BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c114839_g1_i1 len=279 path=[257:0-278]

Length=279
                                                                      Score     E

ref|XP_010677175.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  80.5    2e-15   
ref|XP_010678062.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  78.6    3e-15   
ref|XP_010670287.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  78.2    6e-15   
ref|XP_010695510.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.0    5e-14   
ref|XP_010666566.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.0    5e-14   
ref|XP_010694608.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.1    6e-14   
ref|XP_010667127.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  76.3    8e-14   
ref|XP_010678296.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  74.3    9e-14   
ref|XP_010693927.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.9    1e-13   
ref|XP_010668319.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.6    6e-13   
ref|XP_010675531.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    5e-12   
ref|XP_010678162.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    6e-12   
ref|XP_010692636.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.6    1e-11   
gb|KDO38919.1|  hypothetical protein CISIN_1g046293mg                 69.3    3e-11   
ref|XP_008657613.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  64.3    1e-09   
ref|XP_008390324.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  63.5    2e-09   
ref|XP_002460471.1|  hypothetical protein SORBIDRAFT_02g028930        63.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_008653692.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  63.2    2e-09   
ref|XP_010238967.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  62.4    5e-09   
ref|XP_008246383.1|  PREDICTED: uncharacterized protein LOC103344568  62.0    6e-09   
ref|XP_008365955.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  62.0    8e-09   
ref|XP_010673996.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  62.0    8e-09   
ref|XP_010674487.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  61.6    9e-09   
ref|XP_010236653.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  60.8    9e-09   
ref|XP_010672688.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  61.6    1e-08   
gb|ABN05718.1|  FAR1; Zinc finger, SWIM-type                          61.6    1e-08   Medicago truncatula
ref|XP_010239118.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  60.5    1e-08   
ref|XP_002450570.1|  hypothetical protein SORBIDRAFT_05g007130        60.8    2e-08   Sorghum bicolor [broomcorn]
ref|XP_009391891.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-l...  60.8    2e-08   
ref|XP_008654819.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  60.8    2e-08   
ref|XP_004297991.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  60.1    2e-08   
gb|KDO38178.1|  hypothetical protein CISIN_1g046720mg                 60.1    2e-08   
ref|XP_010229979.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  60.5    2e-08   
ref|XP_008669590.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  60.1    2e-08   
ref|XP_004967151.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  60.1    3e-08   
ref|XP_006428864.1|  hypothetical protein CICLE_v10013881mg           60.1    3e-08   
ref|XP_008244105.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  58.9    3e-08   
ref|XP_002459592.1|  hypothetical protein SORBIDRAFT_02g007217        60.1    3e-08   Sorghum bicolor [broomcorn]
ref|XP_002466896.1|  hypothetical protein SORBIDRAFT_01g016055        59.3    4e-08   Sorghum bicolor [broomcorn]
ref|XP_008680369.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  59.3    4e-08   
ref|XP_008220898.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  58.9    4e-08   
gb|EEE69818.1|  hypothetical protein OsJ_29559                        59.3    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447469.1|  hypothetical protein SORBIDRAFT_06g001517        59.7    5e-08   Sorghum bicolor [broomcorn]
ref|NP_001063309.1|  Os09g0446400                                     59.3    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008381561.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  59.3    5e-08   
ref|XP_002464446.1|  hypothetical protein SORBIDRAFT_01g018540        59.7    5e-08   Sorghum bicolor [broomcorn]
ref|XP_002444099.1|  hypothetical protein SORBIDRAFT_07g007695        57.4    6e-08   Sorghum bicolor [broomcorn]
gb|EEE63476.1|  hypothetical protein OsJ_18290                        59.3    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010233373.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  58.2    6e-08   
ref|XP_004974618.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  58.9    7e-08   
ref|XP_010238888.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  59.3    7e-08   
ref|XP_010232993.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  56.2    8e-08   
gb|EYU26870.1|  hypothetical protein MIMGU_mgv1a025010mg              58.9    8e-08   
ref|XP_004298353.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  58.5    8e-08   
emb|CAD40452.2|  OSJNBa0041M21.10                                     59.3    8e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008221872.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  58.5    1e-07   
ref|XP_008240566.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.8    1e-07   
ref|XP_008233158.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.8    1e-07   
ref|XP_002438472.1|  hypothetical protein SORBIDRAFT_10g020136        57.4    1e-07   Sorghum bicolor [broomcorn]
ref|XP_008231820.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  56.6    1e-07   
ref|XP_010231426.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.8    1e-07   
ref|XP_002446673.1|  hypothetical protein SORBIDRAFT_06g020246        58.5    1e-07   Sorghum bicolor [broomcorn]
ref|XP_002456252.1|  hypothetical protein SORBIDRAFT_03g032960        58.5    1e-07   Sorghum bicolor [broomcorn]
ref|XP_008244497.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.8    1e-07   
ref|XP_002450652.1|  hypothetical protein SORBIDRAFT_05g008730        58.2    1e-07   Sorghum bicolor [broomcorn]
ref|XP_002466791.1|  hypothetical protein SORBIDRAFT_01g014270        58.5    1e-07   Sorghum bicolor [broomcorn]
ref|XP_004297885.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  58.2    1e-07   
ref|XP_008227616.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.8    1e-07   
ref|NP_001047685.1|  Os02g0668200                                     58.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004304830.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  58.2    1e-07   
ref|XP_002456500.1|  hypothetical protein SORBIDRAFT_03g037423        58.2    1e-07   Sorghum bicolor [broomcorn]
ref|XP_002467387.1|  hypothetical protein SORBIDRAFT_01g026910        58.2    2e-07   Sorghum bicolor [broomcorn]
gb|EEE57540.1|  hypothetical protein OsJ_07864                        58.2    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460160.1|  hypothetical protein SORBIDRAFT_02g023634        58.2    2e-07   Sorghum bicolor [broomcorn]
ref|XP_008245177.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.8    2e-07   
ref|XP_010914593.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.8    2e-07   
gb|EAZ09297.1|  hypothetical protein OsI_31570                        57.0    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_009360548.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.4    2e-07   
ref|XP_002445435.1|  hypothetical protein SORBIDRAFT_07g019155        57.4    3e-07   Sorghum bicolor [broomcorn]
gb|AAL58182.1|AC027037_4  putative far-red impaired response protein  57.4    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008348691.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.0    4e-07   
ref|XP_004980514.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  57.0    4e-07   
ref|XP_004305654.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.1    4e-07   
gb|AAF66982.1|  transposase                                           57.0    4e-07   Zea mays [maize]
gb|EAZ03765.1|  hypothetical protein OsI_25894                        56.2    4e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAB33151.1|  hypothetical protein                                 56.6    5e-07   Carthamus tinctorius
ref|XP_006645669.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  56.6    5e-07   
ref|XP_010681467.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  56.6    5e-07   
ref|XP_010678300.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  56.6    5e-07   
ref|XP_006649180.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-like  56.6    5e-07   
ref|XP_010495230.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  56.2    5e-07   
ref|XP_010695837.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  56.6    5e-07   
ref|XP_002458237.1|  hypothetical protein SORBIDRAFT_03g029595        56.6    5e-07   Sorghum bicolor [broomcorn]
ref|XP_010941828.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  56.2    6e-07   
ref|XP_004289552.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 8-like  55.8    6e-07   
ref|XP_010677702.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  56.6    6e-07   
ref|XP_004292126.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  56.2    6e-07   
gb|AAX94831.1|  transposon protein, putative, unclassified            56.6    6e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AAX92763.1|  transposon protein, putative, unclassified            56.6    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008362165.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.8    7e-07   
ref|XP_010695505.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  56.2    7e-07   
ref|XP_002444124.1|  hypothetical protein SORBIDRAFT_07g008830        55.5    7e-07   Sorghum bicolor [broomcorn]
ref|XP_010685186.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  56.2    7e-07   
ref|XP_010696346.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  55.1    7e-07   
ref|XP_002464221.1|  hypothetical protein SORBIDRAFT_01g014380        55.8    7e-07   Sorghum bicolor [broomcorn]
ref|XP_007216405.1|  hypothetical protein PRUPE_ppa022645mg           55.8    7e-07   
ref|XP_008238369.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.5    8e-07   
ref|XP_008230452.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  55.8    9e-07   
gb|ABD33026.2|  Cyclin-like F-box; FAR1; Zinc finger, SWIM-type       55.8    9e-07   Medicago truncatula
ref|XP_006281824.1|  hypothetical protein CARUB_v10028009mg           55.8    1e-06   
ref|XP_008368438.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.8    1e-06   
ref|XP_010930749.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.8    1e-06   
ref|XP_006603498.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.5    1e-06   
gb|KCW63993.1|  hypothetical protein EUGRSUZ_G01680                   55.5    1e-06   
ref|XP_008227250.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  55.1    1e-06   
ref|XP_008227249.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  55.1    1e-06   
ref|XP_006487498.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.7    1e-06   
ref|XP_009416288.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  55.5    1e-06   
ref|XP_010684967.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  55.5    1e-06   
ref|XP_006484349.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.5    1e-06   
ref|XP_010684977.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  55.1    1e-06   
ref|XP_008679530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.7    1e-06   
dbj|BAD10392.1|  putative far-red impaired response protein           55.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN16236.1|  Protein FAR1-RELATED SEQUENCE 5                       55.1    2e-06   
ref|XP_008653248.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  55.1    2e-06   
ref|XP_008227658.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.1    2e-06   
ref|XP_002453665.1|  hypothetical protein SORBIDRAFT_04g010080        55.1    2e-06   Sorghum bicolor [broomcorn]
ref|XP_010233328.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.3    2e-06   
ref|XP_002456061.1|  hypothetical protein SORBIDRAFT_03g029670        55.1    2e-06   Sorghum bicolor [broomcorn]
ref|XP_004309932.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.7    2e-06   
ref|XP_010245238.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  55.1    2e-06   
ref|XP_004289266.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.7    2e-06   
ref|XP_010690587.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       55.1    2e-06   
ref|XP_009103778.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.3    2e-06   
ref|XP_004305996.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  54.3    2e-06   
ref|XP_009116658.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  55.1    2e-06   
ref|XP_009116657.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  55.1    2e-06   
ref|XP_006406281.1|  hypothetical protein EUTSA_v10021958mg           54.7    2e-06   
ref|XP_008236671.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.7    2e-06   
ref|XP_007199084.1|  hypothetical protein PRUPE_ppa019160mg           54.7    2e-06   
ref|XP_006598514.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.3    2e-06   
ref|XP_006406280.1|  hypothetical protein EUTSA_v10022007mg           54.7    2e-06   
ref|XP_008373411.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  54.7    2e-06   
ref|XP_004963627.1|  PREDICTED: uncharacterized protein LOC101779982  54.7    2e-06   
ref|XP_010259175.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.7    2e-06   
ref|XP_007214218.1|  hypothetical protein PRUPE_ppa023217mg           54.7    2e-06   
ref|XP_010259163.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.7    2e-06   
ref|XP_010468694.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.7    2e-06   
ref|XP_010259180.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.7    2e-06   
gb|EEC74573.1|  hypothetical protein OsI_10136                        54.7    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008658616.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.7    3e-06   
ref|XP_008658611.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.7    3e-06   
ref|XP_010236847.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  54.7    3e-06   
ref|XP_010234002.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.9    3e-06   
ref|NP_001175190.1|  Os07g0461700                                     54.3    3e-06   
ref|XP_010259189.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.7    3e-06   
ref|XP_009123544.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    3e-06   
gb|EEE63447.1|  hypothetical protein OsJ_18260                        54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004231427.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    3e-06   
ref|XP_002455464.1|  hypothetical protein SORBIDRAFT_03g011230        54.3    3e-06   Sorghum bicolor [broomcorn]
gb|KCW73521.1|  hypothetical protein EUGRSUZ_E02037                   54.3    3e-06   
ref|XP_010268007.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.3    3e-06   
ref|XP_010233182.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    3e-06   
ref|XP_004980305.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  54.3    3e-06   
dbj|BAJ06700.1|  unnamed protein product                              53.9    3e-06   
gb|AAV31356.1|  hypothetical protein                                  54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002443950.1|  hypothetical protein SORBIDRAFT_07g004960        53.9    3e-06   Sorghum bicolor [broomcorn]
dbj|BAJ06701.1|  unnamed protein product                              53.9    3e-06   
ref|XP_009406927.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-like  54.3    3e-06   
ref|XP_008784343.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.3    3e-06   
ref|XP_010421147.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.5    3e-06   
ref|XP_008784344.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  54.3    3e-06   
ref|XP_004959040.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.1    4e-06   
ref|XP_004966891.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.5    4e-06   
gb|AAS79743.1|  putative Mutator-like transposase                     54.3    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004980265.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    4e-06   
ref|XP_010229941.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  53.5    4e-06   
ref|XP_010418903.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    4e-06   
ref|XP_004967127.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    4e-06   
ref|XP_008784345.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.9    4e-06   
ref|XP_010687444.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    4e-06   
ref|XP_004977727.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    4e-06   
dbj|BAJ06702.1|  unnamed protein product                              53.9    4e-06   
ref|XP_008792844.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.9    4e-06   
ref|XP_010227160.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.9    4e-06   
ref|XP_008792843.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.9    4e-06   
ref|XP_008792840.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.9    4e-06   
ref|XP_009133360.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       53.9    4e-06   
gb|KDP24914.1|  hypothetical protein JCGZ_24292                       53.9    4e-06   
ref|XP_010246487.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.4    4e-06   
ref|XP_004986319.1|  PREDICTED: uncharacterized protein LOC101759074  53.9    5e-06   
ref|XP_009405914.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.5    5e-06   
gb|AAX92857.1|  transposon protein, putative, unclassified            53.9    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655317.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.5    5e-06   
ref|XP_006655826.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.5    5e-06   
ref|XP_010045143.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  53.5    5e-06   
ref|XP_006655825.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.5    5e-06   
ref|XP_009618370.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.5    6e-06   
ref|XP_010045142.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  53.5    6e-06   
ref|XP_010045140.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  53.5    6e-06   
gb|EEC80083.1|  hypothetical protein OsI_21811                        53.5    6e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006388581.1|  hypothetical protein POPTR_0149s00230g           53.5    6e-06   
ref|NP_001056912.1|  Os06g0166100                                     53.5    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009618373.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.5    6e-06   
ref|XP_009618372.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.5    6e-06   
ref|XP_006373793.1|  hypothetical protein POPTR_0016s05920g           53.5    6e-06   
ref|XP_002460267.1|  hypothetical protein SORBIDRAFT_02g025670        53.5    6e-06   Sorghum bicolor [broomcorn]
gb|EEE65156.1|  hypothetical protein OsJ_20251                        53.5    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010685516.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       53.5    6e-06   
ref|XP_008781580.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.5    6e-06   
ref|XP_009618369.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.5    6e-06   
ref|XP_009618368.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.5    6e-06   
emb|CAE02528.2|  OSJNBb0003A12.15                                     53.1    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004496070.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.5    7e-06   
ref|XP_010672835.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.1    7e-06   
ref|XP_002467137.1|  hypothetical protein SORBIDRAFT_01g020250        53.1    7e-06   Sorghum bicolor [broomcorn]
ref|XP_007022953.1|  FAR1-related sequence 5-like protein             52.4    7e-06   
ref|XP_006591712.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.1    7e-06   
ref|XP_010056981.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.1    7e-06   
gb|EYU41087.1|  hypothetical protein MIMGU_mgv1a020432mg              53.1    7e-06   
gb|KCW73916.1|  hypothetical protein EUGRSUZ_E02501                   53.1    7e-06   
dbj|BAD29488.1|  putative far-red impaired response protein           53.1    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446625.1|  hypothetical protein SORBIDRAFT_06g019085        52.4    8e-06   Sorghum bicolor [broomcorn]
ref|XP_010257333.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  53.1    8e-06   
gb|ABA98678.1|  transposon protein, putative, unclassified            53.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009397785.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.1    8e-06   
emb|CAD40514.2|  OSJNBa0050F15.2                                      53.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561049.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-like  53.1    8e-06   
ref|XP_009772395.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    8e-06   
ref|XP_009772389.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    8e-06   
ref|XP_009772385.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    8e-06   
ref|XP_010675047.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.4    8e-06   
ref|XP_009772379.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    8e-06   
ref|XP_010507064.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.8    9e-06   
ref|XP_009365699.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  53.1    9e-06   
ref|XP_010665920.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.8    9e-06   
ref|XP_010932383.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    9e-06   
ref|XP_010277380.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  53.1    9e-06   
ref|XP_010277381.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  53.1    9e-06   
ref|XP_003538916.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  53.1    9e-06   
ref|XP_010456530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.8    9e-06   
dbj|BAD19318.1|  putative far-red impaired response protein           53.1    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009772402.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_010932381.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    9e-06   
ref|XP_009772373.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_009772359.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_009772355.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_009772350.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_009772343.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_009772337.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_009772328.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  53.1    9e-06   
ref|XP_010445346.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.8    1e-05   
ref|XP_008219733.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.8    1e-05   
ref|XP_008244300.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.4    1e-05   
ref|XP_010924140.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    1e-05   
ref|XP_008809356.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    1e-05   
ref|XP_008809355.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    1e-05   
ref|XP_008809351.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    1e-05   
ref|XP_010924139.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    1e-05   
gb|EMT20460.1|  Protein FAR1-RELATED SEQUENCE 5                       52.8    1e-05   
ref|XP_002457925.1|  hypothetical protein SORBIDRAFT_03g022130        52.8    1e-05   Sorghum bicolor [broomcorn]
gb|EXX63008.1|  hypothetical protein RirG_156400                      49.7    1e-05   
dbj|BAK02303.1|  predicted protein                                    52.8    1e-05   
ref|XP_008653142.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-l...  52.8    1e-05   
ref|XP_008653138.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-l...  52.8    1e-05   
ref|XP_002462925.1|  hypothetical protein SORBIDRAFT_02g034560        52.8    1e-05   Sorghum bicolor [broomcorn]
ref|XP_010914594.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.8    1e-05   
ref|XP_004289113.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-like  52.8    1e-05   
ref|XP_009362868.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  52.8    1e-05   
ref|XP_004289345.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.0    1e-05   
ref|XP_010265220.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    1e-05   
ref|XP_009123004.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.4    1e-05   
ref|XP_010265219.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.8    1e-05   
gb|EEE62203.1|  hypothetical protein OsJ_16990                        52.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298288.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.4    1e-05   
ref|XP_010265223.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.4    1e-05   
ref|XP_007212371.1|  hypothetical protein PRUPE_ppa014831mg           52.4    1e-05   
ref|XP_008653143.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.4    1e-05   
ref|XP_006435469.1|  hypothetical protein CICLE_v10000383mg           52.4    1e-05   
ref|XP_010265222.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.4    1e-05   
ref|XP_009412131.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.4    1e-05   
tpg|DAA62892.1|  TPA: FAR1-domain family sequence                     52.4    1e-05   
ref|XP_010679286.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  52.4    2e-05   
gb|KDP46354.1|  hypothetical protein JCGZ_10194                       52.4    2e-05   
ref|XP_010027018.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.0    2e-05   
ref|XP_008660782.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.0    2e-05   
ref|XP_010694768.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.8    2e-05   
ref|XP_010257327.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.0    2e-05   
ref|XP_007031717.1|  Far1-related sequence 5, putative isoform 1      52.0    2e-05   
ref|XP_010681752.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  51.6    2e-05   
ref|XP_009407252.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.0    2e-05   
ref|XP_010324114.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  52.0    2e-05   
ref|XP_006452274.1|  hypothetical protein CICLE_v100102261mg          51.6    2e-05   
ref|XP_004987222.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  51.6    2e-05   
ref|XP_004305530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  52.0    2e-05   
gb|KFK36227.1|  hypothetical protein AALP_AA4G094500                  52.0    2e-05   
gb|EEC84007.1|  hypothetical protein OsI_30215                        52.0    2e-05   
ref|XP_004954935.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  51.6    2e-05   
ref|XP_010245235.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.0    2e-05   
ref|XP_010245233.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  52.0    2e-05   
gb|KCW84786.1|  hypothetical protein EUGRSUZ_B01589                   51.6    2e-05   
ref|XP_010677726.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  51.2    2e-05   
ref|NP_001052447.2|  Os04g0316800                                     52.0    2e-05   
gb|EYU43726.1|  hypothetical protein MIMGU_mgv1a0034692mg             50.8    3e-05   
ref|XP_010277289.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-like  51.6    3e-05   
ref|XP_009358905.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       51.6    3e-05   
ref|XP_010669102.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    3e-05   
gb|EYU36991.1|  hypothetical protein MIMGU_mgv1a0188031mg             51.2    3e-05   
ref|XP_006595317.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  51.6    3e-05   
ref|XP_008670949.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  51.6    3e-05   
ref|XP_006661165.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  51.6    3e-05   
ref|XP_008670948.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  51.6    3e-05   
ref|XP_010695335.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.8    3e-05   
ref|XP_002464378.1|  hypothetical protein SORBIDRAFT_01g017200        51.2    3e-05   
ref|XP_010677709.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  48.9    3e-05   
ref|XP_010667523.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  48.9    3e-05   
ref|XP_008809265.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  51.2    3e-05   
ref|XP_009775261.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  51.2    3e-05   
ref|XP_010669163.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.4    3e-05   
ref|XP_006491139.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  51.2    3e-05   
ref|XP_006445005.1|  hypothetical protein CICLE_v10018794mg           51.2    3e-05   
ref|XP_010649325.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  51.2    3e-05   
emb|CAN71534.1|  hypothetical protein VITISV_018182                   51.2    3e-05   
gb|KDP20361.1|  hypothetical protein JCGZ_06470                       51.2    3e-05   
ref|XP_010239274.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  51.2    3e-05   
ref|XP_008661798.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  51.2    4e-05   
gb|EEE68621.1|  hypothetical protein OsJ_27177                        51.2    4e-05   
ref|XP_010649324.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  51.2    4e-05   
ref|XP_010649323.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  51.2    4e-05   
ref|XP_011080506.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       51.2    4e-05   
ref|XP_008244660.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  50.4    4e-05   
ref|XP_008661806.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  51.2    4e-05   
ref|XP_004958991.1|  PREDICTED: uncharacterized protein LOC101778738  50.4    4e-05   
ref|XP_008781698.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.8    4e-05   
ref|XP_006408658.1|  hypothetical protein EUTSA_v10001905mg           50.8    4e-05   
ref|XP_010660826.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-like  50.8    4e-05   
ref|XP_002457501.1|  hypothetical protein SORBIDRAFT_03g008390        50.8    4e-05   
ref|XP_010913807.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.8    4e-05   
ref|XP_008661794.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.8    4e-05   
ref|XP_010675560.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    4e-05   
ref|XP_006662300.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    4e-05   
ref|XP_003618131.1|  FAR1-related protein                             50.8    5e-05   
gb|KCW80601.1|  hypothetical protein EUGRSUZ_C01967                   50.8    5e-05   
ref|XP_010669219.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.1    5e-05   
ref|XP_010555162.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       50.8    5e-05   
ref|XP_004309848.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.4    5e-05   
ref|XP_011090244.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  50.8    5e-05   
ref|XP_008232022.1|  PREDICTED: uncharacterized protein LOC103331192  50.4    5e-05   
ref|XP_002456110.1|  hypothetical protein SORBIDRAFT_03g030640        50.8    5e-05   
gb|KDP47038.1|  hypothetical protein JCGZ_10765                       50.4    5e-05   
ref|XP_010675549.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    5e-05   
ref|XP_008362288.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    6e-05   
ref|XP_011040842.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAR1...  50.4    6e-05   
ref|XP_006384877.1|  hypothetical protein POPTR_0004s21880g           50.4    6e-05   
gb|KDP42904.1|  hypothetical protein JCGZ_23846                       50.4    6e-05   
ref|XP_010229617.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.4    6e-05   
ref|XP_008665988.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    6e-05   
ref|XP_010230235.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    6e-05   
ref|XP_007226784.1|  hypothetical protein PRUPE_ppa018163mg           50.4    6e-05   
ref|XP_010227128.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    6e-05   
ref|XP_010240799.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.4    6e-05   
ref|XP_010909462.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.4    6e-05   
ref|XP_011088828.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       50.4    6e-05   
ref|XP_006470451.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  50.4    6e-05   
ref|XP_006470450.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  50.4    6e-05   
ref|XP_003545054.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.4    6e-05   
ref|XP_007213864.1|  hypothetical protein PRUPE_ppa016086mg           50.4    7e-05   
ref|XP_007220598.1|  hypothetical protein PRUPE_ppa001310mg           50.4    7e-05   
ref|XP_010685453.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    7e-05   
ref|XP_009381610.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.4    7e-05   
ref|XP_006446368.1|  hypothetical protein CICLE_v10018084mg           50.4    7e-05   
ref|XP_002447845.1|  hypothetical protein SORBIDRAFT_06g016820        50.1    7e-05   
ref|XP_009381611.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.4    7e-05   
ref|XP_007142582.1|  hypothetical protein PHAVU_008G293000g           50.4    7e-05   
ref|XP_010936442.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.1    7e-05   
ref|XP_010936427.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.1    7e-05   
ref|XP_009631561.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.1    7e-05   
gb|KDO66406.1|  hypothetical protein CISIN_1g043648mg                 50.4    7e-05   
ref|XP_009631560.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.1    7e-05   
ref|XP_010266300.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    7e-05   
ref|XP_010684208.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    7e-05   
ref|XP_006486554.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    8e-05   
ref|XP_007214615.1|  hypothetical protein PRUPE_ppa001166mg           50.1    8e-05   
ref|XP_010923773.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    8e-05   
gb|EMT20143.1|  Protein FAR1-RELATED SEQUENCE 5                       50.4    8e-05   
ref|XP_004491651.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    8e-05   
ref|XP_009776133.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  50.1    8e-05   
ref|XP_006422378.1|  hypothetical protein CICLE_v10027888mg           50.1    8e-05   
gb|EXX55726.1|  hypothetical protein RirG_222750                      47.4    8e-05   
ref|XP_010936466.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.1    8e-05   
ref|XP_009776132.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  50.1    8e-05   
ref|XP_006469959.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  50.1    8e-05   
ref|XP_004494023.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  49.3    8e-05   
ref|XP_009776131.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  50.1    8e-05   
ref|XP_006447184.1|  hypothetical protein CICLE_v10014295mg           50.1    8e-05   
ref|XP_006605633.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  50.1    8e-05   
ref|XP_006605632.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  50.1    8e-05   
gb|KHN46338.1|  Protein FAR1-RELATED SEQUENCE 3                       50.1    8e-05   
ref|XP_010229782.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    8e-05   
ref|XP_008451084.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       50.1    8e-05   
ref|XP_004144079.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  50.1    8e-05   
ref|XP_010251622.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       50.1    8e-05   
ref|XP_008660342.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    8e-05   
ref|XP_010231561.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    9e-05   
ref|XP_010666581.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  47.8    9e-05   
ref|NP_565636.1|  FAR1-related sequence 3                             50.1    9e-05   
emb|CAH66510.1|  OSIGBa0111I14.5                                      50.1    9e-05   
ref|XP_006590087.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    9e-05   
gb|EEC80589.1|  hypothetical protein OsI_22927                        49.7    9e-05   
ref|XP_010675037.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    9e-05   
ref|XP_010687046.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  47.8    9e-05   
ref|XP_010260561.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.1    9e-05   
ref|XP_010685076.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  50.1    9e-05   
ref|XP_006589624.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.1    9e-05   
ref|XP_006441931.1|  hypothetical protein CICLE_v10023561mg           50.1    9e-05   
ref|XP_007216795.1|  hypothetical protein PRUPE_ppa023614mg           49.7    9e-05   
ref|XP_006589623.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.1    9e-05   
ref|XP_006589621.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.1    9e-05   
ref|XP_002463799.1|  hypothetical protein SORBIDRAFT_01g006380        50.1    9e-05   
ref|XP_008809267.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    9e-05   
ref|NP_001031428.1|  FAR1-related sequence 3                          49.7    1e-04   
ref|XP_010260560.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.1    1e-04   
ref|XP_010260557.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  50.1    1e-04   
ref|XP_009402879.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
ref|XP_007038614.1|  FAR1-related sequence 5 isoform 4                49.7    1e-04   
gb|ABA95414.1|  transposon protein, putative, unclassified            49.7    1e-04   
ref|XP_009615095.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
ref|XP_008240644.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    1e-04   
ref|XP_010666977.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  49.7    1e-04   
ref|XP_008676064.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  47.8    1e-04   
ref|XP_007038612.1|  FAR1-related sequence 5 isoform 2                49.7    1e-04   
ref|XP_004304854.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    1e-04   
ref|XP_008671695.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
ref|XP_007038613.1|  FAR1-related sequence 5 isoform 3                49.7    1e-04   
ref|XP_003592301.1|  FAR1-related protein                             49.7    1e-04   
ref|XP_007038611.1|  FAR1-related sequence 5 isoform 1                49.7    1e-04   
ref|XP_010696332.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
gb|EEE52553.1|  hypothetical protein OsJ_34801                        49.7    1e-04   
ref|XP_009403868.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
ref|XP_009403859.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
ref|XP_010909464.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
gb|KCW72771.1|  hypothetical protein EUGRSUZ_E01219                   49.7    1e-04   
ref|XP_010909463.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
ref|XP_006582641.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    1e-04   
ref|NP_001050533.1|  Os03g0576100                                     49.7    1e-04   
ref|XP_007018641.1|  Far1-related sequence 5 isoform 1                49.7    1e-04   
ref|XP_010909461.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
gb|KCW88532.1|  hypothetical protein EUGRSUZ_A009102                  49.7    1e-04   
gb|AAR10861.1|  putative transposase                                  49.7    1e-04   
ref|XP_006647047.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
emb|CAN62918.1|  hypothetical protein VITISV_029735                   49.7    1e-04   
ref|XP_006480513.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  49.7    1e-04   
ref|XP_007043118.1|  FAR1-related sequence 5                          49.7    1e-04   
ref|XP_010693208.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 8-like  49.3    1e-04   
ref|XP_004955167.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.7    1e-04   
ref|XP_010044813.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 2       49.7    1e-04   
ref|XP_010909466.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
ref|XP_008343459.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  47.4    1e-04   
gb|EEE59391.1|  hypothetical protein OsJ_11516                        49.7    1e-04   
ref|XP_004295765.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
dbj|BAG95729.1|  unnamed protein product                              49.3    1e-04   
ref|XP_008776587.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.7    1e-04   
gb|KCW54873.1|  hypothetical protein EUGRSUZ_I00824                   49.3    1e-04   
ref|XP_008338195.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  48.5    1e-04   
ref|XP_008776589.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.3    1e-04   
gb|KFK32424.1|  hypothetical protein AALP_AA6G240100                  49.3    1e-04   
ref|XP_010266298.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
gb|AAX96213.1|  transposon protein, putative, unclassified            49.7    1e-04   
ref|XP_008776588.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.3    1e-04   
dbj|BAC10390.1|  far-red impaired response-like protein               49.3    1e-04   
ref|XP_006364336.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
ref|XP_008657291.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  48.1    1e-04   
ref|XP_004954599.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    1e-04   
ref|XP_010937297.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.3    1e-04   
ref|XP_008671732.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  47.8    1e-04   
ref|NP_001046234.1|  Os02g0202800                                     49.3    1e-04   
ref|XP_010681435.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  48.5    1e-04   
ref|XP_010513318.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  49.3    1e-04   
ref|XP_002321891.2|  hypothetical protein POPTR_0015s13560g           49.3    1e-04   
emb|CAE02137.2|  OSJNBa0074L08.5                                      49.3    1e-04   
emb|CAH67914.1|  OSIGBa0115K01-H0319F09.20                            49.3    1e-04   
dbj|BAD87203.1|  far-red impaired response-like                       49.3    2e-04   
ref|XP_010028878.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5 i...  49.3    2e-04   
ref|XP_010473100.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       49.3    2e-04   
ref|XP_004231108.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       49.3    2e-04   
ref|XP_011041602.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    2e-04   
ref|XP_009402876.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.3    2e-04   
ref|XP_003518461.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  49.3    2e-04   
ref|XP_009402878.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.3    2e-04   
ref|XP_008782893.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.3    2e-04   
ref|XP_006377078.1|  hypothetical protein POPTR_0012s13550g           49.3    2e-04   
ref|XP_003592163.1|  Cysteine-rich receptor-like protein kinase       49.3    2e-04   
ref|XP_010270590.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    2e-04   
ref|XP_010937296.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  49.3    2e-04   
ref|XP_010245899.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    2e-04   
ref|XP_008662483.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  49.3    2e-04   
ref|XP_010687090.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  47.0    2e-04   
ref|XP_002318830.1|  hypothetical protein POPTR_0012s13550g           49.3    2e-04   
ref|XP_008382516.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       49.3    2e-04   
ref|XP_009758605.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       49.3    2e-04   



>ref|XP_010677175.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=525

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY+++F PFTGVDH+KRCI F  G   +ED  S+ W+   F  AMG + P C++TDQDP 
Sbjct  52   RYNMVFGPFTGVDHHKRCITFGAGFTAKEDISSFEWLFTTFLKAMGNNEPTCLITDQDPA  111

Query  191  MKI  199
            MKI
Sbjct  112  MKI  114



>ref|XP_010678062.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPTM  193
            Y+L+F PFTG+DH+KR ++F   L +RE+  S+VWV  +FK AMG K P  ++TDQDP M
Sbjct  218  YNLVFCPFTGIDHHKRFVIFGAALTSRENDNSFVWVFEKFKQAMGNKEPNFIITDQDPAM  277

Query  194  K  196
            K
Sbjct  278  K  278



>ref|XP_010670287.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY+++F PFTGVDH+KRCI F  G + +ED  S+ W+   F  AMG + P C++TDQDP 
Sbjct  291  RYNMVFGPFTGVDHHKRCITFGAGFIAKEDISSFEWLFTTFLKAMGNNEPTCLITDQDPA  350

Query  191  MKI  199
            MK+
Sbjct  351  MKV  353



>ref|XP_010695510.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=834

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY+++F PFTGVDH +RCI F  G   +ED  S+ W+   F  AMG + P C++TDQDP 
Sbjct  387  RYNMVFGPFTGVDHRRRCITFGVGFTAKEDISSFEWLFTTFLKAMGNNEPTCLITDQDPA  446

Query  191  MKI  199
            MK+
Sbjct  447  MKV  449



>ref|XP_010666566.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=891

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY+++F PFTGVDH+KRCI F  G   +ED  S+ W+   F  AMG + P C++TDQDP 
Sbjct  418  RYNMVFGPFTGVDHHKRCITFGAGFTAKEDISSFEWLFTTFLKAMGNNEPTCLITDQDPA  477

Query  191  MKI  199
            MK+
Sbjct  478  MKV  480



>ref|XP_010694608.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +YSL+F PFTG++H+++ I F    L  E  ES+VWV  +F + M G+ P C++TDQDP 
Sbjct  51   KYSLIFAPFTGLNHHRQAITFGAAFLANEKEESFVWVFEKFVEVMGGRKPVCIITDQDPA  110

Query  191  MK  196
            MK
Sbjct  111  MK  112



>ref|XP_010667127.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=732

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM--GKSP*CVVTDQDP  187
            RY+++F PFTGVDH+KRC+ F  G + +ED  S+ W+   F  AM     P C++TDQDP
Sbjct  285  RYNMIFGPFTGVDHHKRCVSFGAGFIAKEDIVSFEWLFKTFLKAMWNNNEPTCLITDQDP  344

Query  188  TMKI  199
             MKI
Sbjct  345  AMKI  348



>ref|XP_010678296.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=331

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY+++F PFTGVDH KRCI F     T+ED  S+ W+   F  AMG + P C++TDQDP 
Sbjct  119  RYNMVFGPFTGVDHLKRCITFGADFTTKEDISSFEWLFTTFLKAMGNNEPTCLITDQDPA  178

Query  191  MKI  199
            MK+
Sbjct  179  MKV  181



>ref|XP_010693927.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=562

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY+++F PFTGVDH+KRCI F  G   +ED  S+ W+   F  AMG + P C++TDQDP 
Sbjct  119  RYNMVFGPFTGVDHHKRCITFGVGFTAKEDISSFEWLFTTFLKAMGNNEPTCLITDQDPA  178

Query  191  MKI  199
            MK+
Sbjct  179  MKV  181



>ref|XP_010668319.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=599

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY ++F PFTGVDH+KRCI F  G   +ED  S+ W+   F  AMG + P C++TDQD  
Sbjct  291  RYHMVFGPFTGVDHHKRCITFGAGFTAKEDISSFEWLFTTFLKAMGNNEPTCLITDQDSA  350

Query  191  MKI  199
            MK+
Sbjct  351  MKV  353



>ref|XP_010675531.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=617

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY ++F PFTG+D+++ CI F    L  E  ES+ W+  +F DAM G  P C++TDQD  
Sbjct  300  RYKMIFAPFTGLDNHRLCITFGAAFLGDEKAESFTWLFEKFLDAMGGHKPICIITDQDLA  359

Query  191  MKI  199
            MK+
Sbjct  360  MKV  362



>ref|XP_010678162.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=386

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y ++  PFTGVDH+ +C+ F  GLL +ED ES+VW+   F  AMG   P C++TDQD  
Sbjct  238  KYCMVLAPFTGVDHHGKCVTFGMGLLAKEDIESFVWLFECFLKAMGNCQPTCLITDQDAA  297

Query  191  MK  196
            MK
Sbjct  298  MK  299



>ref|XP_010692636.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPTM  193
            Y+L+F PFT +DH+KR ++F   L +RE+   ++WV  +FK AMG K P  ++TDQD  M
Sbjct  113  YNLVFCPFTRIDHHKRSVIFGAALTSRENDNYFLWVFEKFKQAMGNKEPNFIITDQDSAM  172

Query  194  K  196
            K
Sbjct  173  K  173



>gb|KDO38919.1| hypothetical protein CISIN_1g046293mg [Citrus sinensis]
Length=695

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 6/81 (7%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+++F PF GV+++ + I+F  G L+ E TES++W+  +FK+AM G  P  ++TDQDP 
Sbjct  220  RYNMIFAPFVGVNNHGQTIIFGCGFLSDETTESFLWLFEQFKEAMPGDDPKMIITDQDPA  279

Query  191  MKIYKLHISITHF*LLIKTLE  253
            M    LH++  H  +L K LE
Sbjct  280  M---ILHLAYWH--ILNKFLE  295



>ref|XP_008657613.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=644

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPTM  193
            Y+++F PFTG++H+K C++F   LL+ E TE+Y W+   F  AMG  +P  ++TD+  +M
Sbjct  169  YNMIFTPFTGINHHKSCVLFGAALLSNETTEAYTWLFRTFLRAMGGVAPRLIITDEANSM  228

Query  194  K  196
            +
Sbjct  229  R  229



>ref|XP_008390324.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=430

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDP  187
            RYS++F PF G++++ + I+FAG  L+ E  +S+VW+   F +AM G +P  ++TDQDP
Sbjct  303  RYSMIFAPFMGINNHGQTIIFAGAFLSDETKDSFVWLFREFLNAMPGDAPKMIITDQDP  361



>ref|XP_002460471.1| hypothetical protein SORBIDRAFT_02g028930 [Sorghum bicolor]
 gb|EER96992.1| hypothetical protein SORBIDRAFT_02g028930 [Sorghum bicolor]
Length=499

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L  +PF GV+H+   ++FA G++ +E  ESYVW+L  F DAM  K P  V+TD D  
Sbjct  250  RYNLPLVPFVGVNHHGSTVLFACGIIAQETIESYVWMLRTFSDAMAQKHPVSVITDGDLA  309

Query  191  MK  196
            M+
Sbjct  310  MQ  311



>ref|XP_008653692.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=517

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y++ F PFTGV+H+ + + F  G L  E  ESY W+L  F  AM GK+P  +VTD+D +
Sbjct  297  QYNMKFTPFTGVNHHMQSVFFGAGFLLNEKIESYEWLLKTFLLAMGGKAPILMVTDEDAS  356

Query  191  MK  196
            MK
Sbjct  357  MK  358



>ref|XP_010238967.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=607

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +YS++F PFTG++H+   + +   L+  E  ESY WV   F  AM G +P  +VTD+D +
Sbjct  242  QYSMIFCPFTGINHHMASVFYGAALIVNETIESYKWVFQTFLKAMDGAAPRLIVTDEDQS  301

Query  191  MKI  199
            MKI
Sbjct  302  MKI  304



>ref|XP_008246383.1| PREDICTED: uncharacterized protein LOC103344568 [Prunus mume]
Length=482

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY ++F P  GV+++ + I+F  G L+ E TES++W+  +FK AM    P  ++TDQDP 
Sbjct  66   RYGMVFAPLVGVNNHGQTILFGCGFLSNETTESFLWLFEQFKKAMPAGPPKIIITDQDPA  125

Query  191  M  193
            M
Sbjct  126  M  126



>ref|XP_008365955.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=776

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RYS++F PF G++++ + I+FAG  L  E  +S+VW+   F +A  G +P  ++TDQDP 
Sbjct  308  RYSMIFAPFMGINNHGQTIVFAGAFLXDETXDSFVWLFREFLNAXPGDAPKMIITDQDPA  367

Query  191  M  193
            M
Sbjct  368  M  368



>ref|XP_010673996.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=798

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++  PF G++H++R +MF  G L  EDT+S+VW+   F  +M G+SP  ++TDQD  
Sbjct  280  KYGMICGPFVGMNHHQRNVMFGVGFLLNEDTDSFVWLFDSFLKSMGGRSPITIMTDQDAA  339

Query  191  M  193
            M
Sbjct  340  M  340



>ref|XP_010674487.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=713

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++  PF G++H++R +MF  G L  EDT+S+VW+   F  +M G+SP  ++TDQD  
Sbjct  195  KYGMICGPFVGMNHHQRNVMFGVGFLLNEDTDSFVWLFDSFLKSMGGRSPITIMTDQDAA  254

Query  191  M  193
            M
Sbjct  255  M  255



>ref|XP_010236653.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=355

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L F+PF GVDH++  I+F  G+++ E   SY W+L  F +AM  K+P  V+TD D  
Sbjct  98   RYNLPFVPFIGVDHHRSTIVFGVGIVSDETVSSYEWLLQSFLEAMSHKNPRSVITDGDAA  157

Query  191  MK  196
            M+
Sbjct  158  MR  159



>ref|XP_010672688.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=659

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++  PF G++H++R +MF  G L  EDT+S+VW+   F  +M G+SP  ++TDQD  
Sbjct  141  KYGMICGPFVGMNHHQRNVMFGVGFLLNEDTDSFVWLFESFLKSMGGRSPITIMTDQDAA  200

Query  191  M  193
            M
Sbjct  201  M  201



>gb|ABN05718.1| FAR1; Zinc finger, SWIM-type [Medicago truncatula]
Length=800

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++F PFTG++H+++ I F   LL  E  ES+VW+   F  AM G  P  ++TDQD  
Sbjct  334  KYFMIFAPFTGINHHRQSITFGAALLKNEKEESFVWLFETFLKAMGGHKPVMIITDQDGG  393

Query  191  MK  196
            MK
Sbjct  394  MK  395



>ref|XP_010239118.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=376

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L F+PF GVDH +  I+F  G+++ E   SY W+L  F +AM  K+P  V+TD D  
Sbjct  253  RYNLPFVPFIGVDHRRSTIVFGVGIVSDETVSSYEWLLQSFVEAMSHKNPRSVITDGDAA  312

Query  191  MK  196
            M+
Sbjct  313  MR  314



>ref|XP_002450570.1| hypothetical protein SORBIDRAFT_05g007130 [Sorghum bicolor]
 gb|EES09558.1| hypothetical protein SORBIDRAFT_05g007130 [Sorghum bicolor]
Length=698

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L  +PF GV+H+   ++FA G++ +E  ESYVW+L    DAM  K P  V+TD D  
Sbjct  250  RYNLPLVPFVGVNHHGSTVLFACGIVAQETIESYVWLLSTLSDAMAQKHPVSVITDGDLA  309

Query  191  MK  196
            M+
Sbjct  310  MQ  311



>ref|XP_009391891.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391892.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=817

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F+PF GV+H+ + I+F  GLL+ EDT ++ W+   F   M G++P  ++TDQD  
Sbjct  271  KYDMPFVPFVGVNHHGQSILFGCGLLSNEDTMTFTWLFRAFLSCMSGRAPNAIITDQDKA  330

Query  191  MK  196
            M+
Sbjct  331  MQ  332



>ref|XP_008654819.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=589

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+++F PFTGV+H+ + + F    +  E  ESY W+   F  AM GK P  ++TD+D +
Sbjct  343  QYNMIFAPFTGVNHHMQSVFFGAAFIANEKIESYEWLFRTFLSAMGGKDPRLIITDEDAS  402

Query  191  MK  196
            MK
Sbjct  403  MK  404



>ref|XP_004297991.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=377

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY ++F PFTGV+++ + I+F    L  E  +S+VW+   F + M G +P  ++TDQDP 
Sbjct  250  RYGMIFAPFTGVNNHGQSIIFGCAFLNDETADSFVWLFKEFLNVMPGNAPMMIITDQDPA  309

Query  191  M  193
            M
Sbjct  310  M  310



>gb|KDO38178.1| hypothetical protein CISIN_1g046720mg [Citrus sinensis]
Length=455

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++F PF GV+++ +  +FA   L+ E TES+VW+  +FK AM G  P  ++TDQDP 
Sbjct  246  KYGMIFAPFIGVNNHGQTTVFACSFLSDETTESFVWLFEQFKKAMPGDLPKMIITDQDPA  305

Query  191  M  193
            +
Sbjct  306  I  306



>ref|XP_010229979.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=722

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++F PFTG++H+   + +   L+  E  ESY WV   F  AM G +P  +VTD+D +
Sbjct  346  QYGMIFCPFTGINHHMASVFYGAALIVNETIESYKWVFQTFLKAMDGAAPRLIVTDEDQS  405

Query  191  MKI  199
            MKI
Sbjct  406  MKI  408



>ref|XP_008669590.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008670829.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008662561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=499

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + + F    +  E  ESY W+   F  AMG K+P  ++TD+D +
Sbjct  364  QYNMKFVPFTGVNHHMQSVFFGAAFIVNEKIESYEWLFRTFLSAMGEKAPRLIITDEDAS  423

Query  191  MK  196
            M+
Sbjct  424  MR  425



>ref|XP_004967151.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=546

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y+++F+PFTGV+H+ + +      L  E  ESYVW+   F  AMG  +P  ++TD+D +
Sbjct  265  QYNMIFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLFNTFLKAMGGVAPHLIITDEDAS  324

Query  191  MK  196
            MK
Sbjct  325  MK  326



>ref|XP_006428864.1| hypothetical protein CICLE_v10013881mg, partial [Citrus clementina]
 gb|ESR42104.1| hypothetical protein CICLE_v10013881mg, partial [Citrus clementina]
Length=666

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++F PF GV+++ +  +FA   L+ E TES+VW+  +FK AM G  P  ++TDQDP 
Sbjct  247  KYGMIFAPFIGVNNHGQTTVFACSFLSDETTESFVWLFEQFKKAMPGDLPKMIITDQDPA  306

Query  191  M  193
            +
Sbjct  307  I  307



>ref|XP_008244105.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=325

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            RY ++F P  GV+++ + I+F GG L+ E  ES+ W+  +FK AM  S P  ++T QDP 
Sbjct  209  RYGMVFAPLVGVNNHGQTILFGGGFLSNETIESFPWLFEQFKKAMPASPPKIIITYQDPE  268

Query  191  M  193
            M
Sbjct  269  M  269



>ref|XP_002459592.1| hypothetical protein SORBIDRAFT_02g007217 [Sorghum bicolor]
 gb|EER96113.1| hypothetical protein SORBIDRAFT_02g007217 [Sorghum bicolor]
Length=670

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L  +PF GV+H++  ++F  G+++ E+ ESYVW+L  F +AM  K P  V+TD D  
Sbjct  248  RYNLPLVPFVGVNHHRSTVIFGCGIISHENIESYVWMLRTFSEAMIQKHPVSVITDGDLA  307

Query  191  MK  196
            M+
Sbjct  308  MQ  309



>ref|XP_002466896.1| hypothetical protein SORBIDRAFT_01g016055 [Sorghum bicolor]
 gb|EER93894.1| hypothetical protein SORBIDRAFT_01g016055 [Sorghum bicolor]
Length=437

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L  +PF GV+H+   ++FA G++ +E  ESYVW+L    DAM  K P  V+T+ D  
Sbjct  252  RYNLPLVPFVGVNHHGSTVLFACGIVAQETIESYVWLLSTLSDAMAQKHPVSVITNGDLA  311

Query  191  MK  196
            M+
Sbjct  312  MQ  313



>ref|XP_008680369.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=460

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y++ F PFTGV+H+ + I   GG L  E  ESY W+   F  AM G++P  ++TD+D ++
Sbjct  328  YNMKFTPFTGVNHHMQSIFLGGGFLINERIESYEWLFKTFLVAMGGRAPRLIITDEDASL  387

Query  194  K  196
            K
Sbjct  388  K  388



>ref|XP_008220898.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=367

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY ++F P  GV+++ + I+F+G  L+ E  +S++W+   F  AM G +P  ++TDQDP 
Sbjct  266  RYCMIFAPIMGVNNHGQTIIFSGAFLSDETADSFIWLFREFLRAMPGDAPKIIITDQDPA  325

Query  191  M  193
            M
Sbjct  326  M  326



>gb|EEE69818.1| hypothetical protein OsJ_29559 [Oryza sativa Japonica Group]
Length=562

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+++F+PFTGV+H+ + +      L  E  ESYVW+   F  AM G +P  ++TD+D +
Sbjct  279  QYNMIFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLFKTFLKAMRGVAPHLIITDEDMS  338

Query  191  MK  196
            MK
Sbjct  339  MK  340



>ref|XP_002447469.1| hypothetical protein SORBIDRAFT_06g001517 [Sorghum bicolor]
 gb|EES11797.1| hypothetical protein SORBIDRAFT_06g001517 [Sorghum bicolor]
Length=727

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL+ E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  261  RYNMPFAPIVGINNHAQSILLGCALLSDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  320

Query  191  MK--IYKLHISITH  226
            MK  I ++  S TH
Sbjct  321  MKAAIAQVFPSTTH  334



>ref|NP_001063309.1| Os09g0446400 [Oryza sativa Japonica Group]
 dbj|BAF25223.1| Os09g0446400 [Oryza sativa Japonica Group]
Length=561

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+++F+PFTGV+H+ + +      L  E  ESYVW+   F  AM G +P  ++TD+D +
Sbjct  278  QYNMIFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLFKTFLKAMRGVAPHLIITDEDMS  337

Query  191  MK  196
            MK
Sbjct  338  MK  339



>ref|XP_008381561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=705

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PF GV+H+++ I+   GL++RED +S++W+   +   M G +P  ++TDQD  
Sbjct  340  KYDMPFAPFVGVNHHRQSILLGCGLISREDNDSFIWLFRTWLACMSGHAPSGIITDQDKA  399

Query  191  MK  196
            MK
Sbjct  400  MK  401



>ref|XP_002464446.1| hypothetical protein SORBIDRAFT_01g018540 [Sorghum bicolor]
 gb|EER91444.1| hypothetical protein SORBIDRAFT_01g018540 [Sorghum bicolor]
Length=864

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 7/88 (8%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  401  RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  460

Query  191  MK--IYKLHISITH----F*LLIKTLEF  256
            MK  I ++  S TH    F ++ K L+F
Sbjct  461  MKAAIAQVFPSTTHRCCKFHVVSKALKF  488



>ref|XP_002444099.1| hypothetical protein SORBIDRAFT_07g007695 [Sorghum bicolor]
 gb|EES13594.1| hypothetical protein SORBIDRAFT_07g007695 [Sorghum bicolor]
Length=243

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + +      L  E  ESYVW+L  F  AMG  +P  + TD+D +
Sbjct  176  QYNMKFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLLKTFLKAMGGVAPHLITTDEDVS  235

Query  191  MKIYKLH  211
            M     H
Sbjct  236  MIAVAYH  242



>gb|EEE63476.1| hypothetical protein OsJ_18290 [Oryza sativa Japonica Group]
Length=664

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPTM  193
            Y ++F PFTGV+H+K  ++F   +L+ E  ESY+W+   F  AMG  +P  ++TD+  +M
Sbjct  266  YGMVFTPFTGVNHHKSSVLFGATMLSDETMESYMWLFHTFLKAMGGVAPKLIITDEAASM  325

Query  194  K  196
            K
Sbjct  326  K  326



>ref|XP_010233373.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=325

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y+L+F+PF G++H++  ++F  G+++ E +ESY W+L  F  AM  K P  V+TD D  
Sbjct  249  KYNLLFVPFVGLNHHRSTVVFGCGIISHETSESYEWMLRTFSAAMAQKHPISVITDGDLA  308

Query  191  MK  196
            M+
Sbjct  309  MQ  310



>ref|XP_004974618.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=550

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+++F+PFTGV+H+ + +      L  E  ESY W+   F  AM G +P  ++TD+D +
Sbjct  193  QYNMIFVPFTGVNHHLQSVSLGAAFLANEKIESYEWLFNTFLKAMRGVAPHLIITDEDAS  252

Query  191  MKIYKLHI  214
            MK    HI
Sbjct  253  MKAVIAHI  260



>ref|XP_010238888.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=914

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +YS++F PFTG++H+   + +   L+  E  ESY W+   F  AM G +P  +VT++D +
Sbjct  346  QYSMIFCPFTGINHHMASVFYGAALIVNETIESYKWLFQTFLKAMDGAAPRLIVTNEDQS  405

Query  191  MKI  199
            MKI
Sbjct  406  MKI  408



>ref|XP_010232993.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=185

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y+L F+PF G++H+   I+F  G+++ E +ESY W+L  F  AM  K P  V+TD D  
Sbjct  102  KYNLPFVPFVGLNHHHSTIVFGCGIISHETSESYEWMLRTFSAAMAQKHPISVITDGDLA  161

Query  191  MK  196
            M+
Sbjct  162  MQ  163



>gb|EYU26870.1| hypothetical protein MIMGU_mgv1a025010mg [Erythranthe guttata]
Length=659

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RYS+ F+PFT V H+ + +MF   LL      SYVW+L  + +AM G++P  ++TD+D +
Sbjct  214  RYSMPFVPFTEVHHHHQSVMFGCALLVNVKPSSYVWLLRTWIEAMFGRAPSVIITDEDKS  273

Query  191  MK  196
            M+
Sbjct  274  MR  275



>ref|XP_004298353.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=487

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 5/65 (8%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-----GKSP*CVVTD  178
            RY ++F PFTGV+++ + I+FA   L  E  +S+VW+   F +AM       +P  ++TD
Sbjct  40   RYGMIFAPFTGVNNHGQTIIFACAFLNDETADSFVWLFKEFLNAMPGNASENAPTMIITD  99

Query  179  QDPTM  193
            QDP M
Sbjct  100  QDPAM  104



>emb|CAD40452.2| OSJNBa0041M21.10 [Oryza sativa Japonica Group]
 emb|CAD40359.2| OSJNBa0093P23.5 [Oryza sativa Japonica Group]
Length=2074

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RYSL F+PF G +H++  I+F  G+L+ E   SYVW+L    +AM  K P  ++TD D +
Sbjct  148  RYSLPFVPFVGANHHRSTIIFGCGILSNESVSSYVWLLQTLLEAMHQKHPKSLITDGDAS  207

Query  191  M  193
            M
Sbjct  208  M  208



>ref|XP_008221872.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Prunus mume]
Length=650

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY ++F P  GV+++ + I+F+G  L+ E  +S++W+   F  AM G +P  ++TDQDP 
Sbjct  170  RYCMIFAPIMGVNNHGQTIIFSGAFLSDETADSFIWLFREFLRAMPGDAPKIIITDQDPA  229

Query  191  M  193
            M
Sbjct  230  M  230



>ref|XP_008240566.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=332

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F P  GV+++ + I+ A   L++E TES++W+   FK AM G  P  ++TDQD  
Sbjct  236  RYDLTFAPMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAA  295

Query  191  M  193
            M
Sbjct  296  M  296



>ref|XP_008233158.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=359

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F P  GV+++ + I+ A   L++E TES++W+   FK AM G  P  ++TDQD  
Sbjct  255  RYDLTFAPMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAA  314

Query  191  M  193
            M
Sbjct  315  M  315



>ref|XP_002438472.1| hypothetical protein SORBIDRAFT_10g020136 [Sorghum bicolor]
 gb|EER89839.1| hypothetical protein SORBIDRAFT_10g020136 [Sorghum bicolor]
Length=280

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E T++++WVL   KDAMG+ +P  ++TDQD  
Sbjct  87   RYNMPFAPIDGINNHAQSILLGCALLPDETTKTFLWVLQTLKDAMGEIAPTNIMTDQDRA  146

Query  191  MK--IYKLHISITH  226
            MK  I ++ +S TH
Sbjct  147  MKAAIAQVFLSTTH  160



>ref|XP_008231820.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial [Prunus 
mume]
Length=252

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F P  GV+++ + I+ A   L++E TES++W+   FK AM G  P  ++TDQD  
Sbjct  87   RYDLTFAPMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAA  146

Query  191  M  193
            M
Sbjct  147  M  147



>ref|XP_010231426.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=405

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L F+PF GVDH++  I+F  G+++ E   SY W+L  F + M  K+P  V+TD D  
Sbjct  253  RYNLPFVPFIGVDHHRSTIVFGVGIVSDETVSSYEWLLQSFLEVMSHKNPRSVITDGDAA  312

Query  191  MK  196
            M+
Sbjct  313  MR  314



>ref|XP_002446673.1| hypothetical protein SORBIDRAFT_06g020246 [Sorghum bicolor]
 gb|EES11001.1| hypothetical protein SORBIDRAFT_06g020246 [Sorghum bicolor]
Length=745

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  306  RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  365

Query  191  MK--IYKLHISITH  226
            MK  I ++  S TH
Sbjct  366  MKAAIAQVFPSTTH  379



>ref|XP_002456252.1| hypothetical protein SORBIDRAFT_03g032960 [Sorghum bicolor]
 gb|EES01372.1| hypothetical protein SORBIDRAFT_03g032960 [Sorghum bicolor]
Length=878

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  402  RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  461

Query  191  MK--IYKLHISITH  226
            MK  I ++  S TH
Sbjct  462  MKAAIAQVFPSTTH  475



>ref|XP_008244497.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=377

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F P  GV+++ + I+ A   L++E TES++W+   FK AM G  P  ++TDQD  
Sbjct  236  RYDLTFAPMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAA  295

Query  191  M  193
            M
Sbjct  296  M  296



>ref|XP_002450652.1| hypothetical protein SORBIDRAFT_05g008730 [Sorghum bicolor]
 gb|EES09640.1| hypothetical protein SORBIDRAFT_05g008730 [Sorghum bicolor]
Length=597

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  99   RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  158

Query  191  MK--IYKLHISITH  226
            MK  I ++  S TH
Sbjct  159  MKAAIAQVFPSTTH  172



>ref|XP_002466791.1| hypothetical protein SORBIDRAFT_01g014270 [Sorghum bicolor]
 gb|EER93789.1| hypothetical protein SORBIDRAFT_01g014270 [Sorghum bicolor]
Length=708

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L F+PF G++H++  ++F  G+++ E  ESY W+L  F +AM  K P  V+TD D  
Sbjct  252  RYNLPFVPFVGLNHHRSTVIFGCGVISHETGESYEWMLRTFSEAMSQKHPVSVITDGDLA  311

Query  191  MK  196
            M+
Sbjct  312  MQ  313



>ref|XP_004297885.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Fragaria 
vesca subsp. vesca]
Length=613

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PF GV+H+ + I+   GL++ EDTE++VW+   +   M G +P  ++TDQD  
Sbjct  167  KYEMPFAPFVGVNHHSQSILLGCGLISSEDTETFVWLFKSWLACMSGNAPGGIITDQDRA  226

Query  191  MK  196
            M+
Sbjct  227  MR  228



>ref|XP_008227616.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial [Prunus 
mume]
Length=404

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F P  GV+++ + I+ A   L++E TES++W+   FK AM G  P  ++TDQD  
Sbjct  262  RYDLTFAPMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAA  321

Query  191  M  193
            M
Sbjct  322  M  322



>ref|NP_001047685.1| Os02g0668200 [Oryza sativa Japonica Group]
 dbj|BAF09599.1| Os02g0668200 [Oryza sativa Japonica Group]
Length=766

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++F PFTGV+H+ + + +    L  E   +YVW+   F  AM GK+P  ++TD+D +
Sbjct  325  QYDMIFAPFTGVNHHLQSVFYGAAFLANEKIPAYVWLFKTFLRAMGGKAPTLIITDEDAS  384

Query  191  MK  196
            MK
Sbjct  385  MK  386



>ref|XP_004304830.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=540

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RYSL+F P   ++++ + ++F    L+ E T S+VW+L  F +AM G +P  ++TDQDP 
Sbjct  267  RYSLIFAPLMRINNHGQTVVFGAAFLSDETTYSFVWLLKEFLNAMPGGAPKMIITDQDPA  326

Query  191  MK  196
            M+
Sbjct  327  ME  328



>ref|XP_002456500.1| hypothetical protein SORBIDRAFT_03g037423 [Sorghum bicolor]
 gb|EES01620.1| hypothetical protein SORBIDRAFT_03g037423 [Sorghum bicolor]
Length=625

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  255  RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  314

Query  191  MK--IYKLHISITH  226
            MK  I ++  S TH
Sbjct  315  MKAAIAQVFPSTTH  328



>ref|XP_002467387.1| hypothetical protein SORBIDRAFT_01g026910 [Sorghum bicolor]
 gb|EER94385.1| hypothetical protein SORBIDRAFT_01g026910 [Sorghum bicolor]
Length=558

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + +      L  E  ESYVW+L  F  AMG  +P  + TD+D +
Sbjct  235  QYNMKFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLLKTFLKAMGGVAPHLITTDEDAS  294

Query  191  M  193
            M
Sbjct  295  M  295



>gb|EEE57540.1| hypothetical protein OsJ_07864 [Oryza sativa Japonica Group]
Length=805

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++F PFTGV+H+ + + +    L  E   +YVW+   F  AM GK+P  ++TD+D +
Sbjct  325  QYDMIFAPFTGVNHHLQSVFYGAAFLANEKIPAYVWLFKTFLRAMGGKAPTLIITDEDAS  384

Query  191  MK  196
            MK
Sbjct  385  MK  386



>ref|XP_002460160.1| hypothetical protein SORBIDRAFT_02g023634 [Sorghum bicolor]
 gb|EER96681.1| hypothetical protein SORBIDRAFT_02g023634 [Sorghum bicolor]
Length=625

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  255  RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  314

Query  191  MK--IYKLHISITH  226
            MK  I ++  S TH
Sbjct  315  MKAAIAQVFPSTTH  328



>ref|XP_008245177.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=720

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F P  GV+++ + I+ A   L++E TES++W+   FK AM G  P  ++TDQD  
Sbjct  236  RYDLTFAPMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAA  295

Query  191  M  193
            M
Sbjct  296  M  296



>ref|XP_010914593.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=802

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            R+ + F PF G++H+K+ ++F   LL  E TES+VW+   F DAM GK P  + TD
Sbjct  378  RFDIPFAPFIGINHHKQIVIFGAALLLDETTESFVWLFKTFLDAMSGKQPKTIFTD  433



>gb|EAZ09297.1| hypothetical protein OsI_31570 [Oryza sativa Indica Group]
Length=427

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+++F+PFTGV+H+ + +      L  E  ESYVW+   F  AM G +P  ++TD+D +
Sbjct  144  QYNMIFVPFTGVNHHLQSVFLGATFLANEKIESYVWLFKTFLKAMRGVAPHLIITDEDMS  203

Query  191  MK  196
            MK
Sbjct  204  MK  205



>ref|XP_009360548.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
 ref|XP_009360549.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
 ref|XP_009360550.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=712

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+K  ++F   LL  E   +++W+   + +AM G+ P  ++TD DPT
Sbjct  313  QYKMPFAPFTGVNHHKHSVLFGCALLADESESTFIWLFTTWLEAMSGRQPGLIITDYDPT  372

Query  191  M  193
            +
Sbjct  373  I  373



>ref|XP_002445435.1| hypothetical protein SORBIDRAFT_07g019155 [Sorghum bicolor]
 gb|EES14930.1| hypothetical protein SORBIDRAFT_07g019155 [Sorghum bicolor]
Length=728

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  306  RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  365

Query  191  MK  196
            MK
Sbjct  366  MK  367



>gb|AAL58182.1|AC027037_4 putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=721

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L F+PF G +H++  ++F  G+L+ E   SYVW+L    +AM  K P  ++TD D +
Sbjct  254  RYNLPFVPFVGANHHRSTVIFGCGILSNESVSSYVWLLQTLLEAMHQKHPKSLITDGDAS  313

Query  191  M  193
            M
Sbjct  314  M  314



>ref|XP_008348691.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=588

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  29   FLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTMK  196
            F PF GV+H+ + I+   GL++REDT+S++W+   +   M G +P  ++TDQD  MK
Sbjct  3    FAPFVGVNHHGQSILLGCGLISREDTDSFIWLFKTWLACMSGHAPCGIITDQDKAMK  59



>ref|XP_004980514.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=888

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY + F P  G++++ + I+    LL  E TE++VWVL R K+AM G  P  ++TDQD  
Sbjct  415  RYDMPFAPIVGINNHLQSILLGCALLPDETTETFVWVLERLKEAMGGHEPTNIMTDQDKA  474

Query  191  MK  196
            MK
Sbjct  475  MK  476



>ref|XP_004305654.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=226

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTG++H+ + I F   LL  E   +++W+   + +AM G+ P C++TDQD  
Sbjct  92   KYDMPFAPFTGLNHHFQSIQFGCALLQDETESTFLWLFETWLEAMGGRHPLCIITDQDLA  151

Query  191  MK--IYKLHISITH  226
            MK  I K+  + +H
Sbjct  152  MKGAIAKIFPTASH  165



>gb|AAF66982.1| transposase [Zea mays]
Length=709

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y++ F PFTGV+H+ + + F    L  E  ESY W+   F  AM GK+P  ++TD+D +
Sbjct  255  QYNMRFAPFTGVNHHMQRVFFGAAFLANEKIESYEWLFRTFLVAMGGKAPRLIITDEDAS  314

Query  191  MK  196
            +K
Sbjct  315  IK  316



>gb|EAZ03765.1| hypothetical protein OsI_25894 [Oryza sativa Indica Group]
Length=379

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+L F P  GV ++ + ++F    L  E  E++ WV   F  AM GK P C++TDQD T
Sbjct  243  KYNLPFAPIIGVSNHGQTVLFGCVFLKNEKVETFEWVFETFLKAMDGKEPQCIMTDQDKT  302

Query  191  MKI  199
            M+I
Sbjct  303  MEI  305



>dbj|BAB33151.1| hypothetical protein [Carthamus tinctorius]
Length=699

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKSP*CVVTDQDPTM  193
            +++++F+PF  VD++K+ ++    L+ +E+ + + WVL  F  A G  P  V+TDQ P M
Sbjct  284  KHAMIFVPFVAVDNHKKSVVVGAALIRKENADYFTWVLNAFVKAHGSLPKLVITDQCPAM  343

Query  194  K  196
            K
Sbjct  344  K  344



>ref|XP_006645669.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
Length=704

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            YS+   PF GV H++  I F   LL  ED  ++ W+   + +AM GK P  ++TDQDP M
Sbjct  241  YSMPLAPFLGVSHHRHTISFGWALLRLEDAPNFCWLFKTWLEAMYGKHPSAIITDQDPAM  300

Query  194  K  196
            K
Sbjct  301  K  301



>ref|XP_010681467.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=518

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    L++ ED E+Y WV   +   M GK+P C +TDQD  M
Sbjct  324  YALPFANFVGVNHHGQSILLGCALVSHEDAETYTWVFSTWVKCMGGKAPNCFLTDQDAAM  383

Query  194  K  196
            +
Sbjct  384  R  384



>ref|XP_010678300.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=662

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    +++ ED ESY WV   +   M GK+P C +TDQD  M
Sbjct  162  YALPFANFVGVNHHGQSILLGCAVISHEDAESYTWVFSTWVKCMGGKAPNCFLTDQDAAM  221

Query  194  K  196
            +
Sbjct  222  R  222



>ref|XP_006649180.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like [Oryza brachyantha]
Length=772

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            YS+   PF GV H++  I F   LL  ED  ++ W+   + +AM GK P  ++TDQDP M
Sbjct  309  YSMPLAPFLGVSHHRHTISFGWALLRLEDAPNFCWLFKTWLEAMYGKHPSAIITDQDPAM  368

Query  194  K  196
            K
Sbjct  369  K  369



>ref|XP_010495230.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=519

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TESY W+   F  AM GK P  ++TDQ   M
Sbjct  41   YDRPFAPFVGVNHHKQTVVFGAALLYDETTESYKWLFETFLGAMSGKQPKTILTDQSAAM  100



>ref|XP_010695837.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Beta vulgaris 
subsp. vulgaris]
Length=813

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    L++ ED E+Y WV   +   M GK+P C +TDQD  M
Sbjct  399  YALPFANFVGVNHHGQSILLGCALVSHEDAETYTWVFSTWVKCMGGKAPNCFLTDQDAAM  458

Query  194  K  196
            +
Sbjct  459  R  459



>ref|XP_002458237.1| hypothetical protein SORBIDRAFT_03g029595 [Sorghum bicolor]
 gb|EES03357.1| hypothetical protein SORBIDRAFT_03g029595 [Sorghum bicolor]
Length=681

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  
Sbjct  306  RYNMPFAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRA  365

Query  191  MK  196
            MK
Sbjct  366  MK  367



>ref|XP_010941828.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=533

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY + F+P  G+DH+ + I+F G LL  E  ES+ WV   +  AM GK P  ++TDQ+  
Sbjct  406  RYGMPFVPIIGIDHHYQTIIFGGALLFDEREESFAWVFSTWMKAMEGKRPKVILTDQESA  465

Query  191  M  193
            +
Sbjct  466  I  466



>ref|XP_004289552.1| PREDICTED: protein FAR1-RELATED SEQUENCE 8-like [Fragaria vesca 
subsp. vesca]
Length=336

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PF GV+H+ + I+   GLL  E T S++W+   +K  M GKSP  ++TDQ   
Sbjct  261  KYDMPFAPFVGVNHHGQSILLGCGLLCDETTMSFIWLYEEWKKCMKGKSPNAIITDQCAA  320

Query  191  MK  196
            MK
Sbjct  321  MK  322



>ref|XP_010677702.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Beta vulgaris 
subsp. vulgaris]
Length=738

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    L++ ED E+Y WV   +   M GK+P C +TDQD  M
Sbjct  324  YALPFANFVGVNHHGQSILLGCALVSHEDAETYTWVFSTWVKCMGGKAPNCFLTDQDAAM  383

Query  194  K  196
            +
Sbjct  384  R  384



>ref|XP_004292126.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=488

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            YSL+F P  GV+++ + I+ A   L  E T+S+ W    F  AM G +P  ++TDQDP M
Sbjct  253  YSLIFAPLVGVNNHGQTIILACAFLNNETTDSFTWFFKEFLKAMSGDAPRMIITDQDPAM  312



>gb|AAX94831.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1023

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+L F+PF GV+H+   ++FA  +++ E  E+Y WVL +F   M  K P  V+TD D  
Sbjct  815  KYNLPFIPFVGVNHHGSTVIFACAVVSDERVETYEWVLRQFLTCMCQKHPKSVITDGDNA  874

Query  191  MKIYKLHI  214
            M+   LH+
Sbjct  875  MRRAILHV  882



>gb|AAX92763.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
 gb|ABA91508.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1185

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+L F+PF GV+H+   ++FA  +++ E  E+Y WVL +F   M  K P  V+TD D  
Sbjct  815  KYNLPFIPFVGVNHHGSTVIFACAVVSDERVETYEWVLRQFLTCMCQKHPKSVITDGDNA  874

Query  191  MKIYKLHI  214
            M+   LH+
Sbjct  875  MRRAILHV  882



>ref|XP_008362165.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial [Malus 
domestica]
Length=403

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+K  ++F   LL  E   +++W+   + +AM G+ P  ++TD DP 
Sbjct  4    QYKMPFAPFTGVNHHKHSVLFGCALLADESESTFIWLFTTWLEAMSGRQPGLIITDYDPA  63

Query  191  M  193
            +
Sbjct  64   I  64



>ref|XP_010695505.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=825

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    L++ ED E+Y WV   +   M GK+P C +TDQD  M
Sbjct  324  YALPFANFVGVNHHGQSILLGCALVSHEDAETYTWVFSTWVKCMGGKAPNCFLTDQDAAM  383

Query  194  K  196
            +
Sbjct  384  R  384



>ref|XP_002444124.1| hypothetical protein SORBIDRAFT_07g008830 [Sorghum bicolor]
 gb|EES13619.1| hypothetical protein SORBIDRAFT_07g008830 [Sorghum bicolor]
Length=331

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV H+ + +      L  E  ESYVW+   F  AMG  +P  + TD+D +
Sbjct  77   QYNMKFVPFTGVSHHLQSVFLGAAFLANEKIESYVWLFKTFLKAMGGVAPQLITTDEDAS  136

Query  191  M  193
            M
Sbjct  137  M  137



>ref|XP_010685186.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    L++ ED ESY WV   +   M GK+P C +TDQD  M
Sbjct  322  YALPFANFVGVNHHGQSILLGCALISHEDAESYTWVFSTWVKCMGGKAPNCFLTDQDAAM  381

Query  194  K  196
            +
Sbjct  382  R  382



>ref|XP_010696346.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=319

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRF-KDAMGKSP*CVVTDQDPTM  193
            Y L F  F GV+H+ + I+    LL+ ED E+Y WV   + K   GK+P C +TDQD  M
Sbjct  243  YELPFANFVGVNHHGQSILLGCALLSHEDVETYSWVFSTWLKCKGGKAPQCFLTDQDAAM  302

Query  194  K  196
            +
Sbjct  303  R  303



>ref|XP_002464221.1| hypothetical protein SORBIDRAFT_01g014380 [Sorghum bicolor]
 gb|EER91219.1| hypothetical protein SORBIDRAFT_01g014380 [Sorghum bicolor]
Length=539

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL  E T+++VWVL   KDAMG  +P  ++TDQD  
Sbjct  157  RYNMHFAPIVGINNHAQSIILGCALLPDETTKTFVWVLQTLKDAMGGIAPTNIMTDQDRA  216

Query  191  MK  196
            MK
Sbjct  217  MK  218



>ref|XP_007216405.1| hypothetical protein PRUPE_ppa022645mg [Prunus persica]
 gb|EMJ17604.1| hypothetical protein PRUPE_ppa022645mg [Prunus persica]
Length=556

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  29   FLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            F PF G++H+K+ ++F   LL  E  ESY W+   F +AM GK P  ++TDQD  M
Sbjct  237  FTPFIGINHHKQMLIFGAALLYDESVESYKWLFQTFLEAMSGKKPKTILTDQDALM  292



>ref|XP_008238369.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=416

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY ++F P  GV+++++ ++F    LT E T+S+VW+L  FK AM G+ P  ++TDQ   
Sbjct  40   RYRMVFAPLLGVNNHRQTVLFGCAFLTSETTDSFVWLLEEFKKAMPGEPPKMIITDQYAA  99

Query  191  M  193
            M
Sbjct  100  M  100



>ref|XP_008230452.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like [Prunus mume]
 ref|XP_008230453.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like [Prunus mume]
Length=843

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  29   FLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            F PF G++H+K+ ++F   LL  E  ESY W+   F +AM GK P  ++TDQD  M
Sbjct  524  FTPFIGINHHKQMLIFGAALLYDESVESYKWLFQTFLEAMSGKKPKTILTDQDALM  579



>gb|ABD33026.2| Cyclin-like F-box; FAR1; Zinc finger, SWIM-type [Medicago truncatula]
Length=1116

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PF GV+H+ + ++    LL+ EDT+++ W+   + + M G++P  ++TDQD  
Sbjct  582  KYDMPFAPFVGVNHHGQSVLLGCALLSNEDTKTFSWLFKTWLECMHGRAPNAIITDQDRA  641

Query  191  MK  196
            MK
Sbjct  642  MK  643



>ref|XP_006281824.1| hypothetical protein CARUB_v10028009mg [Capsella rubella]
 gb|EOA14722.1| hypothetical protein CARUB_v10028009mg [Capsella rubella]
Length=809

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ I+F   LL  E TESY W+   F  AM GK P  ++TDQ   M
Sbjct  322  YDRPFAPFVGVNHHKQTIVFGAALLYDETTESYKWLFETFLGAMSGKQPKTILTDQCAAM  381



>ref|XP_008368438.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
 ref|XP_008368439.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=712

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+K  ++F   LL  E   +++W+   + +AM G+ P  ++TD DP 
Sbjct  313  QYKMPFAPFTGVNHHKHSVLFGCALLADESESTFIWLFTTWLEAMSGRQPGLIITDYDPA  372

Query  191  M  193
            +
Sbjct  373  I  373



>ref|XP_010930749.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=813

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  29   FLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTMK  196
            F PF GV+H+K+ ++F   L+  E  ES+ W+   FK AM GK P  ++TDQ+P ++
Sbjct  422  FSPFYGVNHHKQIVIFGAALIYDETKESFRWLFETFKTAMYGKQPRVILTDQNPLIR  478



>ref|XP_006603498.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Glycine max]
Length=550

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y   F+ F+ V+H+ + I+FA  ++T E  E+YVW+L +F +AM GK+P  ++TD D  
Sbjct  304  KYLCPFVVFSSVNHHNQTIVFAAAIVTDETEETYVWLLEQFLEAMKGKAPSSIITDGDLA  363

Query  191  MK--IYKLHISITH  226
            M+  I ++  S+ H
Sbjct  364  MRNAITRVMPSVFH  377



>gb|KCW63993.1| hypothetical protein EUGRSUZ_G01680 [Eucalyptus grandis]
Length=543

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L+  PF GV+H+ + I+F   LL  E  ES++W+   F  +MG K+P  + TDQD  
Sbjct  32   RYNLICAPFVGVNHHWKNILFGCALLLDETAESFIWLFEVFLKSMGNKAPKTIFTDQDQA  91

Query  191  M  193
            M
Sbjct  92   M  92



>ref|XP_008227250.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Prunus 
mume]
Length=544

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L+F P  GV+++ + I+ A   L++E TES+VW+  +FK+AM G  P  ++T+ +  
Sbjct  87   RYGLVFAPLIGVNNHGQTIILACAFLSKETTESFVWLFDQFKNAMPGPPPKMIITNHEAA  146

Query  191  M  193
            M
Sbjct  147  M  147



>ref|XP_008227249.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Prunus 
mume]
Length=562

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L+F P  GV+++ + I+ A   L++E TES+VW+  +FK+AM G  P  ++T+ +  
Sbjct  87   RYGLVFAPLIGVNNHGQTIILACAFLSKETTESFVWLFDQFKNAMPGPPPKMIITNHEAA  146

Query  191  M  193
            M
Sbjct  147  M  147



>ref|XP_006487498.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Citrus sinensis]
Length=372

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKS-P*CVVTDQDPT  190
            +Y + F PF GV+H+   I+F  GL++ ED E++ W+   +   M  S P  ++TDQD  
Sbjct  251  KYDMPFAPFVGVNHHGHSILFGCGLISHEDIETFTWLFRTWLSCMSNSAPNGIITDQDRA  310

Query  191  MKI  199
            MK+
Sbjct  311  MKV  313



>ref|XP_009416288.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Musa acuminata 
subsp. malaccensis]
Length=688

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 44/65 (68%), Gaps = 3/65 (5%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y L F+ F G++H+ + ++F  GL++ EDTE++VW+  ++   M G +P  V+TDQD  
Sbjct  277  KYDLPFVTFVGINHHGQPLLFGCGLVSGEDTETFVWLFKQWLACMSGNAPKAVITDQD--  334

Query  191  MKIYK  205
            M I+K
Sbjct  335  MAIHK  339



>ref|XP_010684967.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Beta vulgaris 
subsp. vulgaris]
Length=797

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    L++ ED E+Y WV   +   M GK+P C +TDQD  M
Sbjct  450  YALPFANFVGVNHHGQSILLGCALVSHEDAETYTWVFSTWVKCMGGKAPNCFLTDQDAAM  509

Query  194  K  196
            +
Sbjct  510  R  510



>ref|XP_006484349.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Citrus sinensis]
Length=754

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/63 (37%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y + F PF GV+H+   I+F  GL++ ED E++ W+   +   M   +P  ++TDQD  
Sbjct  251  KYDMPFAPFVGVNHHGHSILFGCGLISHEDIETFTWLFRTWLSCMSNLAPNGIITDQDRA  310

Query  191  MKI  199
            MK+
Sbjct  311  MKV  313



>ref|XP_010684977.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=587

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPTM  193
            Y+L F  F GV+H+ + I+    L++ ED E+Y WV   +   MG K+P C +TDQD  M
Sbjct  86   YALPFANFVGVNHHGQSILLGCALVSHEDAETYTWVFSTWVKCMGDKAPNCFLTDQDAAM  145

Query  194  K  196
            +
Sbjct  146  R  146



>ref|XP_008679530.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008679531.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=384

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+++F PFTGV+H+ + + F    +  E  ESY W+      AM GK+P  ++T +D +
Sbjct  227  QYNMIFAPFTGVNHHMKSVFFGAAFIANEKIESYEWLFRTSLSAMGGKAPRSIITYEDAS  286

Query  191  MK  196
            MK
Sbjct  287  MK  288



>dbj|BAD10392.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD09065.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=690

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+L F+PF GV+H+   I+FA  ++  E   +Y WVL RF D M  K P  ++TD D +
Sbjct  229  KYNLPFIPFVGVNHHGSTIIFACAIVADEKIATYEWVLKRFLDCMCQKHPKGLITDSDNS  288

Query  191  MK  196
            M+
Sbjct  289  MR  290



>gb|KHN16236.1| Protein FAR1-RELATED SEQUENCE 5 [Glycine soja]
Length=560

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y   F+ F+ V+H+ + I+FA  ++T E  E+YVW+L +F +AM GK+P  ++TD D  
Sbjct  241  KYLCPFVVFSSVNHHNQTIVFAAAIVTDETKETYVWLLEQFLEAMKGKAPSSIITDGDLA  300

Query  191  MK  196
            M+
Sbjct  301  MR  302



>ref|XP_008653248.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Zea 
mays]
Length=528

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            ++ + F P  G +H+K+ I+F   LL  E  ES+VW+   F  AM GK P  + TDQD  
Sbjct  20   KFEMPFAPLLGTNHHKQTIIFGAALLFNETIESFVWLFQTFLKAMSGKHPSTIFTDQDAA  79

Query  191  M  193
            M
Sbjct  80   M  80



>ref|XP_008227658.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=571

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/62 (34%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y + F PF G++H+++ I+   GL++ EDT++++W+   +   M + +P  ++TDQD  
Sbjct  228  KYDMSFAPFVGLNHHRQSILLGCGLISSEDTDAFIWLFKSWLACMHEHAPRGIITDQDKA  287

Query  191  MK  196
            MK
Sbjct  288  MK  289



>ref|XP_002453665.1| hypothetical protein SORBIDRAFT_04g010080 [Sorghum bicolor]
 gb|EES06641.1| hypothetical protein SORBIDRAFT_04g010080 [Sorghum bicolor]
Length=591

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY + F+PF G++H++   +F  G++  E  +SY+WVL  F  AM  K P  V+TD D +
Sbjct  133  RYKMPFVPFVGLNHHRNTTVFGCGIICDERADSYIWVLQAFLKAMCQKKPQSVITDGDYS  192

Query  191  M  193
            M
Sbjct  193  M  193



>ref|XP_010233328.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=308

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y+L F+PF G++H+   ++F  G+++ E +ESY W+L  F  AM  K P  V+T+ D  
Sbjct  109  KYNLPFVPFVGLNHHHSTVVFGCGIISHETSESYKWMLRTFSTAMAQKHPISVITNGDLA  168

Query  191  MK  196
            M+
Sbjct  169  MQ  170



>ref|XP_002456061.1| hypothetical protein SORBIDRAFT_03g029670 [Sorghum bicolor]
 gb|EES01181.1| hypothetical protein SORBIDRAFT_03g029670 [Sorghum bicolor]
Length=549

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY + F+PF G++H++   +F  G++  E  +SY+WVL  F  AM  K P  V+TD D +
Sbjct  111  RYKMPFVPFVGLNHHRNTTVFGCGIICDERADSYIWVLQAFLKAMCQKKPQSVITDGDYS  170

Query  191  M  193
            M
Sbjct  171  M  171



>ref|XP_004309932.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=454

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQ  181
            +Y ++F P TGV+H+ + I+F  GLL+ E TES++W+L ++  AM    P  ++TDQ
Sbjct  91   KYRMIFAPITGVNHHGQTIVFGCGLLSDEKTESFIWLLEQWLKAMPSGPPKVIITDQ  147



>ref|XP_010245238.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
 ref|XP_010245239.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
 ref|XP_010245240.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=731

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  11   CRYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQD  184
            CRY L F+P  GV+H+ + ++F   LL  E  ES+VW+L  +   M G+ P  ++TDQ+
Sbjct  299  CRYGLPFVPIVGVNHHYQTVLFGSALLFDETEESFVWLLETWMKTMGGQQPKVILTDQE  357



>ref|XP_004289266.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=481

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+ + I F   LL  E   +++W+   + +AM G+ P C++ DQD  
Sbjct  294  KYDMPFAPFTGVNHHFQSIQFGCALLQDETESTFLWLFETWLEAMGGRHPLCIIIDQDLA  353

Query  191  MK  196
            MK
Sbjct  354  MK  355



>ref|XP_010690587.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Beta vulgaris subsp. 
vulgaris]
Length=778

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F PFTGV+H+ + ++F    L  E   S+VW+   + +AM GK P  + TD D T
Sbjct  294  RYRLPFAPFTGVNHHGQPVLFGCAFLINESESSFVWLFNTWLEAMSGKHPLSITTDYDAT  353

Query  191  MK  196
            ++
Sbjct  354  IR  355



>ref|XP_009103778.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=429

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+   F  AM GK P  ++TDQ   M
Sbjct  67   YDRPFAPFVGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPRTILTDQSAAM  126



>ref|XP_004305996.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Fragaria 
vesca subsp. vesca]
Length=413

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            YSL+F P  GV+++ + I+ A   L+ E T S+ W    F  AM G +P  ++TDQDP M
Sbjct  34   YSLIFAPLVGVNNHGQTIILACAFLSNETTGSFTWFFKEFLKAMPGDAPRMIITDQDPAM  93



>ref|XP_009116658.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Brassica 
rapa]
Length=867

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+   F  AM GK P  ++TDQ   M
Sbjct  317  YDRPFAPFVGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAM  376



>ref|XP_009116657.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Brassica 
rapa]
Length=897

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+   F  AM GK P  ++TDQ   M
Sbjct  317  YDRPFAPFVGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAM  376



>ref|XP_006406281.1| hypothetical protein EUTSA_v10021958mg, partial [Eutrema salsugineum]
 gb|ESQ47734.1| hypothetical protein EUTSA_v10021958mg, partial [Eutrema salsugineum]
Length=573

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+   F  AM GK P  ++TDQ   M
Sbjct  218  YDRPFAPFIGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAM  277



>ref|XP_008236671.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=542

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F P  GV+++ + I+ A   L++E TE ++W+   FK AM G  P  ++TDQD  
Sbjct  97   RYGLPFAPMLGVNNHGQTIILACAFLSKETTELFIWMFEEFKKAMPGGEPKMIITDQDAA  156

Query  191  M  193
            M
Sbjct  157  M  157



>ref|XP_007199084.1| hypothetical protein PRUPE_ppa019160mg, partial [Prunus persica]
 gb|EMJ00283.1| hypothetical protein PRUPE_ppa019160mg, partial [Prunus persica]
Length=662

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PF GV+H+   I+   GL++ EDT+++VW+   +   M G +P  ++TDQD  
Sbjct  259  KYDMPFAPFVGVNHHGHSILLGCGLISSEDTDTFVWLFKVWLACMSGLAPCGIITDQDRA  318

Query  191  MK  196
            MK
Sbjct  319  MK  320



>ref|XP_006598514.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Glycine max]
Length=383

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y   F+ F+GV+H+ + I+F   ++T E  E+YVW L +F +AM GK+P  ++TD D  
Sbjct  118  KYLFPFVVFSGVNHHNQTIVFGTAIMTDETEETYVWFLEKFLEAMKGKTPCSIITDGDLA  177

Query  191  MK  196
            ++
Sbjct  178  IR  179



>ref|XP_006406280.1| hypothetical protein EUTSA_v10022007mg, partial [Eutrema salsugineum]
 gb|ESQ47733.1| hypothetical protein EUTSA_v10022007mg, partial [Eutrema salsugineum]
Length=685

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+   F  AM GK P  ++TDQ   M
Sbjct  214  YDRPFAPFIGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAM  273



>ref|XP_008373411.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like [Malus domestica]
Length=883

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKSP*C-VVTDQDPT  190
            +Y + F PFTGV+H+ + ++F   LL  E   S++W+   F  AM  SP   ++TDQD T
Sbjct  287  QYRVPFAPFTGVNHHGQTVLFGCALLLDESEASFIWLFKTFLTAMNDSPPVSIMTDQDRT  346

Query  191  MKI  199
            ++I
Sbjct  347  IQI  349



>ref|XP_004963627.1| PREDICTED: uncharacterized protein LOC101779982 [Setaria italica]
Length=1006

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L F+PF GV+H++  ++F  G+L+ E   SYVW+L    +AM  K P  ++TD D  
Sbjct  255  RYNLPFVPFIGVNHHRSTVVFGCGILSDETILSYVWLLEALLEAMHQKHPKSLITDGDAA  314

Query  191  M  193
            M
Sbjct  315  M  315



>ref|XP_010259175.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=819

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+K+ ++F   LL  E   ++VW+   + +AM G+ P  ++TD D  
Sbjct  315  QYKMPFAPFTGVNHHKQSVLFGCALLADETESTFVWLFKTWLEAMSGRQPDLIITDHDLA  374

Query  191  MK  196
            +K
Sbjct  375  IK  376



>ref|XP_007214218.1| hypothetical protein PRUPE_ppa023217mg [Prunus persica]
 gb|EMJ15417.1| hypothetical protein PRUPE_ppa023217mg [Prunus persica]
Length=734

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y + F PF GV+H+ + I+   GL++ EDT++++W+   +   M + +P  ++TDQD  
Sbjct  274  KYDMPFAPFVGVNHHGQSILLGCGLISSEDTDAFIWLFKSWLTCMHEHAPRGIITDQDKA  333

Query  191  MK  196
            MK
Sbjct  334  MK  335



>ref|XP_010259163.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259169.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
Length=826

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+K+ ++F   LL  E   ++VW+   + +AM G+ P  ++TD D  
Sbjct  322  QYKMPFAPFTGVNHHKQSVLFGCALLADETESTFVWLFKTWLEAMSGRQPDLIITDHDLA  381

Query  191  MK  196
            +K
Sbjct  382  IK  383



>ref|XP_010468694.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=693

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TESY W+   F  AM GK P  ++ DQ   M
Sbjct  258  YDRPFAPFVGVNHHKQTVVFGAALLYDETTESYKWLFETFLGAMSGKQPKTILNDQSAAM  317



>ref|XP_010259180.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Nelumbo 
nucifera]
 ref|XP_010259184.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Nelumbo 
nucifera]
Length=807

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+K+ ++F   LL  E   ++VW+   + +AM G+ P  ++TD D  
Sbjct  303  QYKMPFAPFTGVNHHKQSVLFGCALLADETESTFVWLFKTWLEAMSGRQPDLIITDHDLA  362

Query  191  MK  196
            +K
Sbjct  363  IK  364



>gb|EEC74573.1| hypothetical protein OsI_10136 [Oryza sativa Indica Group]
Length=1025

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + +      L  E  ES+VW+   F  A G  +P  ++TD+D +
Sbjct  887  QYNMKFVPFTGVNHHLQSVFLGASFLADEKIESFVWLFQTFLKATGGVAPRLIITDEDAS  946

Query  191  MK  196
            MK
Sbjct  947  MK  948



>ref|XP_008658616.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Zea 
mays]
Length=853

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            ++ + F P  G +H+K+ I+F   LL  E  ES+VW+   F  AM GK P  + TDQD  
Sbjct  317  KFEMPFAPLLGTNHHKQTIVFGAALLFNETIESFVWLFQTFLTAMSGKHPSTIFTDQDAA  376

Query  191  M  193
            M
Sbjct  377  M  377



>ref|XP_008658611.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Zea 
mays]
Length=854

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            ++ + F P  G +H+K+ I+F   LL  E  ES+VW+   F  AM GK P  + TDQD  
Sbjct  318  KFEMPFAPLLGTNHHKQTIVFGAALLFNETIESFVWLFQTFLTAMSGKHPSTIFTDQDAA  377

Query  191  M  193
            M
Sbjct  378  M  378



>ref|XP_010236847.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Brachypodium 
distachyon]
Length=748

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +YS+ F PF GV+H+   ++   GLL+ EDTE+++W+   +   M  K+P  ++TDQ   
Sbjct  269  KYSMPFAPFVGVNHHGESVLLGCGLLSNEDTETFIWLFKSWLCCMSNKAPNAIITDQCKA  328

Query  191  MK  196
            M+
Sbjct  329  MQ  330



>ref|XP_010234002.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Brachypodium 
distachyon]
Length=380

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            R+ + F PF G +H+K+ I+F   LL  E +ES++W+   F +AM GK P  + TD
Sbjct  301  RFEMPFAPFVGTNHHKQTILFGAALLYDESSESFLWLFQTFLNAMSGKQPATIFTD  356



>ref|NP_001175190.1| Os07g0461700 [Oryza sativa Japonica Group]
 dbj|BAH93918.1| Os07g0461700 [Oryza sativa Japonica Group]
Length=603

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y+L F P  GV ++ + ++F    L  E  E++ WV   F  AM GK P C++TDQD T
Sbjct  325  KYNLPFAPIIGVSNHGQTVLFGCVFLKNEKIETFEWVFETFLKAMDGKEPQCIMTDQDKT  384

Query  191  MKI  199
            M+I
Sbjct  385  MEI  387



>ref|XP_010259189.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X4 [Nelumbo 
nucifera]
Length=794

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F PFTGV+H+K+ ++F   LL  E   ++VW+   + +AM G+ P  ++TD D  
Sbjct  322  QYKMPFAPFTGVNHHKQSVLFGCALLADETESTFVWLFKTWLEAMSGRQPDLIITDHDLA  381

Query  191  MK  196
            +K
Sbjct  382  IK  383



>ref|XP_009123544.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=355

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
             Y   F PF GV+H+K+ ++F   LL  E TES+ W+   F  AM GK P  ++TDQ   
Sbjct  69   EYDRPFAPFVGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAA  128

Query  191  M  193
            M
Sbjct  129  M  129



>gb|EEE63447.1| hypothetical protein OsJ_18260 [Oryza sativa Japonica Group]
Length=748

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + +      L  E  ES+VW+   F  A G  +P  ++TD+D +
Sbjct  338  QYNMKFVPFTGVNHHLQSVFLGASFLADEKIESFVWLFQTFLKATGGVAPRLIITDEDAS  397

Query  191  MK  196
            MK
Sbjct  398  MK  399



>ref|XP_004231427.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Solanum lycopersicum]
Length=400

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F+PFTGV+++ + I+F   LL  E  E++ W+L  +++AM G SP  ++TDQD  
Sbjct  279  KYKMPFVPFTGVNNHHQSILFGCSLLWDETEETFQWLLHTWQEAMFGISPRTIITDQDAA  338

Query  191  M  193
            +
Sbjct  339  I  339



>ref|XP_002455464.1| hypothetical protein SORBIDRAFT_03g011230 [Sorghum bicolor]
 gb|EES00584.1| hypothetical protein SORBIDRAFT_03g011230 [Sorghum bicolor]
Length=540

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            RY++ F P  G++++ + I+    LL+ E TE++V VL   KDAMG  +P  ++TDQD  
Sbjct  100  RYNIPFAPIVGINNHAQSILLGCALLSDETTETFVRVLQTLKDAMGGIAPTNIMTDQDRA  159

Query  191  MK--IYKLHISITH  226
            MK  I ++  S TH
Sbjct  160  MKAAIAQVFPSTTH  173



>gb|KCW73521.1| hypothetical protein EUGRSUZ_E02037 [Eucalyptus grandis]
Length=571

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L+  PF GV H+ + I+F   LL  E  ES++W+   F  +MG K+P  + TDQD  
Sbjct  32   RYNLICAPFVGVSHHWKNILFGCALLLDETIESFIWLFEVFLKSMGNKAPKTIFTDQDQA  91

Query  191  M  193
            M
Sbjct  92   M  92



>ref|XP_010268007.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=695

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = +2

Query  29   FLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDP  187
            F PF GV+H+K+ I F   L+  +  ES+ WV   F  AM GK P  ++TD DP
Sbjct  300  FAPFVGVNHHKQTIFFGAALMYDQSVESFKWVFHSFLKAMSGKQPKTILTDHDP  353



>ref|XP_010233182.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=483

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            RY+L F+PF GV+H++  I+F  G+++ E   S+ W+L  F +AM  K+P  V+TD D  
Sbjct  253  RYNLPFVPFIGVNHHRSTIVFGVGIVSDETVSSHEWLLQSFLEAMSHKNPRSVITDGDAA  312

Query  191  MK  196
             +
Sbjct  313  TR  314



>ref|XP_004980305.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=712

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y + F P  G++++   I+    +L  E TE++VWVL R K AM G+ P  ++TDQD  M
Sbjct  323  YDMPFAPIVGINNHLHSILLGCAMLPDETTETFVWVLERLKGAMGGREPTNIMTDQDKAM  382

Query  194  K  196
            K
Sbjct  383  K  383



>dbj|BAJ06700.1| unnamed protein product [Solanum lycopersicum]
Length=524

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F+PFTGV+++ + I+F   LL  E  E++ W+L  +++AM G SP  ++TDQD  
Sbjct  58   KYKMSFVPFTGVNNHHQSILFGCSLLWDETEETFQWLLHTWQEAMFGISPRTIITDQDAA  117

Query  191  M  193
            +
Sbjct  118  I  118



>gb|AAV31356.1| hypothetical protein [Oryza sativa Japonica Group]
Length=896

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + +      L  E  ES+VW+   F  A G  +P  ++TD+D +
Sbjct  338  QYNMKFVPFTGVNHHLQSVFLGASFLADEKIESFVWLFQTFLKATGGVAPRLIITDEDAS  397

Query  191  MK  196
            MK
Sbjct  398  MK  399



>ref|XP_002443950.1| hypothetical protein SORBIDRAFT_07g004960 [Sorghum bicolor]
 gb|EES13445.1| hypothetical protein SORBIDRAFT_07g004960 [Sorghum bicolor]
Length=414

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + +      L  E  ES+VW+   F  A G  +P  ++TD+D +
Sbjct  236  QYNMKFVPFTGVNHHLQSVFLGAAFLADEKIESFVWLFQTFLKANGGVAPHLIITDEDAS  295

Query  191  MK  196
            MK
Sbjct  296  MK  297



>dbj|BAJ06701.1| unnamed protein product [Solanum lycopersicum]
Length=524

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F+PFTGV+++ + I+F   LL  E  E++ W+L  +++AM G SP  ++TDQD  
Sbjct  58   KYKMSFVPFTGVNNHHQSILFGCSLLWDETEETFQWLLHTWQEAMFGISPRTIITDQDAA  117

Query  191  M  193
            +
Sbjct  118  I  118



>ref|XP_009406927.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Musa acuminata 
subsp. malaccensis]
Length=687

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            ++ + ++ F GV+H+   I+F  GL++ EDTE+YVW L ++   M G +P  ++TDQD  
Sbjct  276  KHDMPYVTFVGVNHHGLPILFGCGLVSGEDTETYVWFLTQWLACMCGNAPKAIITDQDMA  335

Query  191  MK  196
            M+
Sbjct  336  MR  337



>ref|XP_008784343.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
Length=733

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF GV+H+K+ I+F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  327  YGRPFAPFLGVNHHKQIIIFGAALLYGETTESFKWLLETFKLAMHGKQPKTILTD  381



>ref|XP_010421147.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=323

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E  ESY W+   F  AM GK P  ++TDQ   M
Sbjct  41   YDRPFAPFLGVNHHKQTVVFGAALLYDETKESYKWLFETFLGAMSGKQPKTILTDQSAAM  100



>ref|XP_008784344.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Phoenix 
dactylifera]
Length=703

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF GV+H+K+ I+F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  297  YGRPFAPFLGVNHHKQIIIFGAALLYGETTESFKWLLETFKLAMHGKQPKTILTD  351



>ref|XP_004959040.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=328

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 34/62 (55%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L F PF GV  +    MF    ++ E T S+ W+   F  +M GK P  ++TDQD  
Sbjct  210  RYNLPFAPFVGVTRHGHTCMFGCAFISDESTLSFAWIFETFLKSMGGKQPKTIITDQDKA  269

Query  191  MK  196
            MK
Sbjct  270  MK  271



>ref|XP_004966891.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=415

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L F+PF GV+H++  ++F  G+L+ E   SYVW+L    +AM  K P  ++TD D  
Sbjct  255  RYNLPFVPFIGVNHHRSTVVFGCGILSDETILSYVWLLEALLEAMHQKHPKSLITDGDAA  314

Query  191  M  193
            M
Sbjct  315  M  315



>gb|AAS79743.1| putative Mutator-like transposase [Oryza sativa Japonica Group]
Length=1510

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14    RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
             +Y++ F+PFTGV+H+ + +      L  E  ES+VW+   F  A G  +P  ++TD+D +
Sbjct  947   QYNMKFVPFTGVNHHLQSVFLGASFLADEKIESFVWLFQTFLKATGGVAPRLIITDEDAS  1006

Query  191   MK  196
             MK
Sbjct  1007  MK  1008



>ref|XP_004980265.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=511

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L F+PF GV+H++  ++F  G+L+ E   SYVW+L    +AM  K P  ++TD D  
Sbjct  323  RYNLPFVPFIGVNHHRSTVVFGCGILSDETILSYVWLLEALLEAMHQKHPKSLITDGDAA  382

Query  191  M  193
            M
Sbjct  383  M  383



>ref|XP_010229941.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like [Brachypodium 
distachyon]
Length=419

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY + F+PF G++++++  +F   +++ E  E+YVW+L  F  AM  K P  V+TD D +
Sbjct  114  RYGMPFIPFVGLNNHRKTTVFGCAIVSDEPEETYVWLLQTFLRAMCQKKPKAVITDGDAS  173

Query  191  M--KIYKLHISITH  226
            M   I  +HI + H
Sbjct  174  MIRAIGAVHIGVWH  187



>ref|XP_010418903.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=539

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E TESY W+   F  AM  K P  + TDQ   M
Sbjct  248  YDRPFAPFVGVNHHKKTVVFGAALLYDETTESYKWLFETFLGAMSRKQPKTIFTDQSAAM  307



>ref|XP_004967127.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=771

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            ++ + F PF G +H+K+ I+F   LL  E   S+VW+   F  AM GK P  + TDQD  
Sbjct  300  KFEMPFAPFLGTNHHKQTIIFGAALLFDETIPSFVWLFETFLTAMSGKHPSTIFTDQDAA  359

Query  191  M  193
            M
Sbjct  360  M  360



>ref|XP_008784345.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Phoenix 
dactylifera]
Length=691

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF GV+H+K+ I+F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  327  YGRPFAPFLGVNHHKQIIIFGAALLYGETTESFKWLLETFKLAMHGKQPKTILTD  381



>ref|XP_010687444.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F  F GV+H+++ I     L++ E+TE+Y WV   +   M GKSP  ++TDQD  M
Sbjct  285  YELPFANFVGVNHHRQSIFLGCALISHENTETYEWVFSTWLSCMGGKSPMGILTDQDAAM  344

Query  194  K  196
            +
Sbjct  345  R  345



>ref|XP_004977727.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=850

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            ++ + F PF G +H+K+ I+F   LL  E   S+VW+   F  AM GK P  + TDQD  
Sbjct  325  KFEMPFAPFLGTNHHKQTIIFGAALLFDETIPSFVWLFETFLTAMSGKHPSTIFTDQDAA  384

Query  191  M  193
            M
Sbjct  385  M  385



>dbj|BAJ06702.1| unnamed protein product [Solanum lycopersicum]
Length=718

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y + F+PFTGV+++ + I+F   LL  E  E++ W+L  +++AM G SP  ++TDQD  
Sbjct  252  KYKMPFVPFTGVNNHHQSILFGCSLLWDETKETFQWLLHTWQEAMFGISPRTIITDQDAA  311

Query  191  M  193
            +
Sbjct  312  I  312



>ref|XP_008792844.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Phoenix 
dactylifera]
Length=675

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  270  YGRPFAPFLGVNHHKQIVIFGAALLYDETTESFKWLLETFKLAMHGKQPKTILTD  324



>ref|XP_010227160.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=612

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y ++F PFTGV+H+ + + F    L  E  ESYVW+   F  A+G  +P  ++TD+  +
Sbjct  234  QYDMIFAPFTGVNHHLQSVFFGAAFLLNEKAESYVWLFKTFLRAIGGVAPKLIITDEAGS  293

Query  191  MK  196
            +K
Sbjct  294  IK  295



>ref|XP_008792843.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Phoenix 
dactylifera]
Length=702

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  317  YGRPFAPFLGVNHHKQIVIFGAALLYDETTESFKWLLETFKLAMHGKQPKTILTD  371



>ref|XP_008792840.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792841.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
Length=722

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF GV+H+K+ ++F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  317  YGRPFAPFLGVNHHKQIVIFGAALLYDETTESFKWLLETFKLAMHGKQPKTILTD  371



>ref|XP_009133360.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Brassica rapa]
Length=767

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F PFTGV+H+ + I+F    +  E+  S+VW+   +  AM G+SP  + TD D  
Sbjct  287  RYRLPFAPFTGVNHHGQPILFGCAFIVNENEASFVWLFKTWLSAMSGRSPVSITTDHDAV  346

Query  191  MK  196
            ++
Sbjct  347  IR  348



>gb|KDP24914.1| hypothetical protein JCGZ_24292 [Jatropha curcas]
Length=808

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F PFTGV+H+ + ++F   LL  E  ES++W+   +  AM G+ P  + TD D  
Sbjct  325  RYRLPFAPFTGVNHHGQPVLFGCALLINESEESFIWLFKTWLVAMSGRPPVSITTDHDRV  384

Query  191  MKI  199
            +++
Sbjct  385  IRL  387



>ref|XP_010246487.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
 ref|XP_010246488.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=262

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = +2

Query  26   MFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTMK  196
            +F  F GV+H+K+ ++F   LL  E  ES+ WV   F  AM GK P  ++  QD TM+
Sbjct  182  LFATFIGVNHHKKIVIFGAALLYDESIESFTWVFQSFLKAMSGKQPKTILIGQDSTME  239



>ref|XP_004986319.1| PREDICTED: uncharacterized protein LOC101759074 [Setaria italica]
Length=1036

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L F+PF GV+H++  ++F  G+L+ E   SYVW+L    +AM  K P  ++TD D  
Sbjct  285  RYNLPFVPFIGVNHHRSTVVFGCGILSDETILSYVWLLEALLEAMHQKHPKSLITDGDAA  344

Query  191  M  193
            M
Sbjct  345  M  345



>ref|XP_009405914.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405915.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405916.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405918.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
Length=864

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ I+F   +L  E  ES+ W+   FKDAM GK P  ++T Q   M
Sbjct  465  YGRPFAPFIGVNHHKQAIIFGAAMLYDETEESFKWLFQTFKDAMNGKQPKVILTGQSKMM  524



>gb|AAX92857.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
 gb|ABA92606.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1106

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY++ F PF GV+++ +   F   LL  E  ES+ W+   FKD M GK P  ++TD  P+
Sbjct  601  RYNMPFAPFVGVNNHFQSTFFGCALLREETKESFAWLFETFKDCMNGKEPIGILTDNCPS  660

Query  191  M  193
            M
Sbjct  661  M  661



>ref|XP_006655317.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
 ref|XP_006658608.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
Length=729

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y++ F+PFTGV+H+ + +      L  E  ES+VW+   F  A G   P  ++TD+D +
Sbjct  325  QYNMKFVPFTGVNHHLQSVFLGAAFLADEKIESFVWLFQTFLKATGGVVPRLIITDEDAS  384

Query  191  MK  196
            MK
Sbjct  385  MK  386



>ref|XP_006655826.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Oryza 
brachyantha]
Length=762

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQD  184
            +YSL+  PF GV+H+ + I+F    L  E + SYVW+   F ++M G+SP  + TDQD
Sbjct  272  KYSLVCAPFVGVNHHWQNIVFGWAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQD  329



>ref|XP_010045143.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X3 [Eucalyptus 
grandis]
Length=795

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y + F PFTGV+H+ + I+F   LL  +   S++W+   F  AMG ++P  ++TDQD  
Sbjct  280  QYRVPFAPFTGVNHHGQTILFGCALLLDDSEASFIWLFKTFLTAMGDRAPISIITDQDRV  339

Query  191  MK  196
            ++
Sbjct  340  IQ  341



>ref|XP_006655825.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Oryza 
brachyantha]
Length=779

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQD  184
            +YSL+  PF GV+H+ + I+F    L  E + SYVW+   F ++M G+SP  + TDQD
Sbjct  272  KYSLVCAPFVGVNHHWQNIVFGWAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQD  329



>ref|XP_009618370.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X3 
[Nicotiana tomentosiformis]
 ref|XP_009618371.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X3 
[Nicotiana tomentosiformis]
Length=797

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  336  YKLRFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDKTL  395

Query  194  K  196
            +
Sbjct  396  E  396



>ref|XP_010045142.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X2 [Eucalyptus 
grandis]
Length=835

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y + F PFTGV+H+ + I+F   LL  +   S++W+   F  AMG ++P  ++TDQD  
Sbjct  280  QYRVPFAPFTGVNHHGQTILFGCALLLDDSEASFIWLFKTFLTAMGDRAPISIITDQDRV  339

Query  191  MK  196
            ++
Sbjct  340  IQ  341



>ref|XP_010045140.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010045141.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X1 [Eucalyptus 
grandis]
Length=860

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y + F PFTGV+H+ + I+F   LL  +   S++W+   F  AMG ++P  ++TDQD  
Sbjct  280  QYRVPFAPFTGVNHHGQTILFGCALLLDDSEASFIWLFKTFLTAMGDRAPISIITDQDRV  339

Query  191  MK  196
            ++
Sbjct  340  IQ  341



>gb|EEC80083.1| hypothetical protein OsI_21811 [Oryza sativa Indica Group]
Length=819

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQD  184
            +YSL+  PF GV+H+ + I+F    L  E + SYVW+   F ++M G+SP  + TDQD
Sbjct  272  KYSLVCAPFVGVNHHWQNIVFGCAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQD  329



>ref|XP_006388581.1| hypothetical protein POPTR_0149s00230g [Populus trichocarpa]
 gb|ERP47495.1| hypothetical protein POPTR_0149s00230g [Populus trichocarpa]
Length=625

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y ++  PF G++H+++ +MF    L  E  ES+VW+   F +AMG K P  +VTD++  
Sbjct  241  KYEMICAPFWGLNHHRQYVMFGCAFLLDESKESFVWLFETFLEAMGRKQPKTIVTDENQV  300

Query  191  M  193
            M
Sbjct  301  M  301



>ref|NP_001056912.1| Os06g0166100 [Oryza sativa Japonica Group]
 dbj|BAD67598.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD67861.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAF18826.1| Os06g0166100 [Oryza sativa Japonica Group]
Length=780

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQD  184
            +YSL+  PF GV+H+ + I+F    L  E + SYVW+   F ++M G+SP  + TDQD
Sbjct  272  KYSLVCAPFVGVNHHWQNIVFGCAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQD  329



>ref|XP_009618373.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X5 
[Nicotiana tomentosiformis]
Length=776

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  336  YKLRFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDKTL  395

Query  194  K  196
            +
Sbjct  396  E  396



>ref|XP_009618372.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X4 
[Nicotiana tomentosiformis]
Length=778

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  336  YKLRFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDKTL  395

Query  194  K  196
            +
Sbjct  396  E  396



>ref|XP_006373793.1| hypothetical protein POPTR_0016s05920g, partial [Populus trichocarpa]
 gb|ERP51590.1| hypothetical protein POPTR_0016s05920g, partial [Populus trichocarpa]
Length=607

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y ++  PF G++H+++ +MF    L  E  ES+VW+   F +AMG K P  +VTD++  
Sbjct  236  KYDMICAPFWGLNHHRQYVMFGCAFLLDESKESFVWLFETFLEAMGRKQPKTIVTDENQV  295

Query  191  M  193
            M
Sbjct  296  M  296



>ref|XP_002460267.1| hypothetical protein SORBIDRAFT_02g025670 [Sorghum bicolor]
 gb|EER96788.1| hypothetical protein SORBIDRAFT_02g025670 [Sorghum bicolor]
Length=610

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY + F PF G++H++   +F  G++  E  +SY+WVL  F  AM  K P  V+TD D +
Sbjct  140  RYKMPFDPFVGLNHHRNTTVFGCGIICDERADSYIWVLQAFLKAMCQKKPQSVITDGDYS  199

Query  191  M  193
            M
Sbjct  200  M  200



>gb|EEE65156.1| hypothetical protein OsJ_20251 [Oryza sativa Japonica Group]
Length=792

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQD  184
            +YSL+  PF GV+H+ + I+F    L  E + SYVW+   F ++M G+SP  + TDQD
Sbjct  272  KYSLVCAPFVGVNHHWQNIVFGCAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQD  329



>ref|XP_010685516.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3 [Beta vulgaris subsp. 
vulgaris]
Length=881

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPT  190
            +Y + F PFTGV+H+ + I+F   LL  +   S+VW+L  F  AM  + P  +VTDQD  
Sbjct  288  QYKVQFAPFTGVNHHGQTILFGCALLLDDSEASFVWLLRTFLTAMNDRPPVSIVTDQDRA  347

Query  191  MK  196
            ++
Sbjct  348  IQ  349



>ref|XP_008781580.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Phoenix dactylifera]
Length=706

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  29   FLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTMK  196
            F  F GV+H+K+ ++F   L+  E  ES++W+   FK AM GK P  ++TDQ+P ++
Sbjct  420  FTLFYGVNHHKQTVIFGAALIYDETKESFMWLFETFKTAMYGKQPQVILTDQNPLIR  476



>ref|XP_009618369.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=847

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  336  YKLRFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDKTL  395

Query  194  K  196
            +
Sbjct  396  E  396



>ref|XP_009618368.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=849

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  336  YKLRFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDKTL  395

Query  194  K  196
            +
Sbjct  396  E  396



>emb|CAE02528.2| OSJNBb0003A12.15 [Oryza sativa Japonica Group]
Length=525

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y+L F+PF GV+H++   +F  G+L+ E   SY W+L  F +AM +  P  ++TD D  
Sbjct  232  KYNLPFIPFIGVNHHRSTTIFGCGILSNESVNSYYWLLETFLEAMRQVHPKSLITDGDLA  291

Query  191  MKIYKLHISITHF  229
            M      + I H 
Sbjct  292  MANAISKLCIQHL  304



>ref|XP_004496070.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Cicer arietinum]
Length=766

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/62 (34%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y +   P  GV+H+ + I+    +L+ EDTE++ W+  R+ + M G +P  ++TD+D  
Sbjct  263  KYDMPLTPLVGVNHHGQSILLGCAILSNEDTETFTWLFTRWLECMFGHAPNAIITDEDKE  322

Query  191  MK  196
            MK
Sbjct  323  MK  324



>ref|XP_010672835.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F  F GV+H+ + I+    L++ E+TE+Y WV   +   M GKSP  ++TDQD  M
Sbjct  283  YELPFANFVGVNHHGQSILLGCALISHENTETYEWVFSTWLSCMGGKSPMGILTDQDAAM  342

Query  194  K  196
            +
Sbjct  343  R  343



>ref|XP_002467137.1| hypothetical protein SORBIDRAFT_01g020250 [Sorghum bicolor]
 gb|EER94135.1| hypothetical protein SORBIDRAFT_01g020250 [Sorghum bicolor]
Length=496

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (61%), Gaps = 3/69 (4%)
 Frame = +2

Query  29   FLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPTMK--I  199
            F P  G++++ + I+    LL  E TE++VWVL   KDAMG  +P  ++TDQD  MK  I
Sbjct  3    FAPIVGINNHAQSILLGCALLPDETTETFVWVLQTLKDAMGGIAPTNIMTDQDRAMKAAI  62

Query  200  YKLHISITH  226
             ++  S TH
Sbjct  63   AQVFPSTTH  71



>ref|XP_007022953.1| FAR1-related sequence 5-like protein [Theobroma cacao]
 gb|EOY25575.1| FAR1-related sequence 5-like protein [Theobroma cacao]
Length=312

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDA-MGKSP*CVVTDQDPTM  193
            ++L  L F GV+H+    +FA  LLT ED ESY+W L  F +  M K P  VV D D  M
Sbjct  219  FNLPLLVFIGVNHHHMTTIFALALLTNEDAESYIWALTTFLECMMNKKPISVVIDGDRAM  278

Query  194  K  196
            +
Sbjct  279  R  279



>ref|XP_006591712.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Glycine max]
Length=661

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y   F+ F+GV+H+ + I+FA  ++T E  E+YVW+L +   AM GK+P  ++TD D  
Sbjct  162  KYLCPFVVFSGVNHHNQTIVFAAAIVTDETEETYVWLLEQLLVAMKGKAPCSIITDGDLA  221

Query  191  MK  196
            M+
Sbjct  222  MR  223



>ref|XP_010056981.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Eucalyptus grandis]
Length=824

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPTM  193
            Y+L+  PF GV+H+ + I+F   LL  E  ES++W+   F  +MG K+P  + TDQD  M
Sbjct  257  YNLICAPFVGVNHHWKNILFGCALLLDETAESFIWLFEVFLKSMGNKAPKTIFTDQDQAM  316



>gb|EYU41087.1| hypothetical protein MIMGU_mgv1a020432mg [Erythranthe guttata]
Length=609

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM  148
            YS+ F+PFTGV+H+ + +MF   LL  E T SYVW+L  + +AM
Sbjct  242  YSMPFVPFTGVNHHHQSVMFGCALLVNETTSSYVWLLRTWLEAM  285



>gb|KCW73916.1| hypothetical protein EUGRSUZ_E02501 [Eucalyptus grandis]
 gb|KCW73917.1| hypothetical protein EUGRSUZ_E02501 [Eucalyptus grandis]
Length=600

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMG-KSP*CVVTDQDPTM  193
            Y+L+  PF GV+H+ + I+F   LL  E  ES++W+   F  +MG K+P  + TDQD  M
Sbjct  33   YNLICAPFVGVNHHWKNILFGCALLLDETAESFIWLFEVFLKSMGNKAPKTIFTDQDQAM  92



>dbj|BAD29488.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD29601.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=688

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y+L F+PF GV+H++   +F  G+L+ E   SY W+L  F +AM +  P  ++TD D  
Sbjct  252  KYNLPFIPFIGVNHHRSTTIFGCGILSNESVNSYCWLLETFLEAMRQVHPKSLITDGDLA  311

Query  191  M  193
            M
Sbjct  312  M  312



>ref|XP_002446625.1| hypothetical protein SORBIDRAFT_06g019085 [Sorghum bicolor]
 gb|EES10953.1| hypothetical protein SORBIDRAFT_06g019085 [Sorghum bicolor]
Length=343

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY + F+PF G++H++   +F  G++  E  +SYVWVL  F  AM  K P  V TD D +
Sbjct  135  RYKMPFVPFVGLNHHRNTTVFGCGIICDERADSYVWVLQAFLKAMCQKKPQSVTTDGDYS  194

Query  191  M  193
            M
Sbjct  195  M  195



>ref|XP_010257333.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010257334.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010257335.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=767

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +2

Query  38   FTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            F GV+H+K+ I+F G LL  E TES+ W+L  F  AM GK P  ++TDQ   M
Sbjct  282  FVGVNHHKQSIVFGGALLYDETTESFEWLLHTFVKAMSGKMPRTIITDQGAAM  334



>gb|ABA98678.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=744

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y++ F+PF G++H+++  +FA G+++ E  ESY W L  F  AM  + P  ++TD D  
Sbjct  298  KYNMPFIPFVGLNHHRQTTIFACGIVSDECVESYTWFLQVFLRAMCQQKPRSIITDSDNA  357

Query  191  M  193
            M
Sbjct  358  M  358



>ref|XP_009397785.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
Length=876

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F  FTGV+H+K+ ++F   LL  E TES  W+   FK AM GK P  ++TD+ P +
Sbjct  461  YGRPFALFTGVNHHKQTVIFGAALLYDESTESLKWLFESFKTAMSGKQPKTILTDRSPVI  520



>emb|CAD40514.2| OSJNBa0050F15.2 [Oryza sativa Japonica Group]
Length=688

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGK-SP*CVVTDQDPT  190
            +Y+L F+PF GV+H++   +F  G+L+ E   SY W+L  F +AM +  P  ++TD D  
Sbjct  252  KYNLPFIPFIGVNHHRSTTIFGCGILSNESVNSYCWLLETFLEAMRQVHPKSLITDGDLA  311

Query  191  M  193
            M
Sbjct  312  M  312



>ref|XP_003561049.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like [Brachypodium 
distachyon]
Length=761

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQD  184
            +YSL+  PF GV+H+   I+F    L  + T SYVW+   F ++M G+SP  + TDQD
Sbjct  266  KYSLICAPFVGVNHHWHNIVFGCAFLLDDSTASYVWLFKSFLESMGGRSPKSIFTDQD  323



>ref|XP_009772395.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X11 
[Nicotiana sylvestris]
Length=846

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_009772389.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X10 
[Nicotiana sylvestris]
Length=848

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_009772385.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X9 
[Nicotiana sylvestris]
Length=851

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_010675047.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y ++  PF G++HN + +MF  G +  E T S++W+   F  +M GK P  ++TDQ  +
Sbjct  191  KYDMICGPFVGMNHNNKNVMFGIGFILNEKTVSFIWLFNTFLKSMSGKHPVTIMTDQSAS  250

Query  191  M  193
            M
Sbjct  251  M  251



>ref|XP_009772379.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X8 
[Nicotiana sylvestris]
Length=853

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_010507064.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=684

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E  ESY W+   F  AM GK P  ++TDQ   M
Sbjct  275  YDRPFAPFVGVNHHKQTVVFGAALLYDETIESYKWLFETFLGAMSGKQPKTILTDQCAAM  334



>ref|XP_009365699.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like [Pyrus x bretschneideri]
Length=883

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAMGKSP*C-VVTDQDPT  190
            +Y + F PFTGV+H+ + ++F   LL  E   S++W+   F  AM  SP   ++TDQD T
Sbjct  287  QYRVPFAPFTGVNHHGQTVLFGCALLLDESEASFIWLFKTFLTAMNDSPPVSIMTDQDRT  346

Query  191  MK  196
            ++
Sbjct  347  IQ  348



>ref|XP_010665920.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=478

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F  F GV+H+ + I+    L++ E+TE+Y WV   +   M GKSP  ++TDQD  M
Sbjct  327  YELPFANFVGVNHHGQSILLGCALISHENTETYEWVFSTWLSCMGGKSPMGILTDQDAAM  386

Query  194  K  196
            +
Sbjct  387  R  387



>ref|XP_010932383.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Elaeis 
guineensis]
Length=644

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF G++H+K+ ++F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  238  YGRPFAPFLGMNHHKQIVIFGAALLYSETTESFKWLLETFKLAMHGKQPKTILTD  292



>ref|XP_010277380.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X1 [Nelumbo 
nucifera]
Length=867

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 34/61 (56%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y   F PF GV+H+K   +F  GLL  E  ESY+W+   +  AM G  P  ++T QD  
Sbjct  342  KYKFPFAPFIGVNHHKHSTLFGCGLLADESVESYIWLFETWLRAMSGCQPASIITYQDKA  401

Query  191  M  193
            M
Sbjct  402  M  402



>ref|XP_010277381.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010277382.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010277383.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010277384.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010277385.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X2 [Nelumbo 
nucifera]
Length=857

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 34/61 (56%), Gaps = 1/61 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            +Y   F PF GV+H+K   +F  GLL  E  ESY+W+   +  AM G  P  ++T QD  
Sbjct  332  KYKFPFAPFIGVNHHKHSTLFGCGLLADESVESYIWLFETWLRAMSGCQPASIITYQDKA  391

Query  191  M  193
            M
Sbjct  392  M  392



>ref|XP_003538916.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Glycine max]
Length=790

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY L F PFTGV+H+ + ++F   LL  E   S+VW+   + +AM G+ P  + TD D  
Sbjct  308  RYRLPFAPFTGVNHHGQPVLFGCALLINESEASFVWLFKTWLEAMTGQPPVSITTDHDRV  367

Query  191  MK  196
            ++
Sbjct  368  IR  369



>ref|XP_010456530.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=761

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 1/60 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y   F PF GV+H+K+ ++F   LL  E  ESY W+   F  AM GK P  ++TDQ   M
Sbjct  275  YDRPFAPFVGVNHHKQTVVFGAALLYDETIESYKWLFETFLGAMSGKQPKTILTDQCAAM  334



>dbj|BAD19318.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=880

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   RYSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPT  190
            RY+L F+PF GV+H+   I+F   ++  E   +Y W+L +F D M  K P  ++TD D  
Sbjct  295  RYNLPFIPFVGVNHHGSTIIFGCAIVADEKVATYEWILKQFLDCMYQKHPRALITDGDNA  354

Query  191  MK  196
            M+
Sbjct  355  MR  356



>ref|XP_009772402.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X12 
[Nicotiana sylvestris]
Length=815

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_010932381.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010932382.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Elaeis 
guineensis]
Length=739

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTD  178
            Y   F PF G++H+K+ ++F   LL  E TES+ W+L  FK AM GK P  ++TD
Sbjct  333  YGRPFAPFLGMNHHKQIVIFGAALLYSETTESFKWLLETFKLAMHGKQPKTILTD  387



>ref|XP_009772373.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X7 
[Nicotiana sylvestris]
Length=856

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_009772359.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X6 
[Nicotiana sylvestris]
 ref|XP_009772368.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X6 
[Nicotiana sylvestris]
Length=857

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_009772355.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X5 
[Nicotiana sylvestris]
Length=858

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_009772350.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X4 
[Nicotiana sylvestris]
Length=863

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  322  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  381

Query  194  K  196
            +
Sbjct  382  E  382



>ref|XP_009772343.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X3 
[Nicotiana sylvestris]
Length=882

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



>ref|XP_009772337.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X2 
[Nicotiana sylvestris]
Length=883

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  17   YSLMFLPFTGVDHNKRCIMFAGGLLTREDTESYVWVLGRFKDAM-GKSP*CVVTDQDPTM  193
            Y L F+PF GV+H+ + I+   GL+  E   ++VW++  +  AM G++P  ++TDQD T+
Sbjct  343  YKLHFVPFIGVNHHCQSILLGCGLIANESKSTFVWLMRAWLRAMGGQAPKVILTDQDNTL  402

Query  194  K  196
            +
Sbjct  403  E  403



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512861740020