSSITKQIVFG  1694
             DPS+ W+ DP P         E+KDS                 V G+   S+++K I F 
Sbjct  279   DPSS-WINDPSPTPAPTAGFIEIKDSTAAAATTTTTTTTTTTPVIGSGSASNLSKGIHF-  336

Query  1693  NENPNPATVETQSNNNNSQL------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGE  1532
              E P+  ++    +  + Q+      F R LNFSE+  D    +V+N +S L  K ESGE
Sbjct  337   -ELPSSVSLTESVDLQHQQIPQTQSFFTRELNFSEYAYDHN--SVKNGSSRL-FKPESGE  392

Query  1531  ILNFGDNAVKRSACSGN--DAIFS--GQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFv  1364
             ILNF ++  KRS+C+GN  +++ S   QF A +     +  KKR+ TSRGS +EGMLSF 
Sbjct  393   ILNFAES--KRSSCTGNGNNSLLSNHSQFVAEE-----SNKKKRSPTSRGSTEEGMLSFT  445

Query  1363  sgvv--vpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEP  1190
             SGV+        + G  GDSDHSDLEASVV++ DSSRV  EPEK+P+KRGRKPANGREEP
Sbjct  446   SGVILPSSGVVKSSGGAGDSDHSDLEASVVKDPDSSRV--EPEKKPRKRGRKPANGREEP  503

Query  1189  LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQED  1010
             LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL++KLQ+AES +ED
Sbjct  504   LNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKED  563

Query  1009  LKTQLESIKKE-----SRHpppppppepPLKL---AGkivdidvdvkiIGWDAMIRIQCS  854
             L+ +L S+KKE           P   +  LK+   A K++D+D++VKIIGWDAMIRIQ S
Sbjct  564   LQKELASVKKELAGGGKDSHSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSS  623

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             KKNHPAA+LM ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  Y QE+L+  L + + 
Sbjct  624   KKNHPAAKLMEALKELDLEVNHASMSVVNDLMIQQATVKMGSRFYTQEQLKNVLAAKVG  682



>ref|XP_006385657.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP63454.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=630

 Score =   288 bits (736),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 213/389 (55%), Positives = 265/389 (68%), Gaps = 39/389 (10%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNS--FPSSITKQIVFGNENPNPATVETQSNNNNSQL  1634
             DPS+LWLTDP  E KD  N  +   +    ++        +++  P+T    +++ +   
Sbjct  272   DPSSLWLTDP--ETKDG-NAGIPSTTPAHQTANNNNHHSSSKSSQPSTAAAAADSYSESF  328

Query  1633  FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQFP  1454
               R        ++  GA             ESGEILNFG++  KRS  S N   +SG   
Sbjct  329   HSR--------VEFWGAQ----------HPESGEILNFGES--KRSPSSANGNFYSGLV-  367

Query  1453  AADEnnnnnknkKRTTTSRGSNDEGMLSFvsg---vvvpsaggaggatgdsdhsDLEASV  1283
                     +  KK++  SRG N+EGMLSF SG           +GG  GDSDHSDLEASV
Sbjct  368   -----TEESNKKKKSPASRGGNEEGMLSFTSGVILSSSGLVKSSGGTGGDSDHSDLEASV  422

Query  1282  VREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  1103
             V+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS
Sbjct  423   VKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  481

Query  1102  KMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLA-  926
             KMDKASLLGDAISYINELK+KLQ+AES++E+L+ Q+ES+K+E        PP   LK++ 
Sbjct  482   KMDKASLLGDAISYINELKTKLQSAESSKEELENQVESMKRELVSKDSSSPPNQELKMSN  541

Query  925   ---GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMI  755
                G+++D+D+DVKI GWDAMIRIQC K NHPAARLM ALKDLDLDV +A+V+V+NDLMI
Sbjct  542   DHGGRLIDMDIDVKISGWDAMIRIQCCKMNHPAARLMSALKDLDLDVQYANVTVMNDLMI  601

Query  754   QQATVKMGSHVYNQEELRLALTSSIAANR  668
             QQATVKMG+  Y QEEL++A+++ +   R
Sbjct  602   QQATVKMGNRYYTQEELKVAISTKVGDAR  630



>ref|XP_003534274.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=731

 Score =   290 bits (741),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 274/423 (65%), Gaps = 57/423 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNT-----------NVQGNSFPSSITKQIVFGNENPNPATV-E  1664
             DPS+LWL+DP  EV+DSVNT             QG S   S T Q+    + P  +T+ E
Sbjct  323   DPSSLWLSDP--EVRDSVNTAAATPSVMVPAQTQGISI--SKTMQLESSIQTPGSSTLTE  378

Query  1663  TQSNNN----NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
             T S+ +    N  +F R LNFSE+G D       N  +  S K ESGEIL+FG++  +R+
Sbjct  379   TPSSIHAIPQNQSVFSRELNFSEYGFDPKSG---NNQNHHSLKPESGEILSFGES--RRT  433

Query  1495  ACSGNDA-----------IFSGQFP---AADEnnnnnkn---kKRTTTSRGSNDEGMLSF  1367
             +  G +             FSGQ P   A DEN  NN +   KKR+  SRGSND+GMLSF
Sbjct  434   SYGGVNGNTNTNTNSNSHFFSGQSPFVAAVDENKKNNMSNNGKKRSPNSRGSNDDGMLSF  493

Query  1366  vsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPL  1187
              SGV++P+     G  GDSDHSDLEASVV++      VVEPEKRP+KRGRKPANGREEPL
Sbjct  494   TSGVIIPATNLKSGGGGDSDHSDLEASVVKDP-----VVEPEKRPRKRGRKPANGREEPL  548

Query  1186  NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDL  1007
             NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELKSKLQT ES ++ L
Sbjct  549   NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKDVL  608

Query  1006  KTQLESIKKESRHpppppppepPLKLA----------GkivdidvdvkiIGWDAMIRIQC  857
               QLE +KKE                             I  +++DVKIIGWDAMI I C
Sbjct  609   HKQLEGVKKELEKTTDNVSSNHACNNNNNNKLSSNQPALIDLVEMDVKIIGWDAMITITC  668

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             SKKNHPAA LM AL +LDLDVH+A+V++VNDLMIQQATVKMGS  Y QE+LR AL++ + 
Sbjct  669   SKKNHPAATLMTALMELDLDVHYATVTLVNDLMIQQATVKMGSRFYTQEQLRAALSAKVG  728

Query  676   ANR  668
               R
Sbjct  729   DVR  731



>gb|AFZ93650.1| transcription factor MYC2, partial [Euphorbia lathyris]
Length=272

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 207/251 (82%), Gaps = 7/251 (3%)
 Frame = -2

Query  1411  TTTSRGSNDEGMLSFvsgvvvpsaggaggatgd---sdhsDLEASVVREADSSRVVVepe  1241
             + TSRGSN+EGMLSF SGV++PS+     + G    SDHSDLEASVVRE +SSR+V EPE
Sbjct  21    SPTSRGSNEEGMLSFTSGVILPSSCVMKSSGGTGGDSDHSDLEASVVRETESSRIV-EPE  79

Query  1240  krpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISY  1061
             K+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISY
Sbjct  80    KKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISY  139

Query  1060  INELKSKLQTAESAQEDLKTQLESIKKESRHppppppp---epPLKLAGkivdidvdvki  890
             I ELKSKLQ  ES +E+L+ Q+ES+KKE             +  LK++ K +++D+DVKI
Sbjct  140   IKELKSKLQNTESDKEELEKQVESMKKEFSKKDTRSGTPPPDQELKMSNKSIEMDIDVKI  199

Query  889   IGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQE  710
             IGWD MIRIQCSKKNHPAARLM ALK+LDLDVHHASVSVVNDLMIQQATVKMGS  Y  E
Sbjct  200   IGWDVMIRIQCSKKNHPAARLMAALKELDLDVHHASVSVVNDLMIQQATVKMGSRFYTHE  259

Query  709   ELRLALTSSIA  677
             +LR+AL++ + 
Sbjct  260   QLRVALSNKVC  270



>ref|XP_010273162.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
 ref|XP_010273163.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=658

 Score =   285 bits (730),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 215/407 (53%), Positives = 273/407 (67%), Gaps = 45/407 (11%)
 Frame = -2

Query  1807  DPSALWLTDPG----PEVKDSVNTNVQGNSFPSSITKQIVFGNENP-----NPATVETQS  1655
             DPS+LW++DP      E  ++             I+K I   N++      NP+T+  Q+
Sbjct  265   DPSSLWISDPSMLDIKESVNAAPAASAVAPPNQEISKPIQIENQSTSNLTENPSTISLQT  324

Query  1654  NNNNSQ-------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
              + +          F R +NFS+FGL+G   +   +  + SCK ESGE++NFG +  + +
Sbjct  325   KHQSHHQQQQTQGFFTREINFSDFGLEG---STTKKGVTQSCKPESGELMNFGGS--RGN  379

Query  1495  ACSGNDAIFSG---QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagg  1325
               S N A+FS    QF A D+          + +SRG  +EGMLSF SG VVPSA     
Sbjct  380   MSSANGALFSNHSQQFVADDKKKKC------SASSRG--EEGMLSFTSGAVVPSACVMKS  431

Query  1324  atg--dsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREK  1151
             +    DSD SDLEASV RE +SSRV  EPEK+P+KRGRKPANGREEPLNHVEAERQRREK
Sbjct  432   SGENLDSDQSDLEASV-REVESSRVG-EPEKKPRKRGRKPANGREEPLNHVEAERQRREK  489

Query  1150  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--  977
             LNQRFY+LRAVVPNVSKMDKASLLGDAISYINEL++KLQ AES +E L+TQ++ +KK+  
Sbjct  490   LNQRFYSLRAVVPNVSKMDKASLLGDAISYINELRAKLQAAESDKEALQTQVDCLKKDLT  549

Query  976   -------SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVA  818
                    S  P      +   +   K +++++DVKI+GW+AM+RIQC+KKNHPAARLM A
Sbjct  550   SRIYPGPSPQPDKDRDGKISSQQGNKALEMEIDVKILGWEAMVRIQCNKKNHPAARLMSA  609

Query  817   LKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             LKDLDLDVH+ASVSVV DLMIQQATVKM S VY QE+LR+AL+S +A
Sbjct  610   LKDLDLDVHYASVSVVKDLMIQQATVKMSSRVYTQEQLRIALSSKVA  656



>ref|XP_008448683.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=662

 Score =   284 bits (726),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 208/395 (53%), Positives = 265/395 (67%), Gaps = 44/395 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGP--EVKDSVNTNVQGNSFPSSITKQIVFGNENP-------NPATVETQS  1655
             DPS++W+++P    E+KDS+ T V  ++ P+   +     +ENP       N +T++ QS
Sbjct  280   DPSSMWISEPSSTIEMKDSITTTVPSSNVPAKPIR-----SENPSSSSLTENMSTIQ-QS  333

Query  1654  NNNNSQLFPRGLNFSEFGLDGGGA------AVRNETSSLSCKRESGEILNFGDNAVKRSA  1493
             ++  SQ F   LNFS++G +   +      A    +++ S K ESG +LNFG        
Sbjct  334   HHKQSQSF---LNFSDYGFESNPSKNTTATATVTTSTTPSFKPESGGMLNFG--------  382

Query  1492  CSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgd  1313
                N ++FSG    +    N    KKR+  SR SNDEG+LSF SGV++PS+G       D
Sbjct  383   ---NGSLFSGH---SQYVTNEQNEKKRSPASRSSNDEGILSFTSGVILPSSGKVKSGDSD  436

Query  1312  sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFY  1133
                  LEASV+RE DS    +EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ+FY
Sbjct  437   HSD--LEASVIREVDSCTKSLEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  494

Query  1132  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpp---  962
             ALRAVVPNVSKMDKASLLGDA+SYINELKSKLQ AES + D+   LE +KKE        
Sbjct  495   ALRAVVPNVSKMDKASLLGDAVSYINELKSKLQMAESEKTDMGKHLELLKKEMGGKDVGC  554

Query  961   pppppepPLKLAGkivd-idvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHA  785
                P +  LK+  + V  ++++VKI+GWDAMIRIQ +KKNHPAARLM A KDLDL++ HA
Sbjct  555   YTNPNDEDLKIGKRKVMDMEIEVKIMGWDAMIRIQSNKKNHPAARLMTAFKDLDLEMLHA  614

Query  784   SVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             SVSVVNDLMIQQATVKMGS  Y QE+L++AL + +
Sbjct  615   SVSVVNDLMIQQATVKMGSRFYTQEQLKMALVARV  649



>ref|XP_004148739.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 ref|XP_004164415.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 gb|KGN55759.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=661

 Score =   281 bits (718),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 207/395 (52%), Positives = 262/395 (66%), Gaps = 44/395 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGP--EVKDSVNTNVQGNSFPSSITKQIVFGNENP-------NPATVETQS  1655
             DPS++W+++P    E+KDS+ T V  ++ P+   +     +ENP       N +T++ QS
Sbjct  280   DPSSMWISEPSSTIEMKDSITTTVPSSNVPAKPIR-----SENPSTSSLTENMSTIQ-QS  333

Query  1654  NNNNSQLFPRGLNFSEFGLDGG------GAAVRNETSSLSCKRESGEILNFGDNAVKRSA  1493
             ++  SQ F   LNFS++G +          A    +++ S K ESG +LNFG        
Sbjct  334   HHKQSQSF---LNFSDYGFESNPTKNTTATATATTSTTPSFKPESGGMLNFG--------  382

Query  1492  CSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgd  1313
                N ++FSG    +    N    KKR+  SR SNDEG+LSF SGV++PS+G       D
Sbjct  383   ---NGSLFSGH---SQYVTNEQNEKKRSPASRSSNDEGILSFTSGVILPSSGKVKSGDSD  436

Query  1312  sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFY  1133
                  LEAS +RE DS    +EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQ+FY
Sbjct  437   HSD--LEASAIREVDSCTKSLEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  494

Query  1132  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpp---  962
             ALRAVVPNVSKMDKASLLGDA+SYINELKSKLQ AES + D+   LE +KKE        
Sbjct  495   ALRAVVPNVSKMDKASLLGDAVSYINELKSKLQMAESEKTDMGKHLELLKKEMGGKDLGC  554

Query  961   pppppepPLKLAGkivd-idvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHA  785
                P +  LK   + V  ++++VKI+GWDAMIRIQ +KKNHPAARLM A KDLDL++ HA
Sbjct  555   YSNPNDEDLKTGKRKVMDMEIEVKIMGWDAMIRIQSNKKNHPAARLMTAFKDLDLEMLHA  614

Query  784   SVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             SVSVVNDLMIQQATVKMGS  Y QE+L++AL + +
Sbjct  615   SVSVVNDLMIQQATVKMGSRFYTQEQLKMALVARV  649



>ref|XP_007156435.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
 gb|ESW28429.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
Length=642

 Score =   280 bits (715),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 218/399 (55%), Positives = 253/399 (63%), Gaps = 53/399 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNTNVQGNSFPSSITKQIVFGN-------ENPNPATVETQSN  1652
             DPS+LWL      E+KD+ N  V   S  +S++K + F         E P+ A      N
Sbjct  270   DPSSLWLNPSSSIEIKDTSNA-VALVSANASLSKTMPFETPGSSTLTETPSAAAAAHVPN  328

Query  1651  NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
               N   FPR LNFS                  S K ESGEIL+FG++  K+S+ +G  + 
Sbjct  329   PKNQGFFPRELNFSN-----------------SLKPESGEILSFGES--KKSSYNG--SY  367

Query  1471  FSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs-------gvvvpsaggaggatgd  1313
             F G   AA+E N       R+  SR S D+GMLSF S        +   +  G G + GD
Sbjct  368   FPGV--AAEETNKKR----RSPASRSSIDDGMLSFTSGVIIPASNIKSGAVAGGGASGGD  421

Query  1312  sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFY  1133
             S++SDLEASVV+EADS   VVEPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFY
Sbjct  422   SENSDLEASVVKEADSR--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  479

Query  1132  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHppppp  953
             ALRAVVPNVSKMDKASLLGDAISYINELKSKL   ES + +L+ QLE +KKE       P
Sbjct  480   ALRAVVPNVSKMDKASLLGDAISYINELKSKLSELESEKGELEKQLELVKKELELATKSP  539

Query  952   ppepPLKLAGkivdidvdv--------kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
              P P    + K                KIIGWDAMIRIQCSKKNHPAARLM ALK+LDLD
Sbjct  540   SPPPGPPPSNKEAKETTSKLIDLELEVKIIGWDAMIRIQCSKKNHPAARLMAALKELDLD  599

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             V+HASVSVVNDLMIQQATV MG+  Y QE+L  AL+S I
Sbjct  600   VNHASVSVVNDLMIQQATVNMGNRFYTQEQLLSALSSKI  638



>ref|XP_010677236.1| PREDICTED: transcription factor MYC2-like [Beta vulgaris subsp. 
vulgaris]
Length=649

 Score =   279 bits (713),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 219/408 (54%), Positives = 269/408 (66%), Gaps = 42/408 (10%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKD-------SVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSN  1652
             DP+ +W+ DP P EVK+            ++  +  S I   +   +  PNPA  + Q  
Sbjct  256   DPTTMWINDPNPVEVKELRKTPTPPPPPPMKLINLDSPIKSNLSEFHSTPNPAPKQQQQQ  315

Query  1651  NNNSQLFPRGLNFSEF-GLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSA--CSGN  1481
                   F R LNFS++ G +G G       S+ S K ESGEIL+FG    KRS    +GN
Sbjct  316   G----FFSRELNFSDYAGYNGNG-----NKSNGSLKPESGEILSFGGGDSKRSTNNSNGN  366

Query  1480  DAIFSG--QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat----  1319
               IF G   F   D    +N  KKR+  SRGSN++GMLSF SGV++ S+G  G ++    
Sbjct  367   VGIFGGNSSFLIDD----SNNKKKRSPNSRGSNEDGMLSFTSGVILASSGVVGKSSNNNG  422

Query  1318  gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQR  1139
              DS+HSDLEASV RE DSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQR
Sbjct  423   ADSEHSDLEASV-REVDSSRVVPEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQR  481

Query  1138  FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRH---  968
             FYALRAVVPNVSKMDKASLLGDAISYINELK+KLQ  E  +E L +Q+E +KKE      
Sbjct  482   FYALRAVVPNVSKMDKASLLGDAISYINELKAKLQDFEVEKEGLVSQVEGLKKELGGSQP  541

Query  967   --------pppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALK  812
                            +  L +  ++VD+++DVKIIGW+AMIR+  +KKNHPAARLM AL 
Sbjct  542   QSQQQLAPSYLEKETKAVLGVKQQLVDLEIDVKIIGWEAMIRVNSNKKNHPAARLMAALM  601

Query  811   DLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAANR  668
             +L+LDV HASVSVVNDLMIQQATVKM +  Y+QE+LR+ L S ++  R
Sbjct  602   ELELDVTHASVSVVNDLMIQQATVKMCNRYYSQEQLRMLLASKVSDPR  649



>gb|AAB00686.1| phaseolin G-box binding protein PG1 [Phaseolus vulgaris]
Length=642

 Score =   278 bits (712),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 252/400 (63%), Gaps = 53/400 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNTNVQGNSFPSSITKQIVFGN-------ENPNPATVETQSN  1652
             DPS+LWL      E+KD+ N  V   S  +S++K + F         E P+ A      N
Sbjct  270   DPSSLWLNPSSSIEIKDTSNA-VALVSANASLSKTMPFETPGSSTLTETPSAAAAAHVPN  328

Query  1651  NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
               N   FPR LNFS                  S K ESGEIL+FG++  K+S+ +G  + 
Sbjct  329   PKNQGFFPRELNFSN-----------------SLKPESGEILSFGES--KKSSYNG--SY  367

Query  1471  FSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs-------gvvvpsaggaggatgd  1313
             F G   AA+E N       R+  SR S D+GMLSF S        +   +  G G + GD
Sbjct  368   FPGV--AAEETNKKR----RSPASRSSIDDGMLSFTSGVIIPASNIKSGAVAGGGASGGD  421

Query  1312  sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFY  1133
             S++SDLEASVV+EADS   VVEPEKRP+KRGRKP NGREEPLNHVEAERQRREKLNQRFY
Sbjct  422   SENSDLEASVVKEADSR--VVEPEKRPRKRGRKPGNGREEPLNHVEAERQRREKLNQRFY  479

Query  1132  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHppppp  953
             ALRAVVPNVSKMDKASLLGDAISYINELKSKL   ES + +L+ QLE +KKE       P
Sbjct  480   ALRAVVPNVSKMDKASLLGDAISYINELKSKLSELESEKGELEKQLELVKKELELATKSP  539

Query  952   ppepPLKLAGkivdidvdv--------kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
              P P    + K                KIIGWDAMIRIQCSKKNHPAARLM ALK+LDLD
Sbjct  540   SPPPGPPPSNKEAKETTSKLIDLELEVKIIGWDAMIRIQCSKKNHPAARLMAALKELDLD  599

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             V+HASVSVVNDLMIQQATV MG+  Y QE+LR A +S I 
Sbjct  600   VNHASVSVVNDLMIQQATVNMGNRFYTQEQLRSARSSKIG  639



>gb|AAY90122.1| basic helix-loop-helix transcription factor protein [Rheum australe]
Length=720

 Score =   276 bits (707),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 268/421 (64%), Gaps = 65/421 (15%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVN--TNVQGNSFPSSITKQIVFGNENP-------------  1682
             DP+ALW++DP     EVK+++N    V+ +S P       V     P             
Sbjct  317   DPAALWISDPSSSAAEVKEALNPRITVRESSIPIGSNSIPVHQPAKPPQLDVQSSIGLTE  376

Query  1681  NPATVETQSNNN----NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGD  1514
             N   + +Q ++N    +   F + LNFSEF +                K ESGEILNFG+
Sbjct  377   NSIGIHSQKSHNQPLQHQGFFTKELNFSEFAM----------------KPESGEILNFGE  420

Query  1513  NAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv---vvps  1343
             +  KR++  GN    + QF   +E+N N  +KKR+ TSRGS +EGMLSF S V      +
Sbjct  421   S--KRNSL-GNGNGLNSQF-LVEESNKNIISKKRSPTSRGSAEEGMLSFTSSVVLPSSMA  476

Query  1342  aggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQ  1163
                +    GDSDHSDLEASVV+EADSSRVV +PEKRP+KRGRKPANGREEPLNHVEAERQ
Sbjct  477   VKSSATGAGDSDHSDLEASVVKEADSSRVV-DPEKRPRKRGRKPANGREEPLNHVEAERQ  535

Query  1162  RREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK  983
             RREKLNQRFYALRAVVPNVSKMDKASLLGDAIS+INELKSKLQ  ES +E L +Q+E +K
Sbjct  536   RREKLNQRFYALRAVVPNVSKMDKASLLGDAISFINELKSKLQNVESEKETLLSQVECLK  595

Query  982   KE-------------------SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQ  860
              E                   + H P        L  + K  D+DVDVKIIG DAM+R+ 
Sbjct  596   TEVLASRDHQSRSSNGGGGVQNHHHPSLEQDMNMLNGSCKQSDLDVDVKIIGRDAMVRVN  655

Query  859   CSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             CSK NHPAARLMVALK+LDL+V HASVSVVNDLMIQQATV+MGS  Y+ + LR+ L + +
Sbjct  656   CSKSNHPAARLMVALKELDLEVTHASVSVVNDLMIQQATVRMGSRYYSPDHLRMVLEAKV  715

Query  679   A  677
             +
Sbjct  716   S  716



>ref|XP_004512525.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=664

 Score =   273 bits (699),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 217/415 (52%), Positives = 256/415 (62%), Gaps = 42/415 (10%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTN----------VQGNSFPS--SITKQIVFGNENPN-----  1679
             DPS++WL DP  E +DSV+ N              S PS  ++TK + F     +     
Sbjct  253   DPSSIWLNDP--ETRDSVDNNSLAVTTTTTTNTSISIPSHNNVTKTLQFETHGSSTLTEV  310

Query  1678  PATVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDN----  1511
             P  V      N S  F + +N  E+G          +   L  K ESGEIL+FGD+    
Sbjct  311   PGAVHVSQKQNQS-FFSKEMNVLEYGASNNNNNNNQQHQRL-LKPESGEILSFGDSKKSS  368

Query  1510  --AVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSN-DEGMLSFvs------g  1358
               A   ++ S   +  S     A+ENNNN   KKR+  SRGSN D+GMLSF S       
Sbjct  369   YVANNGNSNSNFFSGQSQLVSVAEENNNNGNGKKRSPNSRGSNNDDGMLSFTSGVIVPPA  428

Query  1357  vvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHV  1178
                    G  G  GDSDHSDLEASVV+E DSSR+V EPEKRP+KRGRKPANGREEPLNHV
Sbjct  429   GSNLKFSGGTGGGGDSDHSDLEASVVKEVDSSRMV-EPEKRPRKRGRKPANGREEPLNHV  487

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELK+KLQ  ES ++ L+ +
Sbjct  488   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQKTESDKDVLEKE  547

Query  997   LESIKKESRHpppppppepPLKLAGkivdidvd-------vkiIGWDAMIRIQCSKKNHP  839
             ++ +KKE +            +        +         VKIIGWDAMIRIQCSKKNHP
Sbjct  548   IDEVKKELQKINENSSNPSQPQPLHNKPSSNKALINLDIDVKIIGWDAMIRIQCSKKNHP  607

Query  838   AARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             AARLM AL +LDL+VHHASVSVVNDLMIQQATVKMG   Y QE+LR AL+S +  
Sbjct  608   AARLMAALMELDLEVHHASVSVVNDLMIQQATVKMGGRFYTQEQLRAALSSKVGG  662



>gb|ABD59338.1| G-box element binding protein [Pisum sativum]
Length=646

 Score =   273 bits (697),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 207/403 (51%), Positives = 255/403 (63%), Gaps = 51/403 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGP---EVKDSVNTNVQGNSFPSS----ITKQIVFGNENPNPATVETQSNN  1649
             DPS++WL  PG    E++DS+NT V   S  +S    I K+  F     +    E+ +  
Sbjct  266   DPSSMWLDIPGSGGIEIRDSINT-VSAVSVTASANATIPKKSPFEIHGASTTLPESSTTV  324

Query  1648  NNS-------------QLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNA  1508
             N S               FPR LNFS                  S K ESGEILNFG++ 
Sbjct  325   NISTAQRQIQNQNQNQSFFPRELNFSG-----------------SFKPESGEILNFGESK  367

Query  1507  VKRSACSGNDAIFSGQFP-AADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsagga  1331
              K S  S N   FSG  P AA+E N       R+  SR S ++G+LSF SG ++  +   
Sbjct  368   -KSSYSSANGNFFSGPSPFAANEENRKR----RSPVSRSSIEDGILSFSSGKLLHGSTIK  422

Query  1330  ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREK  1151
              G         LE SVV++  SSRV+ EPEKRP+KRGRKPANGREEPLNHVEAERQRREK
Sbjct  423   SGGGDSDHSD-LEVSVVKKTVSSRVI-EPEKRPRKRGRKPANGREEPLNHVEAERQRREK  480

Query  1150  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--  977
             LNQRFYALRAVVPNVSKMDKASLLGDAISYINELK KLQ  ES++++L+ +L++ +KE  
Sbjct  481   LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQGLESSKDELEKELDTTRKELE  540

Query  976   ---SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDL  806
                 +        +   +   K++D+D+DVKI+GWDAMIRIQCSKKNHPAA+LM ALK+L
Sbjct  541   IATKKPVRLNEEEKEKPENNSKLIDLDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKEL  600

Query  805   DLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             DLDV+HASVSVVNDLMIQQA++ MGS  Y QE+L   L+S I 
Sbjct  601   DLDVNHASVSVVNDLMIQQASINMGSRFYTQEQLLSVLSSKIG  643



>gb|AIT39751.1| transcription factor MYC2, partial [Chrysanthemum boreale]
Length=648

 Score =   271 bits (694),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 204/403 (51%), Positives = 257/403 (64%), Gaps = 45/403 (11%)
 Frame = -2

Query  1807  DPSALWLTDP-----------GPEVKDSVN---TNVQGNSFPS---SITKQIVFGNENPN  1679
             DPS++WLTDP              +KD+V    + +  +  PS    + KQ+ F  ENPN
Sbjct  260   DPSSIWLTDPVATSVSTVTTDVTVIKDTVGVIGSEMMTSVLPSVKSHVPKQLPF--ENPN  317

Query  1678  PATVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKR  1499
               +   +S +N      R LNFS  G  GG    +N  SS + K E G+ L+FG++  KR
Sbjct  318   SLSQNPRSGHN---FGSRELNFSMEGGSGG----KNLNSSYT-KPEPGKFLSFGES--KR  367

Query  1498  SACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat  1319
             S  + N A+F G     + NNNN   KKR+ TS GSN++G+LSFVSG     A    GA 
Sbjct  368   S-ITNNGALFVGT--DNNNNNNNTNKKKRSPTSCGSNEDGILSFVSGTAKSGAVAFTGAD  424

Query  1318  gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQR  1139
              D     L+AS+++E +S RVV EPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQR
Sbjct  425   SDHSD--LDASMIKEVESIRVV-EPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQR  481

Query  1138  FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHppp  959
             FYALRAVVPNVSKMDKASLLGDAI YINELKSK+   +  +E+L+ QLE++KKE      
Sbjct  482   FYALRAVVPNVSKMDKASLLGDAILYINELKSKVDNTQCDKEELRNQLEALKKELLTKDS  541

Query  958   ppppepPLKLAGkivdidvdvki----------IGWDAMIRIQCSKKNHPAARLMVALKD  809
                    + L   +                   +GWDAMIRIQC+KKNHPAARLM   K+
Sbjct  542   RQSSSSAISLPDDMKMPTGVHSAIADLDIDVKVMGWDAMIRIQCNKKNHPAARLMAVFKE  601

Query  808   LDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             LD +V+HASVS+VNDLMIQQATVKMGS +Y+Q++LR+ALT+  
Sbjct  602   LDFEVNHASVSIVNDLMIQQATVKMGSRLYSQDQLRVALTNGF  644



>ref|XP_010530031.1| PREDICTED: transcription factor MYC4 [Tarenaya hassleriana]
Length=653

 Score =   271 bits (692),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 196/342 (57%), Positives = 236/342 (69%), Gaps = 29/342 (8%)
 Frame = -2

Query  1681  NPATVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVK  1502
             N ++VE    N  S    R LN S  GL+      +N   S   + +SGEILNF  N   
Sbjct  331   NGSSVENPGQNPQSSSLDRNLNLSSSGLN------QNGNFSDGSRPKSGEILNFCGNK--  382

Query  1501  RSACSGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSN-DEGMLSFvsgvvvpsagga  1331
                 +GN   FSGQ  F AA+ N        R+  S+GSN DEGMLSF  GVV+PS+   
Sbjct  383   ----NGNGTGFSGQTSFAAAENNKK------RSPVSKGSNNDEGMLSFTCGVVLPSSAAK  432

Query  1330  ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREK  1151
              G +  SD   +EASV +EADSSR+V EPEK+P+KRGRKPANGREEPLNHVEAERQRREK
Sbjct  433   SGDSDHSD---VEASVAKEADSSRIV-EPEKKPRKRGRKPANGREEPLNHVEAERQRREK  488

Query  1150  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESR  971
             LNQRFY+LRAVVPNVSKMDKASLLGDAISYINELKSKLQ AES +EDL+ QL  + KE  
Sbjct  489   LNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQEAESDKEDLQKQLNELNKEGS  548

Query  970   HpppppppepPLKL----AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLD  803
                  P      K     +G  +++++DVKIIGWD MIRIQCSKKNHP A+ M ALK+LD
Sbjct  549   GKDSRPQSSKDRKGLNQDSGPAMEMEIDVKIIGWDVMIRIQCSKKNHPGAKFMEALKELD  608

Query  802   LDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             L+V+HAS+SVVNDLMIQQATVKMG+    Q++L++AL + + 
Sbjct  609   LEVNHASLSVVNDLMIQQATVKMGNRFLTQDQLKVALMAKVG  650



>ref|XP_010933462.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=677

 Score =   271 bits (692),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 216/419 (52%), Positives = 257/419 (61%), Gaps = 66/419 (16%)
 Frame = -2

Query  1807  DPSALWLTDPG-PEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATV------------  1667
             DPS LWL DP   E+KDSV+  V   +  S     I F  +NP+ +T+            
Sbjct  276   DPSVLWLADPSMVEIKDSVSP-VSATAEISVTKPPIQF--DNPSSSTITESPSSVPMQQR  332

Query  1666  -----------------ETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRES  1538
                              +TQS  N      +G NFSEF ++G  A         S K E+
Sbjct  333   HNQQQQQNQNSNGNSNFQTQSFGN------KGFNFSEFVMNGSAAPS-------SFKPET  379

Query  1537  GEILNFGDNAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTT--TSRGSNDEGMLSFv  1364
             GEILNFG++    S   G     SG FP   +   ++K  KR+T  TSRGS DEGMLSF 
Sbjct  380   GEILNFGNSKRNSSPTPG-----SGLFPH-HQTAPDDKKNKRSTGATSRGSIDEGMLSFS  433

Query  1363  sgvvvpsaggaggatgdsdh------sDLEASVVREADSSRVVVepekrpkkrgrkPANG  1202
             S    PS+ G   + G          SDLEASV RE +S RVV EPEKRP+KRGRKPANG
Sbjct  434   SAPARPSSAGPVKSGGGILGGGDSDHSDLEASV-REVESGRVV-EPEKRPRKRGRKPANG  491

Query  1201  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAES  1022
             R EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI EL SKL+T ES
Sbjct  492   RSEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIKELTSKLETLES  551

Query  1021  AQEDLKTQLESIKKE----SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCS  854
              +E L+ Q+E++K E       P  PP P+  L   G+   ++++VK +G +AMIR+QC 
Sbjct  552   DKEGLQAQIETLKTERDSAPARPSQPPDPDTRLMNGGRCHGVEIEVKTLGLEAMIRVQCH  611

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             K NHPAARLM ALKDLDLDVH+ASVSVV DLMIQQATVKM   VY QE+L   L + +A
Sbjct  612   KTNHPAARLMAALKDLDLDVHYASVSVVKDLMIQQATVKMSGRVYTQEQLSAGLFARVA  670



>ref|XP_003531962.1| PREDICTED: transcription factor MYC2 [Glycine max]
Length=654

 Score =   269 bits (687),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 215/401 (54%), Positives = 252/401 (63%), Gaps = 59/401 (15%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGN-------ENPNPATVETQSNN  1649
             DPS+LWL    PE+KDS   +       S++ K + F         E P+ A      N+
Sbjct  283   DPSSLWL---NPEIKDSSTVSPPN----STVNKTMHFETPGSSTLTETPSAAAAVHVPNS  335

Query  1648  NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIF  1469
              +   FPR LNFS                  S K ESGEIL+FG++  K+S+ +G  A F
Sbjct  336   KSQGFFPRELNFSN-----------------SLKPESGEILSFGES--KKSSYNG--AFF  374

Query  1468  SGQFPAADEnnnnnknkKRT-TTSRGSNDEGMLSFvsgvvvpsaggaggatgd--sdhsD  1298
              G     + NNNN   KKR+   SR S D+GMLSF S          G   G   SDHSD
Sbjct  375   PGVVAVEENNNNNKNKKKRSPVVSRSSIDDGMLSFTSLPAANIKSVNGACVGAGDSDHSD  434

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASV ++      VVEPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  435   LEASVAKQ------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  488

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-------------  977
             VPNVSKMDKASLLGDAI YINELKSKL   +S + +L+ QL+S KKE             
Sbjct  489   VPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPPPPP  548

Query  976   --SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLD  803
                   PPP     P K   K+ D++++VKIIGWDAM+RIQCSKKNHPAARLM ALKDLD
Sbjct  549   PPPPPGPPPSNSVEPKKTTSKLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALKDLD  608

Query  802   LDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             L+VHHASVSVVNDLMIQQATV MG+  Y QE+L  AL+S +
Sbjct  609   LEVHHASVSVVNDLMIQQATVNMGNKFYTQEQLLSALSSKV  649



>ref|XP_003612909.1| BHLH transcription factor [Medicago truncatula]
 gb|AES95867.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=677

 Score =   268 bits (684),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 216/431 (50%), Positives = 258/431 (60%), Gaps = 65/431 (15%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNV----------QGNSFPS------------SITKQIVFG  1694
             DPS  W+ DP  E +DSV+ N              S PS            S+TK + F 
Sbjct  255   DPSLNWINDP--EARDSVDNNSLVTTTTAATNASISVPSHQHHNNNQNLSVSVTKTMQFE  312

Query  1693  NENPN-----PATVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
                 +     P+ V   S  NN   F + +N S++G         N+   L  K ESG+I
Sbjct  313   THGSSTLTEVPSVVHVSSKQNNQSFFSKEMNLSDYG------GSNNQQRLL--KPESGDI  364

Query  1528  LNFGDN------AVKRSACSGNDAIFSGQFPAADEnnnnnkn---kKRTTTSRGSN-DEG  1379
             L FG++      A   ++ S   +  S     A+ENNN N N   K+R+  SRGSN D+G
Sbjct  365   LCFGESKKSSYVANNGNSNSNFFSGQSQLVSVAEENNNGNGNGNGKRRSPNSRGSNNDDG  424

Query  1378  MLSFvsg-----vvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrk  1214
             MLSF SG              G   GDSDHSDLEASVV+E DSSRVV EPEK+P+KRGRK
Sbjct  425   MLSFTSGVIVPPATSNLKFSGGTGGGDSDHSDLEASVVKEVDSSRVV-EPEKKPRKRGRK  483

Query  1213  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  1034
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELK+KLQ
Sbjct  484   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQ  543

Query  1033  TAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiI-----------  887
               ES ++ L+ QL+ +K E +        +PP +   +    +                 
Sbjct  544   KTESDKDGLEKQLDGMKNEIQKINENQSHQPPQQQQQQQPIPNKPSSNQALIDLDIDVKI  603

Query  886   -GWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQE  710
              GWDAMIR+QCSKKNHPAARLM AL +LDL+VHHASVSVVNDLMIQQATVKMGS  Y QE
Sbjct  604   IGWDAMIRVQCSKKNHPAARLMAALMELDLEVHHASVSVVNDLMIQQATVKMGSRFYTQE  663

Query  709   ELRLALTSSIA  677
             +LR AL+S + 
Sbjct  664   QLRAALSSKVG  674



>gb|KHM99168.1| Transcription factor MYC2 [Glycine soja]
Length=426

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 216/399 (54%), Positives = 256/399 (64%), Gaps = 64/399 (16%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGN-------ENPNPATVETQSNN  1649
             DPS+LWL    PE++DS +T    NS   ++ K + F         + P+ A V    +N
Sbjct  64    DPSSLWL---NPEIRDS-STVAPPNS---TVNKTLQFETPGSSTLTDTPSAAAVHVPKSN  116

Query  1648  NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIF  1469
                  F R LNFS                  S K ESGEIL+FG++  K+S+ +G  + F
Sbjct  117   GQG-FFSRELNFSN-----------------SLKPESGEILSFGES--KKSSYNG--SFF  154

Query  1468  SGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs---gvvvpsaggaggatgdsdhsD  1298
              G   A +ENN       R+  SR S D+GMLSF S     +   +GGAG   GDSDHSD
Sbjct  155   PGVV-AIEENNKK-----RSPVSRSSIDDGMLSFTSLPAANIKSGSGGAGAGGGDSDHSD  208

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASV ++      VVEPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  209   LEASVAKQ------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  262

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-------------  977
             VPNVSKMDKASLLGDAISYINELK KL   +S + +L+ QL+S KKE             
Sbjct  263   VPNVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPP  322

Query  976   SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
                  PP   E   K   K+ D++++VKIIGWDAMIRIQCSKKNHPAARLM ALKDLDL+
Sbjct  323   PPPGLPPSNNEEAKKTTTKLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLE  382

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             VHHASVSVVNDLMIQQATV MG+  Y QE+L  AL+S +
Sbjct  383   VHHASVSVVNDLMIQQATVNMGNKFYTQEQLLSALSSKV  421



>ref|XP_003516794.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=637

 Score =   266 bits (680),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 218/400 (55%), Positives = 260/400 (65%), Gaps = 60/400 (15%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGN-------ENPNPATVETQSNN  1649
             DPS+LWL    PE++DS +T    NS   ++ K + F         + P+ A V    +N
Sbjct  271   DPSSLWL---NPEIRDS-STVAPPNS---TVNKTLQFETPGSSTLTDTPSAAAVHVPKSN  323

Query  1648  NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIF  1469
                  F R LNFS                  S K ESGEIL+FG++  K+S+ +G  + F
Sbjct  324   GQG-FFSRELNFSN-----------------SLKPESGEILSFGES--KKSSYNG--SFF  361

Query  1468  SGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvs---gvvvpsaggaggatgdsdhsD  1298
              G   A +ENN       R+  SR S D+GMLSF S     +   +GGAG   GDSDHSD
Sbjct  362   PGVV-AIEENNKK-----RSPVSRSSIDDGMLSFTSLPAANIKSGSGGAGAGGGDSDHSD  415

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEAS+V++ADS   V+EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  416   LEASMVKQADSR--VMEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  473

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-------------  977
             VPNVSKMDKASLLGDAISYINELK KL   +S + +L+ QL+S KKE             
Sbjct  474   VPNVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPP  533

Query  976   SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
                  PP   E   K   K+ D++++VKIIGWDAMIRIQCSKKNHPAARLM ALKDLDL+
Sbjct  534   PPPGLPPSNNEEAKKTTTKLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLE  593

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             VHHASVSVVNDLMIQQATV MG+  Y QE+L  AL+S + 
Sbjct  594   VHHASVSVVNDLMIQQATVNMGNKFYTQEQLLSALSSKVG  633



>ref|XP_009401251.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=690

 Score =   267 bits (683),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 211/416 (51%), Positives = 258/416 (62%), Gaps = 49/416 (12%)
 Frame = -2

Query  1807  DPSALWLTDPG-PEVKDSVNTNVQGNSFPSSITKQIVFGNENP-------NPAT-VETQ-  1658
             DPS LWLT+P   E+KDSV+          S+TK  +    NP       NPA+ +E Q 
Sbjct  279   DPSVLWLTEPSMVEIKDSVSPAPAAADI--SVTKLPILLESNPSSTVHIENPASSMEIQK  336

Query  1657  ------------------SNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGE  1532
                               S   +   F + LNFS F  +G  A         S K ESG+
Sbjct  337   ALYGHQQQIHHPQHQSSGSKPQSQPFFSKELNFSGFASNGSVAL-------HSVKPESGD  389

Query  1531  ILNFGDNAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv  1352
             ILNF       S      ++FS    AA  ++  N     TT+   +NDEGMLSF S   
Sbjct  390   ILNFAGGKRNSSPVPVTGSVFSHHQAAAVADDKKNSKSTGTTSMVSNNDEGMLSFSSAPT  449

Query  1351  vpsaggaggat--------gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGRE  1196
              P +     ++         DSD SDLEASV RE +S RVV EPEKRP+KRGRKPANGRE
Sbjct  450   RPPSNSQLKSSCGGGVLDGADSDQSDLEASV-REVESIRVV-EPEKRPRKRGRKPANGRE  507

Query  1195  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQ  1016
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA+SYINEL+SKLQ +E+ +
Sbjct  508   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLQASEADK  567

Query  1015  EDLKTQLESIKK--ESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNH  842
             E+L++Q+E IKK  ES    P PPP   +K+      +++DVK++G +AMIR+Q  K+NH
Sbjct  568   EELQSQMEIIKKERESAPARPAPPPRYDVKMMKGCHGVEIDVKLLGSEAMIRLQSQKRNH  627

Query  841   PAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             PAARLM AL+DLDL+VH+ASVSVV DLMIQQATV+M S VY QE+L  AL S + A
Sbjct  628   PAARLMAALQDLDLEVHYASVSVVKDLMIQQATVQMSSRVYTQEQLNAALYSRLVA  683



>gb|AET03296.2| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=648

 Score =   265 bits (676),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 211/413 (51%), Positives = 250/413 (61%), Gaps = 60/413 (15%)
 Frame = -2

Query  1807  DPSALWLTD----PGPEVKDS-VNTNV---QGNSFPSSIT--KQIVFGNENPNPATVETQ  1658
             DPS++WL D       E+++S VNT        + P++ T  K + F          ET 
Sbjct  255   DPSSVWLNDLSASAAIEIRESTVNTAAVPAMNATIPANATVGKTLPFETNGSTSTLTETT  314

Query  1657  SNN---------NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
             + N          N   F + LNFS                  S K ESGEIL+FG++  
Sbjct  315   AVNFAQRQNQNNQNHSFFLKELNFSG-----------------SMKPESGEILSFGESK-  356

Query  1504  KRSACSGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv---vvpsa  1340
             K S  +GN   FSGQ  F A +EN        ++  SR S D+GMLSF SGV        
Sbjct  357   KSSYITGNGTFFSGQSQFVAGEENRKR-----KSPISRSSIDDGMLSFTSGVVLPSSNMK  411

Query  1339  ggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQR  1160
               + G  GDSDHSDL+ S V+E +SSRVV EP KRPKKRGRKPANGREEPLNHVEAERQR
Sbjct  412   SSSRGGGGDSDHSDLDVSAVKEGESSRVV-EPGKRPKKRGRKPANGREEPLNHVEAERQR  470

Query  1159  REKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKK  980
             REKLNQ+FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  ES++ +L+ QL + KK
Sbjct  471   REKLNQKFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQGLESSKGELEKQLGATKK  530

Query  979   ESRHpppppppepPLKLAGkivdidvdv------------kiIGWDAMIRIQCSKKNHPA  836
             E          + P+ L  +                    KI+GWDAMIRIQCSKKNHPA
Sbjct  531   ELELVASKNQSQNPIPLDKEKEKTTSSTSSSKLIDLDIDVKIMGWDAMIRIQCSKKNHPA  590

Query  835   ARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             A+LM ALK+LDLDV+HASVSVVNDLMIQQA+V MGS  Y QE+L   L+S I 
Sbjct  591   AKLMAALKELDLDVNHASVSVVNDLMIQQASVNMGSRFYTQEQLLSLLSSKIG  643



>ref|XP_010919958.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=691

 Score =   263 bits (673),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 221/423 (52%), Positives = 268/423 (63%), Gaps = 64/423 (15%)
 Frame = -2

Query  1807  DPSALWLTDPG-PEVKDSVNTNVQGNSFPSSITKQ-IVFGNENP-----NPATVETQSN-  1652
             DPS LWL DP   E+KDSV+          SITK  I F N +      NP++++ Q + 
Sbjct  281   DPSMLWLADPTMVEIKDSVSPASATADI--SITKPPIQFDNPSSSTVTENPSSIQMQQHH  338

Query  1651  ----------------------NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRES  1538
                                      S    R  NF+E  L+G            + K ES
Sbjct  339   NHHQQQQQQQQQHQNQNSNSNVQTQSLFTSREFNFAEVVLNGSAPP-------QAFKPES  391

Query  1537  GEILNFGDNAVKRSACSGNDAIFS----GQFPAADEnnnnnknkKRTT--TSRGSNDEGM  1376
             GEIL FG+N  KR++     ++FS        AAD+  N      R+T  TSRGSNDEGM
Sbjct  392   GEILTFGNN--KRNSSPAPSSLFSHHQIATVTAADDKKNK-----RSTGATSRGSNDEGM  444

Query  1375  LSFvsgvvvpsaggaggat------gdsdhsDLEASVVREADSSRVVVepekrpkkrgrk  1214
             LSF S    PS+ G   +        DSDHSDLEASV RE +SS VV EPEKRP+KRGRK
Sbjct  445   LSFSSAAARPSSAGQVKSGGGILGGADSDHSDLEASV-REVESSPVV-EPEKRPRKRGRK  502

Query  1213  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  1034
             PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+SKLQ
Sbjct  503   PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRSKLQ  562

Query  1033  TAESAQEDLKTQLESIKKE--SRHpppppppepPLKL--AGkivdidvdvkiIGWDAMIR  866
             + ES +E L+TQ+E++K+E  S    P   P+  +K+   G+   ++++VKI+G +AMIR
Sbjct  563   SLESDKEGLQTQIEALKRERDSNPARPLQLPDQDMKMMNGGRCHGVEIEVKILGVEAMIR  622

Query  865   IQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTS  686
             +QC K+NHPAARLM ALK+LDLDV++ASVSVV DLMIQQATVKM S VY QE+L  AL S
Sbjct  623   VQCHKRNHPAARLMAALKELDLDVYYASVSVVKDLMIQQATVKMSSRVYTQEQLSAALFS  682

Query  685   SIA  677
              + 
Sbjct  683   RVG  685



>ref|XP_003628820.1| Transcription factor MYC2 [Medicago truncatula]
Length=648

 Score =   262 bits (669),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 210/413 (51%), Positives = 249/413 (60%), Gaps = 60/413 (15%)
 Frame = -2

Query  1807  DPSALWLTD----PGPEVKDS-VNTNV---QGNSFPSSIT--KQIVFGNENPNPATVETQ  1658
             DPS++WL D       E+++S VNT        + P++ T  K + F          ET 
Sbjct  255   DPSSVWLNDLSASAAIEIRESTVNTAAVPAMNATIPANATVGKTLPFETNGSTSTLTETT  314

Query  1657  SNN---------NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
             + N          N   F + LNFS                  S K ESGEIL+FG++  
Sbjct  315   AVNFAQRQNQNNQNHSFFLKELNFSG-----------------SMKPESGEILSFGESK-  356

Query  1504  KRSACSGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv---vvpsa  1340
             K S  +GN   FSGQ  F A +EN        ++  SR S D+GMLSF SGV        
Sbjct  357   KSSYITGNGTFFSGQSQFVAGEENRKR-----KSPISRSSIDDGMLSFTSGVVLPSSNMK  411

Query  1339  ggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQR  1160
               + G  GDSDHSDL+ S V+E +SSRVV EP KRPKKRGRKPANGREEPLNHVEAERQR
Sbjct  412   SSSRGGGGDSDHSDLDVSAVKEGESSRVV-EPGKRPKKRGRKPANGREEPLNHVEAERQR  470

Query  1159  REKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKK  980
             REKLNQ+FYALRAVVPN SKMDKASLLGDAISYINELKSKLQ  ES++ +L+ QL + KK
Sbjct  471   REKLNQKFYALRAVVPNGSKMDKASLLGDAISYINELKSKLQGLESSKGELEKQLGATKK  530

Query  979   ESRHpppppppepPLKLAGkivdidvdv------------kiIGWDAMIRIQCSKKNHPA  836
             E          + P+ L  +                    KI+GWDAMIRIQCSKKNHPA
Sbjct  531   ELELVASKNQSQNPIPLDKEKEKTTSSTSSSKLIDLDIDVKIMGWDAMIRIQCSKKNHPA  590

Query  835   ARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             A+LM ALK+LDLDV+HASVSVVNDLMIQQA+V MGS  Y QE+L   L+S I 
Sbjct  591   AKLMAALKELDLDVNHASVSVVNDLMIQQASVNMGSRFYTQEQLLSLLSSKIG  643



>gb|EEC67493.1| hypothetical protein OsI_34761 [Oryza sativa Indica Group]
Length=664

 Score =   262 bits (669),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 206/433 (48%), Positives = 258/433 (60%), Gaps = 64/433 (15%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNT-NVQGNSFPSSITKQIV-FGN-------ENPNPAT-VET  1661
             DPS LWL D  P ++KDS++  ++  +  P     QI  F N       ENP+P+    T
Sbjct  233   DPSVLWLADAPPMDMKDSISAADISVSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPT  292

Query  1660  QSNNNNSQL---------------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEIL  1526
              S                      F R LNFS+F  +GG AA          K E+GEIL
Sbjct  293   PSQPAAPPQRQQQQQQSSQAQQGPFRRELNFSDFASNGGAAA------PPFFKPETGEIL  346

Query  1525  NFG-DNAVKR------------SACSGNDAIFSGQFP----AADEnnnnnknkKRTTTSR  1397
             NFG D++  R            S  +   ++FS   P    AA++  +NN+ +    TSR
Sbjct  347   NFGNDSSTGRRNPSPAPPAATASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSR  406

Query  1396  GSN---------DEGMLSFvsgvvvpsagga-ggatgdsdhsDLEASVVREADSSRVVVe  1247
              SN         +EGMLSF S      + G    A  +SDHSDLEASV RE +SSRVV  
Sbjct  407   ASNTNNHPAATANEGMLSFSSAPTTRPSTGTGAPAKSESDHSDLEASV-REVESSRVVAP  465

Query  1246  pekrpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  1076
             P +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG
Sbjct  466   PPEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  525

Query  1075  DAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdv  896
             DAISYINEL+ KL   E+ +E L++Q+ES+KKE R   PP P         +   ++++ 
Sbjct  526   DAISYINELRGKLTALETDKETLQSQMESLKKE-RDARPPAPSGGGGDGGARCHAVEIEA  584

Query  895   kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYN  716
             KI+G +AMIR+QC K+NHPAARLM AL++LDLDV+HASVSVV DLMIQQ  VKM S VY+
Sbjct  585   KILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYS  644

Query  715   QEELRLALTSSIA  677
             Q++L  AL + IA
Sbjct  645   QDQLNAALYTRIA  657



>ref|XP_008796257.1| PREDICTED: transcription factor MYC4 [Phoenix dactylifera]
Length=687

 Score =   262 bits (669),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 219/428 (51%), Positives = 264/428 (62%), Gaps = 74/428 (17%)
 Frame = -2

Query  1807  DPSALWLTDPG-PEVKDSVNTNVQGNSFPSSITKQIVFGN-----ENPNPATVETQSNN-  1649
             DPS LWL DP   E+KDS++        P+S T  I         +NP+ +TV    ++ 
Sbjct  277   DPSVLWLADPTMVEIKDSIS--------PASATADISVTKPPIQFDNPSSSTVTENPSSI  328

Query  1648  ----------------------------NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLS  1553
                                           S    R  NFSE  L+G            S
Sbjct  329   QMQRHHNQHQQQRQQHENQNSNSNSNLQTQSLFAAREFNFSEVVLNG-------PAPPQS  381

Query  1552  CKRESGEILNFGDNAVKRSACSGNDAIFS----GQFPAADEnnnnnknkKRTT--TSRGS  1391
              K ESG+IL FGD+    S   G+ ++FS       PAAD+  N      R+T  TSRGS
Sbjct  382   FKPESGDILTFGDSKRNSSPAPGS-SLFSHHQIATVPAADDKKNK-----RSTGATSRGS  435

Query  1390  NDEGMLSFvsgvvvpsaggaggat------gdsdhsDLEASVVREADSSRVVVepekrpk  1229
             NDEGMLSF S    PS+ G   +        DSDHSDLEASV RE +SS  VVEPEKRP+
Sbjct  436   NDEGMLSFSSAAARPSSAGQAKSGGGILGGADSDHSDLEASV-REVESS-PVVEPEKRPR  493

Query  1228  krgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL  1049
             KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL
Sbjct  494   KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL  553

Query  1048  KSKLQTAESAQEDLKTQLESIK--KESRHpppppppepPLKL--AGkivdidvdvkiIGW  881
             +SKLQ+ ES +E L+ Q++S+K  ++S    P   P+   K+   G+   ++++VKI+G 
Sbjct  554   RSKLQSLESDKEGLQAQIDSLKRDRDSSPARPLQLPDQDAKMMNGGRCHGVEIEVKILGL  613

Query  880   DAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELR  701
             +AMIR+QC KKNHPAARLM ALKDLDLDV++ASVSVV DLMIQQ TVKM S VY+QE+L 
Sbjct  614   EAMIRVQCHKKNHPAARLMAALKDLDLDVYYASVSVVKDLMIQQTTVKMPSRVYSQEQLS  673

Query  700   LALTSSIA  677
              AL S + 
Sbjct  674   AALFSRVG  681



>gb|AAK00453.1|AC060755_23 putative MYC transcription factor [Oryza sativa Japonica Group]
Length=688

 Score =   261 bits (666),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 204/433 (47%), Positives = 257/433 (59%), Gaps = 64/433 (15%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNT-NVQGNSFPSSITKQIV-FGN-------ENPNPAT-VET  1661
             DPS LWL D  P ++KDS++  ++  +  P     QI  F N       ENP+P+    T
Sbjct  257   DPSVLWLADAPPMDMKDSISAADISVSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPT  316

Query  1660  QSNNNNSQL---------------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEIL  1526
              S                      F R LNFS+F  +GG AA          K E+GEIL
Sbjct  317   PSQPAAPPQRQQQQQQSSQAQQGPFRRELNFSDFASNGGAAA------PPFFKPETGEIL  370

Query  1525  NFGDNA-------------VKRSACSGNDAIFSGQFP----AADEnnnnnknkKRTTTSR  1397
             NFG+++                S  +   ++FS   P    AA++  +NN+ +    TSR
Sbjct  371   NFGNDSSSGRRNPSPAPPAATASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSR  430

Query  1396  GSN---------DEGMLSFvsgvvvpsagga-ggatgdsdhsDLEASVVREADSSRVVVe  1247
              SN         +EGMLSF S      + G    A  +SDHSDLEASV RE +SSRVV  
Sbjct  431   ASNTNNHPAATANEGMLSFSSAPTTRPSTGTGAPAKSESDHSDLEASV-REVESSRVVAP  489

Query  1246  pekrpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  1076
             P +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG
Sbjct  490   PPEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  549

Query  1075  DAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdv  896
             DAISYINEL+ KL   E+ +E L++Q+ES+KKE R   PP P         +   ++++ 
Sbjct  550   DAISYINELRGKLTALETDKETLQSQMESLKKE-RDARPPAPSGGGGDGGARCHAVEIEA  608

Query  895   kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYN  716
             KI+G +AMIR+QC K+NHPAARLM AL++LDLDV+HASVSVV DLMIQQ  VKM S VY+
Sbjct  609   KILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYS  668

Query  715   QEELRLALTSSIA  677
             Q++L  AL + IA
Sbjct  669   QDQLNAALYTRIA  681



>ref|NP_001065478.1| Os10g0575000 [Oryza sativa Japonica Group]
 gb|AAS66204.1| MYC protein [Oryza sativa]
 gb|ABB48017.1| transcription factor MYC7E, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27315.1| Os10g0575000 [Oryza sativa Japonica Group]
Length=699

 Score =   260 bits (665),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 204/433 (47%), Positives = 257/433 (59%), Gaps = 64/433 (15%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNT-NVQGNSFPSSITKQIV-FGN-------ENPNPAT-VET  1661
             DPS LWL D  P ++KDS++  ++  +  P     QI  F N       ENP+P+    T
Sbjct  268   DPSVLWLADAPPMDMKDSISAADISVSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPT  327

Query  1660  QSNNNNSQL---------------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEIL  1526
              S                      F R LNFS+F  +GG AA          K E+GEIL
Sbjct  328   PSQPAAPPQRQQQQQQSSQAQQGPFRRELNFSDFASNGGAAA------PPFFKPETGEIL  381

Query  1525  NFGDNA-------------VKRSACSGNDAIFSGQFP----AADEnnnnnknkKRTTTSR  1397
             NFG+++                S  +   ++FS   P    AA++  +NN+ +    TSR
Sbjct  382   NFGNDSSSGRRNPSPAPPAATASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSR  441

Query  1396  GSN---------DEGMLSFvsgvvvpsagga-ggatgdsdhsDLEASVVREADSSRVVVe  1247
              SN         +EGMLSF S      + G    A  +SDHSDLEASV RE +SSRVV  
Sbjct  442   ASNTNNHPAATANEGMLSFSSAPTTRPSTGTGAPAKSESDHSDLEASV-REVESSRVVAP  500

Query  1246  pekrpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  1076
             P +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG
Sbjct  501   PPEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  560

Query  1075  DAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdv  896
             DAISYINEL+ KL   E+ +E L++Q+ES+KKE R   PP P         +   ++++ 
Sbjct  561   DAISYINELRGKLTALETDKETLQSQMESLKKE-RDARPPAPSGGGGDGGARCHAVEIEA  619

Query  895   kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYN  716
             KI+G +AMIR+QC K+NHPAARLM AL++LDLDV+HASVSVV DLMIQQ  VKM S VY+
Sbjct  620   KILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYS  679

Query  715   QEELRLALTSSIA  677
             Q++L  AL + IA
Sbjct  680   QDQLNAALYTRIA  692



>gb|AAF04917.1|AF011557_1 jasmonic acid 3 [Solanum lycopersicum]
Length=326

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 216/274 (79%), Gaps = 12/274 (4%)
 Frame = -2

Query  1636  LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQ-  1460
              F R LNFSEFG DG  ++ RN  SS+SCK ESGEILNFGD + K+SA S N  +F+GQ 
Sbjct  24    FFTRELNFSEFGFDG--SSNRNGNSSVSCKPESGEILNFGD-STKKSASSANVNLFTGQS  80

Query  1459  -FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggag-gatgdsdhsDLEAS  1286
              F    E NNN   + + +  RGSN+EGMLSFVSG V             DS+HSDLEAS
Sbjct  81    QFWGLGEENNNKNQE-KISYFRGSNEEGMLSFVSGTVCFFGHEVRWRRRQDSEHSDLEAS  139

Query  1285  VVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  1106
             VV+EADSSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRF++LRAVVPNV
Sbjct  140   VVKEADSSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFFSLRAVVPNV  198

Query  1105  SKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLA  926
             SKMDKASLLGDAISYINELKSKLQ  ES +EDLK+Q+E +KKESR P PPPPP   LK++
Sbjct  199   SKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPPPPNQDLKMS  258

Query  925   ----GkivdidvdvkiIGWDAMIRIQCSKKNHPA  836
                 GKIVD+D+DVKIIGWDAMIRIQC+KKNHPA
Sbjct  259   SHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPA  292



>gb|EPS60924.1| hypothetical protein M569_13876, partial [Genlisea aurea]
Length=539

 Score =   255 bits (651),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 214/332 (64%), Gaps = 27/332 (8%)
 Frame = -2

Query  1627  RGLNFSEFGLDGGG-----AAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSG  1463
             R LNFS+F  +          +RN  +S  CK +SGEILNFGDN  +       D  FS 
Sbjct  219   RDLNFSDFRFNSSNNSSTMTMMRNIGNS-PCKHQSGEILNFGDNTAQM------DNYFSS  271

Query  1462  QFPAADEnnnnnknkKRTTTSRGSNDEGM-LSFvsgvvv-psaggaggatgdsdhsDLEA  1289
                A  +     K   R  TS+GS++EG  LSF S V+   S+        +SDHSD+EA
Sbjct  272   VVQADSDAIRAKK---RYPTSKGSSNEGGGLSFTSVVIAPSSSATLKADKVESDHSDMEA  328

Query  1288  SVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN  1109
             SVV+EA+SSR  +   +  K+  +  ANGREEPLNHVEAERQRREKLNQ+FYALRAVVPN
Sbjct  329   SVVKEAESSRAALPERRPRKRGRKP-ANGREEPLNHVEAERQRREKLNQKFYALRAVVPN  387

Query  1108  VSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK--------KESRHppppp  953
             VSKMDKASLLGDAISYINEL+++LQ +E   +DLK+Q+ES+          ES+ P    
Sbjct  388   VSKMDKASLLGDAISYINELRTQLQNSEMDMQDLKSQIESLNNHHHLPLPHESKRPRKCE  447

Query  952   ppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSV  773
               E      G+         I   DAMIRIQCSKKNHPAA+LM A ++LDLD+HHAS+SV
Sbjct  448   EGES-FTATGEDAVDIEVKIIGRDDAMIRIQCSKKNHPAAKLMTAFRELDLDLHHASLSV  506

Query  772   VNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
              N+ MIQQATVKMGS  ++Q++LRLAL S IA
Sbjct  507   ANEFMIQQATVKMGSRYFSQDQLRLALMSKIA  538



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score =   255 bits (652),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 180/335 (54%), Positives = 216/335 (64%), Gaps = 46/335 (14%)
 Frame = -2

Query  1669  VETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSAC  1490
             V++Q+ N     F R +NFS              ++S   K  SGEIL+FG++A KRS+ 
Sbjct  322   VQSQTQNTKYNNFSREINFST-------------SNSNLAKPRSGEILSFGEDA-KRSSS  367

Query  1489  SGNDAIFSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatg  1316
             + N A FSGQ  F   D         KR T S G  ++G+LSF                 
Sbjct  368   NLNPAPFSGQTQFLPGD--------TKRKTKSVGVTEDGVLSFGVPGESSDHSD------  413

Query  1315  dsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRF  1136
                   LEASVV+EA   +       RP+KRGRKPANGREEPLNHVEAERQRREKLNQRF
Sbjct  414   ------LEASVVKEAAPEK-------RPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  460

Query  1135  YALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SRHpp  962
             YALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  ES +  ++ QLE++K E   R+  
Sbjct  461   YALRAVVPNVSKMDKASLLGDAISYINELKSKLQRTESEKTQIECQLENLKSELAGRNAN  520

Query  961   pppppepPLKLA-GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHA  785
                        A  K + ++++VKIIGWDAMIRI+ SK+NHPAARLM ALKDL+L+V+HA
Sbjct  521   AGNRDCGDSSSAVSKPIGMEIEVKIIGWDAMIRIESSKRNHPAARLMSALKDLELEVNHA  580

Query  784   SVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             S+SVVNDLMIQQATVKMG  +Y QE+LR AL S I
Sbjct  581   SMSVVNDLMIQQATVKMGFRIYTQEQLRAALISKI  615



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score =   255 bits (652),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 184/391 (47%), Positives = 234/391 (60%), Gaps = 58/391 (15%)
 Frame = -2

Query  1798  ALWLTDPGPEVKDSVNTNVQGNSFPSS----ITKQIVFGN-------ENPNPATVETQSN  1652
             ++W++DP   +     TN  G+  PSS     +K ++  N       ENPNP  V + + 
Sbjct  264   SMWISDP---ICGEPGTNEPGHGAPSSNSQLFSKSLLMENGSSSPITENPNPTLVHSLTQ  320

Query  1651  NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
             N     F R +NFS               S+L+  R SGEILNFG++A KR   + N  +
Sbjct  321   NLKYNDFSREINFSTL------------NSNLARPR-SGEILNFGEDA-KRCPGNPNPGL  366

Query  1471  FSGQ--FPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsD  1298
             +SGQ  F  +D         KR T S G  ++ +LSF                       
Sbjct  367   YSGQSQFLTSD--------IKRKTKSIGITEDTVLSFGVAGDKSGDSDHSD---------  409

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EA   +       RP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  410   LEASVVKEAVPEK-------RPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  462

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE----SRHpppppp  950
             VPNVSKMDKASLLGDAI+YINELKSKLQ  ES +  ++ Q+ES+K E    + +      
Sbjct  463   VPNVSKMDKASLLGDAIAYINELKSKLQKVESEKTQVECQVESLKGELAGQNANAGVVGD  522

Query  949   pepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVV  770
                      K   ++++VKIIGWDAMIRI+ SK+N+PAARLM AL+DL+L+V+HAS+SVV
Sbjct  523   VGDSYSSVSKRTGVEIEVKIIGWDAMIRIESSKRNYPAARLMSALRDLELEVNHASMSVV  582

Query  769   NDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             NDLM+QQATVKMG  +Y Q++LR  L S   
Sbjct  583   NDLMVQQATVKMGFRIYTQDQLRAGLISKFG  613



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   254 bits (648),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 194/400 (49%), Positives = 239/400 (60%), Gaps = 75/400 (19%)
 Frame = -2

Query  1807  DPSALWLTDP--GPEVKDSVN-----------TNVQ-GNSFPSSITKQIVFGNENPNPAT  1670
             DPS +W+ DP   PE  + VN            ++Q  N   S+IT+     N +P P+ 
Sbjct  278   DPS-MWINDPIGAPESNEPVNGAPSSSSQLFSKSIQFENGSSSTITEN---PNPDPTPSP  333

Query  1669  VETQSNN---NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKR  1499
             V +Q+ N   NN+  F R LNFS              +SS   K  SGEILNFGD+  KR
Sbjct  334   VHSQTQNPKFNNT--FSRKLNFST-------------SSSTLVKPRSGEILNFGDDG-KR  377

Query  1498  SACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat  1319
             S+ + + + +SGQ           + + +   S   N++ +LSF       S        
Sbjct  378   SSVNPDPSSYSGQ----------TQFENKRKKSMVLNEDKVLSFGDKTAGESDHSD----  423

Query  1318  gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQR  1139
                    LEASVV+E       V  EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQR
Sbjct  424   -------LEASVVKE-------VAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQR  469

Query  1138  FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK------KE  977
             FYALRAVVPNVSKMDKASLLGDAISYINELKSK+   ES +  +K QLE +K      K 
Sbjct  470   FYALRAVVPNVSKMDKASLLGDAISYINELKSKVVKTESEKIQIKNQLEEVKLELAGRKA  529

Query  976   SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
             S            +K  G    ++++VKIIGWDAMIR++ SK+NHPAARLM AL DL+L+
Sbjct  530   SASGGDMSSSCSSIKPVG----MEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELE  585

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  586   VNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  625



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score =   253 bits (645),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 189/397 (48%), Positives = 232/397 (58%), Gaps = 75/397 (19%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSS----ITKQIVFGN--------ENPNP----  1676
             DP+ +W+ DP       +    QGN  PSS      K I F N        ENPNP    
Sbjct  264   DPT-MWINDP-------IGVAEQGNGAPSSSSQLFAKSIQFENGGSSSTIIENPNPDPAP  315

Query  1675  ATVETQSNNNN-SQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKR  1499
             + V +Q+ N   S  F R LNFS              +S+   K   GEIL+FGD   KR
Sbjct  316   SPVHSQTQNPKFSNNFSRELNFST-------------SSTTLVKPRPGEILSFGDEG-KR  361

Query  1498  SACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggat  1319
             S+ + + + +SGQ    ++              + S D+ +L+F +G             
Sbjct  362   SSVNPDPSSYSGQTQFENKR-------------KKSIDDKVLTFGTGGGESDHSD-----  403

Query  1318  gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQR  1139
                    LEASVV+E    R        PKKRGRKPANGREEPLNHVEAERQRREKLNQR
Sbjct  404   -------LEASVVKEIPEKR--------PKKRGRKPANGREEPLNHVEAERQRREKLNQR  448

Query  1138  FYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SRHp  965
             FYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +KTQLE +K E   R  
Sbjct  449   FYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGRKA  508

Query  964   ppppppepPLKL-AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHH  788
                        + A K V ++++VKIIGWDAMIR++ SK+NHPAARLM AL DL+L+V+H
Sbjct  509   SAGGDLSSSCSMTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNH  568

Query  787   ASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             AS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  569   ASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  605



>ref|XP_006283348.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
 gb|EOA16246.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
Length=614

 Score =   252 bits (643),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 188/239 (79%), Gaps = 7/239 (3%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             NDEGMLSF S +  P+  G    +       LEASVV+EA+S+R VVEPEK+P+KRGRKP
Sbjct  379   NDEGMLSFTSVLPRPAKSGDSNHSD------LEASVVKEAESNRTVVEPEKKPRKRGRKP  432

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFY+LRAVVPN+SKMDKASLLGDAISYINELKSKLQ 
Sbjct  433   ANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNISKMDKASLLGDAISYINELKSKLQK  492

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPL-KLAGkivdidvdvkiIGWDAMIRIQCS  854
              ES +E+L+ Q+E + KE+ +            + +G  ++++VDVKIIGWDAMIR+QCS
Sbjct  493   VESDKEELQKQIEGMSKEAANEKSYVKERKCANQESGVTIEMEVDVKIIGWDAMIRVQCS  552

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             K+NHP A+ M ALK+LDL+V+HAS+SVVNDLMIQQATVKMG   + Q++L++AL   + 
Sbjct  553   KRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGKEFFTQDQLKVALMEKVG  611



>ref|XP_008786336.1| PREDICTED: transcription factor MYC2-like [Phoenix dactylifera]
Length=680

 Score =   252 bits (644),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 206/404 (51%), Positives = 253/404 (63%), Gaps = 53/404 (13%)
 Frame = -2

Query  1807  DPSALWLTDPG-PEVKDSVNTNVQGNSFPSSITKQ-IVFGNENPN-----PATVETQSNN  1649
             DPS LWL DP   E+KDSV+          S+TK  I   N + +     P++++ Q  +
Sbjct  276   DPSVLWLADPSMVEIKDSVSPGPATAEI--SVTKSPIQLDNRSSSTITESPSSIQMQQRH  333

Query  1648  NNSQ----------------LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFG  1517
             N  +                L  RG  FSEF ++G            S K ESGEILNFG
Sbjct  334   NQQKHQNQNSNGTSNFQTQSLCTRGFTFSEFAMNGSAPPP-------SLKPESGEILNFG  386

Query  1516  DNAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTT--TSRGSNDEGMLSFvsgvvvps  1343
              N+ + S+ +    + S Q  AA      +KN KR+T  TSRGS+DEGMLSF S    PS
Sbjct  387   -NSKRNSSPAPGSGLLSHQQTAA----TGDKNNKRSTGATSRGSSDEGMLSFSSAPARPS  441

Query  1342  aggaggatgdsd------hsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNH  1181
             + G   + G         HSDLEASV RE +S  +VVEPEKRP+KRGRKPANGR EPLNH
Sbjct  442   SAGQAKSVGGIAGGGDSDHSDLEASV-REVESG-LVVEPEKRPRKRGRKPANGRLEPLNH  499

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI EL +K +T ES +E L+ 
Sbjct  500   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIKELATKQETLESEKEGLQA  559

Query  1000  QLESIK----KESRHpppppppepPLKL--AGkivdidvdvkiIGWDAMIRIQCSKKNHP  839
             Q+E +K     +S    P   P+P  +L   G+   ++++VK +G +AMIR+QC K NHP
Sbjct  560   QIEILKTARDSDSAPARPSQQPDPDTRLMNGGRCHGVEIEVKTLGLEAMIRVQCHKTNHP  619

Query  838   AARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEE  707
             AARLM ALK+LDLDV++A VSVV DLMIQQATVKM   VY QE+
Sbjct  620   AARLMAALKELDLDVYYAMVSVVKDLMIQQATVKMSGRVYTQEQ  663



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score =   250 bits (638),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 227/388 (59%), Gaps = 56/388 (14%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNTNVQGNSFPSSITKQ---IVFGNENPNPATVETQSNNN  1646
             DPS  W++DP   GP       TN  G+  PSS ++     +  N NPNP   +TQ+   
Sbjct  261   DPST-WISDPTDLGP------GTNESGHGAPSSSSQLFSSTITENLNPNPVYSQTQNPKY  313

Query  1645  NSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFS  1466
             N+  F R +N                T+S+     SGEIL+FG++A + S          
Sbjct  314   NN--FSREINCWT-------------TNSILAMPRSGEILSFGEDAKRGSGPKPGPYSCQ  358

Query  1465  GQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEAS  1286
              QF ++D       +K++TT S   N++G+LSF                       LEAS
Sbjct  359   TQFLSSD-------SKRKTTKSIRINEDGVLSFGFTGEKFGDSDHSD---------LEAS  402

Query  1285  VVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  1106
             VV+EA   +       RP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV
Sbjct  403   VVKEAAPEK-------RPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNV  455

Query  1105  SKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SRHpppppppepPLK  932
             SKMDKASLLGDAISYINELKSKLQ AES +   + QLE++K+E   RH            
Sbjct  456   SKMDKASLLGDAISYINELKSKLQRAESDKTQFQCQLENLKRELAGRHANANAGILDASD  515

Query  931   LAGkivdidvdvkiIG---WDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
              +  +         +    WDAMIRI+ SK+NHPAARLM ALK+L+L+V+HASVSVVNDL
Sbjct  516   SSSAVSKPIGMEIEVKIIEWDAMIRIESSKRNHPAARLMTALKELELEVNHASVSVVNDL  575

Query  760   MIQQATVKMGSHVYNQEELRLALTSSIA  677
             MIQQATVK+G   Y QE+L+ AL S I 
Sbjct  576   MIQQATVKLGFRPYTQEQLKAALISKIG  603



>gb|AAL55711.1|AF251689_1 putative transcription factor BHLH4 [Arabidopsis thaliana]
Length=589

 Score =   249 bits (637),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 189/239 (79%), Gaps = 12/239 (5%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             N+EGMLSF S +   S               LEASV +EA+S+RVVVEPEK+P+KRGRKP
Sbjct  359   NEEGMLSFTSVLPCDSNHSD-----------LEASVAKEAESNRVVVEPEKKPRKRGRKP  407

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYI+ELKSKLQ 
Sbjct  408   ANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYISELKSKLQK  467

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPL-KLAGkivdidvdvkiIGWDAMIRIQCS  854
             AES +E+L+ Q++ + KE+ +          L + +  +++++VDVKIIGWDAMIRIQCS
Sbjct  468   AESDKEELQKQIDVMNKEAGNAKSSVKDRKCLNQESSVLIEMEVDVKIIGWDAMIRIQCS  527

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             K+NHP A+ M ALK+LDL+V+HAS+SVVNDLMIQQATVKMG+  + Q++L++ALT  + 
Sbjct  528   KRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNQFFTQDQLKVALTEKVG  586



>ref|NP_193522.1| transcription factor MYC4 [Arabidopsis thaliana]
 sp|O49687.1|MYC4_ARATH RecName: Full=Transcription factor MYC4; Short=AtMYC4; AltName: 
Full=Basic helix-loop-helix protein 4; Short=AtbHLH4; Short=bHLH 
4; AltName: Full=Transcription factor EN 37; AltName: 
Full=bHLH transcription factor bHLH004 [Arabidopsis thaliana]
 emb|CAA17131.1| bHLH protein-like [Arabidopsis thaliana]
 emb|CAB78790.1| bHLH protein-like [Arabidopsis thaliana]
 dbj|BAD94748.1| putative transcription factor BHLH4 [Arabidopsis thaliana]
 gb|AEE83960.1| transcription factor MYC4 [Arabidopsis thaliana]
Length=589

 Score =   249 bits (636),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 189/239 (79%), Gaps = 12/239 (5%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             N+EGMLSF S +   S               LEASV +EA+S+RVVVEPEK+P+KRGRKP
Sbjct  359   NEEGMLSFTSVLPCDSNHSD-----------LEASVAKEAESNRVVVEPEKKPRKRGRKP  407

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYI+ELKSKLQ 
Sbjct  408   ANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYISELKSKLQK  467

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPL-KLAGkivdidvdvkiIGWDAMIRIQCS  854
             AES +E+L+ Q++ + KE+ +          L + +  +++++VDVKIIGWDAMIRIQCS
Sbjct  468   AESDKEELQKQIDVMNKEAGNAKSSVKDRKCLNQESSVLIEMEVDVKIIGWDAMIRIQCS  527

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             K+NHP A+ M ALK+LDL+V+HAS+SVVNDLMIQQATVKMG+  + Q++L++ALT  + 
Sbjct  528   KRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNQFFTQDQLKVALTEKVG  586



>ref|XP_010538501.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=646

 Score =   250 bits (639),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 231/322 (72%), Gaps = 29/322 (9%)
 Frame = -2

Query  1621  LNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQ--FPAA  1448
             LN S  GL+      +N       + +SGEIL    ++ KR+   GN   +SGQ  F A 
Sbjct  344   LNLSSSGLN------QNGNYPDGSRPKSGEILT---SSEKRN---GNGTGYSGQTSFMAG  391

Query  1447  DEnnnnnknkKRTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREA  1271
             D       NKKR+  S+GSN +EGMLSF  GVV+PSA    G +  SD   +EASV +EA
Sbjct  392   D------SNKKRSPVSKGSNNEEGMLSFTCGVVIPSAAAKSGDSDHSD---VEASVAKEA  442

Query  1270  DSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  1091
             DS R V EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK
Sbjct  443   DSGRTV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDK  501

Query  1090  ASLLGDAISYINELKSKLQTAESAQEDLKTQL--ESIKKESRHpppppppepPL--KLAG  923
             ASL+GDAISYI+ELKSKLQTAES +E+L+ QL  E   K+SR        +  +  + +G
Sbjct  502   ASLIGDAISYISELKSKLQTAESDKEELRQQLNKEESGKDSRPQQRSKDRKGVITNQDSG  561

Query  922   kivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQAT  743
               +++++DVKIIGWD MIRIQC KKNHP A+ M ALKDLDL+V+HAS+SVVNDLMIQQAT
Sbjct  562   LAIEMEIDVKIIGWDVMIRIQCGKKNHPGAKFMEALKDLDLEVNHASLSVVNDLMIQQAT  621

Query  742   VKMGSHVYNQEELRLALTSSIA  677
             VKMG+  ++Q++L+ AL + + 
Sbjct  622   VKMGNRFFSQDQLKRALMAKVG  643



>gb|KFK45000.1| hypothetical protein AALP_AA1G331100 [Arabis alpina]
Length=610

 Score =   248 bits (634),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 175/382 (46%), Positives = 222/382 (58%), Gaps = 57/382 (15%)
 Frame = -2

Query  1783  DPGPEVKDSVNTNVQGNSFPSSITKQIVFGN--------ENPNPATVETQSNN---NNSQ  1637
             DPG  + + V  +  G+S     +K + F N        ENPNP+ V +Q+ N   NN  
Sbjct  273   DPGLWINEPVGVSEPGHS-SQLFSKSVPFENGGSSSTITENPNPSPVHSQTQNPKFNNG-  330

Query  1636  LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQF  1457
              F R LNFS            N +++L  K  SGEIL+FGD+  KRS+ + + + +SGQ 
Sbjct  331   -FGRELNFS------------NSSTTL-VKPRSGEILSFGDD--KRSSGNPDPSSYSGQ-  373

Query  1456  PAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVR  1277
                        +  +   + G  D+ +LSF                       LEASVV+
Sbjct  374   --------TQFDNNKRKKTTGLTDDKVLSFGGKDKTGVESDHSD---------LEASVVK  416

Query  1276  EADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKM  1097
             E    +      K         ANGR+EPLNHVEAERQRREKLNQRFYALRAVVPNVSKM
Sbjct  417   EIPEKKPKKRGRKP--------ANGRDEPLNHVEAERQRREKLNQRFYALRAVVPNVSKM  468

Query  1096  DKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SRHpppppppepPLKLAG  923
             DKASLLGDAISYINELKSK+   ES +  ++ QLE +K E   R              A 
Sbjct  469   DKASLLGDAISYINELKSKVTKTESEKTQIRNQLEEVKSELAERKASANGGDLTATTTAI  528

Query  922   kivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQAT  743
             K V ++++VKIIGWDAMIR++ SK+NHPAARLM AL +L+L+V+HAS+SVVNDLMIQQAT
Sbjct  529   KAVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMELELEVNHASMSVVNDLMIQQAT  588

Query  742   VKMGSHVYNQEELRLALTSSIA  677
             VKMG  +Y QE+LR +L S I 
Sbjct  589   VKMGFRIYTQEQLRASLISKIG  610



>ref|XP_010053608.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=614

 Score =   248 bits (634),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 197/395 (50%), Positives = 252/395 (64%), Gaps = 45/395 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSN--------  1652
             DP++LW+ DP           ++ N  P      + F  ENP+ +++    +        
Sbjct  246   DPASLWICDP--------PVTMEINDRP------MTFQIENPSSSSLTESPSAICAINDQ  291

Query  1651  ------NNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSAC  1490
                     N   F + LNF+E+ ++   ++  N   S   K ES E+LNFGD+   R   
Sbjct  292   QSGQNQQQNEGFFAKELNFAEYAINS--SSRSNNGDSHPMKPESVEVLNFGDSGSGRLLS  349

Query  1489  SGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgd-  1313
             S +    +G+           K KKR+ TS GSN+E M+SF SGV+VPS+G     +G  
Sbjct  350   SHSQVAVAGE---------TAKKKKRSATSIGSNEEEMMSFTSGVIVPSSGMLKSVSGAG  400

Query  1312  -sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRF  1136
              SDHSD+EASVV+EA+SS+VV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRF
Sbjct  401   DSDHSDVEASVVKEAESSKVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  459

Query  1135  YALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKES--RHpp  962
             YALRAVVPNVSKMDKASLL DA SYI EL   LQ AES +EDLK QL+ +KK S  +   
Sbjct  460   YALRAVVPNVSKMDKASLLQDAESYIRELNMNLQAAESDKEDLKKQLDELKKRSSDKECI  519

Query  961   pppppepPLKLAGkivdidvd-vkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHA  785
             P        K  G         VKI+GWDA++R++  +K+HPAARLMVAL++L+L++ HA
Sbjct  520   PVDQDRKMAKPTGSRSTGVAIDVKIMGWDAVVRVESGRKDHPAARLMVALQELNLELQHA  579

Query  784   SVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             SVSVVN+LMIQQATVKMGS +Y QE+L+ AL + I
Sbjct  580   SVSVVNELMIQQATVKMGSQLYTQEQLKAALLAVI  614



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score =   249 bits (635),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 195/401 (49%), Positives = 238/401 (59%), Gaps = 77/401 (19%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQ----IVFGN-------ENPN----PA  1673
             DPS +W+ DP      +  +N  GN  PSS ++     I F N       ENPN    P+
Sbjct  276   DPS-MWINDP----IGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPS  330

Query  1672  TVETQSNN---NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVK  1502
              V +Q+ N   NN+  F R LNFS              +SS   K  SGEILNFGD   K
Sbjct  331   PVHSQTQNPKFNNT--FSRELNFST-------------SSSTLVKPRSGEILNFGDEG-K  374

Query  1501  RSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagga  1322
             RS+ + + + +SGQ           + + +   S   N++ +LSF       S       
Sbjct  375   RSSGNPDPSSYSGQ----------TQFENKRKRSMVLNEDKVLSFGDKTAGESDHSD---  421

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
                     LEASVV+E       V  EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  422   --------LEASVVKE-------VAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQ  466

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK------K  980
             RFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +K QLE +K      K
Sbjct  467   RFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRK  526

Query  979   ESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDL  800
              S            +K  G    ++++VKIIGWDAMIR++ SK+NHPAARLM AL DL+L
Sbjct  527   ASASGGDMSSSCSSIKPVG----MEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLEL  582

Query  799   DVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  583   EVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  623



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score =   248 bits (634),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 195/401 (49%), Positives = 238/401 (59%), Gaps = 77/401 (19%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQ----IVFGN-------ENPN----PA  1673
             DPS +W+ DP      +  +N  GN  PSS ++     I F N       ENPN    P+
Sbjct  276   DPS-MWINDP----IGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPS  330

Query  1672  TVETQSNN---NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVK  1502
              V +Q+ N   NN+  F R LNFS              +SS   K  SGEILNFGD   K
Sbjct  331   PVHSQTQNPKFNNT--FSRELNFST-------------SSSTLVKPRSGEILNFGDEG-K  374

Query  1501  RSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagga  1322
             RS+ + + + +SGQ           + + +   S   N++ +LSF       S       
Sbjct  375   RSSGNPDPSSYSGQ----------TQFENKRKRSMVLNEDKVLSFGDKTAGESDHSD---  421

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
                     LEASVV+E       V  EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  422   --------LEASVVKE-------VAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQ  466

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-----  977
             RFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +K QLE +K E     
Sbjct  467   RFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRR  526

Query  976   -SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDL  800
              S            +K  G    ++++VKIIGWDAMIR++ SK+NHPAARLM AL DL+L
Sbjct  527   ASASGGDMSSSCSSIKPVG----MEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLEL  582

Query  799   DVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  583   EVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  623



>ref|XP_009413229.1| PREDICTED: transcription factor MYC2-like [Musa acuminata subsp. 
malaccensis]
Length=707

 Score =   249 bits (637),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 202/415 (49%), Positives = 256/415 (62%), Gaps = 43/415 (10%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNTNVQGNSFPSSITKQ-IVFGN--------ENPNPATVETQ  1658
             DPS L LTDP   E+KDSV+      +   S+TK  I FGN        ENP+ ++ +TQ
Sbjct  293   DPSVLSLTDPSAVEIKDSVS--FLSTTADMSVTKPPIQFGNKATSSNLIENPS-SSFQTQ  349

Query  1657  SNNNNSQLF------PRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
              + N+ Q        PR  +F    L+    A  +     S +RESG ILNF       S
Sbjct  350   KSQNHQQQHRSGGSKPRNQSFFSKDLNSSEFASNDSVGPHSFERESGNILNFAGGKRNSS  409

Query  1495  ACSGNDAIFSGQFPAADEnnnnnknkKRTT--TSRGSN--DEGMLSFvsgvvvp---sag  1337
                   ++FS   PAA     ++K   R+T  TSR SN  DEGMLSF S  V P      
Sbjct  410   PAPAAGSLFS--HPAAAAATVDDKKNTRSTGATSRASNNNDEGMLSFSSTPVRPLPNGQR  467

Query  1336  gaggatgdsdhsDLEAS---------VVREADSSRVVVepekrpkkrgrkPANGREEPLN  1184
              + G         L+A+          VRE +SS+VV EPEKRP+KRGRKPANGREEPLN
Sbjct  468   NSSGGGRGGGGGILDAADSDQSDLVASVREVESSQVV-EPEKRPRKRGRKPANGREEPLN  526

Query  1183  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLK  1004
             HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLL DA+SYI EL+SKLQ  E+ +E+L+
Sbjct  527   HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLADAVSYIEELRSKLQAVEADREELQ  586

Query  1003  TQLESIKKE---SRHpppppppepPLKLAGki-vdidvdvkiIGWDAMIRIQCSKKNHPA  836
              Q+E+++K+    R  P P      +   G     ++++VKI+G +AM+R+QC ++NHPA
Sbjct  587   AQVEALEKQRDSGRARPSPTAQHEQMVNGGSRCHGVEMEVKILGMEAMVRLQCERRNHPA  646

Query  835   ARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMG-SHVYNQEELRLALTSSIAA  674
             ARLM AL++L ++VH+ASVSVV DLMIQQATVKM  S VY QE+L  AL S +AA
Sbjct  647   ARLMTALQELGVEVHYASVSVVKDLMIQQATVKMSPSRVYTQEQLNAALYSRLAA  701



>ref|XP_002868032.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44291.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   247 bits (630),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 189/239 (79%), Gaps = 7/239 (3%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             N+EGMLSF S +  P+  G    +       LEASV +EA+S+R VVEPEK+P+KRGRKP
Sbjct  363   NEEGMLSFTSVLPRPAKSGDSNHSD------LEASVAKEAESNRFVVEPEKKPRKRGRKP  416

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELKSKLQ 
Sbjct  417   ANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQK  476

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPL-KLAGkivdidvdvkiIGWDAMIRIQCS  854
             AES +E+L+ Q + + KE+ +          L + +  +++++VDVKIIGWDAMIRIQCS
Sbjct  477   AESDKEELQKQFDGMIKEAGNSKSSVKDRRCLNQESSVLIEMEVDVKIIGWDAMIRIQCS  536

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             K+NHP A+ M ALK+LDL+V+HAS+SVVNDLMIQQATVKMG+  + Q++L++AL   + 
Sbjct  537   KRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNQFFTQDQLKVALMEKVG  595



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score =   247 bits (631),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 193/382 (51%), Positives = 245/382 (64%), Gaps = 34/382 (9%)
 Frame = -2

Query  1807  DPSALWLTDP--GPEVKDSVNTNV--QGNSFPSSITKQIVFGNENPNPATVETQSNNNNS  1640
             DP A W+++P  G E  +   T     GNS    +TK   F     N ++VE    N   
Sbjct  283   DP-AFWISEPTTGIESGNMAPTAAINNGNSNSHQLTKPGQF----ENGSSVENPRQNPQG  337

Query  1639  QLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNF-GDNAVKRSACSGNDAIFSG  1463
                 R LN S  GLD      +N   S   + +SGEIL+F G+        SG   I +G
Sbjct  338   SSVDRDLNVSSSGLD------QNGNYSDGSRPKSGEILSFCGNKNGNGGGLSGKTRIVAG  391

Query  1462  QFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASV  1283
             +          NK K+   + R +N+EG+LSF SG  +PS+    G +  SD   +EASV
Sbjct  392   E----------NKKKRSPVSKRSNNEEGILSFTSGAALPSSAAKSGDSDHSD---VEASV  438

Query  1282  VREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  1103
              +EADS RVV EPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRA+VPNVS
Sbjct  439   YKEADSGRVV-EPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRALVPNVS  497

Query  1102  KMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAG  923
             KMDKASLLGDAISYINELKSK+Q AE  + +L+ QL    +E R        +   + +G
Sbjct  498   KMDKASLLGDAISYINELKSKVQKAEFDKGELQKQL----RELRKGVSGKDQKGLNQDSG  553

Query  922   kivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQAT  743
               V+ ++DVKIIGWD MIRIQCSKKNHP A+ M ALK+LDL+V+HAS+SVVND MI+QAT
Sbjct  554   PSVETEIDVKIIGWDVMIRIQCSKKNHPGAKFMEALKELDLEVNHASLSVVNDFMIEQAT  613

Query  742   VKMGSHVYNQEELRLALTSSIA  677
             VKMGS  + Q++L+ AL + ++
Sbjct  614   VKMGSRFFTQDQLKTALMAKVS  635



>ref|XP_010434608.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=623

 Score =   247 bits (630),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 189/238 (79%), Gaps = 6/238 (3%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             N+EGMLSF S  V+P    +G +        LEASVV+EA+S+R VVEPEK+P+KRGRKP
Sbjct  389   NEEGMLSFTSVSVLPRPAKSGDSNHSD----LEASVVKEAESNRTVVEPEKKPRKRGRKP  444

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELKSKL  
Sbjct  445   ANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLLK  504

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +E+L+ Q++ + KE+ +           +  G  V+++VDVKIIGWDAMIR+QCSK
Sbjct  505   AESDKEELQKQIDGMSKEAANGKSSVKERN--QEPGVSVEMEVDVKIIGWDAMIRVQCSK  562

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +NHP A+ M ALK+LDL+V+HAS+SVVNDLMIQQATVKMG+  + Q++L++AL   + 
Sbjct  563   RNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNEFFTQDQLKVALMEKVG  620



>dbj|BAJ33793.1| unnamed protein product [Thellungiella halophila]
Length=606

 Score =   246 bits (628),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 190/250 (76%), Gaps = 14/250 (6%)
 Frame = -2

Query  1414  RTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepek  1238
             R+  S+GSN DEGMLSF + V   +  G    +       LEASVV+EA    +VVEPEK
Sbjct  364   RSPVSKGSNNDEGMLSFSTVVRSAAKSGDSDHSD------LEASVVKEA----IVVEPEK  413

Query  1237  rpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI  1058
             +P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVS+MDKASLLGDAISYI
Sbjct  414   KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSEMDKASLLGDAISYI  473

Query  1057  NELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPL---KLAGkivdidvdvkiI  887
             NELKSKLQ AES +E+++ QL+ + KE          +      + +   +++++DVKII
Sbjct  474   NELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGGSRVKERKCSNQDSASSIEMEIDVKII  533

Query  886   GWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEE  707
             GWD MIR+QCSKKNHP AR M ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  +N ++
Sbjct  534   GWDVMIRVQCSKKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQ  593

Query  706   LRLALTSSIA  677
             L+LAL S + 
Sbjct  594   LKLALMSKVG  603



>ref|XP_010449546.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=622

 Score =   246 bits (629),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 189/238 (79%), Gaps = 6/238 (3%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             N+EGMLSF S  V+P    +G +        LEASVV+EA+S+R VVEPEK+P+KRGRKP
Sbjct  388   NEEGMLSFTSVSVLPRPAKSGDSNHSV----LEASVVKEAESNRTVVEPEKKPRKRGRKP  443

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELKSKL  
Sbjct  444   ANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLLK  503

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +E+L+ Q++ + KE+ +           +  G  VD++VDVKIIGWDAMIR+QCSK
Sbjct  504   AESDKEELQKQIDGMSKEAANGKSLVKERN--QEPGVSVDMEVDVKIIGWDAMIRVQCSK  561

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +NHP A+ M ALK+LDL+V+HAS+SVVNDLMIQQATVKMG+  + Q++L++AL   + 
Sbjct  562   RNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNEFFTQDQLKVALMEKVG  619



>ref|XP_010445298.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=612

 Score =   246 bits (628),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 219/308 (71%), Gaps = 34/308 (11%)
 Frame = -2

Query  1600  LDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQFPAADEnnnnnkn  1421
             L  GG++V N    ++   +SGE+++F  N V+    SG       +F   D     + N
Sbjct  336   LCNGGSSVENPKLQVT---KSGEMVSF-KNGVENGFSSGQS-----RFMGED-----SSN  381

Query  1420  kKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepe  1241
             KKR+  S  +N+EGMLSF S  V+P    +G +        LEASVV+EA+S+R VVEPE
Sbjct  382   KKRSPVS--NNEEGMLSFTSVSVLPRPAKSGDSNHSD----LEASVVKEAESNRTVVEPE  435

Query  1240  krpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISY  1061
             K+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISY
Sbjct  436   KKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISY  495

Query  1060  INELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGW  881
             INELKSKL  AES +E+L+ Q++ +K+                  G  V+++VDVKIIGW
Sbjct  496   INELKSKLLKAESDKEELQKQIDGMKRNQE--------------PGVSVEMEVDVKIIGW  541

Query  880   DAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELR  701
             DAMIR+QCSK+NHP A+ M ALK+LDL+V+HAS+SVVNDLMIQQATVKMG+  + Q++L+
Sbjct  542   DAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLMIQQATVKMGNEFFTQDQLK  601

Query  700   LALTSSIA  677
             +AL   + 
Sbjct  602   VALMEKVG  609



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score =   246 bits (628),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 227/399 (57%), Gaps = 74/399 (19%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSS----ITKQIVFGNENPNPATVE--------  1664
             DPS +W+ DP       +    QGN  PSS      K I F N   +   +E        
Sbjct  264   DPS-MWINDP-------IGVPEQGNGAPSSSSQLFAKSIQFENGGSSSTIIENPNPDPAP  315

Query  1663  ----TQSNNNNSQL---FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
                   S   N +    F R LNFS              +S+   K    EIL+FGD   
Sbjct  316   APSPVHSQTQNPKFSNNFSRELNFST-------------SSTTLVKPRPAEILSFGDEG-  361

Query  1504  KRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagg  1325
             KRS+ + + + +SGQ           + + +   S G +D+ +L+F +G           
Sbjct  362   KRSSVNPDPSSYSGQ----------TQFENKRKKSIGMSDDKVLTFGTGGGESDHSD---  408

Query  1324  atgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLN  1145
                      LEASVV+E    R        PKKRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  409   ---------LEASVVKEIPEKR--------PKKRGRKPANGREEPLNHVEAERQRREKLN  451

Query  1144  QRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SR  971
             QRFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +KTQLE +K E   R
Sbjct  452   QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGR  511

Query  970   HpppppppepPLKL-AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDV  794
                          L A K V ++++VKIIGWDAMIR++ SK+NHPAARLM AL DL+L+V
Sbjct  512   KASAGGDLSSSCSLTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEV  571

Query  793   HHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  572   NHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  610



>ref|XP_009101493.1| PREDICTED: transcription factor MYC3 [Brassica rapa]
Length=580

 Score =   245 bits (626),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 189/253 (75%), Gaps = 15/253 (6%)
 Frame = -2

Query  1414  RTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepek  1238
             R+  S+GSN +EGMLSF + V   +  G    +       LEASVV+EA    +VVEPEK
Sbjct  337   RSPVSKGSNNEEGMLSFSTVVRSTAKSGESDHSD------LEASVVKEA----IVVEPEK  386

Query  1237  rpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI  1058
             +P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYI
Sbjct  387   KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYI  446

Query  1057  NELKSKLQTAESAQEDLKTQLESIKKE----SRHpppppppepPLKLAGkivdidvdvki  890
             NELKSKLQ AES +E+++ QL+ + KE    S             + +   V++++DVKI
Sbjct  447   NELKSKLQQAESEKEEIQKQLDGMSKEGNGKSGASRAVKERRSSYQDSASSVEMEIDVKI  506

Query  889   IGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQE  710
             IGWD MIR+QCSKKNHP +R M ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  +N +
Sbjct  507   IGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHD  566

Query  709   ELRLALTSSIAAN  671
             +LR AL   +  +
Sbjct  567   QLRAALMLKVGGD  579



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score =   246 bits (629),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 190/400 (48%), Positives = 234/400 (59%), Gaps = 70/400 (18%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQ----IVFGN--------ENPNP----  1676
             DPS +W+ DP      +  +N  GN  PSS ++     I F N        ENPNP    
Sbjct  272   DPS-MWINDP----IGAPGSNEPGNGAPSSSSQLFSKSIQFENGGSSSTITENPNPDPTP  326

Query  1675  ATVETQSNN---NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAV  1505
             + V +Q+ N   NN   F R LNFS              +S+   K  SG+IL+FGD   
Sbjct  327   SPVHSQTQNPKFNNG--FSRELNFST-------------SSTTLVKPRSGDILSFGDEG-  370

Query  1504  KRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagg  1325
             KR + + + + +SGQ           +   +   S G  D+ +LSF  G           
Sbjct  371   KRGSGNPDPSSYSGQ----------TQFDNKRKKSVGLCDDKVLSFGGGDKTGGGESDHS  420

Query  1324  atgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLN  1145
                      LEASVV+E    R        PKKRGRKPANGREEPLNHVEAERQRREKLN
Sbjct  421   D--------LEASVVKEVPEKR--------PKKRGRKPANGREEPLNHVEAERQRREKLN  464

Query  1144  QRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE---S  974
             QRFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +KTQLE +K E    
Sbjct  465   QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKHELAGR  524

Query  973   RHpppppppepPLKLAG-kivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
             +             + G K V ++++VKIIGWDAMIR++ SK+NHPAARLM AL DL+L+
Sbjct  525   KASAGGGDLASSSPMMGIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMTALMDLELE  584

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  585   VNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  624



>ref|XP_006398371.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
 gb|ESQ39824.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
Length=665

 Score =   247 bits (631),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 190/250 (76%), Gaps = 14/250 (6%)
 Frame = -2

Query  1414  RTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepek  1238
             R+  S+GSN DEGMLSF + V   +  G    +       LEASVV+EA    +VVEPEK
Sbjct  423   RSPVSKGSNNDEGMLSFSTVVRSAAKSGDSDHSD------LEASVVKEA----IVVEPEK  472

Query  1237  rpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI  1058
             +P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYI
Sbjct  473   KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYI  532

Query  1057  NELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPL---KLAGkivdidvdvkiI  887
             NELKSKLQ AES +E+++ QL+ + KE          +      + +   +++++DVKII
Sbjct  533   NELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGGSRVKERKCSNQDSASSIEMEIDVKII  592

Query  886   GWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEE  707
             GWD MIR+QCSKKNHP AR M ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  +N ++
Sbjct  593   GWDVMIRVQCSKKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQ  652

Query  706   LRLALTSSIA  677
             L+LAL S + 
Sbjct  653   LKLALMSKVG  662



>ref|XP_009131125.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=230

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 170/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EA+S R+  EPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  22    LEASVVKEAESGRIAAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  81

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP  938
             VPNVSKMDKASLLGDAISYINELK+KLQ AE+ +E+L+ Q++ + KE          +  
Sbjct  82    VPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVKSSVKDQ  141

Query  937   LKL---AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVN  767
               L   +G  +++++DVKIIGWDAMIRIQC KKNHP A+ M ALK+L+L+V+HAS+SVVN
Sbjct  142   KCLEQDSGVSIEVEIDVKIIGWDAMIRIQCGKKNHPGAKFMEALKELELEVNHASLSVVN  201

Query  766   DLMIQQATVKMGSHVYNQEELRLALTSSI  680
             + MIQQATVKMG+  + Q++L+ AL   +
Sbjct  202   EFMIQQATVKMGNQFFTQDQLKAALMERV  230



>ref|XP_006838603.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
 gb|ERN01172.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
Length=655

 Score =   246 bits (627),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 221/346 (64%), Gaps = 37/346 (11%)
 Frame = -2

Query  1621  LNFSEFGLDGGGAAVRNETSSLS----------------CKRESGEILNFGDNAVKRSAC  1490
             LNFS+FG +G   A  N+  +L+                CK ESGEIL+FG      ++ 
Sbjct  310   LNFSDFGFEG--LATNNQRGALNTYEDSHRDGKVGNLQPCKPESGEILSFGGGNGGGNSM  367

Query  1489  SGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgds  1310
             S   +         ++           T   G  DEG+LSF SGVV+ S   +G  +  S
Sbjct  368   SRGGSSSGLMGRVDEKRGGRLGPTMGPTRQNGGVDEGILSFSSGVVLQSELKSGADSDHS  427

Query  1309  dhsDLEASVVREADSSRVV-VepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFY  1133
             D   LEASV RE +SSR+V    E+RP+KRGR+PANGREEPLNHVEAERQRREKLNQRFY
Sbjct  428   D---LEASV-REVESSRIVDTAAERRPRKRGRRPANGREEPLNHVEAERQRREKLNQRFY  483

Query  1132  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHppppp  953
             ALRAVVPNVSKMDKASLLGDAI+YINEL+ KLQ  ES  ++L+TQ+E++KK+        
Sbjct  484   ALRAVVPNVSKMDKASLLGDAIAYINELRGKLQGLESENDELQTQVEALKKKESQLFNGS  543

Query  952   ppepPLKL--------------AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVAL  815
                  L                +GK   ++++VKI+GW+AMIRIQ +K+NHPAAR MVAL
Sbjct  544   LKSQALSGDSDLKAHSTHSSANSGKYPGLEIEVKILGWEAMIRIQSNKQNHPAARFMVAL  603

Query  814   KDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             KDLDL+VH+ASVSVV DLMIQQATVKM S +Y Q++L  AL S +A
Sbjct  604   KDLDLEVHYASVSVVKDLMIQQATVKMTSRIYTQDQLSAALYSKVA  649



>gb|AAL55712.1|AF251690_1 putative transcription factor BHLH5 [Arabidopsis thaliana]
Length=592

 Score =   244 bits (623),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 158/292 (54%), Positives = 197/292 (67%), Gaps = 21/292 (7%)
 Frame = -2

Query  1516  DNAVKRSAC-SGNDAIFSGQFPAADEnnn---nnknkKRTTTSRGSN-DEGMLSFvsgvv  1352
             +N  ++S+C    D  F G    ++E  +   N  +KKRT+ S+GSN DEGMLSF + V 
Sbjct  311   ENQNRQSSCLVEKDLTFQGGLLKSNETLSFCGNESSKKRTSVSKGSNNDEGMLSFSTVVR  370

Query  1351  vpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEA  1172
               +               LEASVV+EA    VV  PEK+P+KRGRKPANGREEPLNHVEA
Sbjct  371   SAANDSDHSD--------LEASVVKEA---IVVEPPEKKPRKRGRKPANGREEPLNHVEA  419

Query  1171  ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLE  992
             ERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELKSKLQ AES +E+++ +L+
Sbjct  420   ERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLD  479

Query  991   SIKKESRHpppppppepPLKLAGkivdidvdvki-----IGWDAMIRIQCSKKNHPAARL  827
              + KE  +           K + +               IGWD MIR+QC KK+HP AR 
Sbjct  480   GMSKEGNNGKGCGSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARF  539

Query  826   MVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             M ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  +N ++L++AL + +  N
Sbjct  540   MEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKVALMTKVGEN  591



>ref|NP_199488.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
 sp|Q9FIP9.1|MYC3_ARATH RecName: Full=Transcription factor MYC3; AltName: Full=Basic 
helix-loop-helix protein 5; Short=AtbHLH5; Short=bHLH 5; AltName: 
Full=Protein ALTERED TRYPTOPHAN REGULATION 2; AltName: 
Full=Transcription factor ATR2; AltName: Full=Transcription 
factor EN 36; AltName: Full=bHLH transcription factor bHLH005 
[Arabidopsis thaliana]
 dbj|BAB08920.1| bHLH protein-like [Arabidopsis thaliana]
 gb|AED95422.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
Length=592

 Score =   244 bits (623),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 158/292 (54%), Positives = 197/292 (67%), Gaps = 21/292 (7%)
 Frame = -2

Query  1516  DNAVKRSAC-SGNDAIFSGQFPAADEnnn---nnknkKRTTTSRGSN-DEGMLSFvsgvv  1352
             +N  ++S+C    D  F G    ++E  +   N  +KKRT+ S+GSN DEGMLSF + V 
Sbjct  311   ENQNRQSSCLVEKDLTFQGGLLKSNETLSFCGNESSKKRTSVSKGSNNDEGMLSFSTVVR  370

Query  1351  vpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEA  1172
               +               LEASVV+EA    VV  PEK+P+KRGRKPANGREEPLNHVEA
Sbjct  371   SAANDSDHSD--------LEASVVKEA---IVVEPPEKKPRKRGRKPANGREEPLNHVEA  419

Query  1171  ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLE  992
             ERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELKSKLQ AES +E+++ +L+
Sbjct  420   ERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLD  479

Query  991   SIKKESRHpppppppepPLKLAGkivdidvdvki-----IGWDAMIRIQCSKKNHPAARL  827
              + KE  +           K + +               IGWD MIR+QC KK+HP AR 
Sbjct  480   GMSKEGNNGKGCGSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARF  539

Query  826   MVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             M ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  +N ++L++AL + +  N
Sbjct  540   MEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKVALMTKVGEN  591



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score =   244 bits (624),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 186/400 (47%), Positives = 230/400 (58%), Gaps = 76/400 (19%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQ----IVFGN-------ENPNP----A  1673
             DPS +W+ DP      +  +N  GN  PSS ++     I F N       ENPNP    +
Sbjct  280   DPS-MWINDP----IGAPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNPDPTPS  334

Query  1672  TVETQSNNNN-SQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
              V +Q+ N   S  F R LNFS              +SS   K  SGEIL+FGD+  KR 
Sbjct  335   PVHSQTQNPKFSNNFSRELNFST-------------SSSTLVKPRSGEILSFGDDG-KRG  380

Query  1495  ACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatg  1316
             + + + + +SGQ             +      +  N++ +LSF       S         
Sbjct  381   SGNPDPSSYSGQ------------TQFENKRKKSPNEDKVLSFGDKTTGESDHSD-----  423

Query  1315  dsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRF  1136
                   LEASVV+E       V  EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRF
Sbjct  424   ------LEASVVKE-------VAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRF  470

Query  1135  YALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-------  977
             YALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +K QLE +K E       
Sbjct  471   YALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKAS  530

Query  976   SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
             +            +K  G  +++ +     GWDAMIR++ SK+NHPAARLM AL DL+L+
Sbjct  531   AGCGDMSSSTCSSIKPVGMEIEVKII----GWDAMIRVESSKRNHPAARLMAALMDLELE  586

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  587   VNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  626



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score =   244 bits (623),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 186/400 (47%), Positives = 229/400 (57%), Gaps = 76/400 (19%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQ----IVFGN-------ENPNP----A  1673
             DPS +W+ DP      +  +N  GN  PSS ++     I F N       ENPNP    +
Sbjct  277   DPS-MWINDP----IGAPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNPDPTPS  331

Query  1672  TVETQSNNNN-SQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRS  1496
              V +Q+ N   S  F R LNFS              +SS   K  SGEIL+FGD+  KR 
Sbjct  332   PVHSQTQNPKFSNNFSRELNFST-------------SSSTLVKPRSGEILSFGDDG-KRG  377

Query  1495  ACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatg  1316
             + + + + +SGQ             +      +  N+  +LSF       S         
Sbjct  378   SGNPDPSSYSGQ------------TQLENKRKKSPNENKVLSFGDKTTGESDHSD-----  420

Query  1315  dsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRF  1136
                   LEASVV+E       V  EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRF
Sbjct  421   ------LEASVVKE-------VAMEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRF  467

Query  1135  YALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-------  977
             YALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +K QLE +K E       
Sbjct  468   YALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKAS  527

Query  976   SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLD  797
             +            +K  G  +++ +     GWDAMIR++ SK+NHPAARLM AL DL+L+
Sbjct  528   AGCGDVSSSTCSSIKPVGMEIEVKII----GWDAMIRVESSKRNHPAARLMAALMDLELE  583

Query  796   VHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  584   VNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  623



>ref|XP_002865164.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41423.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score =   243 bits (620),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 187/393 (48%), Positives = 231/393 (59%), Gaps = 65/393 (17%)
 Frame = -2

Query  1807  DPSALWLTDP---GPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQ  1637
             DP ALW+++P   G E    VN     NS   S + QI   ++N + ++VE Q N  +S 
Sbjct  268   DP-ALWISEPTNTGIESPARVNNGNNSNSNSKSDSHQISKLDKN-DISSVENQ-NRQSSC  324

Query  1636  LFPRGLNFSEFGLDG-----GGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAI  1472
             L  R LNFS  GL+      GG    NET S  C  ES +                    
Sbjct  325   LVERDLNFSSSGLNQNGNFQGGLLKSNETLSF-CGNESSK--------------------  363

Query  1471  FSGQFPAADEnnnnnknkKRTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDL  1295
                               KR+  S+GSN DEGMLSF + V   +       +       L
Sbjct  364   ------------------KRSPVSKGSNNDEGMLSFSTVVRSAAKSVDSDHSD------L  399

Query  1294  EASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVV  1115
             EASVV+EA    VV  PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVV
Sbjct  400   EASVVKEA---IVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVV  456

Query  1114  PNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPL  935
             PNVSKMDKASLLGDAISYINELKSKLQ AES +E+++ +L+ + KE  +           
Sbjct  457   PNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGGGSRAKER  516

Query  934   KLAGkivdidvdvki-----IGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVV  770
             K + +               IGWD MIR+QCSKK+HP AR M ALK+LDL+V+HAS+SVV
Sbjct  517   KSSNQDSTASSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVV  576

Query  769   NDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             NDLMIQQATVKMGS  +N ++L++AL + +  N
Sbjct  577   NDLMIQQATVKMGSQFFNHDQLKVALMTKVGEN  609



>ref|XP_010494857.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   243 bits (619),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 211/329 (64%), Gaps = 44/329 (13%)
 Frame = -2

Query  1648  NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIF  1469
             N ++L  R LNFS  GL        N+  +     +S E L+F         C  N+   
Sbjct  319   NQNRLGERELNFSSSGL--------NQNGNFQGGLKSNETLSF---------CGNNN---  358

Query  1468  SGQFPAADEnnnnnknkKRTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLE  1292
                          +  KKR+  S+GSN DEGMLSF + V   +  G    +       LE
Sbjct  359   ------------ESNKKKRSPVSKGSNNDEGMLSFSTVVRSAAKSGDSDHSD------LE  400

Query  1291  ASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVP  1112
             ASVV+EA    VV  PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVP
Sbjct  401   ASVVKEA---IVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVP  457

Query  1111  NVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLK  932
             NVSKMDKASLLGDAISYINELKSKLQ AE  +E+++ +L+ + KE +            K
Sbjct  458   NVSKMDKASLLGDAISYINELKSKLQQAEIDKEEIQKRLDGVNKEGKGGGGGGSRARERK  517

Query  931   LAGkivdidvdvkiI--GWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLM  758
              + +   I++++ +   GWD MIR+QCSKK+HP AR M ALK+LDL+V+HAS+SVVNDLM
Sbjct  518   CSNQDTSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLM  577

Query  757   IQQATVKMGSHVYNQEELRLALTSSIAAN  671
             IQQATVKMGS  +N ++L++AL + +  N
Sbjct  578   IQQATVKMGSQFFNHDQLKVALMTKVGEN  606



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score =   243 bits (619),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 236/401 (59%), Gaps = 77/401 (19%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSITKQ----IVFGN-------ENPN----PA  1673
             DPS +W+ DP      +  +N  GN  PSS ++     I F N       ENPN    P+
Sbjct  276   DPS-MWINDP----IGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPS  330

Query  1672  TVETQSNN---NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVK  1502
              V +Q+ N   NN+  F R LNFS+                   +  SGEILNFGD   K
Sbjct  331   PVHSQTQNPKFNNT--FSRELNFSDVKF-------------YFSEPRSGEILNFGDEG-K  374

Query  1501  RSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggagga  1322
             RS+ + + + +SGQ           + + +   S   N++ +LSF       S       
Sbjct  375   RSSGNPDPSSYSGQ----------TQFENKRKRSMVLNEDKVLSFGDKTAGESDHSD---  421

Query  1321  tgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQ  1142
                     LEASVV+E       V  EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQ
Sbjct  422   --------LEASVVKE-------VAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQ  466

Query  1141  RFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIK------K  980
             RFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +  +K QLE +K      K
Sbjct  467   RFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRK  526

Query  979   ESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDL  800
              S            +K  G    ++++VKIIGWDAMIR++ SK+NHPAARLM AL DL+L
Sbjct  527   ASPSGGDMSSSCSSIKPVG----MEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLEL  582

Query  799   DVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +V+HAS+SVVNDLMIQQATVKMG  +Y Q++LR +L S I 
Sbjct  583   EVNHASMSVVNDLMIQQATVKMGFRIYTQDQLRASLISKIG  623



>emb|CDY58502.1| BnaA06g40330D [Brassica napus]
Length=449

 Score =   238 bits (607),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 170/213 (80%), Gaps = 8/213 (4%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EA    +VVEPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  240   LEASVVKEA----IVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  295

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE----SRHpppppp  950
             VPNVSKMDKASLLGDAISYINELKSKLQ AES +E+++ QL+ + KE    S        
Sbjct  296   VPNVSKMDKASLLGDAISYINELKSKLQQAESEKEEIQKQLDGMSKEGNGKSGASRAVKE  355

Query  949   pepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVV  770
                  + +   V++++DVKIIGWD MIR+QCSKKNHP +R M ALK+LDL+V+HAS+SVV
Sbjct  356   RRSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASLSVV  415

Query  769   NDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             NDLMIQQATVKMGS  +N ++LR AL   +  +
Sbjct  416   NDLMIQQATVKMGSQFFNHDQLRAALMLKVGGD  448



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score =   242 bits (618),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 232/405 (57%), Gaps = 84/405 (21%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFP------------------SSITKQIVFGNENP  1682
             DPS +W+ DP      +  +N  GN  P                  S+IT+     N +P
Sbjct  276   DPS-MWINDP----ITAPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITET---PNPDP  327

Query  1681  NPATVETQSNN---NNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDN  1511
              P+ V +Q+ N   NN+  F R LNFS              +SS   K  SGEILNFGD 
Sbjct  328   TPSPVHSQTQNLKFNNN--FSRELNFST-------------SSSTLVKPRSGEILNFGDE  372

Query  1510  AVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsagga  1331
               KRS+ + + + +SGQ           + + +   S   N++ +LSF       S    
Sbjct  373   G-KRSSINPDPSSYSGQ----------TQFENKRKKSTLLNEDKVLSFGDKTAGESDHSD  421

Query  1330  ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREK  1151
                        +EASVV+E       V  EKRPKKRGRKPANGREEPLNHVEAERQRREK
Sbjct  422   -----------VEASVVKE-------VAVEKRPKKRGRKPANGREEPLNHVEAERQRREK  463

Query  1150  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--  977
             LNQRFYALRAVVPNVSKMDKASLLGDAI+YINELK+K+   ES +  +K QLE +K E  
Sbjct  464   LNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKAKVVKTESEKVMIKNQLEEVKMELA  523

Query  976   -----SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALK  812
                  +            +K  G  +++ +     GWDAMIR++ SK+NHPAARLM AL 
Sbjct  524   GRKASAGCGDMSSSSCSSIKPVGMEIEVKII----GWDAMIRVESSKRNHPAARLMSALM  579

Query  811   DLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             DL+L+V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I+
Sbjct  580   DLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIS  624



>ref|XP_009384727.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score =   243 bits (619),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 201/419 (48%), Positives = 254/419 (61%), Gaps = 55/419 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNTNVQGNSFPSSITKQIVFGNENP-------NPAT------  1670
             +P  LWLTDP   E+KDSV+      S   S+TK  +  + NP       NP +      
Sbjct  286   NPPVLWLTDPSTVEIKDSVSR--VSTSVGISVTKPPIQSDSNPSSSILTENPTSAMQIPK  343

Query  1669  -----------VETQSNNNNSQ---LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGE  1532
                        ++ QS+ +  Q      +  +FS F  +G  A  R      S K ES +
Sbjct  344   VHDDHQRQIHQLQHQSSCSKPQAQSFMSKEFDFSGFASNGAVAPAR------SFKPESRD  397

Query  1531  ILNFGDNAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTT--TSRGSND-EGMLSFvs  1361
             I +F       S      ++FS Q   A     ++K   R+T  TSR SND EGMLSF S
Sbjct  398   IPSFAGGKRDSSPAPVASSLFSRQQATA---VADDKKTNRSTGATSRASNDGEGMLSFSS  454

Query  1360  gvvvpsaggaggatgd-------sdhsDLEASVVREADSSRVVVepekrpkkrgrkPANG  1202
                   + G   ++         SD S+LE SV RE +SSR V EPEKRP+KRGRKPANG
Sbjct  455   APARAPSSGQLRSSSGGVPDGPDSDQSELEPSV-REVESSRAV-EPEKRPRKRGRKPANG  512

Query  1201  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAES  1022
             REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA+SYINEL+SKLQ  E+
Sbjct  513   REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLQALEA  572

Query  1021  AQEDLKTQLESIKKESRHpppppppepPLKL---AGkivdidvdvkiIGWDAMIRIQCSK  851
              +EDL+ Q++ +KKE R   P   PE  LK     G+   ++++VK++G +A+IR+Q  K
Sbjct  573   NKEDLQAQIQGLKKE-RESAPTQRPESNLKTMNGGGRCHGVEIEVKLLGSEALIRLQSQK  631

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             +NHPAA LM AL+DLDL+VH+ASVSVV DLMIQQATVKM   V+ QE+L   L + +AA
Sbjct  632   RNHPAAVLMAALQDLDLEVHYASVSVVKDLMIQQATVKMSRRVFTQEQLSSVLYARLAA  690



>ref|XP_006414178.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
 gb|ESQ55631.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
Length=621

 Score =   241 bits (615),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 185/238 (78%), Gaps = 7/238 (3%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             N+EGMLSF S +  P+  G    +       L+ASVV+EA+S+R VVEPEK+P+KRGRKP
Sbjct  388   NEEGMLSFTSVLPRPTKSGDSNHSD------LDASVVKEAESNRTVVEPEKKPRKRGRKP  441

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELKSKLQ 
Sbjct  442   ANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSKLQK  501

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
              ES +E+L+ Q++ +  E+             + +G  +++++DVKIIGWDAMIRIQCSK
Sbjct  502   VESDKEELQKQIDVMSNENGKCSGGDRKYLN-QDSGVSIEMEIDVKIIGWDAMIRIQCSK  560

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +NHP A+ M ALKDLDL+V+HAS+SVVND MIQQATVKMG+  + Q++L+ +L   + 
Sbjct  561   RNHPGAKFMEALKDLDLEVNHASLSVVNDFMIQQATVKMGNQFFTQDQLKASLMEKVG  618



>gb|AAD15818.1| transcription factor MYC7E [Zea mays]
Length=702

 Score =   243 bits (619),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 191/432 (44%), Positives = 236/432 (55%), Gaps = 61/432 (14%)
 Frame = -2

Query  1807  DPSALWLTD-PGPEVKDSVNTNVQGNSF--PSSITKQIVFGN-------ENPNPATVETQ  1658
             DPS LWL D P  ++KDS++      S   P     QI F N       ENP+P+     
Sbjct  269   DPSMLWLADAPVMDIKDSLSHPSAEISVSKPPPHPPQIHFENGSTSTLTENPSPSVHAPP  328

Query  1657  SNNNNSQL---------------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILN  1523
                  +                 F R LNFS+F      AA     +    K ESGEIL+
Sbjct  329   PPPAPAAPQQRQHQHQNQAHQGPFRRELNFSDFASTPSLAA-----TPPFFKPESGEILS  383

Query  1522  FGDNAVKR------------SACSGNDAIFSGQFPAADEnnnnnknkKRT----TTSRGS  1391
             FG ++  R            S  +   ++FS           N+           TSR S
Sbjct  384   FGADSNARRNPSPVPPAATASLTTAPGSLFSQHTATMTAAAANDAKNNNKRSMEATSRAS  443

Query  1390  N---------DEGMLSFvsgvvvpsaggaggatgdsdhsD-LEASVVREADSSRVVVepe  1241
             N         +EGMLSF S      + G G           L+ASV RE +SSRVV  P 
Sbjct  444   NTNHHPAATANEGMLSFSSAPTTRPSTGTGAPAKSESDHSDLDASV-REVESSRVVAPPP  502

Query  1240  krpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1070
             +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  503   EAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  562

Query  1069  ISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGki-vdidvdvk  893
             ISYINEL+ KL + E+ +E L+TQ+E++KKE    PP           G     +++D K
Sbjct  563   ISYINELRGKLTSLETDKETLQTQVEALKKERDARPPSHSAGLGGHDGGPRCHAVEIDAK  622

Query  892   iIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQ  713
             I+G +AMIR+QC K+NHP+ARLM AL++LDLDV+HASVSVV DLMIQQ  VKM S VY Q
Sbjct  623   ILGLEAMIRVQCHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYTQ  682

Query  712   EELRLALTSSIA  677
             ++L  AL S +A
Sbjct  683   DQLSAALYSRLA  694



>ref|XP_008658563.1| PREDICTED: transcription factor MYC4 [Zea mays]
 tpg|DAA46409.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=705

 Score =   243 bits (619),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 242/432 (56%), Gaps = 61/432 (14%)
 Frame = -2

Query  1807  DPSALWLTD-PGPEVKDSVNTNVQGNSF--PSSITKQIVFGN-------ENPNPATVETQ  1658
             DPS LWL D P  ++KDS++      S   P     QI F N       ENP+P+     
Sbjct  272   DPSMLWLADAPVMDIKDSLSHPSAEISVSKPPPHPPQIHFENGSTSTLTENPSPSVHAPP  331

Query  1657  SNNNNSQL---------------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILN  1523
                  +                 F R LNFS+F      AA     +    K ESGEIL+
Sbjct  332   PPPAPAAPQQRQHQHQNQAHQGPFRRELNFSDFASTPSLAA-----TPPFFKPESGEILS  386

Query  1522  FGDNAVKR------------SACSGNDAIFSGQFPAADEnnnnnknkKRT----TTSRGS  1391
             FG ++  R            S  +   ++FS           N+           TSR S
Sbjct  387   FGADSNARRNPSPVPPAATASLTTAPGSLFSQHTATMTAAAANDAKNNNKRSMEATSRAS  446

Query  1390  N---------DEGMLSFvsgvvvpsagga-ggatgdsdhsDLEASVVREADSSRVVVepe  1241
             N         +EGMLSF S      + G    A  +SDHSDL+ASV RE +SSRVV  P 
Sbjct  447   NTNHHPAATANEGMLSFSSAPTTRPSTGTGAPAKSESDHSDLDASV-REVESSRVVAPPP  505

Query  1240  krpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  1070
             +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA
Sbjct  506   EAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA  565

Query  1069  ISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGki-vdidvdvk  893
             ISYINEL+ KL + E+ +E L+TQ+E++KKE    PP           G     +++D K
Sbjct  566   ISYINELRGKLTSLETDKETLQTQVEALKKERDARPPSHSAGLGGHDGGPRCHAVEIDAK  625

Query  892   iIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQ  713
             I+G +AMIR+QC K+NHP+ARLM AL++LDLDV+HASVSVV DLMIQQ  VKM S VY Q
Sbjct  626   ILGLEAMIRVQCHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYTQ  685

Query  712   EELRLALTSSIA  677
             ++L  AL S +A
Sbjct  686   DQLSAALYSRLA  697



>gb|KHN18804.1| Transcription factor MYC4 [Glycine soja]
Length=280

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 169/221 (76%), Gaps = 21/221 (10%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASV ++      VVEPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  61    LEASVAKQ------VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  114

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-------------  977
             VPNVSKMDKASLLGDAI YINELKSKL   +S + +L+ QL+S KKE             
Sbjct  115   VPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPPPPP  174

Query  976   --SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLD  803
                   PPP     P K   K+ D++++VKIIGWDAM+RIQCSKKNHPAARLM ALKDLD
Sbjct  175   PPPPPGPPPSNSVEPKKTTSKLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALKDLD  234

Query  802   LDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             L+VHHASVSVVNDLMIQQATV MG+  Y QE+L  AL+S +
Sbjct  235   LEVHHASVSVVNDLMIQQATVNMGNKFYTQEQLLSALSSKV  275



>gb|KHM99167.1| Transcription factor MYC4 [Glycine soja]
Length=218

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 146/190 (77%), Gaps = 13/190 (7%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELK KL  
Sbjct  24    ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLNG  83

Query  1030  AESAQEDLKTQLESIKKE-------------SRHpppppppepPLKLAGkivdidvdvki  890
              +S + +L+ QL+S KKE                  PP   E   K   K+ D++++VKI
Sbjct  84    LDSEKGELEKQLDSAKKELELATKNPPPPPPPPPGLPPSNNEEAKKTTTKLADLEIEVKI  143

Query  889   IGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQE  710
             IGWDAMIRIQCSKKNHPAARLM ALKDLDL+VHHASVSVVNDLMIQQATV MG+  Y QE
Sbjct  144   IGWDAMIRIQCSKKNHPAARLMAALKDLDLEVHHASVSVVNDLMIQQATVNMGNKFYTQE  203

Query  709   ELRLALTSSI  680
             +L  AL+S +
Sbjct  204   QLLSALSSKV  213



>emb|CDX77688.1| BnaC07g19420D [Brassica napus]
Length=452

 Score =   236 bits (602),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 171/213 (80%), Gaps = 8/213 (4%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EA    +VVEPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  243   LEASVVKEA----IVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  298

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE----SRHpppppp  950
             VPNVSKMDKASLLGDAISYINELKSKLQ AES +E+++ QL+ + KE    S        
Sbjct  299   VPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGASRAVRE  358

Query  949   pepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVV  770
              +   + +   V++++DVKIIGWD MIR+QCSKKNHP +R M ALK+LDL+V+HAS+SVV
Sbjct  359   RKSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASLSVV  418

Query  769   NDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             NDLMIQQATVKMGS  +N ++L+ AL   +  +
Sbjct  419   NDLMIQQATVKMGSQFFNHDQLKAALMLKVGGD  451



>ref|XP_010441550.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   239 bits (611),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 187/389 (48%), Positives = 232/389 (60%), Gaps = 62/389 (16%)
 Frame = -2

Query  1807  DPSALWLTDP----GPEVKDSVN-TNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNN  1643
             DP ALW+++P    G E    VN +N    S    I+K      E  + ++VE   N  +
Sbjct  270   DP-ALWISEPATNTGIESPARVNHSNSNSKSDSHRISKL-----EKNDISSVENH-NRQS  322

Query  1642  SQLFPRGLNFSEFGLDGGG----AAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDA  1475
             S L  R LNFS  GL+  G        NET S     ES        N  KRS  S    
Sbjct  323   SCLGERELNFSSSGLNQNGNFQGGLKSNETFSFCGNNES--------NKKKRSPVSKG--  372

Query  1474  IFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDL  1295
                                       G+ND+GMLSF + V   +  G    +       L
Sbjct  373   --------------------------GNNDQGMLSFSTVVRSAAKSGDSDHSD------L  400

Query  1294  EASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVV  1115
             EASVV+EA    VV  PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVV
Sbjct  401   EASVVKEA---IVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVV  457

Query  1114  PNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHppppp-ppepP  938
             PNVSKMDKASLLGDAISYINELKSKLQ AE  +E+++ +L+ + KE +         E  
Sbjct  458   PNVSKMDKASLLGDAISYINELKSKLQQAEVDKEEIQKRLDGVNKEGKGGGGGSRARERK  517

Query  937   LKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLM  758
                    +++++DVKIIGWD MIR+QCSKK+HP AR M ALK+LDL+V+HAS+SVVNDLM
Sbjct  518   CSNQDTSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLM  577

Query  757   IQQATVKMGSHVYNQEELRLALTSSIAAN  671
             IQQATVKMGS  +N ++L++AL + +  N
Sbjct  578   IQQATVKMGSQFFNHDQLKVALMTKVGEN  606



>ref|XP_006279855.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
 gb|EOA12753.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
Length=602

 Score =   237 bits (605),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 178/250 (71%), Gaps = 13/250 (5%)
 Frame = -2

Query  1414  RTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepek  1238
             R+  S+GSN DEGMLSF + V   +  G    +       LEASVV+EA    VV  PEK
Sbjct  359   RSVVSKGSNNDEGMLSFSTVVRSTAKSGDSDHSD------LEASVVKEA---IVVEPPEK  409

Query  1237  rpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI  1058
             +P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYI
Sbjct  410   KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYI  469

Query  1057  NELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdv---kiI  887
             NELKSKLQ AE  +E+++ +L+ + KE          E                   KII
Sbjct  470   NELKSKLQQAEIDKEEIQKRLDGVNKEGNGKGGSRAKERKSSNQDSSGSSIEMEIDVKII  529

Query  886   GWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEE  707
             GWD MIR+QCSKK+HP AR M ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  +N ++
Sbjct  530   GWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQ  589

Query  706   LRLALTSSIA  677
             L++AL + + 
Sbjct  590   LKVALMTKVG  599



>gb|ABD65632.1| basic helix-loop-helix (bHLH) family transcription factor [Brassica 
oleracea]
Length=586

 Score =   236 bits (603),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 171/209 (82%), Gaps = 3/209 (1%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EA+S R+V E EK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  378   LEASVVKEAESGRIVAETEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  437

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP  938
             VPNVSKMDKASLLGDAISYINELK+KLQ AE+ +E+L+ Q++ + KE          +  
Sbjct  438   VPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVKSLVKDQ  497

Query  937   LKL---AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVN  767
               L   +G  +++++DVKIIGWDAMIRIQC+KKNHP A+ M ALK+L+L+V+HAS+SVVN
Sbjct  498   KCLDQDSGVSIEVEIDVKIIGWDAMIRIQCAKKNHPGAKFMEALKELELEVNHASLSVVN  557

Query  766   DLMIQQATVKMGSHVYNQEELRLALTSSI  680
             + MIQQATVKMG+  + Q++L+ AL   +
Sbjct  558   EFMIQQATVKMGNQFFTQDQLKAALMERV  586



>gb|KFK31432.1| hypothetical protein AALP_AA6G111200 [Arabis alpina]
Length=585

 Score =   236 bits (602),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 185/247 (75%), Gaps = 10/247 (4%)
 Frame = -2

Query  1414  RTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepek  1238
             R+  S+GSN DEGMLSF + V   +  G    +       LEASVV+EA    VV  PEK
Sbjct  348   RSPVSKGSNNDEGMLSFSTVVRSTAKSGDSDHSD------LEASVVKEA---IVVEPPEK  398

Query  1237  rpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI  1058
             +P+KRGRKPANGREEPLNHVEAERQRREKLNQ+FY+LRAVVPNVSKMDKASLLGDAISYI
Sbjct  399   KPRKRGRKPANGREEPLNHVEAERQRREKLNQKFYSLRAVVPNVSKMDKASLLGDAISYI  458

Query  1057  NELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWD  878
             NELK+KLQ AE+ +E+++  L+ + KE              + +   +++++DVKIIGWD
Sbjct  459   NELKTKLQQAENDKEEIQKLLDGMGKEGNGTRGRERKRGSNQDSASSIEMEIDVKIIGWD  518

Query  877   AMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRL  698
              MIR+QCSKKNHP AR M ALK+LDL+V+HAS+SVVN+LMIQQATVKMGS  +N ++L+ 
Sbjct  519   VMIRVQCSKKNHPGARFMDALKELDLEVNHASLSVVNELMIQQATVKMGSQFFNHDQLKA  578

Query  697   ALTSSIA  677
             AL + + 
Sbjct  579   ALMAKVG  585



>dbj|BAJ91022.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   236 bits (603),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 219/348 (63%), Gaps = 38/348 (11%)
 Frame = -2

Query  1633  FPRGLNFSEFGLDGGGAAVRNETSSLS---CKRESGEILNFGDNAVKR------------  1499
             F R LNFS+F          N + +++    K ESGEILNFG ++  R            
Sbjct  337   FRRELNFSDFA--------SNPSVTVTPPFFKPESGEILNFGADSTSRRNPSPAPPAATA  388

Query  1498  SACSGNDAIFS---GQFPAADEnnnnnknkKRTTTSRGSN---------DEGMLSFvsgv  1355
             S  +   ++FS       A   +  NN  +    TSR SN         +EGMLSF S  
Sbjct  389   SLTTAPGSLFSQHTATVTAPSNDAKNNPKRSMEATSRASNTNHHQTATANEGMLSFSSAP  448

Query  1354  vvpsagga-ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrg-rkPANGREEPLNH  1181
                 + G    A  +SDHSDLEASV RE +SSRVV  PE++  ++  RKPANGREEPLNH
Sbjct  449   TTRPSTGTGAPAKSESDHSDLEASV-REVESSRVVPPPEEKRPRKRGRKPANGREEPLNH  507

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+ K+   ES +E L +
Sbjct  508   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESDKETLHS  567

Query  1000  QLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMV  821
             Q+E++KKE    P  P          +   ++++ KI+G +AMIR+QC K+NHPAA+LM 
Sbjct  568   QIEALKKERDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMT  627

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             AL++LDLDV+HASVSVV D+MIQQ  VKM + VY+QE+L  AL   +A
Sbjct  628   ALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQEQLNAALYGRLA  675



>ref|XP_008659898.1| PREDICTED: transcription factor MYC4-like [Zea mays]
 gb|AFW87749.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=703

 Score =   237 bits (604),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 205/435 (47%), Positives = 254/435 (58%), Gaps = 71/435 (16%)
 Frame = -2

Query  1807  DPSALWLTD-PGPEVKDSVNTNVQGNSFPS----SITK--------QIVFGN-------E  1688
             DPS LWL D P  ++KDS        S PS    S++K        QI F N       E
Sbjct  274   DPSVLWLADAPVVDIKDSY-------SHPSAAEISVSKPPPPPPPPQIHFENGSTSTLTE  326

Query  1687  NPNPAT-------VETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
             NP+P+           Q    N   F R LNFS+F  +   AA     +    K ESGEI
Sbjct  327   NPSPSVHAPPAPPAPPQRQQQNQGPFRRELNFSDFASNPSLAA-----APPFFKPESGEI  381

Query  1528  LNFG-DNAVKR--------SACSGNDAIFS------GQFPAADEnnnnnknkKRTTTSRG  1394
             L+FG D+  +R        S  +   ++FS             +NNNNN  +    TS  
Sbjct  382   LSFGVDSNAQRNPSPAPPASLTTAPGSLFSQSQHTATAAANDAKNNNNNNKRSMEATSLA  441

Query  1393  SN---------DEGMLSFvsgvvvpsagga-ggatgdsdhsDLEASVVREADSSRVVVep  1244
             SN         +EGMLSF S      + G    A  +SDHSDL+ASV RE +SSRVV  P
Sbjct  442   SNTNHHPAAAANEGMLSFSSAPTARPSAGTGAPAKSESDHSDLDASV-REVESSRVVAPP  500

Query  1243  ekrpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGD  1073
              +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGD
Sbjct  501   PEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGD  560

Query  1072  AISYINELKSKLQTAESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGki-vdidv  902
             AISYINEL+ KL + ES +E L+ Q+E++KKE  +R  P P          G     +++
Sbjct  561   AISYINELRGKLTSLESDRETLQAQVEALKKERDARPHPHPAAGLGGHDAGGPRCHAVEI  620

Query  901   dvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHV  722
             D KI+G +AMIR+QC K+NHP+ARLM AL++LDLDV+HASVSVV DLMIQQ  VKM S +
Sbjct  621   DAKILGLEAMIRVQCHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRM  680

Query  721   YNQEELRLALTSSIA  677
             Y+Q++L  AL S +A
Sbjct  681   YSQDQLSAALYSRLA  695



>dbj|BAJ91674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   236 bits (603),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 219/348 (63%), Gaps = 38/348 (11%)
 Frame = -2

Query  1633  FPRGLNFSEFGLDGGGAAVRNETSSLS---CKRESGEILNFGDNAVKR------------  1499
             F R LNFS+F          N + +++    K ESGEILNFG ++  R            
Sbjct  337   FRRELNFSDFA--------SNPSVTVTPPFFKPESGEILNFGADSTSRRNPSPAPPAATA  388

Query  1498  SACSGNDAIFS---GQFPAADEnnnnnknkKRTTTSRGSN---------DEGMLSFvsgv  1355
             S  +   ++FS       A   +  NN  +    TSR SN         +EGMLSF S  
Sbjct  389   SLTTAPGSLFSQHTATVTAPSNDAKNNPKRSMEATSRASNTNHHQTATANEGMLSFSSAP  448

Query  1354  vvpsagga-ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrg-rkPANGREEPLNH  1181
                 + G    A  +SDHSDLEASV RE +SSRVV  PE++  ++  RKPANGREEPLNH
Sbjct  449   TTRPSTGTGAPAKSESDHSDLEASV-REVESSRVVPPPEEKRPRKRGRKPANGREEPLNH  507

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+ K+   ES +E L +
Sbjct  508   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESDKETLHS  567

Query  1000  QLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMV  821
             Q+E++KKE    P  P          +   ++++ KI+G +AMIR+QC K+NHPAA+LM 
Sbjct  568   QIEALKKERDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMT  627

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             AL++LDLDV+HASVSVV D+MIQQ  VKM + VY+QE+L  AL   +A
Sbjct  628   ALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQEQLNAALYGRLA  675



>emb|CDY03195.1| BnaC09g19610D [Brassica napus]
Length=545

 Score =   233 bits (595),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 176/234 (75%), Gaps = 26/234 (11%)
 Frame = -2

Query  1393  SNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrk  1214
             S DE MLSF + V   +       +       +EASVV+EA    ++VEPEK+P+KRGRK
Sbjct  330   SKDEEMLSFSTVVRSAAKSVDSDHSD------IEASVVKEA----IIVEPEKKPRKRGRK  379

Query  1213  PANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  1034
             PANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVSKMDKASLLGDAISYINELK+KLQ
Sbjct  380   PANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKTKLQ  439

Query  1033  TAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCS  854
              AE+ +E+++ QL+ + KE                 G  V++++DVKIIGWD MIR+QC 
Sbjct  440   QAETDKEEVQKQLDGMSKE----------------GGGSVEMEIDVKIIGWDVMIRVQCG  483

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             KKNHP AR M ALK+LDL+V+HAS+SVVNDLMIQQATVKMGS  +N ++L+ AL
Sbjct  484   KKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQATVKMGSQFFNHDQLKAAL  537



>ref|XP_010941241.1| PREDICTED: transcription factor MYC2-like [Elaeis guineensis]
Length=665

 Score =   236 bits (601),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 187/395 (47%), Positives = 245/395 (62%), Gaps = 44/395 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFP--SSITKQIVFGNENPN---------PATVET  1661
             DPS LW++ P      +   +V   SFP  + I+  +    ENP+         P    +
Sbjct  271   DPSVLWISGPIVPTSTAPEISVSKPSFPFENPISSSLA---ENPSSIPAPHRSPPPPQSS  327

Query  1660  QSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGN  1481
              +N        R  +FSEFGL+          SS  CK ESG++ N+ D+    S  + N
Sbjct  328   STNPQTQSFLTRDFSFSEFGLNA-------YPSSPICKPESGDLSNYDDSKRNPSTSAAN  380

Query  1480  DAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdh-  1304
               +F     +A+  N  +       TSRGSND+G++SF S  +  +A     ++G     
Sbjct  381   GGLFFHHEISAEAKNKKSA----VATSRGSNDDGLISFSSAALAAAASARPSSSGGGGGA  436

Query  1303  ----------sDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRRE  1154
                       SDLEASV RE +SSRVV EPEKRP+KRGRKPANGREEPLNHVEAERQRRE
Sbjct  437   TGLLTGDSDHSDLEASV-REVESSRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRRE  494

Query  1153  KLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKES  974
             KLNQRFYALRAVVPNVSKMDKASLL DA+SYINEL+SKLQ+ E  +E L+ Q++++K+E 
Sbjct  495   KLNQRFYALRAVVPNVSKMDKASLLADAVSYINELRSKLQSLELDKERLQGQVDTLKEER  554

Query  973   RHpppppp------pepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALK  812
                   P       P+  +  +G+   ++V+VKI+G +AMIR+QC+KK HPAARLM+A K
Sbjct  555   DSTLARPRPPLDRDPKAMMNGSGRCHGVEVEVKILGLEAMIRVQCNKKFHPAARLMMAFK  614

Query  811   DLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEE  707
             +LDL+V++ASVSVV DLM+QQATVKM S  Y QE+
Sbjct  615   ELDLEVNYASVSVVKDLMMQQATVKMLSRSYTQEK  649



>dbj|BAJ86015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   235 bits (600),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 218/348 (63%), Gaps = 38/348 (11%)
 Frame = -2

Query  1633  FPRGLNFSEFGLDGGGAAVRNETSSLS---CKRESGEILNFGDNAVKR------------  1499
             F R LNFS+F          N + +++    K ESGEILNFG ++  R            
Sbjct  337   FRRELNFSDFA--------SNPSVTVTPPFFKPESGEILNFGADSTSRRNPSPAPPAATA  388

Query  1498  SACSGNDAIFS---GQFPAADEnnnnnknkKRTTTSRGSN---------DEGMLSFvsgv  1355
             S  +   ++FS       A   +  NN  +    TSR SN         +EGMLSF S  
Sbjct  389   SLTTAPGSLFSQHTATVTAPSNDAKNNPKRSMEATSRASNTNHHQTATANEGMLSFSSAP  448

Query  1354  vvpsagga-ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrg-rkPANGREEPLNH  1181
                 + G    A  +SDHSDLEASV RE +SSRVV  PE++  ++  RKPANGREEPLNH
Sbjct  449   TTRPSTGTGAPAKSESDHSDLEASV-REVESSRVVPPPEEKRPRKRGRKPANGREEPLNH  507

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFY LRAVVPNVSKMDKASLLGDAISYINEL+ K+   ES +E L +
Sbjct  508   VEAERQRREKLNQRFYTLRAVVPNVSKMDKASLLGDAISYINELRGKMTALESDKETLHS  567

Query  1000  QLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMV  821
             Q+E++KKE    P  P          +   ++++ KI+G +AMIR+QC K+NHPAA+LM 
Sbjct  568   QIEALKKERDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMT  627

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             AL++LDLDV+HASVSVV D+MIQQ  VKM + VY+QE+L  AL   +A
Sbjct  628   ALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQEQLNAALYGRLA  675



>emb|CDX78808.1| BnaA01g08750D [Brassica napus]
Length=579

 Score =   233 bits (594),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 170/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EA+S R+  EPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  371   LEASVVKEAESGRIAAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  430

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP  938
             VPNVSKMDKASLLGDAISYINELK+KLQ AE+ +E+L+ Q++ + KE          +  
Sbjct  431   VPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVKSSVKDQ  490

Query  937   LKL---AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVN  767
               L   +G  V++++DVKIIGWDAMIRIQC KK+HP A+ M ALK+L+L+V+HAS+SVVN
Sbjct  491   KCLEQDSGVSVEVEIDVKIIGWDAMIRIQCGKKDHPGAKFMEALKELELEVNHASLSVVN  550

Query  766   DLMIQQATVKMGSHVYNQEELRLALTSSI  680
             + MIQQATVKMG+  + Q++L+ AL   +
Sbjct  551   EFMIQQATVKMGNQFFTQDQLKAALMERV  579



>emb|CDY35179.1| BnaA09g18160D [Brassica napus]
Length=562

 Score =   232 bits (591),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 167/202 (83%), Gaps = 5/202 (2%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             +EASVV+EA    ++VEPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  358   IEASVVKEA----IIVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  413

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP  938
             VPNVSKMDKASLLGDAISYINELK+KLQ AE+ +E+++ QL+ + KE          +  
Sbjct  414   VPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKERKSN  473

Query  937   LKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLM  758
             L  A   V++++DVKIIGWD MIR+QC KKNHP AR M ALK+LDL+V+HAS+S+VNDLM
Sbjct  474   LDSA-SSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVNDLM  532

Query  757   IQQATVKMGSHVYNQEELRLAL  692
             IQQATVKMGS  +N ++L+ AL
Sbjct  533   IQQATVKMGSQFFNHDQLKAAL  554



>ref|XP_010481417.1| PREDICTED: transcription factor MYC3 [Camelina sativa]
Length=610

 Score =   233 bits (594),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 187/385 (49%), Positives = 237/385 (62%), Gaps = 51/385 (13%)
 Frame = -2

Query  1807  DPSALWLTDP----GPEVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNS  1640
             DP ALW+++P    G E    VN     NS   S + QI    +N + ++VE   N  +S
Sbjct  270   DP-ALWISEPATNTGVESPARVNNGNHSNSNSKSDSHQISKLEKN-DISSVENH-NRQSS  326

Query  1639  QLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGNDAIFSGQ  1460
              L  R LNFS  GL        N+  +     +S E L+F         C  N++     
Sbjct  327   CLGERELNFSSSGL--------NQNGNFQGGLKSNETLSF---------CGNNES-----  364

Query  1459  FPAADEnnnnnknkKRTTTSRGSN-DEGMLSFvsgvvvpsaggaggatgdsdhsDLEASV  1283
                          KKR+  S+GSN DEGMLSF + V   +  G    +       LEASV
Sbjct  365   -----------NKKKRSPVSKGSNNDEGMLSFSTVVRSAAKSGDSDHSD------LEASV  407

Query  1282  VREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  1103
             V+EA    VV  PEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAVVPNVS
Sbjct  408   VKEA---IVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAVVPNVS  464

Query  1102  KMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP-LKLA  926
             KMDKASLL DAISYINELKSKLQ AE  +E+++ +L+ + KE +                
Sbjct  465   KMDKASLLADAISYINELKSKLQQAEIDKEEIQKRLDGVNKEGKGGGGGSRGRERNCSNQ  524

Query  925   GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQA  746
                +++++DVKIIGWD MIR+QCSKK+HP AR M ALK+LDL+V+HAS+SVVNDLMIQQA
Sbjct  525   DASIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVVNDLMIQQA  584

Query  745   TVKMGSHVYNQEELRLALTSSIAAN  671
             TVKMGS  +N ++L++AL + +  N
Sbjct  585   TVKMGSQFFNHDQLKVALMTKVGEN  609



>emb|CDY44507.1| BnaC01g10420D [Brassica napus]
Length=586

 Score =   232 bits (592),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEASVV+EA+S R+V EPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  378   LEASVVKEAESGRIVAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  437

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP  938
             VPNVSKMDKASLLGDAISYINELK+KLQ AE+ +E+L+ Q+  + KE          +  
Sbjct  438   VPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIGGMSKEVGDGNVKSSVKDQ  497

Query  937   LKL---AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVN  767
               L   +G  +++++DVKIIGWDAMIRIQC K NHP A+ M ALK+L+L+V+HAS+SVVN
Sbjct  498   KCLDQDSGVSIEVEIDVKIIGWDAMIRIQCGKNNHPGAKFMEALKELELEVNHASLSVVN  557

Query  766   DLMIQQATVKMGSHVYNQEELRLALTSSI  680
             + MIQQATVKMG+  + Q++L+ AL   +
Sbjct  558   EFMIQQATVKMGNQFFTQDQLKAALMERV  586



>ref|XP_009114329.1| PREDICTED: transcription factor MYC3-like [Brassica rapa]
Length=563

 Score =   232 bits (591),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 167/202 (83%), Gaps = 5/202 (2%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             +EASVV+EA    ++VEPEK+P+KRGRKPANGREEPLNHVEAERQRREKLNQRFY+LRAV
Sbjct  359   IEASVVKEA----IIVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSLRAV  414

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepP  938
             VPNVSKMDKASLLGDAISYINELK+KLQ AE+ +E+++ QL+ + KE          +  
Sbjct  415   VPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKERKSN  474

Query  937   LKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLM  758
             L  A   V++++DVKIIGWD MIR+QC KKNHP AR M ALK+LDL+V+HAS+S+VNDLM
Sbjct  475   LDSA-SSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVNDLM  533

Query  757   IQQATVKMGSHVYNQEELRLAL  692
             IQQATVKMGS  +N ++L+ AL
Sbjct  534   IQQATVKMGSQFFNHDQLKAAL  555



>ref|XP_003574381.1| PREDICTED: transcription factor MYC4-like [Brachypodium distachyon]
Length=706

 Score =   234 bits (598),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 175/345 (51%), Positives = 220/345 (64%), Gaps = 33/345 (10%)
 Frame = -2

Query  1633  FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKR------------SAC  1490
             F R LNFS+F  +   A+V    +    K ESGEILNFG ++  R            S  
Sbjct  360   FRRELNFSDFATN---ASV--TVTPPFFKPESGEILNFGADSTSRRNPSPAPPAAAASLT  414

Query  1489  SGNDAIFS---GQFPAADEnnnnnknkKRTTTSRGSN---------DEGMLSFvsgvvvp  1346
             +   ++FS       A      NN  +    TSR SN         +EGMLSF S     
Sbjct  415   TAPGSLFSQHTATVTAPTNEAKNNPKRSMEATSRASNTNHHPSATANEGMLSFSSAPTTR  474

Query  1345  sagga-ggatgdsdhsDLEASVVREADSSRVVVepekrpkkrg-rkPANGREEPLNHVEA  1172
              + G    A  +SDHSDLEASV RE +SSRVV  PE++  ++  RKPANGREEPLNHVEA
Sbjct  475   PSTGTGAPAKSESDHSDLEASV-REVESSRVVPPPEEKRPRKRGRKPANGREEPLNHVEA  533

Query  1171  ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLE  992
             ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL+ K+   ES ++ L +Q+E
Sbjct  534   ERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESDKDTLHSQIE  593

Query  991   SIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALK  812
             ++KKE R   P  P         +   ++++ KI+G +AMIR+QC K+NHPAA+LM AL+
Sbjct  594   ALKKE-RDARPVAPLSGVHDSGPRCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALR  652

Query  811   DLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             +LDLDV+HASVSVV D+MIQQ  VKM + VY+Q++L  AL S +A
Sbjct  653   ELDLDVYHASVSVVKDIMIQQVAVKMPNRVYSQDQLNAALYSRLA  697



>ref|XP_009388411.1| PREDICTED: transcription factor MYC2 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   234 bits (597),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 196/418 (47%), Positives = 253/418 (61%), Gaps = 49/418 (12%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNT------------NVQGNSFPSSI--------TKQIVFGN  1691
             DPS LWLTDP   ++KDSV+              +Q  + PSS         + Q    +
Sbjct  291   DPSMLWLTDPSAVDIKDSVSPVSATADLSVTKPPIQLENNPSSSILTESPSSSMQFQRTH  350

Query  1690  ENPNPATVETQSNNNNSQLF-PRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGD  1514
               P     ++ +++ ++ LF  +  N SEF  +G            S K E  +IL+F  
Sbjct  351   NQPQQQLHQSSASDPHTHLFVSKKFNLSEFASNGS-------VVPRSAKPEPSDILDFAG  403

Query  1513  NAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSN-DEGMLSFvsgvvvpsag  1337
             +    +      ++FS         ++    +    TSR SN DEGM+SF S    P + 
Sbjct  404   SNRNPTPAPVTGSLFSHHQTITAAADDKRNKRSTGATSRVSNSDEGMISFSSASARPPSD  463

Query  1336  gaggat--------gdsdhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNH  1181
                 ++         DSD SDLEAS  RE +S R V EPEKRPKKRGRKPANGREEPLNH
Sbjct  464   VLFKSSGGGGILDGPDSDQSDLEASA-REVESIRPV-EPEKRPKKRGRKPANGREEPLNH  521

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA+SYINEL+SKL+T E  +E+L+ 
Sbjct  522   VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLETLEIDKEELRA  581

Query  1000  QLESIKKESRHpppppppepP---LKL-----AGkivdidvdvkiIGWDAMIRIQCSKKN  845
             Q+E+++KE    P  P   PP   L++       +   ++++VKI+G +AMIR+QC K+N
Sbjct  582   QVEALEKERESNPTRPVQPPPDHDLRMMNGSGGDRCHGVELEVKILGSEAMIRLQCLKRN  641

Query  844   HPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMG-SHVYNQEELRLALTSSIAA  674
             HPAA+LM A++DLDLDVH+ASVSVV DLMIQQATVKM  S  Y  E+LR AL S +AA
Sbjct  642   HPAAKLMAAIRDLDLDVHYASVSVVEDLMIQQATVKMSPSRTYTPEQLRAALYSKLAA  699



>ref|XP_008799392.1| PREDICTED: transcription factor MYC2-like [Phoenix dactylifera]
Length=665

 Score =   231 bits (590),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 191/394 (48%), Positives = 240/394 (61%), Gaps = 44/394 (11%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSV--NTNVQGNSFPSSITKQIVFG-NENPN----------PATV  1667
             DPS LW+  PGP V  S    ++V   SFP      I  G NENP+          P   
Sbjct  273   DPSVLWV--PGPIVHASAAPGSSVSKPSFP--FENPISIGLNENPSSIPAPHRSPPPPPQ  328

Query  1666  ETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACS  1487
              + +N        R  +FSEFGL+          S   CK ESG+  N+GD+    S  +
Sbjct  329   SSSTNPQTQSFLTRDFSFSEFGLNA-------YPSPPICKPESGDFSNYGDSKRNPSTPA  381

Query  1486  GNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsd  1307
              N  +F     +A+  N  +       TSRGSN+EG+LSF S  +  +A      +    
Sbjct  382   ANGGLFFHHEISAEGKNKKSA----VATSRGSNEEGILSFSSAAIATAASARPSPSSGGA  437

Query  1306  --------hsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREK  1151
                     HSDLEASV RE +SSRV  EPEKRP+KRGRKPANGREEPLNHVEAERQRREK
Sbjct  438   GLFTGDSDHSDLEASV-REVESSRVA-EPEKRPRKRGRKPANGREEPLNHVEAERQRREK  495

Query  1150  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESR  971
             LNQRFYALRAVVPNVSKMDKASLL DA+SYI+EL+SKLQ+ E  +E L+ Q++++K+E  
Sbjct  496   LNQRFYALRAVVPNVSKMDKASLLADAVSYISELRSKLQSLELDKERLQCQVDALKEERD  555

Query  970   HpppppppepPLKL------AGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKD  809
                  P P   L         G+   ++V+ KI+G +AMIR+Q  K+ HPAARLM+AL++
Sbjct  556   SASARPRPLLDLDPKAMMNGCGRCHGVEVEAKILGSEAMIRVQSDKRFHPAARLMMALRE  615

Query  808   LDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEE  707
             LDL+V++ASVSVV DLMIQQATVKM S  Y QE+
Sbjct  616   LDLEVNYASVSVVKDLMIQQATVKMLSRSYTQEQ  649



>gb|KFK28472.1| hypothetical protein AALP_AA7G000700 [Arabis alpina]
Length=543

 Score =   226 bits (576),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 173/247 (70%), Gaps = 34/247 (14%)
 Frame = -2

Query  1390  NDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpkkrgrkP  1211
             N+EGMLSF                          SVV+EA S+R VVEP ++  ++  + 
Sbjct  319   NEEGMLSF-------------------------TSVVKEAGSNRNVVEPGEKKPRKRGRK  353

Query  1210  -ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQ  1034
              ANGREEPLNHVEAERQRREKLNQ+FYALRAVVPNVSKMDKASLLGDAISYINELKS L+
Sbjct  354   PANGREEPLNHVEAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDAISYINELKSNLE  413

Query  1033  TAESAQEDLKTQLESIKKE-------SRHpppppppepPL-KLAGkivdidvdvkiIGWD  878
              AES +E+L+ Q++ ++KE       S +          L + +   +++++DVKIIGWD
Sbjct  414   KAESDKEELEKQIDEMRKEVKAKAMASENGKCSVKDRKCLNQDSSVAIEMEIDVKIIGWD  473

Query  877   AMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRL  698
              M+RIQCSKKNHP AR M ALK+LD++V+HAS+SV+NDLMIQQATVKMG+  + Q++L++
Sbjct  474   VMVRIQCSKKNHPGARFMEALKELDMEVNHASLSVMNDLMIQQATVKMGNQFFTQDQLKV  533

Query  697   ALTSSIA  677
             AL   + 
Sbjct  534   ALMEKVG  540



>ref|XP_002467448.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
 gb|EER94446.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
Length=709

 Score =   229 bits (584),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 246/443 (56%), Gaps = 86/443 (19%)
 Frame = -2

Query  1795  LWLTD-PGPEVKDSVNTNVQGNSFPS---SITK--------QIVFGN-------ENPNPA  1673
             LWL D P  ++KDS+       S PS   S++K        QI F N       ENP+P+
Sbjct  275   LWLADAPVMDIKDSM-------SHPSAEISVSKPPPPPPPPQIHFENASTSTLTENPSPS  327

Query  1672  TVETQSNNNNSQL---------------FPRGLNFSEFGLDGGGAAVRNETSSLSC----  1550
                       +                 F R LNFS+F             SSL+     
Sbjct  328   VHAAPPQPAPAAAPQRQHQHQNQAHQGPFRRELNFSDF--------ASTNPSSLAATPPF  379

Query  1549  -KRESGEILNFG-DNAVKRSA-----------CSGNDAIFSGQFPAADEnnnnnknkKRT  1409
              K ESGEIL+FG D+  +R+             +   ++FS       +    N  K   
Sbjct  380   FKPESGEILSFGADSNARRNPSPAPPAATASLTTAPGSLFSQHTATMTQAAAANDAKNNN  439

Query  1408  -----TTSRGSN---------DEGMLSFvsgvvvpsagga-ggatgdsdhsDLEASVVRE  1274
                   TSR SN         +EGMLSF S      + G    A  +SDHSDL+ASV RE
Sbjct  440   KRSMEATSRASNTNHHPAATANEGMLSFSSAPTTRPSTGTGAPAKSESDHSDLDASV-RE  498

Query  1273  ADSSRVVVepekrpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  1103
              +SSRVV  P +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS
Sbjct  499   VESSRVVAPPPEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVS  558

Query  1102  KMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAG  923
             KMDKASLLGDAISYINEL+ KL + ES ++ L+ Q+E++KKE    PP           G
Sbjct  559   KMDKASLLGDAISYINELRGKLTSLESDKDTLQAQIEALKKERDARPPAHAAGLGGHDGG  618

Query  922   ki-vdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQA  746
                  +++D KI+G +AMIR+QC K+NHP+ARLM AL++LDLDV+HASVSVV DLMIQQ 
Sbjct  619   PRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELDLDVYHASVSVVKDLMIQQV  678

Query  745   TVKMGSHVYNQEELRLALTSSIA  677
              VKM S +Y+Q++L  AL S +A
Sbjct  679   AVKMASRIYSQDQLNAALYSRLA  701



>gb|EPS71023.1| hypothetical protein M569_03732, partial [Genlisea aurea]
Length=549

 Score =   222 bits (566),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 13/217 (6%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             +EASV ++A SS+VV +P+KRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  335   IEASVAKDAGSSKVV-DPQKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  393

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESR-----------  971
             VP VSKMDK+SLLGDAISYINELKSKLQ +E   E+++ QLES+KK+ +           
Sbjct  394   VPTVSKMDKSSLLGDAISYINELKSKLQNSELDMEEMRAQLESLKKKKKKKEEEEEGLPP  453

Query  970   HpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVH  791
             H           K  G          I G DAMIRIQCS+KNHPAA+LM A K+LDLD+H
Sbjct  454   HNETKYSAPSENKYGGGGATDIEVKII-GSDAMIRIQCSRKNHPAAKLMAAFKELDLDLH  512

Query  790   HASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             HAS+SV+N+ MIQ+ATVKMG+  ++Q++LR  L S I
Sbjct  513   HASISVMNESMIQRATVKMGATSFSQDQLRTTLMSKI  549



>emb|CDX73261.1| BnaC05g28450D [Brassica napus]
Length=443

 Score =   217 bits (553),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 138/176 (78%), Gaps = 3/176 (2%)
 Frame = -2

Query  1195  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQ  1016
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +
Sbjct  268   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEK  327

Query  1015  EDLKTQLESIKKE--SRHpppppppepPLKL-AGkivdidvdvkiIGWDAMIRIQCSKKN  845
               +KTQLE +K E   R             L A K V ++++VKIIGWDAMIR++ SK+N
Sbjct  328   TQIKTQLEEVKMELAGRKASAGGDLSSSCSLTAIKPVGMEIEVKIIGWDAMIRVESSKRN  387

Query  844   HPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             HPAARLM AL DL+L+V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  388   HPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  443



>emb|CDY26910.1| BnaA05g18020D [Brassica napus]
Length=443

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 138/176 (78%), Gaps = 3/176 (2%)
 Frame = -2

Query  1195  EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQ  1016
             EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI+YINELKSK+   ES +
Sbjct  268   EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEK  327

Query  1015  EDLKTQLESIKKE--SRHpppppppepPLKL-AGkivdidvdvkiIGWDAMIRIQCSKKN  845
               +KTQLE +K E   R             + A K V ++++VKIIGWDAMIR++ SK+N
Sbjct  328   TQIKTQLEEVKMELAGRKASAGGDLSSSCSMTAIKPVGMEIEVKIIGWDAMIRVESSKRN  387

Query  844   HPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             HPAARLM AL DL+L+V+HAS+SVVNDLMIQQATVKMG  +Y QE+LR +L S I 
Sbjct  388   HPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG  443



>ref|XP_009384126.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=676

 Score =   218 bits (554),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 187/395 (47%), Positives = 243/395 (62%), Gaps = 25/395 (6%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNTNVQGNSFPSSITKQIVFGNENPNPATVETQSNNNNSQLF  1631
             DPS LWLTDP   E+KDSV+          S+TK       NP+ + + T++ +++ ++ 
Sbjct  281   DPSVLWLTDPSAVEIKDSVSPVTTAADI--SVTKPRTQCENNPS-SRILTENPSSSRRIQ  337

Query  1630  PRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKR--SACSGNDAIFSGQF  1457
                 +  +    G G+  +N+T                +   KR  S       +FS   
Sbjct  338   KPHHHHHQQQHQGSGSNPQNQTFYSKLASNGPVPPQSTEPCSKRNPSPAPVTGGLFSDHQ  397

Query  1456  PAADEnnnnnknkKRTTTSRGSNDE-GMLSFvsgvvvpsaggaggatgd----------s  1310
              A     +         TSR SN E GML F S      + G   ++G           S
Sbjct  398   VATAVAEDMKNKGCTGATSRVSNQEAGMLCFSSAPARAPSNGQMKSSGGGVGGILDGPDS  457

Query  1309  dhsDLEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYA  1130
             D SDLEAS  RE +S+RVV EPEKRP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYA
Sbjct  458   DQSDLEASA-REVESNRVV-EPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  515

Query  1129  LRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppp  950
             LRAVVPNVSKMDKASLLGDA+SYINEL+S LQT E+ +E+L+ ++E+++K+    P  PP
Sbjct  516   LRAVVPNVSKMDKASLLGDAVSYINELRSNLQTLEADKEELRDRVEALEKK---LPVQPP  572

Query  949   pepPLKLA--GkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVS  776
             P+  L+    G+   ++++VKI+G +AMIR+QC K+NHPAA LM ALKDLDL++H+ASVS
Sbjct  573   PDHNLRTTTNGRCHGVEMEVKILGSEAMIRLQCQKRNHPAASLMAALKDLDLELHYASVS  632

Query  775   VVNDLMIQQATVKMG-SHVYNQEELRLALTSSIAA  674
             VV DLMIQQ TVKM    V  QE+L  +L S +AA
Sbjct  633   VVKDLMIQQVTVKMSPGRVMTQEQLCASLYSRVAA  667



>emb|CDX84081.1| BnaC08g07580D [Brassica napus]
Length=529

 Score =   214 bits (546),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 155/212 (73%), Gaps = 13/212 (6%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEA +V+E    R        PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV
Sbjct  326   LEAFIVKEIPEKR--------PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  377

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE--SRHpppppppe  944
             VPNVSKMDKASLLGDAI+YINELK K+   ES +  +K QLE +K E   R         
Sbjct  378   VPNVSKMDKASLLGDAIAYINELKLKVNKTESEKIHIKNQLEEVKIELAGRKSSTCGDLS  437

Query  943   pPLKLAGkivd---idvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSV  773
                  A  ++    ++++VK+IGWDAMIR++ SK+NHPAARLM AL DL+L+V HAS+SV
Sbjct  438   SSSSSATAMIKPVGMEIEVKVIGWDAMIRVESSKRNHPAARLMSALMDLELEVSHASMSV  497

Query  772   VNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             VNDLMIQQATVKMG  +Y Q++L+ +L S I 
Sbjct  498   VNDLMIQQATVKMGFRIYTQDQLQASLVSKIG  529



>ref|XP_009408104.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=613

 Score =   216 bits (550),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 167/214 (78%), Gaps = 6/214 (3%)
 Frame = -2

Query  1297  LEASVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAV  1118
             LEAS  RE  SS V+  PEKRPKKRGRKPANGREEPL+HVEAERQRREKLNQRFYALR+V
Sbjct  395   LEASA-REVTSSAVMEPPEKRPKKRGRKPANGREEPLDHVEAERQRREKLNQRFYALRSV  453

Query  1117  VPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE-----SRHppppp  953
             VPNVSKMDKASLL DA++YINEL+SK+Q  ES +  L+++L  +K E      R  PP  
Sbjct  454   VPNVSKMDKASLLADAVTYINELRSKMQALESDKRKLQSELGVLKMERESGSGRQMPPAG  513

Query  952   ppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSV  773
             P        G+  +++V+VKI+GW+AMIR+QC ++ HP+ARLM+AL++LDL+V++A+VSV
Sbjct  514   PRPAASNWPGRCSEVEVEVKILGWEAMIRVQCDRRCHPSARLMIALRELDLEVYYANVSV  573

Query  772   VNDLMIQQATVKMGSHVYNQEELRLALTSSIAAN  671
             V DLMIQQ TVKM S +Y QE+L  AL SS+ A+
Sbjct  574   VKDLMIQQVTVKMTSRIYTQEQLTAALFSSVTAD  607



>ref|XP_010935028.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=641

 Score =   216 bits (551),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 180/402 (45%), Positives = 234/402 (58%), Gaps = 40/402 (10%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQG------NSFPSSITKQIVFGNENPNPATVETQSNNN  1646
             DPS LW++DP      +    V        N   SS+T       ENP+P  +  +S+  
Sbjct  247   DPSVLWISDPIAPAPPAPEIPVSKPPSQFENPNSSSLT-------ENPSPFPIPQRSSPP  299

Query  1645  NSQLF-----PRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDNAVKRSACSGN  1481
                       P   +F +  L   G  ++   S+ +CK E+ +  N+G++    S  + N
Sbjct  300   PPPPQSSSTNPHTQSFLDVSLSESG--LKAFPSAPTCKPETCDFSNYGESKRNPSTVAAN  357

Query  1480  DAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhs  1301
                F     + +  N  +       TS+GSN+EGMLSF S     +A            +
Sbjct  358   GGFFFHHSISTENKNKKSTG----ATSKGSNNEGMLSFSSAATAVAAADWSRPASGGCTT  413

Query  1300  DLEA---------SVVREADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKL  1148
              L A         + VRE +SSRV  EPEKRP+KRGRKPANGREEPL+HVEAERQRREKL
Sbjct  414   GLLAGDSDHSDLEASVREVESSRVA-EPEKRPRKRGRKPANGREEPLDHVEAERQRREKL  472

Query  1147  NQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKE---  977
             NQRFYALRA VPNVSKMDKASLL DAISYI EL+SKLQ+ E  +E L +Q++ +KKE   
Sbjct  473   NQRFYALRAEVPNVSKMDKASLLADAISYIRELRSKLQSLELDREGLHSQIDVLKKERDL  532

Query  976   --SRHpppppppepPLKLAGkivd-idvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDL  806
               +R  PP       +   G     ++V+VKI+G +AMIR+ C+K+ HPAARLM+ALK+L
Sbjct  533   TLARPSPPLDNDLKAVVNGGSRCHGVEVEVKILGREAMIRVHCNKRYHPAARLMMALKEL  592

Query  805   DLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             DL+V +ASVSVVNDLMIQQATV M S  Y QE+L  AL + I
Sbjct  593   DLEVSYASVSVVNDLMIQQATVNMLSRSYTQEQLTAALFARI  634



>ref|XP_009396848.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=712

 Score =   216 bits (549),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 186/417 (45%), Positives = 240/417 (58%), Gaps = 48/417 (12%)
 Frame = -2

Query  1807  DPSALWLTDPG-PEVKDSVNTNVQGNSFPSSITKQIVFGN---------ENPNPATVETQ  1658
             DPS LW  DP   E++D V  N    S   S +K ++  +         ENP+P  ++ Q
Sbjct  298   DPSELWFADPSLVEIRDFVLPN--SASVEISASKPLIHFDSNHSSRTLRENPSPFQIQ-Q  354

Query  1657  SNN--------------NNSQ---LFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEI  1529
             SN               N+SQ    F R LNFSE    G  A ++      S K ES E 
Sbjct  355   SNGQRHQQRQQHQSSSGNDSQTQPFFARELNFSELLHTGPAAPLQ------SVKPESDEN  408

Query  1528  LNF-GDNAVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvv  1352
              NF G      +A   ++   S Q  AA  ++N N +     +   SNDE  L F S   
Sbjct  409   GNFIGSKRNSSAAIVASNLFSSHQIAAAVPDDNMNNSSTGAMSMPRSNDEAKLVFSSAPA  468

Query  1351  vpsaggaggatgd--sdhsDLEASVVREADSSR--------VVVepekrpkkrgrkPANG  1202
              PS+      +    S    LE +    +D+ R        ++ +PEKRP+KRGRKPANG
Sbjct  469   RPSSIALMKCSPGGGSIGDFLEGADSDHSDTERSMRKMGSSLLTDPEKRPRKRGRKPANG  528

Query  1201  REEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAES  1022
             REEPLNHVEAERQRREKLNQRFYALR+VVPNVSKMDKASLLGDA +YINEL+ KLQ+ ES
Sbjct  529   REEPLNHVEAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDATTYINELRVKLQSLES  588

Query  1021  AQEDLKTQLESIKKESRHpppppppepPLKLA-GkivdidvdvkiIGWDAMIRIQCSKKN  845
              +E L+ Q+E+++K+ + PP   P         G+   ++++VK++  +AMIR+QC   N
Sbjct  589   EKEGLEAQVEALRKDRQSPPARSPHLGETTNGNGRCYGVEMEVKMLDSEAMIRLQCQNTN  648

Query  844   HPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIAA  674
             HP A LM ALKDL+LDV++ASVSVV DLMIQQATVKM S  Y QE+L  AL   +AA
Sbjct  649   HPTAMLMSALKDLNLDVYYASVSVVKDLMIQQATVKMSSREYTQEQLSSALYYRVAA  705



>gb|AEB35595.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    XEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35606.1| MYC2 [Helianthus annuus]
 gb|AEB35607.1| MYC2 [Helianthus annuus]
 gb|AEB35695.1| MYC2 [Helianthus annuus]
 gb|AEB35696.1| MYC2 [Helianthus annuus]
Length=155

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E+ +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEANKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35578.1| MYC2 [Helianthus exilis]
 gb|AEB35579.1| MYC2 [Helianthus exilis]
Length=155

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D++VDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSVQENMKMSSITTRGPPADLEVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35671.1| MYC2 [Helianthus annuus]
Length=155

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEXNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35565.1| MYC2 [Helianthus petiolaris]
 gb|AEB35584.1| MYC2 [Helianthus tuberosus]
 gb|AEB35585.1| MYC2 [Helianthus tuberosus]
 gb|AEB35586.1| MYC2 [Helianthus tuberosus]
 gb|AEB35588.1| MYC2 [Helianthus tuberosus]
 gb|AEB35589.1| MYC2 [Helianthus tuberosus]
 gb|AEB35590.1| MYC2 [Helianthus tuberosus]
 gb|AEB35591.1| MYC2 [Helianthus tuberosus]
 gb|AEB35593.1| MYC2 [Helianthus tuberosus]
 gb|AEB35594.1| MYC2 [Helianthus tuberosus]
 gb|AEB35679.1| MYC2 [Helianthus annuus]
 gb|AEB35685.1| MYC2 [Helianthus annuus]
Length=155

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35580.1| MYC2 [Helianthus exilis]
 gb|AEB35581.1| MYC2 [Helianthus exilis]
 gb|AEB35582.1| MYC2 [Helianthus exilis]
 gb|AEB35583.1| MYC2 [Helianthus exilis]
Length=155

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSVQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35676.1| MYC2 [Helianthus annuus]
 gb|AEB35677.1| MYC2 [Helianthus annuus]
Length=155

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITARGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35597.1| MYC2 [Helianthus argophyllus]
 gb|AEB35598.1| MYC2 [Helianthus argophyllus]
 gb|AEB35599.1| MYC2 [Helianthus argophyllus]
 gb|AEB35600.1| MYC2 [Helianthus argophyllus]
 gb|AEB35602.1| MYC2 [Helianthus argophyllus]
 gb|AEB35603.1| MYC2 [Helianthus argophyllus]
 gb|AEB35608.1| MYC2 [Helianthus annuus]
 gb|AEB35609.1| MYC2 [Helianthus annuus]
 gb|AEB35610.1| MYC2 [Helianthus annuus]
 gb|AEB35611.1| MYC2 [Helianthus annuus]
 gb|AEB35612.1| MYC2 [Helianthus annuus]
 gb|AEB35613.1| MYC2 [Helianthus annuus]
 gb|AEB35614.1| MYC2 [Helianthus annuus]
 gb|AEB35615.1| MYC2 [Helianthus annuus]
 gb|AEB35616.1| MYC2 [Helianthus annuus]
 gb|AEB35617.1| MYC2 [Helianthus annuus]
 gb|AEB35618.1| MYC2 [Helianthus annuus]
 gb|AEB35619.1| MYC2 [Helianthus annuus]
 gb|AEB35620.1| MYC2 [Helianthus annuus]
 gb|AEB35621.1| MYC2 [Helianthus annuus]
 gb|AEB35622.1| MYC2 [Helianthus annuus]
 gb|AEB35623.1| MYC2 [Helianthus annuus]
 gb|AEB35624.1| MYC2 [Helianthus annuus]
 gb|AEB35625.1| MYC2 [Helianthus annuus]
 gb|AEB35626.1| MYC2 [Helianthus annuus]
 gb|AEB35627.1| MYC2 [Helianthus annuus]
 gb|AEB35628.1| MYC2 [Helianthus annuus]
 gb|AEB35629.1| MYC2 [Helianthus annuus]
 gb|AEB35630.1| MYC2 [Helianthus annuus]
 gb|AEB35631.1| MYC2 [Helianthus annuus]
 gb|AEB35632.1| MYC2 [Helianthus annuus]
 gb|AEB35633.1| MYC2 [Helianthus annuus]
 gb|AEB35634.1| MYC2 [Helianthus annuus]
 gb|AEB35635.1| MYC2 [Helianthus annuus]
 gb|AEB35636.1| MYC2 [Helianthus annuus]
 gb|AEB35637.1| MYC2 [Helianthus annuus]
 gb|AEB35638.1| MYC2 [Helianthus annuus]
 gb|AEB35639.1| MYC2 [Helianthus annuus]
 gb|AEB35641.1| MYC2 [Helianthus annuus]
 gb|AEB35642.1| MYC2 [Helianthus annuus]
 gb|AEB35643.1| MYC2 [Helianthus annuus]
 gb|AEB35644.1| MYC2 [Helianthus annuus]
 gb|AEB35645.1| MYC2 [Helianthus annuus]
 gb|AEB35646.1| MYC2 [Helianthus annuus]
 gb|AEB35647.1| MYC2 [Helianthus annuus]
 gb|AEB35648.1| MYC2 [Helianthus annuus]
 gb|AEB35650.1| MYC2 [Helianthus annuus]
 gb|AEB35651.1| MYC2 [Helianthus annuus]
 gb|AEB35652.1| MYC2 [Helianthus annuus]
 gb|AEB35653.1| MYC2 [Helianthus annuus]
 gb|AEB35665.1| MYC2 [Helianthus annuus]
 gb|AEB35666.1| MYC2 [Helianthus annuus]
 gb|AEB35667.1| MYC2 [Helianthus annuus]
 gb|AEB35668.1| MYC2 [Helianthus annuus]
 gb|AEB35669.1| MYC2 [Helianthus annuus]
 gb|AEB35670.1| MYC2 [Helianthus annuus]
 gb|AEB35672.1| MYC2 [Helianthus annuus]
 gb|AEB35673.1| MYC2 [Helianthus annuus]
 gb|AEB35680.1| MYC2 [Helianthus annuus]
 gb|AEB35683.1| MYC2 [Helianthus annuus]
 gb|AEB35684.1| MYC2 [Helianthus annuus]
 gb|AEB35686.1| MYC2 [Helianthus annuus]
 gb|AEB35687.1| MYC2 [Helianthus annuus]
 gb|AEB35688.1| MYC2 [Helianthus annuus]
 gb|AEB35690.1| MYC2 [Helianthus annuus]
 gb|AEB35691.1| MYC2 [Helianthus annuus]
 gb|AEB35697.1| MYC2 [Helianthus annuus]
 gb|AEB35698.1| MYC2 [Helianthus annuus]
 gb|AEB35700.1| MYC2 [Helianthus annuus]
 gb|AEB35701.1| MYC2 [Helianthus annuus]
Length=155

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35601.1| MYC2 [Helianthus argophyllus]
Length=155

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSXQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35575.1| MYC2 [Helianthus exilis]
 gb|AEB35576.1| MYC2 [Helianthus exilis]
Length=155

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSVQENMKMSCITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35706.1| MYC2 [Helianthus annuus]
Length=155

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSXQENMKMSSVTXRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35592.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITXRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMXAMMELDLEVHHASVSVVNEL  155



>gb|AEB35568.1| MYC2 [Helianthus petiolaris]
 gb|AEB35569.1| MYC2 [Helianthus petiolaris]
Length=155

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENINLSSITARGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35674.1| MYC2 [Helianthus annuus]
 gb|AEB35675.1| MYC2 [Helianthus annuus]
Length=155

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMSAMMELDLEVHHASVSVVNEL  155



>gb|AEB35596.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITXRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMSAMMELDLEVHHASVSVVNEL  155



>gb|AEB35587.1| MYC2 [Helianthus tuberosus]
Length=155

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITSRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMXAMMELDLEVHHASVSVVNEL  155



>gb|AEB35567.1| MYC2 [Helianthus petiolaris]
 gb|AEB35689.1| MYC2 [Helianthus annuus]
 gb|AEB35705.1| MYC2 [Helianthus annuus]
Length=155

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35656.1| MYC2 [Helianthus annuus]
Length=155

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E+ +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEANKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +K +HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKMSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35692.1| MYC2 [Helianthus annuus]
Length=155

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKXSSXTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35577.1| MYC2 [Helianthus exilis]
Length=155

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+D DVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSVQENMKMSSXTTRGPPADLDXDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35658.1| MYC2 [Helianthus annuus]
 gb|AEB35659.1| MYC2 [Helianthus annuus]
 gb|AEB35663.1| MYC2 [Helianthus annuus]
 gb|AEB35664.1| MYC2 [Helianthus annuus]
Length=155

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM ++ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTSMMELDLEVHHASVSVVNEL  155



>ref|XP_006398377.1| hypothetical protein EUTSA_v10000853mg [Eutrema salsugineum]
 gb|ESQ39830.1| hypothetical protein EUTSA_v10000853mg [Eutrema salsugineum]
Length=534

 Score =   203 bits (516),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 190/342 (56%), Gaps = 71/342 (21%)
 Frame = -2

Query  1690  ENPNPATVETQSNNNNSQLFPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEILNFGDN  1511
             +NPNP   + Q +      F   LNFS    +    A+            SGEILNFGD+
Sbjct  258   DNPNPTYPKIQKS------FSPELNFSMVTPNSSTGAL------------SGEILNFGDD  299

Query  1510  AVKRSACSGNDAIFSGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgvvvpsagga  1331
              VKR+    N   + GQ                       ND+G                
Sbjct  300   -VKRNPGILNCTSYPGQI---------------------QNDDG----------------  321

Query  1330  ggatgdsdhsDLEASVVREADSSR-----VVVepekrpkkrgrkPANGREEPLNHVEAER  1166
                       DL A+V +  DS +      VV   KR  KRGRKPANGR+EP+NHVEAER
Sbjct  322   ----------DLLAAVKKIDDSDQSNINATVVCENKRQSKRGRKPANGRKEPMNHVEAER  371

Query  1165  QRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQLESI  986
              RR+KLNQRFYALRAVVPNVSKMDKASLLGDA+ YINELKS+ + AE  +  ++ QL+ +
Sbjct  372   LRRDKLNQRFYALRAVVPNVSKMDKASLLGDAVCYINELKSRAENAEMEKIAIEIQLQKL  431

Query  985   KKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDL  806
             K+E              K A KI    +DVK++G DAMIR++ SK+NHP ARLM A  DL
Sbjct  432   KEEISGCNAISSVCADGKNASKIGTAKIDVKVMGCDAMIRVESSKRNHPGARLMNAFMDL  491

Query  805   DLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +L+V+HASVSV+NDLM+QQATVKM    Y +E+LR+ L S I
Sbjct  492   ELEVNHASVSVINDLMVQQATVKMVLKFYTEEQLRVMLISKI  533



>gb|AEB35604.1| MYC2 [Helianthus argophyllus]
 gb|AEB35605.1| MYC2 [Helianthus argophyllus]
Length=155

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +K +HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKMSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35703.1| MYC2 [Helianthus annuus]
Length=155

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +K +HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKXSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35660.1| MYC2 [Helianthus annuus]
 gb|AEB35661.1| MYC2 [Helianthus annuus]
Length=155

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAEQNMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAA LM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAAHLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35694.1| MYC2 [Helianthus annuus]
Length=155

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEA+RQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEADRQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35678.1| MYC2 [Helianthus annuus]
Length=155

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARL  A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLRTAMMELDLEVHHASVSVVNEL  155



>ref|XP_009391048.1| PREDICTED: transcription factor MYC2-like [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   202 bits (513),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 141/245 (58%), Positives = 183/245 (75%), Gaps = 4/245 (2%)
 Frame = -2

Query  1408  TTSRGSNDEGMLSFvsgvvvpsaggaggatgdsdhsDLEASVVREADSSRVVVepekrpk  1229
             +TSRGS+D G L   S  V  +A    G   DSDHSDLE S  REA SS   +E EKRPK
Sbjct  310   STSRGSDDGGFLP-SSTAVAATAPKPEGGGLDSDHSDLEGSA-REATSS-ATLEREKRPK  366

Query  1228  krgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINEL  1049
             KRGRKPANGRE P++HVEAERQRREKLNQRFYALR+VVPNVSKMDKASLL DAI+YINEL
Sbjct  367   KRGRKPANGREVPIDHVEAERQRREKLNQRFYALRSVVPNVSKMDKASLLADAIAYINEL  426

Query  1048  KSKLQTAESAQEDLKTQLESIKK-ESRHpppppppepPLKLAGkivdidvdvkiIGWDAM  872
              +K+ T ES +  L+++L ++K+ +S+                   +++V+VK++G +AM
Sbjct  427   HTKVGTMESEKRRLRSELSALKEAKSKATANEWTTSETGTSGEGEGEVEVEVKLLGREAM  486

Query  871   IRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             IR+QC ++ HPAARLMVAL++L+L+V++A+V+VV +LMIQQATVKMGS +YNQE+L  AL
Sbjct  487   IRVQCERRAHPAARLMVALRELELEVYYANVTVVKELMIQQATVKMGSRIYNQEQLTAAL  546

Query  691   TSSIA  677
              + +A
Sbjct  547   FARVA  551



>gb|AEB35640.1| MYC2 [Helianthus annuus]
 gb|AEB35654.1| MYC2 [Helianthus annuus]
 gb|AEB35662.1| MYC2 [Helianthus annuus]
Length=155

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +K +HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKXSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35571.1| MYC2 [Helianthus paradoxus]
 gb|AEB35572.1| MYC2 [Helianthus paradoxus]
Length=156

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 126/156 (81%), Gaps = 9/156 (6%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkiv------didvdvkiIGWDAMI  869
              E  +++L+ Q++++KKE          +  +K++          D+DVDVK+IGWDAMI
Sbjct  64    NEGNKDELRNQIDALKKE---LSNKVSAQENMKMSSTTRGPPADLDLDVDVKVIGWDAMI  120

Query  868   RIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             R+QC+KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  121   RVQCNKKSHPAARLMTAMMELDLEVHHASVSVVNEL  156



>gb|AEB35649.1| MYC2 [Helianthus annuus]
 gb|AEB35655.1| MYC2 [Helianthus annuus]
Length=155

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAZZNMKMSSXTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAA LM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAAXLMTAMMELDLEVHHASVSVVNEL  155



>gb|AEB35570.1| MYC2 [Helianthus petiolaris]
Length=155

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGRE PLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREAPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q +++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQXDALKKELSNKVSXQENMKMSSITARGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +KK+HPAARLM A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKKSHPAARLMTAMMELDLEVHHASVSVVNEL  155



>gb|EEE51454.1| hypothetical protein OsJ_32566 [Oryza sativa Japonica Group]
Length=732

 Score =   203 bits (517),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 182/433 (42%), Positives = 235/433 (54%), Gaps = 86/433 (20%)
 Frame = -2

Query  1807  DPSALWLTDPGP-EVKDSVNT-NVQGNSFPSSITKQIV-FGN-------ENPNPAT-VET  1661
             DPS LWL D  P ++KDS++  ++  +  P     QI  F N       ENP+P+    T
Sbjct  323   DPSVLWLADAPPMDMKDSISAADISVSKPPPPPPHQIQHFENGSTSTLTENPSPSVHAPT  382

Query  1660  QSNNNNSQL---------------FPRGLNFSEFGLDGGGAAVRNETSSLSCKRESGEIL  1526
              S                      F R LNFS+F  +GG AA          K E+GEIL
Sbjct  383   PSQPAAPPQRQQQQQQSSQAQQGPFRRELNFSDFASNGGAAA------PPFFKPETGEIL  436

Query  1525  NFGDNA-------------VKRSACSGNDAIFSGQFP----AADEnnnnnknkKRTTTSR  1397
             NFG+++                S  +   ++FS   P    AA++  +NN+ +    TSR
Sbjct  437   NFGNDSSSGRRNPSPAPPAATASLTTAPGSLFSQHTPTLTAAANDAKSNNQKRSMEATSR  496

Query  1396  GSN---------DEGMLSFvsgvvvpsagga-ggatgdsdhsDLEASVVREADSSRVVVe  1247
              SN         +EGMLSF S      + G    A  +SDHSDLEASV RE +SSRVV  
Sbjct  497   ASNTNNHPAATANEGMLSFSSAPTTRPSTGTGAPAKSESDHSDLEASV-REVESSRVVAP  555

Query  1246  pekrpkkrgr---kPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLG  1076
             P +  K+  +   KPANGREEPLNHVEAERQRREKLNQRFYALRAV              
Sbjct  556   PPEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV--------------  601

Query  1075  DAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdv  896
                     L+ KL   E+ +E L++Q+ES+KKE R   PP P         +   ++++ 
Sbjct  602   --------LRGKLTALETDKETLQSQMESLKKE-RDARPPAPSGGGGDGGARCHAVEIEA  652

Query  895   kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYN  716
             KI+G +AMIR+QC K+NHPAARLM AL++LDLDV+HASVSVV DLMIQQ  VKM S VY+
Sbjct  653   KILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYHASVSVVKDLMIQQVAVKMASRVYS  712

Query  715   QEELRLALTSSIA  677
             Q++L  AL + IA
Sbjct  713   QDQLNAALYTRIA  725



>gb|AEB35657.1| MYC2 [Helianthus annuus]
Length=155

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E+ +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEANKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDL  761
             +K +HPAARL  A+ +LDL+VHHASVSVVN+L
Sbjct  124   NKMSHPAARLRTAMMELDLEVHHASVSVVNEL  155



>ref|XP_009114324.1| PREDICTED: transcription factor bHLH28-like [Brassica rapa]
Length=507

 Score =   199 bits (506),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 135/177 (76%), Gaps = 3/177 (2%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGR+EPLNHV+AER RREKLNQRFYALRA VPNVSKMDKASLLGDAISYI ELKS+ + 
Sbjct  333   ANGRKEPLNHVQAERLRREKLNQRFYALRATVPNVSKMDKASLLGDAISYIKELKSRAEN  392

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +  ++ QL  +K+E                A +I   ++DVKI+G DAM+R++ SK
Sbjct  393   AESERNAIQIQLNKLKEEMAGRNVVCRGGEN---ASEIETANIDVKILGCDAMVRLESSK  449

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +NHPAARLM A  DLD++++HAS+SV++DLMIQQATVKMGS +Y Q++LR  L S I
Sbjct  450   RNHPAARLMNAFMDLDVELNHASISVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  506



>emb|CDY35183.1| BnaA09g18200D [Brassica napus]
Length=507

 Score =   199 bits (505),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 135/177 (76%), Gaps = 3/177 (2%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGR+EPLNHV+AER RREKLNQRFYALRA VPNVSKMDKASLLGDAISYI ELKS+ + 
Sbjct  333   ANGRKEPLNHVQAERLRREKLNQRFYALRATVPNVSKMDKASLLGDAISYIKELKSRAEN  392

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +  ++ QL  +K+E                A +I   ++DVKI+G DAM+R++ SK
Sbjct  393   AESERNAIQIQLNKLKEEMAGRNVVCRGGEN---ASEIETANIDVKILGCDAMVRLESSK  449

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +NHPAARLM A  DLD++++HAS+SV++DLMIQQATVKMGS +Y Q++LR  L S I
Sbjct  450   RNHPAARLMNAFMDLDVELNHASISVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  506



>gb|AGO03813.1| JAMYC2 [Taxus cuspidata]
Length=304

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 132/194 (68%), Gaps = 16/194 (8%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDA+SYINEL+SK+Q 
Sbjct  106   ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKVQE  165

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdv-------------  896
              E+ +++L++ +E+ KKE  S H           K       +                 
Sbjct  166   LETERKELESHVEATKKELLSSHSGFSGANFGFAKDLSSSSRVPDSKGFGTKQCPGLDLD  225

Query  895   -kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVY  719
              +++G +AM+RIQ  KKNHPAARLM A ++L+L+VHHASVS VN+LM+Q   V++   +Y
Sbjct  226   VRVLGAEAMVRIQSGKKNHPAARLMTAFQELELEVHHASVSTVNELMLQNVIVRLPKSLY  285

Query  718   NQEELRLALTSSIA  677
              +E+L  AL   ++
Sbjct  286   TEEQLSAALFKKLS  299



>emb|CDY59973.1| BnaA09g53560D [Brassica napus]
Length=509

 Score =   198 bits (503),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGR+EPLNHV+AER RREKLN RFYALRA VPNVSKMDKASLLGDAI YINELKS+ + 
Sbjct  332   ANGRKEPLNHVQAERLRREKLNMRFYALRATVPNVSKMDKASLLGDAICYINELKSRAEN  391

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +  ++ +L  +++E                A +    ++DVKI+G DAM+R++ SK
Sbjct  392   AESKKNAIQMELNKLREELAGRNAVSSVCRGEGNASENETANIDVKILGCDAMVRLESSK  451

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +NHPAARLM A  DLD++++HAS+SV++DLMIQQATVKMGS +Y Q++LR  L S I
Sbjct  452   RNHPAARLMNAFMDLDVELNHASISVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  508



>ref|XP_009114323.1| PREDICTED: transcription factor bHLH28-like [Brassica rapa]
Length=509

 Score =   196 bits (498),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGR+EPLNHV+AER RREKLN +FYALRA VPNVSKMDKASLLGDAI YINELKS+ + 
Sbjct  332   ANGRKEPLNHVQAERLRREKLNMQFYALRATVPNVSKMDKASLLGDAICYINELKSRAEN  391

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +  ++ +L  +++E                A +    ++DVKI+G DAM+R++ SK
Sbjct  392   AESKKNAIQMELNKLREEIAGRNAVSSVCRGEGNASENETANIDVKILGCDAMVRLESSK  451

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +NHPAARLM A  DLD++++HAS+SV++DLMIQQATVKMGS +Y Q++LR  L S I
Sbjct  452   RNHPAARLMNAFMDLDVELNHASISVIHDLMIQQATVKMGSRMYTQDQLRAMLVSKI  508



>emb|CDY03185.1| BnaC09g19710D [Brassica napus]
Length=473

 Score =   193 bits (491),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 134/177 (76%), Gaps = 3/177 (2%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGR+EPLNHV+AER RREKLNQRFYALRA VPNVSKMDK SLLGDAISYI ELKS+ + 
Sbjct  299   ANGRKEPLNHVQAERLRREKLNQRFYALRATVPNVSKMDKTSLLGDAISYIKELKSRAEN  358

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +  ++  L  +K+E              K A +I   ++DVKI+G DAM+R++ SK
Sbjct  359   AESERNAIQILLNKLKEE---MAGRNAVCRGGKNASEIETANIDVKILGCDAMVRLESSK  415

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +NHPAARLM A  DLD++++HAS+SV++DLMIQQATVKMGS +Y Q++L+  L S I
Sbjct  416   RNHPAARLMNAFMDLDVELNHASISVIHDLMIQQATVKMGSRMYTQDQLQAMLVSKI  472



>emb|CDY03183.1| BnaC09g19730D [Brassica napus]
Length=509

 Score =   194 bits (493),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGR+EPLNHV+AER RREKLN RFYALRA VPNVSKMDKASLLGDAI YINELKS+ + 
Sbjct  332   ANGRKEPLNHVQAERLRREKLNMRFYALRATVPNVSKMDKASLLGDAICYINELKSRAED  391

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +  ++ +L  +++E              + A +    ++DVKI+G DAM+R++ SK
Sbjct  392   AESKKNAIQMELIKLREEIAGRNADSSVCRGGENASENETANIDVKILGCDAMVRLESSK  451

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +NHPAARLM A  DLD++++HAS+SV++DLMIQQATVKMGS  Y  ++LR  L S I
Sbjct  452   RNHPAARLMNAFMDLDVELNHASISVIHDLMIQQATVKMGSRTYTPDQLRAMLVSKI  508



>gb|EMS55891.1| Transcription factor MYC4 [Triticum urartu]
Length=373

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -2

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             V AERQRREKLNQRFY LRAVVPNVSKMDKASLLGDAISYINEL+ K+   ES +E L +
Sbjct  198   VTAERQRREKLNQRFYTLRAVVPNVSKMDKASLLGDAISYINELRGKMTALESDKETLHS  257

Query  1000  QLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARLMV  821
             Q+E++KKE R   P  P         +   ++++ KI+G +AMIR+QC K+NHPAA+LM 
Sbjct  258   QIEALKKE-RDARPAAPSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMT  316

Query  820   ALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             AL++LDLDV+HASVSVV D+MIQQ  VKM + VY+Q++L  AL   +A
Sbjct  317   ALRELDLDVYHASVSVVKDIMIQQVAVKMATRVYSQDQLNAALYGRLA  364



>gb|AEB35573.1| MYC2 [Helianthus paradoxus]
 gb|AEB35574.1| MYC2 [Helianthus paradoxus]
Length=151

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 121/151 (80%), Gaps = 9/151 (6%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkiv------didvdvkiIGWDAMI  869
              E  +++L+ Q++++KKE          +  +K++          D+DVDVK+IGWDAMI
Sbjct  64    NEGNKDELRNQIDALKKE---LSNKVSAQENMKMSSTTRGPPADLDLDVDVKVIGWDAMI  120

Query  868   RIQCSKKNHPAARLMVALKDLDLDVHHASVS  776
             R+QC+KK+HPAARLM A+ +LDL+VHHASVS
Sbjct  121   RVQCNKKSHPAARLMTAMMELDLEVHHASVS  151



>gb|ACM48567.1| JAMYC [Taxus cuspidata]
Length=660

 Score =   194 bits (492),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 131/198 (66%), Gaps = 20/198 (10%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQR YALRAVVPNVSKMDKASLLGDAI+YINEL+SK+  
Sbjct  458   ANGREEPLNHVEAERQRREKLNQRVYALRAVVPNVSKMDKASLLGDAIAYINELRSKVVD  517

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGW----------  881
             AE+ +++L+ Q+E++KKE           P   L            + G           
Sbjct  518   AETHKKELQVQVEALKKELVVVRESGASGPNFGLIKDHYPTADSSDVKGHGLNNSKCHGI  577

Query  880   ---------DAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKM-G  731
                      +AMIR+Q  K+NHP ARLM ALK+LDL+VHHASVS V +LMIQ   VKM G
Sbjct  578   ELEVRLLGREAMIRVQSPKQNHPVARLMGALKELDLEVHHASVSAVKELMIQTVIVKMTG  637

Query  730   SHVYNQEELRLALTSSIA  677
               VY+QE+L  AL+ S+A
Sbjct  638   GIVYSQEQLNAALSKSVA  655



>ref|XP_006279851.1| hypothetical protein CARUB_v10028430mg [Capsella rubella]
 gb|EOA12749.1| hypothetical protein CARUB_v10028430mg [Capsella rubella]
Length=474

 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -2

Query  1207  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTA  1028
             +GRE+PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKSK + +
Sbjct  299   HGREKPLNHVEAERMRREKLNNRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSKAENS  358

Query  1027  ESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKK  848
             ES +  ++ QL+ +KK               K   K+ ++ ++VK++G D MIR++  K+
Sbjct  359   ESGKTAVEIQLKELKKVMELQNATSSSVCKDK-EKKLSELKMEVKVMGSDVMIRVESGKR  417

Query  847   NHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
             NHP AR M AL DL+L+V+H S+SV+NDLMIQQATVKMG  +Y QE+LR  L S I+
Sbjct  418   NHPGARFMNALMDLELEVNHTSISVMNDLMIQQATVKMGLRIYEQEQLRDMLISKIS  474



>ref|XP_010441529.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=461

 Score =   185 bits (470),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 126/177 (71%), Gaps = 3/177 (2%)
 Frame = -2

Query  1207  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTA  1028
             +GRE+PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKS  + A
Sbjct  286   HGREKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSTAENA  345

Query  1027  ESAQEDLKTQLESIKK-ESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             ES +  ++ QL  +KK   R            K    + ++ ++VK +G D MIR++  K
Sbjct  346   ESERNAVQNQLNELKKITGRQNATSSVVCNDDK--ENVSELKIEVKAMGSDVMIRVESGK  403

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             +NHP ARLM AL DL+L+V HAS+SV+NDLMIQQATVKMG  +Y QE+LR  L S I
Sbjct  404   RNHPGARLMNALMDLELEVSHASISVMNDLMIQQATVKMGLRIYEQEQLRDMLKSKI  460



>ref|XP_010494874.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=478

 Score =   186 bits (471),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 126/176 (72%), Gaps = 2/176 (1%)
 Frame = -2

Query  1207  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTA  1028
             +GRE+PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKS  + A
Sbjct  304   HGREKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSTAENA  363

Query  1027  ESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKK  848
             ES +  ++ QL  +KK +             K    + D+ ++VK +G D MIR++  K+
Sbjct  364   ESEKNAVQNQLNELKKITGRQNATSSVCNDDK--ENVSDLKIEVKAMGSDVMIRVESGKR  421

Query  847   NHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             NHP ARLM AL DL+L+V+HAS+SV+NDLMIQQATVKMG   Y QE+LR  L S I
Sbjct  422   NHPGARLMNALMDLELEVNHASISVMNDLMIQQATVKMGLRTYEQEQLRDMLKSKI  477



>ref|XP_002865159.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   186 bits (472),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             A+GR++PLNHVEAER RREKLN RFYALRAVVPN+SKMDK SLL DA+ YINELKSK + 
Sbjct  329   AHGRDQPLNHVEAERMRREKLNHRFYALRAVVPNISKMDKTSLLEDAVHYINELKSKAEN  388

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AES +  ++ QL  +K+ +             K      ++ ++VKI+G DAM+R++ SK
Sbjct  389   AESEKNAIQIQLNELKEMAGQ---RNAIPSVFKYEENASEMKIEVKIMGNDAMVRVESSK  445

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
              +HP ARLM AL DL+L+V++AS+SV+ND MIQQA VKMG  +Y QEELR  L S I+
Sbjct  446   SHHPGARLMNALMDLELEVNNASMSVMNDFMIQQANVKMGLRIYKQEELRDVLISKIS  503



>ref|XP_010481407.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=474

 Score =   184 bits (468),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 126/176 (72%), Gaps = 2/176 (1%)
 Frame = -2

Query  1207  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTA  1028
             +GRE+PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKS  + A
Sbjct  300   HGREKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINELKSTAENA  359

Query  1027  ESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKK  848
             ES +  ++ QL  +KK +             K    + ++ ++VK +G D MIR++  K+
Sbjct  360   ESERNAVQNQLNELKKITGRQNATSSVCNDDK--ENLSELKIEVKAMGSDVMIRVESGKR  417

Query  847   NHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             NHP ARLM AL DL+L+V HAS+SV+NDLMIQQATVKMG  +Y QE+L+  L S I
Sbjct  418   NHPGARLMNALMDLELEVSHASISVMNDLMIQQATVKMGLRIYEQEQLQDMLISKI  473



>gb|AEJ88337.1| putative MYC protein, partial [Tamarix hispida]
Length=521

 Score =   185 bits (469),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 194/306 (63%), Gaps = 39/306 (13%)
 Frame = -2

Query  1807  DPSALWLTDPGPEVKDSVNTNVQGNSFPSSIT-------------------KQIVFGNEN  1685
             DPSALW+++P     +       G    S++T                   K ++  +  
Sbjct  225   DPSALWISEPSSSAAEFRTVMTAGGGSSSNLTCLSSNPVANGSHHHQQQQQKGVIHLDVQ  284

Query  1684  P------NPATVETQSNNNNSQ--LFPRGLNFSEFG-LDGGGAAVRNETSSLSCKRESGE  1532
                    NP  + T     N Q     R LNFSE+G +DG G+  RN T +   K E+GE
Sbjct  285   STSCVGENPIGINTHKVQQNQQPGFVSRELNFSEYGYVDGIGS--RNGTLT-PAKPEAGE  341

Query  1531  ILNFGDNAVKRSACSGNDAIF-SGQFPAADEnnnnnknkKRTTTSRGSNDEGMLSFvsgv  1355
             IL+FGD+  +  +C+G+  IF S     A+E          + TSRGSN+EGM+SF SGV
Sbjct  342   ILSFGDSK-RVPSCTGSGTIFGSNSHLMAEEYKKKKS----SPTSRGSNEEGMMSFTSGV  396

Query  1354  vvpsaggaggatgdsdhsDLEASVVREADS-SRVVVepekrpkkrgrkPANGREEPLNHV  1178
             ++PS+GG   +T DSDHSDLEASV +EADS SRVV   EK+P+KRGRKPANGREEPLNHV
Sbjct  397   LLPSSGGVKSSTVDSDHSDLEASV-KEADSASRVVDPAEKKPRKRGRKPANGREEPLNHV  455

Query  1177  EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKTQ  998
             EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYI ELKSKLQ  ES +E L+ Q
Sbjct  456   EAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIKELKSKLQNVESDKEILQKQ  515

Query  997   LESIKK  980
             + ++K+
Sbjct  516   IGTLKR  521



>gb|AEB35693.1| MYC2 [Helianthus annuus]
Length=142

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  1180  VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESAQEDLKT  1001
             VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+  E  +++L+ 
Sbjct  1     VEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLENNEGNKDELRN  60

Query  1000  QLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHPAARL  827
             Q++++KKE  ++           +   G   D DVDVK+IGWDAMIR+QC+KK+HPAARL
Sbjct  61    QIDALKKELSNKVSAQENMKMSSVTTRGPPADXDVDVKVIGWDAMIRVQCNKKSHPAARL  120

Query  826   MVALKDLDLDVHHASVSVVNDL  761
             M A+ +LDL+VHHASVSVVN+L
Sbjct  121   MTAMMELDLEVHHASVSVVNEL  142



>gb|ABR16623.1| unknown [Picea sitchensis]
Length=582

 Score =   182 bits (463),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 130/188 (69%), Gaps = 10/188 (5%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQ+FY LRAVVPNVSKMDKASLLGDA +YI +L SK Q 
Sbjct  392   ANGREEPLNHVEAERQRREKLNQKFYELRAVVPNVSKMDKASLLGDAAAYIKDLCSKQQD  451

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLA---------GkivdidvdvkiIGWD  878
              ES + +L+ Q+ES+KKE          +    L+         GK   ++ +V+I+G +
Sbjct  452   LESERVELQDQIESVKKELLMNSLKLAAKEATDLSSIDLKGFSQGKFPGLNSEVRILGRE  511

Query  877   AMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVND-LMIQQATVKMGSHVYNQEELR  701
             A+IRIQC+K NHP ARLM AL++LDL+V HAS+S V D L+IQ   VKM   +Y +E+L 
Sbjct  512   AIIRIQCTKHNHPVARLMTALQELDLEVLHASISTVKDSLIIQTVIVKMTRGLYTEEQLH  571

Query  700   LALTSSIA  677
               L   +A
Sbjct  572   ALLCKKVA  579



>gb|AGO03814.1| JAMYC4 [Taxus cuspidata]
Length=361

 Score =   177 bits (448),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 130/188 (69%), Gaps = 10/188 (5%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQ+FY LRAVVPNVSKMDKASLL DA++YIN+L S+ Q+
Sbjct  172   ANGREEPLNHVEAERQRREKLNQKFYELRAVVPNVSKMDKASLLADAVTYINDLSSRQQS  231

Query  1030  AESAQEDLKTQLESIKKE-----SRHpppppppepPLKLAGkivdi----dvdvkiIGWD  878
              E  +++L+TQ+ + KKE     S+     P     + L G         D +V+I+G +
Sbjct  232   LELERDELRTQIGAAKKELLVLPSKFGNKEPSGHTNMDLKGSSGGKFPGLDSEVRILGQE  291

Query  877   AMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVND-LMIQQATVKMGSHVYNQEELR  701
             AMI+IQC+K NHP ARLM AL++L+++V HAS+S + D LMIQ    KM   +Y +++L 
Sbjct  292   AMIKIQCAKHNHPVARLMTALQELEMEVLHASISTIKDALMIQTVIAKMTRVLYTEQQLH  351

Query  700   LALTSSIA  677
               L   +A
Sbjct  352   ALLCKKVA  359



>ref|NP_199495.1| calcium-binding transcription factor NIG1 [Arabidopsis thaliana]
 sp|Q9LUK7.1|BH028_ARATH RecName: Full=Transcription factor bHLH28; AltName: Full=Basic 
helix-loop-helix protein 28; Short=AtbHLH28; Short=bHLH 28; 
AltName: Full=Transcription factor EN 40; AltName: Full=bHLH 
transcription factor bHLH028 [Arabidopsis thaliana]
 gb|AAL55721.1|AF252636_1 putative transcription factor bHLH28 [Arabidopsis thaliana]
 dbj|BAA97217.1| bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAH30619.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95431.1| calcium-binding transcription factor NIG1 [Arabidopsis thaliana]
Length=511

 Score =   179 bits (455),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 126/178 (71%), Gaps = 1/178 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             A+GR++PLNHVEAER RREKLN RFYALRAVVPNVSKMDK SLL DA+ YINELKSK + 
Sbjct  335   AHGRDKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVCYINELKSKAEN  394

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
              E  +  ++ Q   +K+ +      P      + A +++ I+V +     DAM+R++  K
Sbjct  395   VELEKHAIEIQFNELKEIAGQRNAIPSVCKYEEKASEMMKIEVKIMESD-DAMVRVESRK  453

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
              +HP ARLM AL DL+L+V+HAS+SV+NDLMIQQA VKMG  +Y QEELR  L S I+
Sbjct  454   DHHPGARLMNALMDLELEVNHASISVMNDLMIQQANVKMGLRIYKQEELRDLLMSKIS  511



>ref|XP_009101672.1| PREDICTED: transcription factor bHLH28-like [Brassica rapa]
Length=271

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -2

Query  1207  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTA  1028
             +GREEP+NHVEAER RREKLNQRFYALRA++PNV+K +KAS+L D ++YINELK   + A
Sbjct  95    HGREEPMNHVEAERLRREKLNQRFYALRALLPNVTKKEKASILEDTVTYINELKLNAENA  154

Query  1027  ESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKK  848
             E+ +  ++ QL  +K++                    +++ +DVK++  DA+IR++ SK 
Sbjct  155   ETEKNAIENQLNELKEKIAGRRNGSSSVCSGGEKTPEIEVKIDVKVMDRDALIRLESSKN  214

Query  847   NHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             NHP ARLM A  DL+++V+HAS+SV+NDLMIQQ TVKMGS VY QE+LR  L S I
Sbjct  215   NHPGARLMNAFMDLEVEVNHASISVMNDLMIQQVTVKMGSRVYKQEQLRDLLLSKI  270



>ref|XP_009385748.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Musa acuminata subsp. malaccensis]
Length=564

 Score =   179 bits (454),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 132/186 (71%), Gaps = 9/186 (5%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             AN R+ PL+HVEAERQRREKLNQRFY+LR+VVPNVSKMDKASLL DA++YINEL+SK Q 
Sbjct  378   ANSRKXPLDHVEAERQRREKLNQRFYSLRSVVPNVSKMDKASLLADAVTYINELRSKTQA  437

Query  1030  AESAQEDLKTQLESIKKESR-------HpppppppepPLKLAGkivdidvdvkiIGWDAM  872
              ES    L+++L +++ ES        H  P           G  VD++V +   G +A+
Sbjct  438   LESNNRGLQSELSALRTESESAGSSAAHRDPKTTETNGSGRCGGEVDVEVKIV--GSEAI  495

Query  871   IRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             IR+QC +++HP A LMVALK+LDL++++A++SVV +LMIQQAT KM + VY+Q++L   L
Sbjct  496   IRVQCDRRSHPPASLMVALKELDLELYYANISVVKELMIQQATTKMTTRVYSQQQLTAKL  555

Query  691   TSSIAA  674
                + A
Sbjct  556   LGRMIA  561



>gb|KFK31426.1| hypothetical protein AALP_AA6G110400 [Arabis alpina]
Length=506

 Score =   178 bits (451),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 126/177 (71%), Gaps = 4/177 (2%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             A  RE PL+HV+AER RREKLNQRFYALRAVVPNV+KMDK SLLGDAI YINELK K + 
Sbjct  333   AKDREVPLSHVQAERLRREKLNQRFYALRAVVPNVTKMDKTSLLGDAICYINELKLKSEN  392

Query  1030  AESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             AE+ +  ++ QL  +K++              K A      ++DVKIIG DAMIR++ +K
Sbjct  393   AETEKNAVQIQLNKLKEQITGRRRNAISSGGEKNA----FSEIDVKIIGCDAMIRVESNK  448

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
              NHP AR M AL DL+++V+HAS+SV+N LMIQQATVKMG   Y +E+LR  L+S +
Sbjct  449   SNHPGARFMNALMDLEVEVNHASISVINHLMIQQATVKMGLRNYTEEQLRAMLSSKV  505



>emb|CDY33482.1| BnaA06g35910D [Brassica napus]
Length=271

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 125/176 (71%), Gaps = 0/176 (0%)
 Frame = -2

Query  1207  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTA  1028
             +GREEP+NHVEAER RREKLNQRFYALRA++PN +K +KAS+L D ++YINELK   + A
Sbjct  95    HGREEPMNHVEAERLRREKLNQRFYALRALLPNATKKEKASILEDTVTYINELKLNAENA  154

Query  1027  ESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKK  848
             E+ +  ++ QL  +K++                    +++ +DVK++  DA+IR++ SK 
Sbjct  155   ETEKNAIENQLNELKEKIAGRRNGSSSVCSGGEKTPEIEVKIDVKVMDRDALIRLESSKN  214

Query  847   NHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             NHP ARLM A  DL+++V+HAS+SV+NDLMIQQ TVKMGS VY QE+LR  L S I
Sbjct  215   NHPGARLMNAFMDLEVEVNHASISVMNDLMIQQVTVKMGSRVYKQEQLRDLLLSKI  270



>gb|AEB35566.1| MYC2 [Helianthus petiolaris]
Length=136

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIXYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGXKDELRNQIDALKKELSNKVSAQENMKMSSITTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVA  818
             +KK+HPAARLM A
Sbjct  124   NKKSHPAARLMTA  136



>emb|CDX77699.1| BnaC07g19530D [Brassica napus]
Length=271

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 125/176 (71%), Gaps = 0/176 (0%)
 Frame = -2

Query  1207  NGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTA  1028
             +GREEP+NHVEAER RREKLNQRFYALRA++PNV+K +KAS+L D ++YINELK   + A
Sbjct  95    HGREEPMNHVEAERLRREKLNQRFYALRALLPNVTKREKASILEDTVTYINELKVNAENA  154

Query  1027  ESAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKK  848
             ES +   + QL  +K++                    +++ +DVK++  DA+IR++ SK 
Sbjct  155   ESEKNAFEIQLNELKEKIAGRRNGSSSVCGGGEKTPEIEVKIDVKVMDRDALIRLESSKN  214

Query  847   NHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             NHP ARLM A  DL+++V+HAS+SV+N+LMIQQ TVKMGS VY QE+LR  L S +
Sbjct  215   NHPGARLMNAFMDLEVEVNHASISVMNNLMIQQVTVKMGSRVYKQEQLRDLLLSKV  270



>gb|AEB35681.1| MYC2 [Helianthus annuus]
 gb|AEB35682.1| MYC2 [Helianthus annuus]
Length=138

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVAL  815
             +KK+HPAARLM A+
Sbjct  124   NKKSHPAARLMTAM  137



>ref|XP_006294316.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
 gb|EOA27214.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
Length=409

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 122/178 (69%), Gaps = 10/178 (6%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             +  RE+P +HVEAERQRR  LNQ FYALRAVVP VSKMDK SLL D I+YINELK+K+  
Sbjct  240   SKSREKPRDHVEAERQRRNNLNQLFYALRAVVPKVSKMDKESLLSDTITYINELKAKVDK  299

Query  1030  AESAQEDLKTQLESIKKE-SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCS  854
             A S + +++ QLE +KKE +            +++  K+++           AMI+++ S
Sbjct  300   AVSERNEIEIQLEEVKKELAERRVASSKEPEGMEIEVKVIESY---------AMIKVKSS  350

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
             K+NHP AR+M AL D++L+V HASV VVNDLM+QQATVKM   +Y QE+LR+ L S I
Sbjct  351   KQNHPEARMMKALMDMELEVDHASVVVVNDLMVQQATVKMDFKIYTQEQLRIMLISKI  408



>ref|XP_010412880.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=415

 Score =   173 bits (438),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 115/173 (66%), Gaps = 13/173 (8%)
 Frame = -2

Query  1198  EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESA  1019
             EEP +HVEAERQRR++LNQRFYALR VVP VSKMDK SLL D I+YI ELKSK++ A   
Sbjct  255   EEPRDHVEAERQRRKQLNQRFYALRGVVPKVSKMDKGSLLSDTIAYIKELKSKVEKAVYE  314

Query  1018  QEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHP  839
             + +++ QLE +K++          E  +K+                 AMI+++ SK+NHP
Sbjct  315   RNEIQIQLEEVKRKVASSKETEGMEIEVKIIECY-------------AMIKVKSSKQNHP  361

Query  838   AARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
              AR M ALKDL+L+V HAS+ VV DLM+QQATVKM   +Y QE+LR  L S I
Sbjct  362   EARFMKALKDLELEVDHASIVVVEDLMVQQATVKMDFRIYTQEQLRTMLISKI  414



>gb|AEB35699.1| MYC2 [Helianthus annuus]
Length=138

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAZZNMKMSSXTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVAL  815
             +KK+HPAARLM A+
Sbjct  124   NKKSHPAARLMTAM  137



>gb|AEB35702.1| MYC2 [Helianthus annuus]
Length=138

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++               G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSXTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLMVAL  815
             +KK+HPAARLM A+
Sbjct  124   NKKSHPAARLMTAM  137



>ref|XP_010513049.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=415

 Score =   172 bits (435),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 114/174 (66%), Gaps = 13/174 (7%)
 Frame = -2

Query  1198  EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESA  1019
             EEP +HVEAERQRR++LNQRFYALR VVP VSKMDK SLL D I+YI ELKSK++     
Sbjct  255   EEPRDHVEAERQRRKQLNQRFYALRGVVPKVSKMDKGSLLSDTIAYIKELKSKVEKVVYE  314

Query  1018  QEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHP  839
             + +++ QLE +K++          E  +K+                 AMI+++ SK+NHP
Sbjct  315   RNEIQVQLEEVKRKVASFKETEEMEIEVKIIECY-------------AMIKVKSSKQNHP  361

Query  838   AARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSIA  677
              AR M ALKDL L+V HAS+ VV DLM+QQATVKM   +Y QE+LR  L S I+
Sbjct  362   EARFMKALKDLKLEVDHASIVVVEDLMVQQATVKMDFRIYTQEQLRTMLISKIS  415



>ref|XP_010507550.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=415

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 114/173 (66%), Gaps = 13/173 (8%)
 Frame = -2

Query  1198  EEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAESA  1019
             E P NHVEAERQRR++LNQRFYALR VVPNVSKMDK SLL D I+YI ELKSK++ A   
Sbjct  255   EGPRNHVEAERQRRKQLNQRFYALRGVVPNVSKMDKGSLLSDTIAYIKELKSKVEKAVYE  314

Query  1018  QEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKNHP  839
             + +++ QLE +K++          E  +K+                 A I+++ SK+NHP
Sbjct  315   RNEIQIQLEEVKRKVASSKETEGMEIEVKIIECY-------------AKIKVKSSKQNHP  361

Query  838   AARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
              AR M ALKDL+L+V HAS+ VV DLM+QQATVKM   +Y QE+LR  L S I
Sbjct  362   EARFMKALKDLELEVDHASIVVVEDLMVQQATVKMDFRIYTQEQLRTMLISKI  414



>gb|AEB35704.1| MYC2 [Helianthus annuus]
Length=134

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAI YINELK+KL+ 
Sbjct  4     ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAILYINELKAKLEN  63

Query  1030  AESAQEDLKTQLESIKKE--SRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQC  857
              E  +++L+ Q++++KKE  ++           +   G   D+DVDVK+IGWDAMIR+QC
Sbjct  64    NEGNKDELRNQIDALKKELSNKVSAQENMKMSSVTTRGPPADLDVDVKVIGWDAMIRVQC  123

Query  856   SKKNHPAARLM  824
             +K +HPAARLM
Sbjct  124   NKMSHPAARLM  134



>ref|XP_010054972.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
 gb|KCW71457.1| hypothetical protein EUGRSUZ_E00019 [Eucalyptus grandis]
Length=495

 Score =   162 bits (411),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 122/179 (68%), Gaps = 7/179 (4%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELKSK+   E
Sbjct  318   GRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKSKIGDLE  377

Query  1024  SAQEDLKTQLESIKKESRHpppppppepPLKLAGki----vdidvdvkiIGWDAMIRIQC  857
             S    L+ + + +K+E             +  +         ++V+VKI+G DAMIR+Q 
Sbjct  378   S---QLQRESKRVKQEVTDATDNLSTTTSVDHSSPSGCGGSLLEVEVKIVGCDAMIRVQS  434

Query  856   SKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
                N+P+ARLM A++DL+L +HHAS+S VNDLM+Q   V +   +  +E+LR AL  ++
Sbjct  435   ENANYPSARLMAAMRDLELHIHHASLSTVNDLMLQDVVVSVPEGLKGEEDLRAALLRAL  493



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score =   162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             G + P+NHVEAERQRREKLN RFYALR+VVPNVSKMDKASLL DA+ YINELKSK++  E
Sbjct  285   GTQTPMNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVDYINELKSKIEDLE  344

Query  1024  SAQ--EDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSK  851
             S Q  E  K ++E+++    +           K    +   ++DVKIIG DAM+R+Q   
Sbjct  345   SVQQKESKKVKMETMEIVDNNSATTTSTVVDQKRPCNVNAFEIDVKIIGNDAMVRVQSEN  404

Query  850   KNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEEL  704
              NHP ARLM  LKDL+  VHHAS+S VN++M+Q   V++ + +  +E L
Sbjct  405   VNHPGARLMSVLKDLEFQVHHASISTVNEVMVQDVVVRIPNEMNKEESL  453



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score =   161 bits (408),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GRE P+NHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++YINELK+K++  E
Sbjct  281   GRETPINHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDLE  340

Query  1024  SAQ-----EDLKTQL-ESIKKESRHpppppppe--pPLKLAGkivdidvdvkiIGWDAMI  869
             S Q     + +KT++ +++  +S         +     +L    + ++VDV+I+G DAM+
Sbjct  341   SQQPRDSNKKMKTEMTDTLDNQSATTTSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMV  400

Query  868   RIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             R+Q    NHP ARLM AL+DL+  VHHAS+S VNDLM+Q   VK+ + + ++E L+ A+
Sbjct  401   RVQSENVNHPGARLMGALRDLEFQVHHASMSCVNDLMLQDVVVKLPNGMRSEESLKSAI  459



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score =   161 bits (408),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GRE P+NHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++YINELK+K++  E
Sbjct  282   GRETPINHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDLE  341

Query  1024  SAQ-----EDLKTQL-ESIKKESRHpppppppe--pPLKLAGkivdidvdvkiIGWDAMI  869
             S Q     + +KT++ +++  +S         +     +L    + ++VDV+I+G DAM+
Sbjct  342   SQQPRDSNKKMKTEMTDTLDNQSATTTSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMV  401

Query  868   RIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             R+Q    NHP ARLM AL+DL+  VHHAS+S VNDLM+Q   VK+ + + ++E L+ A+
Sbjct  402   RVQSENVNHPGARLMGALRDLEFQVHHASMSCVNDLMLQDVVVKLPNGMRSEESLKSAI  460



>gb|KDO86574.1| hypothetical protein CISIN_1g046178mg [Citrus sinensis]
Length=515

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYI ELK K+   E
Sbjct  337   GRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLE  396

Query  1024  S---AQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCS  854
             S    +E  K +LE I              P    +G   +++V+ KI+G DAMIR+Q  
Sbjct  397   SQLLQRESKKVKLE-ISDNHSTTTSVDQARPSSAGSGGGFNLEVETKIMGSDAMIRVQSE  455

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
               NHPAA+LM +L+DLDL +HHAS+S VNDLM+Q   V++   +  ++ LR AL
Sbjct  456   NVNHPAAKLMSSLRDLDLQLHHASMSCVNDLMLQDIVVRVPDGLRTEDALRSAL  509



>ref|XP_006444764.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
 gb|ESR58004.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
Length=515

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYI ELK K+   E
Sbjct  337   GRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLE  396

Query  1024  S---AQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCS  854
             S    +E  K +LE I              P    +G   +++V+ KI+G DAMIR+Q  
Sbjct  397   SQLLQRESKKVKLE-ISDNHSTTTSVDQARPSSAGSGGGFNLEVETKIMGSDAMIRVQSE  455

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
               NHPAA+LM +L+DLDL +HHAS+S VNDLM+Q   V++   +  ++ LR AL
Sbjct  456   NVNHPAAKLMSSLRDLDLQLHHASMSCVNDLMLQDIVVRVPDGLRTEDALRSAL  509



>emb|CBI34590.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 116/174 (67%), Gaps = 23/174 (13%)
 Frame = -2

Query  1210  ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQT  1031
             A GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYI+ELK+K+  
Sbjct  150   ATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYIHELKTKI--  207

Query  1030  AESAQEDLKTQL-ESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCS  854
                  +DL+T+L E ++K   +       E  +K+ G              +AMIR+QC 
Sbjct  208   -----DDLETKLREEVRKPKAY--GAIRMEVDVKIIGS-------------EAMIRVQCP  247

Query  853   KKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
               N+P+A LM AL+DLDL V HASVS V +LM+Q   V++   + ++E +R A+
Sbjct  248   DLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDVVVRIPEGLTSEESMRTAI  301



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score =   160 bits (405),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 121/183 (66%), Gaps = 6/183 (3%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELKSK+   E
Sbjct  315   GRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKSKVDELE  374

Query  1024  SA--QEDLKTQLES---IKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQ  860
             S   +E  K ++E+   +  +S          P    +G          + G DAMIR+Q
Sbjct  375   SQVQRESKKVKVETGDNLDNQSTTTSVEQTRPPNSSASGSTGLEMEVKIV-GSDAMIRVQ  433

Query  859   CSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
              +  N+P+ARLM AL+DL+ ++HHAS+S +N+LM+Q   VK+  ++ ++E ++ AL   +
Sbjct  434   SANVNYPSARLMAALRDLEFEIHHASLSCMNELMLQDVVVKVPDNMRSEESIKAALLKIL  493

Query  679   AAN  671
               N
Sbjct  494   DQN  496



>ref|XP_004510627.1| PREDICTED: transcription factor bHLH14-like [Cicer arietinum]
Length=472

 Score =   159 bits (403),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             G   P++HVEAERQRREK+N RFYALRAVVPNVS+MDKASLL DA+ +INELKSK+   E
Sbjct  295   GNPTPMSHVEAERQRREKINHRFYALRAVVPNVSRMDKASLLSDAVDFINELKSKIVELE  354

Query  1024  SAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQCSKKN  845
               Q+    +L+    +++            +++   + +++DVKIIG DAM+R+QC   N
Sbjct  355   LEQQKELKKLKIENMDNQSTATTSTVVDQKRISCNNISLEIDVKIIGGDAMVRVQCENVN  414

Query  844   HPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             HP ARLM  LKDL+  VHHAS+S VN++M+Q   V++  ++ N+E LR A+
Sbjct  415   HPGARLMSVLKDLEFQVHHASISCVNEIMVQDVVVQVPINMRNEERLRSAI  465



>ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max]
 gb|KHN06348.1| Transcription factor bHLH14 [Glycine soja]
Length=464

 Score =   159 bits (402),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 126/179 (70%), Gaps = 8/179 (4%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GRE P+NHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++YI+ELK+K++  E
Sbjct  280   GRETPVNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYISELKAKIEYLE  339

Query  1024  SAQ-----EDLKTQL-ESIKKESRHpppppppep--PLKLAGkivdidvdvkiIGWDAMI  869
             S Q     + +KT++ +++   S         +     +L    + ++VDVKI+G DAM+
Sbjct  340   SQQPRDSSKKVKTEMTDTLDNHSTTTISTVVDQSGPEPRLGPSPLGLEVDVKIVGPDAMV  399

Query  868   RIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             R+Q    NHP ARLM AL+DL+  VHHAS+S VNDLM+Q   VK+ + + ++E L+ A+
Sbjct  400   RVQSENVNHPGARLMGALRDLEFQVHHASMSCVNDLMLQDVVVKLPNGMRSEEGLKSAI  458



>ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=497

 Score =   159 bits (403),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 118/183 (64%), Gaps = 12/183 (7%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K+   E
Sbjct  309   GRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYINELKAKVDELE  368

Query  1024  SA--QEDLKTQLESIKKESRHpppppppepPLKL----------AGkivdidvdvkiIGW  881
             S   +E  K +LE               +                G  V ++V++KI+G 
Sbjct  369   SQVHKESKKVKLEMADTTDNQSTTTSVDQTGPTPPPPPPPPSSATGGGVALEVEIKIVGP  428

Query  880   DAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELR  701
             DAMIR+Q    NHP+ARLM AL+DL+  VHHAS+S +NDLM+Q   V++     N++ L+
Sbjct  429   DAMIRVQSDNHNHPSARLMGALRDLEFQVHHASMSSINDLMLQDVVVRLPDRFRNEDALK  488

Query  700   LAL  692
              AL
Sbjct  489   SAL  491



>gb|ABK94979.1| unknown [Populus trichocarpa]
Length=491

 Score =   159 bits (401),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 121/176 (69%), Gaps = 5/176 (3%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K+   E
Sbjct  311   GRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELE  370

Query  1024  SA--QEDLKTQLE---SIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQ  860
             S   +E  K +LE   ++  +S           P    G  + ++V++K +G DAMIR+Q
Sbjct  371   SQLERESKKVKLEVADNLDNQSTTTSVDQSACRPNSAGGAGLALEVEIKFVGNDAMIRVQ  430

Query  859   CSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
                 N+PA+RLM AL++L+  VHHAS+S VN+LM+Q   V++   +  +E L+ AL
Sbjct  431   SENVNYPASRLMCALRELEFQVHHASMSCVNELMLQDVVVRVPDGLRTEEALKSAL  486



>ref|XP_002301432.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE80705.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=491

 Score =   159 bits (401),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 121/176 (69%), Gaps = 5/176 (3%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K+   E
Sbjct  311   GRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELE  370

Query  1024  SA--QEDLKTQLE---SIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQ  860
             S   +E  K +LE   ++  +S           P    G  + ++V++K +G DAMIR+Q
Sbjct  371   SQLERESKKVKLEVADNLDNQSTTTSVDQSACRPNSAGGAGLALEVEIKFVGNDAMIRVQ  430

Query  859   CSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
                 N+PA+RLM AL++L+  VHHAS+S VN+LM+Q   V++   +  +E L+ AL
Sbjct  431   SENVNYPASRLMCALRELEFQVHHASMSCVNELMLQDVVVRVPDGLRTEEALKSAL  486



>ref|XP_007051457.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOX95614.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=497

 Score =   159 bits (401),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 117/181 (65%), Gaps = 13/181 (7%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GRE PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K++  E
Sbjct  314   GRETPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKIEELE  373

Query  1024  SAQEDLKTQLESIKKESRHpppppppepPLKLAGkivdidvdv----------kiIGWDA  875
             S    L+ + + +K E             +  A +  +               KI+G DA
Sbjct  374   S---QLQRECKKVKVEMVDAMDNQSTTTSVDQAARPSNSSSGTAGSGGLEFDIKIMGNDA  430

Query  874   MIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLA  695
             MIR+Q    N+P+ARLM+AL+DL+  VHHAS+S VN+LM+Q   V++   +  +E L+ A
Sbjct  431   MIRVQSENVNYPSARLMIALRDLEFQVHHASMSCVNELMLQDIVVRVPDGLRTEEGLKSA  490

Query  694   L  692
             L
Sbjct  491   L  491



>ref|XP_008370350.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=496

 Score =   159 bits (401),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK K+   E
Sbjct  315   GRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKXKVDELE  374

Query  1024  S--AQEDLKTQLES---IKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQ  860
             S   +E  K ++E+   +  +S          P    +G     + +VKI+G DAMIR+Q
Sbjct  375   SQVQRESKKVKVETGDNLDNQSTTTSVEQTRPPNSSASG-STGFETEVKIVGSDAMIRVQ  433

Query  859   CSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSSI  680
              +  N+P+ARLM AL+DL+ ++HHAS+S +N+LM+Q   VK+  ++ ++E ++ AL   +
Sbjct  434   SANVNYPSARLMAALRDLEFEIHHASLSCMNELMLQDVVVKVPBNMRSEESIKAALLKIL  493

Query  679   AAN  671
               N
Sbjct  494   DQN  496



>ref|XP_004306627.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   158 bits (400),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 121/188 (64%), Gaps = 10/188 (5%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K+   E
Sbjct  303   GRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELE  362

Query  1024  S--AQEDLKTQLE--------SIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDA  875
             S   +E  K ++E        S    +                     ++++VKI+G DA
Sbjct  363   SQLQRESKKVKVEMADNLDNQSTTTTASVEQTQTVTPDNNNNNNNGSGLEIEVKIVGTDA  422

Query  874   MIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLA  695
             MIR+Q    N+P+ARLM A++DL+  +HHAS+S +NDLM+Q   VK+  ++ N+E L+ A
Sbjct  423   MIRVQSENVNYPSARLMTAMRDLEFQIHHASLSSINDLMLQDIVVKVPDNMKNEEGLKAA  482

Query  694   LTSSIAAN  671
             L   +  N
Sbjct  483   LLGILDQN  490



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 116/188 (62%), Gaps = 30/188 (16%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K+   E
Sbjct  315   GRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKTKVDELE  374

Query  1024  S-AQEDLK----------------TQLESIKKESRHpppppppepPLKLAGkivdidvdv  896
             S  Q + K                T +E I K           E  +K+ G         
Sbjct  375   SQVQRESKKVKVETGDNLDIQSTTTSVEQIAKPPSSSANGSGLEVEVKIVGT--------  426

Query  895   kiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYN  716
                  DAMIR+Q    N+P+ARLM AL+DL+L +HHAS+S +N+LM+Q   +K+  ++ +
Sbjct  427   -----DAMIRVQSENVNYPSARLMAALRDLELQIHHASLSCINELMLQDIVLKVPENMRS  481

Query  715   QEELRLAL  692
             ++ L+ AL
Sbjct  482   EDSLKSAL  489



>ref|XP_011023113.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=491

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 120/176 (68%), Gaps = 5/176 (3%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K+   E
Sbjct  311   GRDAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELE  370

Query  1024  SA--QEDLKTQLE---SIKKESRHpppppppepPLKLAGkivdidvdvkiIGWDAMIRIQ  860
             S   +E  K +LE   ++  +S           P    G    ++V+VK +G DAMIR+Q
Sbjct  371   SQLEREFKKVKLEVADNLDNQSTTTSVDQSACRPNSAGGAGHALEVEVKFVGNDAMIRVQ  430

Query  859   CSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
                 N+PA+RLM AL++L+  VHHAS+S VN+LM+Q   V++   +  +E L+ AL
Sbjct  431   SENVNYPASRLMCALRELEFQVHHASMSCVNELMLQDVVVRVPDGLRTEEALKSAL  486



>ref|XP_010100678.1| hypothetical protein L484_023447 [Morus notabilis]
 gb|EXB83840.1| hypothetical protein L484_023447 [Morus notabilis]
Length=525

 Score =   157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 121/194 (62%), Gaps = 23/194 (12%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINELK+K+   E
Sbjct  326   GRDTPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKIDDLE  385

Query  1024  SA----QEDLKTQLESIKKESRHpppppppepPLK----------------LAGkivdid  905
             S     Q + K +LE+    S             K                + G I  ++
Sbjct  386   SQLQRDQSNKKVKLEAADTMSLDNQSTTTSVDQTKPPNSNSSSNKSNNINSVTGNINGLE  445

Query  904   vdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSH  725
             ++VKIIG DAMIR+Q    N+P+ARLM AL+DL+  VHHASVS +NDLM+Q   VK+   
Sbjct  446   IEVKIIGTDAMIRVQSENVNYPSARLMGALRDLEFQVHHASVSSINDLMLQDVVVKIPEG  505

Query  724   VY---NQEELRLAL  692
             +     QE L+ AL
Sbjct  506   IVLMRTQEGLKSAL  519



>ref|XP_011039024.1| PREDICTED: transcription factor MYC2 isoform X1 [Populus euphratica]
Length=525

 Score =   157 bits (396),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 118/177 (67%), Gaps = 6/177 (3%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR  PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINE+K+K+   E
Sbjct  311   GRGAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLE  370

Query  1024  S--AQEDLKTQLESIKKESRHpppppppepPLKL----AGkivdidvdvkiIGWDAMIRI  863
             S   +E  K ++E               +   +      G  + ++V+VK +G DAMIR+
Sbjct  371   SQLQRESKKVKMEVADTMDNQSTTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRV  430

Query  862   QCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             Q    N+PA+RLM AL+DL+  VHHAS+S VN+LM+Q   V++   +  +EEL+ AL
Sbjct  431   QSDNVNYPASRLMSALRDLEFQVHHASMSSVNELMLQDVVVRVPDGLRTEEELKSAL  487



>ref|XP_011039030.1| PREDICTED: transcription factor MYC2 isoform X2 [Populus euphratica]
Length=500

 Score =   156 bits (395),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 118/177 (67%), Gaps = 6/177 (3%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR  PLNHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA+SYINE+K+K+   E
Sbjct  311   GRGAPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLE  370

Query  1024  S--AQEDLKTQLESIKKESRHpppppppepPLKL----AGkivdidvdvkiIGWDAMIRI  863
             S   +E  K ++E               +   +      G  + ++V+VK +G DAMIR+
Sbjct  371   SQLQRESKKVKMEVADTMDNQSTTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRV  430

Query  862   QCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             Q    N+PA+RLM AL+DL+  VHHAS+S VN+LM+Q   V++   +  +EEL+ AL
Sbjct  431   QSDNVNYPASRLMSALRDLEFQVHHASMSSVNELMLQDVVVRVPDGLRTEEELKSAL  487



>ref|XP_007135301.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
 gb|ESW07295.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
Length=464

 Score =   155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GRE P+NHVEAERQRREKLN RFYALRAVVPNVS+MDKASLL DA++YINELK+K++  E
Sbjct  279   GRETPMNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVTYINELKAKIEYLE  338

Query  1024  SAQE-----DLKTQLESIKKESRHpppppppepPLKLAGk----ivdidvdvkiIGWDAM  872
             S Q+      +KT++                       G        +++DVKI+G DAM
Sbjct  339   SQQQREGNKRVKTEMMDTMDNQSTTTTTTSTIVDQSRPGAGGPCPFGLEIDVKIMGPDAM  398

Query  871   IRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLAL  692
             +R+Q    NHP ARLM AL+DL+  VHHAS+S VNDLM+Q   + + + + ++E L+ A+
Sbjct  399   VRVQSENANHPGARLMGALRDLEFQVHHASMSCVNDLMLQDVVINVPNGMRSEEGLKSAI  458



>ref|XP_011094312.1| PREDICTED: transcription factor MYC2 [Sesamum indicum]
Length=473

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 121/183 (66%), Gaps = 13/183 (7%)
 Frame = -2

Query  1204  GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQTAE  1025
             GR+ PLNHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYI ELKSK+    
Sbjct  297   GRDAPLNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIKELKSKV----  352

Query  1024  SAQEDLKTQLESIKKESRHpppp------pppepPLKLAGkivdidvdvkiIGWDAMIRI  863
                E+L+TQL+   K+ +                  ++      ++V+VKI+G D MIR+
Sbjct  353   ---EELETQLQRESKKVKTETTAETLDNQSTTTSVDQVGPITSLLEVEVKIVGVDGMIRV  409

Query  862   QCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVKMGSHVYNQEELRLALTSS  683
             Q    N+PAARLM A+++L+L VHHAS+S VNDLM+Q   +++   +  ++ L+ AL   
Sbjct  410   QSDNGNYPAARLMDAIRELELQVHHASMSCVNDLMLQDVVIRVPDGLRCEKALKAALIRR  469

Query  682   IAA  674
             + A
Sbjct  470   LEA  472



>gb|ABR16436.1| unknown [Picea sitchensis]
Length=590

 Score =   155 bits (392),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 132/197 (67%), Gaps = 12/197 (6%)
 Frame = -2

Query  1276  EADSSRVVVepekrpkkrgrkPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKM  1097
             EA   R VV  E+RP+KRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPN+SKM
Sbjct  397   EASERRPVVVEERRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNISKM  456

Query  1096  DKASLLGDAISYINELKSKLQTAESAQEDLKTQLESIKKESRHpppppppepPLKLAGki  917
             DKASLLGDAISYI EL++K++  E+ +E  +       K +        P   + +    
Sbjct  457   DKASLLGDAISYIQELQNKVKDMETEKEKQQQPQLQQAKSNIQDGRIVDPISDIDV----  512

Query  916   vdidvdvkiIGWDAMIRIQCSKKNHPAARLMVALKDLDLDVHHASVSVVNDLMIQQATVK  737
                    +++  +A +R+ C K++HP  R+M+AL+ L LDVHHA++S  N+ ++    +K
Sbjct  513   -------QMMSGEATVRVSCPKESHPVGRVMLALQRLQLDVHHANISAANENILHTFVIK  565

Query  736   M-GSHVYNQEELRLALT  689
             + G+ V  +++L  A++
Sbjct  566   LGGAQVLTKDQLLEAIS  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5262573346098