BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11481_g1_i2 len=505 path=[109:0-436 108:437-504]

Length=505
                                                                      Score     E

gb|AAK91877.1|AC091665_3  Putative copia-type polyprotein               192   2e-58   Oryza sativa [red rice]
dbj|BAD45248.1|  Zinc knuckle containing protein-like                   187   1e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01490.1|  P0041A24.2                                             197   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449567.1|  hypothetical protein SORBIDRAFT_05g019135          184   7e-54   Sorghum bicolor [broomcorn]
ref|XP_002446279.1|  hypothetical protein SORBIDRAFT_06g012571          182   6e-53   Sorghum bicolor [broomcorn]
ref|XP_002442483.1|  hypothetical protein SORBIDRAFT_08g020705          181   1e-52   Sorghum bicolor [broomcorn]
gb|AAT77826.1|  putative Zinc knuckle containing protein                183   3e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05263.2|  OSJNBb0115I09.25                                       188   7e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446503.1|  hypothetical protein SORBIDRAFT_06g017035          179   1e-51   Sorghum bicolor [broomcorn]
gb|AAT77830.1|  putative zinc knuckle containing protein                185   3e-51   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96902.1|  retrotransposon protein, putative, Ty1-copia subc...    183   1e-49   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85780.1|  zinc knuckle domain containing protein                  182   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010511862.1|  PREDICTED: uncharacterized protein LOC104787903    174   1e-49   
ref|XP_002467660.1|  hypothetical protein SORBIDRAFT_01g031795          171   1e-48   Sorghum bicolor [broomcorn]
dbj|BAF36297.1|  hypothetical protein                                   170   1e-48   Ipomoea trifida
ref|XP_009628840.1|  PREDICTED: uncharacterized protein LOC104119122    166   8e-48   
ref|XP_010494165.1|  PREDICTED: uncharacterized protein LOC104771345    168   2e-47   
ref|XP_010478690.1|  PREDICTED: uncharacterized protein LOC104757635    168   2e-47   
gb|EAZ11596.1|  hypothetical protein OsJ_01460                          166   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010693880.1|  PREDICTED: uncharacterized protein LOC104906778    164   3e-47   
ref|XP_010466947.1|  PREDICTED: uncharacterized protein LOC104747075    167   5e-47   
ref|XP_009764303.1|  PREDICTED: uncharacterized protein LOC104216046    162   1e-46   
emb|CAN77377.1|  hypothetical protein VITISV_020255                     164   1e-46   Vitis vinifera
ref|XP_011100848.1|  PREDICTED: uncharacterized protein LOC105178961    160   1e-46   
ref|XP_010695582.1|  PREDICTED: uncharacterized protein LOC104908191    164   2e-46   
ref|XP_010681193.1|  PREDICTED: uncharacterized protein LOC104896173    163   2e-46   
ref|XP_008778764.1|  PREDICTED: uncharacterized protein LOC103698516    160   2e-46   
ref|XP_004231476.1|  PREDICTED: uncharacterized protein LOC101254546    165   2e-46   
ref|XP_010673154.1|  PREDICTED: uncharacterized protein LOC104889594    163   3e-46   
ref|XP_010478536.1|  PREDICTED: uncharacterized protein LOC104757488    164   3e-46   
ref|XP_010677767.1|  PREDICTED: uncharacterized protein LOC104893370    162   3e-46   
ref|XP_009798432.1|  PREDICTED: uncharacterized protein LOC104244660    165   4e-46   
ref|XP_010491896.1|  PREDICTED: uncharacterized protein LOC104769391    164   6e-46   
ref|XP_010451435.1|  PREDICTED: uncharacterized protein LOC104733564    164   8e-46   
ref|XP_010466886.1|  PREDICTED: uncharacterized protein LOC104747019    164   8e-46   
ref|XP_010434008.1|  PREDICTED: uncharacterized protein LOC104718045    164   8e-46   
ref|XP_010317354.1|  PREDICTED: uncharacterized protein LOC104646059    162   1e-45   
ref|XP_011070180.1|  PREDICTED: uncharacterized protein LOC105155895    158   1e-45   
ref|XP_010684163.1|  PREDICTED: uncharacterized protein LOC104898758    164   1e-45   
ref|XP_010695630.1|  PREDICTED: uncharacterized protein LOC104908233    164   1e-45   
ref|XP_010694402.1|  PREDICTED: uncharacterized protein LOC104907206    164   1e-45   
ref|XP_010445368.1|  PREDICTED: uncharacterized protein LOC104728024    163   1e-45   
ref|XP_010667383.1|  PREDICTED: uncharacterized protein LOC104884...    164   2e-45   
gb|AAK84482.1|  unknown                                                 162   4e-45   Solanum lycopersicum
ref|XP_010456707.1|  PREDICTED: uncharacterized protein LOC104738191    162   4e-45   
ref|XP_004251340.1|  PREDICTED: uncharacterized protein LOC101250662    161   5e-45   
ref|XP_009104473.1|  PREDICTED: uncharacterized protein LOC103830446    161   7e-45   
ref|XP_010673982.1|  PREDICTED: uncharacterized protein LOC104890258    162   7e-45   
ref|XP_010322038.1|  PREDICTED: uncharacterized protein LOC104647892    161   7e-45   
ref|XP_009763091.1|  PREDICTED: uncharacterized protein LOC104215050    158   8e-45   
ref|XP_010685542.1|  PREDICTED: uncharacterized protein LOC104899944    161   9e-45   
ref|XP_010541843.1|  PREDICTED: uncharacterized protein LOC104815...    161   9e-45   
ref|XP_009599254.1|  PREDICTED: uncharacterized protein LOC104094937    160   1e-44   
ref|XP_010671935.1|  PREDICTED: keratin, type I cytoskeletal 9-like     161   1e-44   
ref|XP_010312898.1|  PREDICTED: uncharacterized protein LOC104644539    161   1e-44   
ref|XP_009626992.1|  PREDICTED: uncharacterized protein LOC104117623    157   1e-44   
ref|XP_004235099.1|  PREDICTED: uncharacterized protein LOC101249439    161   1e-44   
ref|XP_009586969.1|  PREDICTED: uncharacterized protein LOC104084730    157   2e-44   
ref|XP_004252118.1|  PREDICTED: uncharacterized protein LOC101264598    161   2e-44   
ref|XP_009798929.1|  PREDICTED: uncharacterized protein LOC104245073    160   2e-44   
ref|XP_010541842.1|  PREDICTED: uncharacterized protein LOC104815...    161   2e-44   
ref|XP_011079447.1|  PREDICTED: uncharacterized protein LOC105162964    158   2e-44   
ref|XP_008391278.1|  PREDICTED: uncharacterized protein LOC103453518    155   3e-44   
emb|CAN82314.1|  hypothetical protein VITISV_015643                     159   3e-44   Vitis vinifera
ref|XP_011075270.1|  PREDICTED: uncharacterized protein LOC105159783    156   4e-44   
ref|XP_009613067.1|  PREDICTED: uncharacterized protein LOC104106268    159   4e-44   
ref|XP_009615854.1|  PREDICTED: uncharacterized protein LOC104108500    156   6e-44   
gb|KCW64414.1|  hypothetical protein EUGRSUZ_G02034                     159   6e-44   
ref|XP_010682012.1|  PREDICTED: uncharacterized protein LOC104896921    158   1e-43   
ref|XP_009789585.1|  PREDICTED: uncharacterized protein LOC104237180    159   1e-43   
ref|XP_004231307.1|  PREDICTED: uncharacterized protein LOC101251134    158   2e-43   
ref|XP_010678303.1|  PREDICTED: uncharacterized protein LOC104893872    158   2e-43   
ref|XP_004233677.1|  PREDICTED: uncharacterized protein LOC101243760    157   3e-43   
ref|XP_009601014.1|  PREDICTED: uncharacterized protein LOC104096354    153   5e-43   
emb|CAN60947.1|  hypothetical protein VITISV_015758                     164   6e-43   Vitis vinifera
ref|XP_004245367.1|  PREDICTED: uncharacterized protein LOC101261349    159   6e-43   
ref|XP_010540305.1|  PREDICTED: uncharacterized protein LOC104814122    156   7e-43   
emb|CAN77974.1|  hypothetical protein VITISV_006175                     164   7e-43   Vitis vinifera
ref|XP_009121262.1|  PREDICTED: uncharacterized protein LOC103846095    155   1e-42   
ref|XP_009145335.1|  PREDICTED: uncharacterized protein LOC103869047    154   2e-42   
ref|XP_011076490.1|  PREDICTED: uncharacterized protein LOC105160709    156   2e-42   
emb|CAN77859.1|  hypothetical protein VITISV_005455                     155   2e-42   Vitis vinifera
ref|XP_008342091.1|  PREDICTED: uncharacterized protein LOC103404905    153   3e-42   
emb|CAN66814.1|  hypothetical protein VITISV_041767                     152   4e-42   Vitis vinifera
emb|CAN66208.1|  hypothetical protein VITISV_035070                     161   6e-42   Vitis vinifera
gb|KEH22941.1|  Copia-like polyprotein/retrotransposon, putative        149   6e-42   
ref|XP_008392734.1|  PREDICTED: uncharacterized protein LOC103454916    149   8e-42   
ref|XP_009607502.1|  PREDICTED: uncharacterized protein LOC104101709    148   1e-41   
ref|XP_009610481.1|  PREDICTED: uncharacterized protein LOC104104178    149   1e-41   
ref|XP_009593720.1|  PREDICTED: uncharacterized protein LOC104090362    152   1e-41   
ref|XP_009774472.1|  PREDICTED: uncharacterized protein LOC104224495    150   2e-41   
ref|XP_004252419.1|  PREDICTED: uncharacterized protein LOC101248177    152   2e-41   
ref|XP_004240332.1|  PREDICTED: uncharacterized protein LOC101255496    152   2e-41   
ref|XP_004234725.1|  PREDICTED: uncharacterized protein LOC101246320    151   2e-41   
ref|XP_009759843.1|  PREDICTED: uncharacterized protein LOC104212322    150   3e-41   
ref|XP_008346258.1|  PREDICTED: uncharacterized protein LOC103409222    147   3e-41   
ref|XP_004231656.1|  PREDICTED: uncharacterized protein LOC101250848    150   3e-41   
ref|XP_011074126.1|  PREDICTED: uncharacterized protein LOC105158908    149   4e-41   
ref|XP_010687096.1|  PREDICTED: uncharacterized protein LOC104901243    152   4e-41   
ref|XP_004252451.2|  PREDICTED: uncharacterized protein LOC101250381    150   4e-41   
gb|AAU89218.1|  integrase core domain containing protein                158   5e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009138172.1|  PREDICTED: uncharacterized protein LOC103862225    151   6e-41   
ref|XP_009630496.1|  PREDICTED: uncharacterized protein LOC104120439    147   1e-40   
emb|CAN61562.1|  hypothetical protein VITISV_039565                     156   3e-40   Vitis vinifera
gb|KCW80868.1|  hypothetical protein EUGRSUZ_C02227                     149   3e-40   
dbj|BAD46193.1|  zinc knuckle domain containing protein-like            145   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004239523.1|  PREDICTED: uncharacterized protein LOC101245254    143   7e-40   
ref|XP_002455742.1|  hypothetical protein SORBIDRAFT_03g023756          146   8e-40   Sorghum bicolor [broomcorn]
emb|CAN63894.1|  hypothetical protein VITISV_037389                     144   1e-39   Vitis vinifera
ref|XP_002445322.1|  hypothetical protein SORBIDRAFT_07g009380          147   1e-39   Sorghum bicolor [broomcorn]
ref|XP_004251351.1|  PREDICTED: uncharacterized protein LOC101255763    147   1e-39   
ref|XP_010681471.1|  PREDICTED: uncharacterized protein LOC104896419    142   2e-39   
ref|XP_008366158.1|  PREDICTED: uncharacterized protein LOC103429806    142   3e-39   
ref|XP_008350466.1|  PREDICTED: uncharacterized protein LOC103413801    147   4e-39   
ref|XP_004236371.1|  PREDICTED: uncharacterized protein LOC101249626    147   4e-39   
ref|XP_009150116.1|  PREDICTED: uncharacterized protein LOC103873461    146   5e-39   
ref|XP_008354851.1|  PREDICTED: uncharacterized protein LOC103418510    146   5e-39   
ref|XP_009149999.1|  PREDICTED: uncharacterized protein LOC103873331    146   5e-39   
ref|XP_010675982.1|  PREDICTED: uncharacterized protein LOC104891894    141   8e-39   
ref|XP_004239534.1|  PREDICTED: uncharacterized protein LOC101251983    143   8e-39   
ref|XP_004244988.1|  PREDICTED: uncharacterized protein LOC101256203    144   1e-38   
ref|XP_008391920.1|  PREDICTED: uncharacterized protein LOC103454107    141   1e-38   
ref|XP_004253487.1|  PREDICTED: uncharacterized protein LOC101261606    142   2e-38   
ref|XP_009778345.1|  PREDICTED: uncharacterized protein LOC104227738    145   2e-38   
ref|XP_008370034.1|  PREDICTED: uncharacterized protein LOC103433544    145   3e-38   
ref|XP_008650141.1|  PREDICTED: uncharacterized protein LOC103630875    140   4e-38   
ref|XP_008646609.1|  PREDICTED: uncharacterized protein LOC103628118    144   5e-38   
ref|XP_008358231.1|  PREDICTED: uncharacterized protein LOC103421969    138   5e-38   
ref|XP_008381538.1|  PREDICTED: uncharacterized protein LOC103444391    138   8e-38   
ref|XP_008368584.1|  PREDICTED: uncharacterized protein LOC103432188    149   8e-38   
ref|XP_009138461.1|  PREDICTED: uncharacterized protein LOC103862508    143   1e-37   
ref|XP_004234901.1|  PREDICTED: uncharacterized protein LOC101254879    137   1e-37   
ref|XP_008653954.1|  PREDICTED: uncharacterized protein LOC103634125    139   1e-37   
ref|XP_010681472.1|  PREDICTED: uncharacterized protein LOC104896420    142   1e-37   
emb|CAN75894.1|  hypothetical protein VITISV_024509                     140   1e-37   Vitis vinifera
ref|XP_008352629.1|  PREDICTED: uncharacterized protein LOC103416146    139   2e-37   
ref|XP_010682496.1|  PREDICTED: uncharacterized protein LOC104897336    137   2e-37   
ref|XP_008646794.1|  PREDICTED: uncharacterized protein LOC103628356    142   2e-37   
ref|XP_009589636.1|  PREDICTED: uncharacterized protein LOC104086974    142   2e-37   
ref|XP_010685744.1|  PREDICTED: uncharacterized protein LOC104900098    137   2e-37   
ref|XP_008671098.1|  PREDICTED: uncharacterized protein LOC103648399    142   2e-37   
ref|XP_009150095.1|  PREDICTED: uncharacterized protein LOC103873440    141   2e-37   
ref|XP_008647188.1|  PREDICTED: uncharacterized protein LOC103628841    142   3e-37   
ref|XP_004289434.1|  PREDICTED: uncharacterized protein LOC101299333    140   3e-37   
ref|XP_004248599.1|  PREDICTED: uncharacterized protein LOC101264379    138   3e-37   
ref|XP_009102426.1|  PREDICTED: uncharacterized protein LOC103828570    140   4e-37   
ref|XP_008660757.1|  PREDICTED: uncharacterized protein LOC103639842    141   4e-37   
ref|XP_008646917.1|  PREDICTED: uncharacterized protein LOC103628507    141   4e-37   
dbj|BAA97086.1|  unnamed protein product                                141   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008666881.1|  PREDICTED: uncharacterized protein LOC103645641    141   5e-37   
ref|XP_008664249.1|  PREDICTED: uncharacterized protein LOC103642851    139   5e-37   
ref|XP_008653682.1|  PREDICTED: uncharacterized protein LOC103633778    140   5e-37   
ref|XP_009124277.1|  PREDICTED: uncharacterized protein LOC103849214    141   6e-37   
ref|XP_009138539.1|  PREDICTED: uncharacterized protein LOC103862598    136   6e-37   
ref|XP_010667203.1|  PREDICTED: uncharacterized protein LOC104884278    140   6e-37   
ref|XP_008661035.1|  PREDICTED: uncharacterized protein LOC103640181    141   7e-37   
ref|XP_008664331.1|  PREDICTED: uncharacterized protein LOC103642956    140   7e-37   
ref|XP_008673588.1|  PREDICTED: uncharacterized protein LOC103649630    141   7e-37   
ref|XP_008384441.1|  PREDICTED: zinc finger MYM-type protein 1-like     144   8e-37   
ref|XP_008646549.1|  PREDICTED: uncharacterized protein LOC103628043    140   8e-37   
ref|XP_008657946.1|  PREDICTED: uncharacterized protein LOC103637561    140   1e-36   
ref|XP_008671773.1|  PREDICTED: uncharacterized protein LOC103649237    140   1e-36   
ref|XP_008671123.1|  PREDICTED: uncharacterized protein LOC103648428    140   1e-36   
ref|XP_008680759.1|  PREDICTED: uncharacterized protein LOC103655855    140   1e-36   
ref|XP_008657419.1|  PREDICTED: uncharacterized protein LOC103636888    139   1e-36   
ref|XP_008660770.1|  PREDICTED: uncharacterized protein LOC103639856    140   1e-36   
ref|XP_008666877.1|  PREDICTED: uncharacterized protein LOC103645635    140   1e-36   
ref|XP_008646761.1|  PREDICTED: uncharacterized protein LOC103628316    139   1e-36   
gb|AAF67379.1|  Hypothetical protein T15F17.k                           139   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008647223.1|  PREDICTED: uncharacterized protein LOC103628876    140   1e-36   
ref|XP_008666113.1|  PREDICTED: uncharacterized protein LOC103644730    139   2e-36   
ref|XP_008343356.1|  PREDICTED: uncharacterized protein LOC103406118    135   2e-36   
gb|ABA97378.1|  retrotransposon protein, putative, Ty1-copia subc...    138   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008661169.1|  PREDICTED: uncharacterized protein LOC103640347    140   2e-36   
ref|XP_010684131.1|  PREDICTED: uncharacterized protein LOC104898727    139   2e-36   
ref|XP_008657641.1|  PREDICTED: uncharacterized protein LOC103637168    139   2e-36   
ref|XP_008666735.1|  PREDICTED: uncharacterized protein LOC103645462    139   2e-36   
ref|XP_008661225.1|  PREDICTED: uncharacterized protein LOC103640415    139   2e-36   
ref|XP_002458270.1|  hypothetical protein SORBIDRAFT_03g030320          136   2e-36   Sorghum bicolor [broomcorn]
ref|XP_008661188.1|  PREDICTED: uncharacterized protein LOC103640372    139   2e-36   
ref|XP_008654167.1|  PREDICTED: uncharacterized protein LOC103634422    139   2e-36   
ref|XP_008661115.1|  PREDICTED: uncharacterized protein LOC103640278    139   3e-36   
ref|XP_008653593.1|  PREDICTED: uncharacterized protein LOC103633656    139   3e-36   
ref|XP_008650603.1|  PREDICTED: uncharacterized protein LOC103631479    139   4e-36   
ref|XP_008680688.1|  PREDICTED: uncharacterized protein LOC103655768    138   4e-36   
ref|XP_008657837.1|  PREDICTED: uncharacterized protein LOC103637415    139   5e-36   
ref|XP_008650614.1|  PREDICTED: uncharacterized protein LOC103631493    138   5e-36   
ref|XP_008646554.1|  PREDICTED: uncharacterized protein LOC103628049    138   5e-36   
ref|XP_008671793.1|  PREDICTED: uncharacterized protein LOC103649260    138   6e-36   
ref|XP_008676149.1|  PREDICTED: uncharacterized protein LOC103652313    138   6e-36   
ref|XP_008666759.1|  PREDICTED: uncharacterized protein LOC103645496    137   6e-36   
ref|XP_010670074.1|  PREDICTED: uncharacterized protein LOC104887176    137   6e-36   
ref|XP_009128779.1|  PREDICTED: uncharacterized protein LOC103853622    138   7e-36   
ref|XP_008680660.1|  PREDICTED: uncharacterized protein LOC103655734    138   7e-36   
ref|XP_009138606.1|  PREDICTED: uncharacterized protein LOC103862680    137   7e-36   
ref|XP_004251338.1|  PREDICTED: uncharacterized protein LOC101249524    137   7e-36   
ref|XP_008676178.1|  PREDICTED: uncharacterized protein LOC103652350    138   7e-36   
ref|XP_008675813.1|  PREDICTED: uncharacterized protein LOC103651919    138   7e-36   
ref|XP_008380881.1|  PREDICTED: uncharacterized protein LOC103443767    137   7e-36   
ref|XP_009102747.1|  PREDICTED: uncharacterized protein LOC103828860    137   9e-36   
ref|XP_008378553.1|  PREDICTED: uncharacterized protein LOC103441644    138   9e-36   
ref|XP_008647058.1|  PREDICTED: uncharacterized protein LOC103628671    138   1e-35   
ref|XP_008650659.1|  PREDICTED: uncharacterized protein LOC103631554    137   1e-35   
ref|XP_004245369.1|  PREDICTED: uncharacterized protein LOC101262235    137   1e-35   
gb|AAL68850.1|AF466199_9  putative copia polyprotein                    137   1e-35   Sorghum bicolor [broomcorn]
gb|EAY79627.1|  hypothetical protein OsI_34772                          137   1e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010687794.1|  PREDICTED: uncharacterized protein LOC104901867    134   1e-35   
emb|CAD40420.3|  OSJNBa0065J03.16                                       137   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008341470.1|  PREDICTED: uncharacterized protein LOC103404345    134   2e-35   
ref|XP_008647124.1|  PREDICTED: uncharacterized protein LOC103628759    137   2e-35   
ref|XP_008354241.1|  PREDICTED: uncharacterized protein LOC103417860    137   2e-35   
ref|XP_004234874.1|  PREDICTED: uncharacterized protein LOC101266608    136   3e-35   
ref|XP_010689613.1|  PREDICTED: uncharacterized protein LOC104903294    136   3e-35   
ref|XP_008650487.1|  PREDICTED: uncharacterized protein LOC103631329    136   3e-35   
ref|XP_008680667.1|  PREDICTED: uncharacterized protein LOC103655744    137   3e-35   
ref|XP_008676230.1|  PREDICTED: uncharacterized protein LOC103652422    136   4e-35   
ref|XP_009145077.1|  PREDICTED: uncharacterized protein LOC103868759    134   4e-35   
emb|CAN72204.1|  hypothetical protein VITISV_001821                     137   4e-35   Vitis vinifera
ref|XP_008661222.1|  PREDICTED: uncharacterized protein LOC103640412    136   4e-35   
ref|XP_009801527.1|  PREDICTED: uncharacterized protein LOC104247269    135   5e-35   
ref|XP_008680675.1|  PREDICTED: uncharacterized protein LOC103655752    136   5e-35   
ref|XP_008657334.1|  PREDICTED: uncharacterized protein LOC103636791    135   5e-35   
ref|XP_008646602.1|  PREDICTED: uncharacterized protein LOC103628111    135   6e-35   
ref|XP_009378832.1|  PREDICTED: uncharacterized protein LOC103967280    130   6e-35   
ref|XP_009630959.1|  PREDICTED: uncharacterized protein LOC104120816    131   6e-35   
ref|XP_009124037.1|  PREDICTED: uncharacterized protein LOC103848956    135   6e-35   
ref|XP_008657919.1|  PREDICTED: uncharacterized protein LOC103637531    135   7e-35   
emb|CAN72352.1|  hypothetical protein VITISV_019854                     130   9e-35   Vitis vinifera
ref|XP_010430940.1|  PREDICTED: uncharacterized protein LOC104715207    132   9e-35   
ref|XP_008347476.1|  PREDICTED: uncharacterized protein LOC103410566    132   1e-34   
ref|XP_010675436.1|  PREDICTED: uncharacterized protein LOC104891438    134   1e-34   
ref|XP_008680769.1|  PREDICTED: uncharacterized protein LOC103655871    135   1e-34   
emb|CAD39859.2|  OSJNBa0036B17.9                                        135   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010675250.1|  PREDICTED: uncharacterized protein LOC104891280    129   2e-34   
ref|XP_008671310.1|  PREDICTED: uncharacterized protein LOC103648658    134   2e-34   
ref|XP_009113854.1|  PREDICTED: uncharacterized protein LOC103839116    133   2e-34   
ref|XP_009117188.1|  PREDICTED: uncharacterized protein LOC103842328    133   3e-34   
ref|XP_008347144.1|  PREDICTED: uncharacterized protein LOC103410172    129   3e-34   
ref|XP_009114821.1|  PREDICTED: uncharacterized protein LOC103840095    133   3e-34   
ref|XP_008346628.1|  PREDICTED: uncharacterized protein LOC103409593    134   3e-34   
ref|XP_008650661.1|  PREDICTED: uncharacterized protein LOC103631556    133   5e-34   
ref|XP_008646982.1|  PREDICTED: uncharacterized protein LOC103628588    133   5e-34   
ref|XP_004243077.1|  PREDICTED: uncharacterized protein LOC101256103    132   6e-34   
ref|XP_009337903.1|  PREDICTED: uncharacterized protein LOC103930307    128   6e-34   
ref|XP_008358118.1|  PREDICTED: uncharacterized protein LOC103421859    133   6e-34   
ref|XP_010229530.1|  PREDICTED: uncharacterized protein LOC104581995    133   7e-34   
ref|XP_009108120.1|  PREDICTED: uncharacterized protein LOC103833812    132   7e-34   
ref|XP_004229128.1|  PREDICTED: uncharacterized protein LOC101256322    127   8e-34   
ref|XP_008650293.1|  PREDICTED: uncharacterized protein LOC103631064    132   8e-34   
ref|XP_009361107.1|  PREDICTED: uncharacterized protein LOC103951466    127   1e-33   
ref|XP_009612804.1|  PREDICTED: uncharacterized protein LOC104106041    128   1e-33   
ref|XP_008675830.1|  PREDICTED: uncharacterized protein LOC103651943    132   2e-33   
gb|ABF96131.1|  retrotransposon protein, putative, Ty1-copia subc...    136   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002488985.1|  hypothetical protein SORBIDRAFT_0761s002010        131   2e-33   Sorghum bicolor [broomcorn]
ref|XP_002455581.1|  hypothetical protein SORBIDRAFT_03g013390          130   2e-33   Sorghum bicolor [broomcorn]
ref|XP_008366728.1|  PREDICTED: uncharacterized protein LOC103430370    129   2e-33   
ref|XP_002447727.1|  hypothetical protein SORBIDRAFT_06g014690          130   2e-33   Sorghum bicolor [broomcorn]
ref|XP_010470578.1|  PREDICTED: uncharacterized protein LOC104750...    129   3e-33   
ref|XP_010470576.1|  PREDICTED: uncharacterized protein LOC104750...    129   3e-33   
dbj|BAB01818.1|  unnamed protein product                                127   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010696226.1|  PREDICTED: uncharacterized protein LOC104908773    130   5e-33   
ref|XP_004249829.1|  PREDICTED: uncharacterized protein LOC101260495    127   6e-33   
dbj|BAD44910.1|  zinc knuckle domain containing protein-like            130   7e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008366908.1|  PREDICTED: uncharacterized protein LOC103430538    135   7e-33   
ref|XP_009622095.1|  PREDICTED: uncharacterized protein LOC104113589    125   8e-33   
ref|XP_010230117.1|  PREDICTED: uncharacterized protein LOC104582345    130   9e-33   
ref|XP_004237325.1|  PREDICTED: uncharacterized protein LOC101252169    127   1e-32   
dbj|BAI39885.1|  hypothetical protein                                   130   1e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_010693631.1|  PREDICTED: uncharacterized protein LOC104906559    123   2e-32   
ref|XP_010239386.1|  PREDICTED: uncharacterized protein LOC104585110    127   2e-32   
ref|XP_008676289.1|  PREDICTED: uncharacterized protein LOC103652494    123   3e-32   
ref|XP_008350524.1|  PREDICTED: uncharacterized protein LOC103413860    128   3e-32   
ref|XP_009613720.1|  PREDICTED: uncharacterized protein LOC104106794    122   3e-32   
gb|EMT30057.1|  Splicing factor 3B subunit 1                            133   3e-32   
ref|XP_010667609.1|  PREDICTED: uncharacterized protein LOC104884...    129   5e-32   
ref|XP_009105348.1|  PREDICTED: uncharacterized protein LOC103831215    127   6e-32   
ref|XP_009619790.1|  PREDICTED: uncharacterized protein LOC104111740    124   8e-32   
gb|AAK50605.1|AC084404_30  hypothetical protein                         127   1e-31   Oryza sativa [red rice]
ref|XP_008239131.1|  PREDICTED: uncharacterized protein LOC103337739    122   2e-31   
ref|XP_009600255.1|  PREDICTED: uncharacterized protein LOC104095764    123   3e-31   
gb|ABA98007.1|  retrotransposon protein, putative, Ty1-copia subc...    129   3e-31   
ref|XP_009618065.1|  PREDICTED: uncharacterized protein LOC104110307    120   3e-31   
gb|ABD65024.1|  Zinc knuckle containing protein                         125   3e-31   
ref|XP_009795122.1|  PREDICTED: uncharacterized protein LOC104241862    121   3e-31   
ref|XP_009607772.1|  PREDICTED: uncharacterized protein LOC104101925    125   3e-31   
ref|XP_010513991.1|  PREDICTED: uncharacterized protein LOC104790005    124   6e-31   
gb|KFK33862.1|  hypothetical protein AALP_AA5G069700                    123   6e-31   
ref|XP_008647149.1|  PREDICTED: uncharacterized protein LOC103628797    124   9e-31   
ref|XP_009101272.1|  PREDICTED: uncharacterized protein LOC103827528    123   1e-30   
ref|XP_009138595.1|  PREDICTED: uncharacterized protein LOC103862663    123   2e-30   
ref|XP_002464243.1|  hypothetical protein SORBIDRAFT_01g014820          123   2e-30   
ref|XP_010412858.1|  PREDICTED: uncharacterized protein LOC104699222    123   3e-30   
ref|XP_008373282.1|  PREDICTED: uncharacterized protein LOC103436613    118   3e-30   
gb|EAZ08972.1|  hypothetical protein OsI_31238                          123   3e-30   
ref|XP_009787692.1|  PREDICTED: uncharacterized protein LOC104235567    119   3e-30   
ref|XP_009630763.1|  PREDICTED: uncharacterized protein LOC104120663    119   3e-30   
gb|EAZ08974.1|  hypothetical protein OsI_31240                          124   4e-30   
gb|AAM74356.1|AC115686_23  Putative retroelement                        122   4e-30   
ref|XP_008647099.1|  PREDICTED: uncharacterized protein LOC103628724    122   4e-30   
ref|XP_010667384.1|  PREDICTED: uncharacterized protein LOC104884...    122   4e-30   
ref|XP_009619271.1|  PREDICTED: uncharacterized protein LOC104111300    120   6e-30   
ref|XP_002450426.1|  hypothetical protein SORBIDRAFT_05g005250          122   6e-30   
ref|XP_002454667.1|  hypothetical protein SORBIDRAFT_04g035170          121   7e-30   
ref|XP_002445759.1|  hypothetical protein SORBIDRAFT_07g025250          121   7e-30   
gb|KCW63733.1|  hypothetical protein EUGRSUZ_G01379                     120   8e-30   
ref|XP_008380868.1|  PREDICTED: uncharacterized protein LOC103443754    124   1e-29   
ref|XP_009369001.1|  PREDICTED: uncharacterized protein LOC103958463    116   1e-29   
ref|XP_008671095.1|  PREDICTED: uncharacterized protein LOC103648395    116   1e-29   
ref|XP_008227661.1|  PREDICTED: uncharacterized protein LOC103327154    116   2e-29   
ref|XP_009779851.1|  PREDICTED: uncharacterized protein LOC104228985    115   2e-29   
ref|XP_008372974.1|  PREDICTED: uncharacterized protein LOC103436327    115   2e-29   
ref|XP_009376321.1|  PREDICTED: uncharacterized protein LOC103965028    117   2e-29   
ref|XP_008657791.1|  PREDICTED: uncharacterized protein LOC103637356    120   3e-29   
ref|XP_008352494.1|  PREDICTED: uncharacterized protein LOC103415996    115   3e-29   
ref|XP_002467441.1|  hypothetical protein SORBIDRAFT_01g028130          119   6e-29   
ref|XP_004986811.1|  PREDICTED: uncharacterized protein LOC101776092    115   6e-29   
gb|KCW76150.1|  hypothetical protein EUGRSUZ_D00527                     117   7e-29   
gb|ACG60680.1|  unknown protein                                         114   7e-29   
ref|XP_010681207.1|  PREDICTED: uncharacterized protein LOC104896187    118   9e-29   
ref|XP_008369223.1|  PREDICTED: uncharacterized protein LOC103432795    118   9e-29   
ref|XP_002467512.1|  hypothetical protein SORBIDRAFT_01g029366          118   1e-28   
ref|XP_009375238.1|  PREDICTED: uncharacterized protein LOC103964073    114   1e-28   
ref|XP_010684697.1|  PREDICTED: uncharacterized protein LOC104899244    115   1e-28   
gb|AAL67596.1|AC018929_18  hypothetical protein                         118   1e-28   
gb|AAP55152.2|  retrotransposon protein, putative, Ty1-copia subc...    118   1e-28   
ref|XP_009350151.1|  PREDICTED: uncharacterized protein LOC103941675    113   1e-28   
ref|XP_009612949.1|  PREDICTED: uncharacterized protein LOC104106161    118   2e-28   
ref|XP_009780716.1|  PREDICTED: uncharacterized protein LOC104229723    117   2e-28   
ref|XP_009795011.1|  PREDICTED: uncharacterized protein LOC104241771    117   2e-28   
ref|XP_008666823.1|  PREDICTED: uncharacterized protein LOC103645565    112   3e-28   
ref|XP_009353197.1|  PREDICTED: uncharacterized protein LOC103944458    112   4e-28   
ref|XP_011087074.1|  PREDICTED: uncharacterized protein LOC105168641    116   4e-28   
ref|XP_010446098.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    117   6e-28   
ref|XP_008382921.1|  PREDICTED: uncharacterized protein LOC103445685    112   6e-28   
gb|ABD64973.1|  Zinc knuckle containing protein                         116   7e-28   
gb|ABF96510.1|  retrotransposon protein, putative, Ty1-copia subc...    113   1e-27   
ref|XP_008357927.1|  PREDICTED: uncharacterized protein LOC103421660    111   1e-27   
gb|ABA98086.1|  retrotransposon protein, putative, Ty1-copia subc...    115   1e-27   
gb|ABD65140.1|  Zinc knuckle containing protein                         115   2e-27   
gb|KCW85948.1|  hypothetical protein EUGRSUZ_B02654                     114   2e-27   
ref|XP_004239500.1|  PREDICTED: uncharacterized protein LOC101253898    112   2e-27   
emb|CAN60267.1|  hypothetical protein VITISV_040888                     111   3e-27   
ref|XP_009349894.1|  PREDICTED: uncharacterized protein LOC103941426    111   4e-27   
ref|XP_010666579.1|  PREDICTED: uncharacterized protein LOC104883722    113   4e-27   
ref|XP_009362630.1|  PREDICTED: uncharacterized protein LOC103952698    108   9e-27   
ref|XP_009354507.1|  PREDICTED: uncharacterized protein LOC103945642    112   1e-26   
ref|XP_008372622.1|  PREDICTED: uncharacterized protein LOC103435972    111   1e-26   
ref|XP_003614910.1|  hypothetical protein MTR_5g061150                  108   2e-26   
ref|XP_009123347.1|  PREDICTED: uncharacterized protein LOC103848127    109   3e-26   
ref|XP_009590462.1|  PREDICTED: uncharacterized protein LOC104087635    111   3e-26   
ref|XP_008352905.1|  PREDICTED: uncharacterized protein LOC103416437    107   5e-26   
ref|XP_010695862.1|  PREDICTED: uncharacterized protein LOC104908444    108   6e-26   
ref|XP_010230153.1|  PREDICTED: uncharacterized protein LOC100823845    110   9e-26   
ref|XP_009758870.1|  PREDICTED: uncharacterized protein LOC104211506    108   9e-26   
emb|CAN73148.1|  hypothetical protein VITISV_037478                     107   2e-25   
emb|CAE04801.1|  OSJNBb0018J12.14                                       108   2e-25   
ref|XP_009350654.1|  PREDICTED: uncharacterized protein LOC103942170    108   2e-25   
ref|XP_006408856.1|  hypothetical protein EUTSA_v10002286mg             108   2e-25   
ref|XP_002445344.1|  hypothetical protein SORBIDRAFT_07g011326          105   3e-25   
ref|XP_010326499.1|  PREDICTED: uncharacterized protein LOC104649305    108   3e-25   
ref|XP_008654124.1|  PREDICTED: uncharacterized protein LOC103634362    107   3e-25   
emb|CAN71756.1|  hypothetical protein VITISV_003809                     105   4e-25   
ref|XP_004237118.1|  PREDICTED: uncharacterized protein LOC101255582    106   5e-25   
ref|XP_010321738.1|  PREDICTED: uncharacterized protein LOC104647757    105   5e-25   
emb|CAN79264.1|  hypothetical protein VITISV_034881                     112   5e-25   
ref|XP_010683442.1|  PREDICTED: uncharacterized protein LOC104898121    105   1e-24   
ref|XP_009795572.1|  PREDICTED: uncharacterized protein LOC104242248    105   1e-24   
gb|AAM08510.1|AC068654_12  Hypothetical protein with similarity t...    105   1e-24   
ref|XP_009804241.1|  PREDICTED: uncharacterized protein LOC104249501    107   2e-24   
emb|CAN81763.1|  hypothetical protein VITISV_026693                     104   2e-24   
gb|ABG65885.1|  transposon protein, putative, CACTA, En/Spm sub-c...    109   4e-24   
ref|XP_010317852.1|  PREDICTED: uncharacterized protein LOC104646256    103   5e-24   
ref|XP_008358489.1|  PREDICTED: uncharacterized protein LOC103422224    105   6e-24   
ref|XP_008348459.1|  PREDICTED: uncharacterized protein LOC103411603    103   6e-24   
ref|XP_008379018.1|  PREDICTED: uncharacterized protein LOC103442057    101   1e-23   
ref|XP_009115065.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    104   1e-23   
ref|XP_008364025.1|  PREDICTED: uncharacterized protein LOC103427730    103   2e-23   
ref|XP_008373795.1|  PREDICTED: uncharacterized protein LOC103437118    100   2e-23   
ref|XP_008373885.1|  PREDICTED: uncharacterized protein LOC103437206    100   2e-23   
ref|XP_004243931.1|  PREDICTED: uncharacterized protein LOC101264950    101   4e-23   
ref|XP_008348253.1|  PREDICTED: uncharacterized protein LOC103411395    103   4e-23   
emb|CAN71782.1|  hypothetical protein VITISV_028677                     106   4e-23   
ref|XP_008358725.1|  PREDICTED: uncharacterized protein LOC103422438  99.0    6e-23   
ref|XP_008369701.1|  PREDICTED: uncharacterized protein LOC103433246    101   6e-23   
ref|XP_008222695.1|  PREDICTED: uncharacterized protein LOC103322549    101   6e-23   
ref|XP_008646754.1|  PREDICTED: uncharacterized protein LOC103628307  99.0    2e-22   
emb|CAH68015.1|  H0807C06-H0308C08.2                                    101   2e-22   
gb|EAY93291.1|  hypothetical protein OsI_15100                          101   2e-22   
ref|XP_009616444.1|  PREDICTED: uncharacterized protein LOC104108982  97.4    3e-22   
ref|XP_009631853.1|  PREDICTED: uncharacterized protein LOC104121541  97.8    4e-22   
gb|ABF96803.1|  retrotransposon protein, putative, Ty1-copia subc...    103   5e-22   
ref|XP_008388897.1|  PREDICTED: uncharacterized protein LOC103451248    100   6e-22   
ref|XP_004308746.1|  PREDICTED: uncharacterized protein LOC101306682  97.8    7e-22   
gb|ACY01924.1|  hypothetical protein                                    102   8e-22   
ref|XP_009772690.1|  PREDICTED: uncharacterized protein LOC104223038  98.2    1e-21   
ref|XP_009124809.1|  PREDICTED: uncharacterized protein LOC103849844  97.8    1e-21   
ref|XP_008358245.1|  PREDICTED: uncharacterized protein LOC103421983  95.1    2e-21   
ref|XP_010665796.1|  PREDICTED: uncharacterized protein LOC104883048  96.7    3e-21   
ref|XP_008354794.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...    101   3e-21   
ref|XP_004289357.1|  PREDICTED: uncharacterized protein LOC101295086  97.1    3e-21   
ref|XP_010326732.1|  PREDICTED: uncharacterized protein LOC101256711  97.8    4e-21   
emb|CAN70087.1|  hypothetical protein VITISV_039203                     100   4e-21   
ref|XP_006369619.1|  hypothetical protein POPTR_0001s27140g           93.2    5e-21   
ref|XP_008373711.1|  PREDICTED: uncharacterized protein LOC103437023  95.1    5e-21   
ref|XP_008343294.1|  PREDICTED: uncharacterized protein LOC103406052  95.5    7e-21   
gb|EEC81222.1|  hypothetical protein OsI_24265                        96.7    9e-21   
ref|XP_004305764.1|  PREDICTED: uncharacterized protein LOC101314781  95.1    1e-20   
gb|ABE77199.1|  putative copia polyprotein                            95.9    1e-20   
ref|XP_010682941.1|  PREDICTED: uncharacterized protein LOC104897702  95.5    2e-20   
ref|XP_010230225.1|  PREDICTED: uncharacterized protein LOC104582401  94.4    4e-20   
ref|XP_008780111.1|  PREDICTED: uncharacterized protein LOC103699896  91.3    5e-20   
ref|XP_008680503.1|  PREDICTED: uncharacterized protein LOC103655551  93.6    7e-20   
ref|XP_004301546.1|  PREDICTED: uncharacterized protein LOC101301017  92.0    8e-20   
gb|KCW80871.1|  hypothetical protein EUGRSUZ_C02230                   92.8    1e-19   
gb|AFP55536.1|  retrotransposon polyprotein                           95.1    4e-19   
ref|XP_010227205.1|  PREDICTED: uncharacterized protein LOC104581403  91.3    4e-19   
ref|XP_009369992.1|  PREDICTED: uncharacterized protein LOC103959363  90.5    7e-19   
ref|XP_009767987.1|  PREDICTED: uncharacterized protein LOC104219048  89.7    9e-19   
ref|XP_010684541.1|  PREDICTED: uncharacterized protein LOC104899104  89.4    1e-18   
ref|XP_009782108.1|  PREDICTED: uncharacterized protein LOC104230900  90.1    1e-18   
ref|XP_004234302.1|  PREDICTED: uncharacterized protein LOC101245730  89.0    1e-18   
ref|XP_009610232.1|  PREDICTED: uncharacterized protein LOC104103969  89.4    1e-18   
ref|XP_002439511.1|  hypothetical protein SORBIDRAFT_09g008726        88.6    2e-18   
ref|XP_010674820.1|  PREDICTED: uncharacterized protein LOC104890901  90.1    2e-18   
ref|XP_004308595.1|  PREDICTED: uncharacterized protein LOC101301623  87.8    2e-18   
ref|XP_006646488.1|  PREDICTED: uncharacterized protein LOC102718422  89.7    2e-18   
ref|XP_010681843.1|  PREDICTED: uncharacterized protein LOC104896751  88.6    3e-18   
emb|CAN77289.1|  hypothetical protein VITISV_031729                   87.8    3e-18   
ref|XP_008344544.1|  PREDICTED: uncharacterized protein LOC103407390  88.2    3e-18   
ref|XP_008391613.1|  PREDICTED: uncharacterized protein LOC103453811  86.3    3e-18   
gb|KCW59609.1|  hypothetical protein EUGRSUZ_H02352                   88.2    3e-18   
ref|XP_009351440.1|  PREDICTED: myb-related protein Myb4-like         89.4    4e-18   
ref|XP_009757687.1|  PREDICTED: uncharacterized protein LOC104210479  87.8    4e-18   
gb|AFP55573.1|  retrotransposon protein                               92.4    5e-18   
ref|XP_004297944.1|  PREDICTED: uncharacterized protein LOC101292405  88.6    5e-18   
ref|XP_009369058.1|  PREDICTED: uncharacterized protein LOC103958518  86.7    6e-18   
gb|AAX95252.1|  retrotransposon protein, putative, Ty1-copia sub-...  87.4    7e-18   
ref|XP_008666238.1|  PREDICTED: uncharacterized protein LOC103644862  87.4    1e-17   
ref|XP_009795264.1|  PREDICTED: uncharacterized protein LOC104241989  86.7    1e-17   
ref|XP_006664465.1|  PREDICTED: uncharacterized protein LOC102721224  87.0    2e-17   
ref|XP_009128626.1|  PREDICTED: uncharacterized protein LOC103853477  85.1    2e-17   
ref|XP_004298009.1|  PREDICTED: uncharacterized protein LOC101295513  86.3    2e-17   
ref|XP_004298247.1|  PREDICTED: uncharacterized protein LOC101315232  86.3    4e-17   
ref|XP_009128625.1|  PREDICTED: uncharacterized protein LOC103853476  84.0    5e-17   
ref|XP_004305629.1|  PREDICTED: uncharacterized protein LOC101291077  85.9    5e-17   
gb|EMS62814.1|  Peroxidase 1                                          85.9    6e-17   
ref|XP_004289608.1|  PREDICTED: uncharacterized protein LOC101292353  85.9    7e-17   
ref|XP_008370139.1|  PREDICTED: uncharacterized protein LOC103433650  88.2    7e-17   
ref|XP_010236638.1|  PREDICTED: uncharacterized protein LOC104584178  85.1    8e-17   
ref|XP_004290238.1|  PREDICTED: uncharacterized protein LOC101303758  83.2    8e-17   
ref|XP_004237610.1|  PREDICTED: uncharacterized protein LOC101261614  85.1    9e-17   
ref|XP_004289293.1|  PREDICTED: uncharacterized protein LOC101295465  83.6    1e-16   
ref|XP_008390015.1|  PREDICTED: uncharacterized protein LOC103452283  87.8    1e-16   
emb|CAN78524.1|  hypothetical protein VITISV_000164                   82.4    1e-16   
ref|XP_008675674.1|  PREDICTED: uncharacterized protein LOC103651753  83.6    2e-16   
ref|XP_010678498.1|  PREDICTED: uncharacterized protein LOC104894034  82.8    2e-16   
ref|XP_008671862.1|  PREDICTED: uncharacterized protein LOC103649344  83.2    3e-16   
ref|XP_010313131.1|  PREDICTED: uncharacterized protein LOC104644676  82.8    3e-16   
gb|AAP50929.1|  putative polyprotein                                  85.9    3e-16   
ref|XP_004288698.1|  PREDICTED: uncharacterized protein LOC101309094  82.8    4e-16   
gb|KCW69287.1|  hypothetical protein EUGRSUZ_F02781                   82.4    5e-16   
gb|KCW72052.1|  hypothetical protein EUGRSUZ_E00494                   82.0    6e-16   
ref|XP_004309899.1|  PREDICTED: uncharacterized protein LOC101292956  81.6    1e-15   
ref|XP_007036640.1|  Uncharacterized protein TCM_012503               78.6    1e-15   
ref|XP_004297860.1|  PREDICTED: uncharacterized protein LOC101308280  81.3    3e-15   
emb|CAN70119.1|  hypothetical protein VITISV_026303                   80.5    3e-15   
ref|XP_006396018.1|  hypothetical protein EUTSA_v10005468mg           77.4    3e-15   
ref|XP_008657277.1|  PREDICTED: uncharacterized protein LOC103636712  80.1    4e-15   
ref|XP_006370018.1|  hypothetical protein POPTR_0001s38000g           77.0    5e-15   
ref|XP_004295714.1|  PREDICTED: uncharacterized protein LOC101311845  80.5    6e-15   
ref|XP_004296119.1|  PREDICTED: uncharacterized protein LOC101291131  80.1    7e-15   
emb|CAN67626.1|  hypothetical protein VITISV_007389                   81.6    7e-15   
ref|XP_004292054.1|  PREDICTED: uncharacterized protein LOC101307860  80.1    7e-15   
gb|KCW53497.1|  hypothetical protein EUGRSUZ_J02764                   79.0    9e-15   
ref|XP_004292121.1|  PREDICTED: uncharacterized protein LOC101310668  79.7    1e-14   
ref|XP_008392731.1|  PREDICTED: uncharacterized protein LOC103454914  79.7    1e-14   
ref|XP_010667278.1|  PREDICTED: uncharacterized protein LOC104884340  79.0    1e-14   
ref|XP_008368293.1|  PREDICTED: uncharacterized protein LOC103431897  77.4    1e-14   
ref|XP_010682062.1|  PREDICTED: uncharacterized protein LOC104896966  78.6    2e-14   
ref|XP_009336586.1|  PREDICTED: uncharacterized protein LOC103929167  77.8    2e-14   
emb|CCW72596.1|  ORW1943Ba0047B01.15                                  81.3    2e-14   
ref|XP_004306257.1|  PREDICTED: uncharacterized protein LOC101314881  78.6    3e-14   
ref|XP_008340285.1|  PREDICTED: uncharacterized protein LOC103403234  76.3    6e-14   
ref|XP_010319628.1|  PREDICTED: uncharacterized protein LOC101261223  76.3    8e-14   
ref|XP_008349031.1|  PREDICTED: uncharacterized protein LOC103412208  75.9    1e-13   
ref|XP_004309974.1|  PREDICTED: uncharacterized protein LOC101301066  73.9    2e-13   
ref|XP_008361881.1|  PREDICTED: uncharacterized protein LOC103425568  75.1    2e-13   
ref|XP_004241094.1|  PREDICTED: uncharacterized protein LOC101252995  73.9    3e-13   
ref|XP_008374085.1|  PREDICTED: uncharacterized protein LOC103437395  73.9    6e-13   
ref|XP_010318110.1|  PREDICTED: uncharacterized protein LOC104646406  73.9    8e-13   
ref|XP_006665001.1|  PREDICTED: uncharacterized protein LOC102707369  72.4    2e-12   
ref|XP_008366159.1|  PREDICTED: uncharacterized protein LOC103429807  72.8    2e-12   
emb|CAN69488.1|  hypothetical protein VITISV_009192                   71.2    2e-12   
ref|XP_010683829.1|  PREDICTED: uncharacterized protein LOC104898442  70.9    7e-12   
ref|XP_008369391.1|  PREDICTED: uncharacterized protein LOC103432944  70.9    7e-12   
ref|XP_010672824.1|  PREDICTED: uncharacterized protein LOC104889327  70.9    7e-12   
gb|ABA98895.2|  hypothetical protein LOC_Os12g36360                   70.5    8e-12   
ref|XP_004305185.1|  PREDICTED: uncharacterized protein LOC101308306  71.2    9e-12   
ref|XP_008351707.1|  PREDICTED: uncharacterized protein LOC103415131  70.1    2e-11   
ref|XP_004293250.1|  PREDICTED: uncharacterized protein LOC101295979  67.4    3e-11   



>gb|AAK91877.1|AC091665_3 Putative copia-type polyprotein [Oryza sativa]
 gb|ABB46746.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=183

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII--ENST--SDEAQKVKALIF  267
            M+ +AK+EF ELALDGSNYLTWALDVEI L S  L +TI+  E  T  S +A+K KAL F
Sbjct  1    MSDIAKKEFTELALDGSNYLTWALDVEIKLDSMGLDHTIVLPEVGTVESTKAEKAKALHF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ +LK+EY TEKDP  LW+SLKDRFD+Q S+VLPQA+ DW+ LRFQD+KSV  YN
Sbjct  61   LRHHLHPNLKSEYMTEKDPLVLWQSLKDRFDQQGSIVLPQAQHDWITLRFQDYKSVVTYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+I+SQL+LC  +++D ++IEKTLS
Sbjct  121  SALHRIISQLRLCGLKITDAEMIEKTLS  148



>dbj|BAD45248.1| Zinc knuckle containing protein-like [Oryza sativa Japonica Group]
 dbj|BAD45350.1| Zinc knuckle containing protein-like [Oryza sativa Japonica Group]
Length=356

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII--ENST--SDEAQKVKALIF  267
            M+ +AK+EF ELALD SNYLTWALDVEI L S  L +TI+  E  T  S +A+K KAL F
Sbjct  14   MSDIAKKEFAELALDDSNYLTWALDVEIKLDSMGLDHTIVLPEVGTVESTKAEKAKALHF  73

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK+EY  EKDP  LW+SLKDRFD+Q S+VLPQ + DW+ LRFQD+KSV  YN
Sbjct  74   LRHHLHPDLKSEYMFEKDPLVLWQSLKDRFDQQGSIVLPQEQHDWITLRFQDYKSVAAYN  133

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+I+SQL+LC  +++DT++IEKTLS
Sbjct  134  SALHRIISQLRLCGLKITDTEMIEKTLS  161



>emb|CAE01490.1| P0041A24.2 [Oryza sativa Japonica Group]
Length=1376

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII----ENSTSDEAQKVKALIF  267
            M+ +AK+EF ELALDGSNYLTWALDVEI L S  L +TI+        S +A+K KAL F
Sbjct  1    MSDIAKKEFAELALDGSNYLTWALDVEIKLDSMGLDHTIVLPKVGTVESTKAEKAKALHF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK+EY TEKDP  LW+SLKDRFD+Q S+VLPQA+ DW+ LRFQD+KSV  YN
Sbjct  61   LRHHLHPDLKSEYMTEKDPLVLWQSLKDRFDQQGSIVLPQAQHDWITLRFQDYKSVAAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+I+SQL+LC Q+++D ++IEKTLS
Sbjct  121  SALHRIISQLRLCGQKITDAEMIEKTLS  148



>ref|XP_002449567.1| hypothetical protein SORBIDRAFT_05g019135 [Sorghum bicolor]
 gb|EES08555.1| hypothetical protein SORBIDRAFT_05g019135 [Sorghum bicolor]
Length=309

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSDE---AQKVKALIF  267
            M+ +AKR+F  LA+DGSNYLTWA D+EI L    L +TI++  +  DE     K KAL +
Sbjct  1    MSDIAKRDFEMLAVDGSNYLTWATDIEIRLDGMGLDHTIVQLEAGKDERTKQDKAKALHY  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK EY TEKDP  LW+SLKDRF +Q ++VLP+A+ DW+NLRFQDFKSV  YN
Sbjct  61   LRHHLHPDLKCEYMTEKDPLVLWQSLKDRFSQQLTIVLPRAQQDWINLRFQDFKSVVAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+IVS+L+LC Q+++D D+IEKTLS
Sbjct  121  SALHRIVSKLRLCGQKITDADMIEKTLS  148



>ref|XP_002446279.1| hypothetical protein SORBIDRAFT_06g012571 [Sorghum bicolor]
 gb|EES10607.1| hypothetical protein SORBIDRAFT_06g012571 [Sorghum bicolor]
Length=324

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQ----KVKALIF  267
            M+ +AKR+F  LA+DGSNYLTWA D+EI L    L +TI++     + +    K KAL +
Sbjct  1    MSDIAKRDFEMLAVDGSNYLTWATDIEIRLDGMGLDHTIVQPEAGKDERTKQDKAKALHY  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK EY TEKDP  LW+SLKDRF +Q ++VLP+A+ DW+NLRFQDFKSV  YN
Sbjct  61   LRHHLHPDLKCEYMTEKDPLVLWQSLKDRFSQQLTIVLPRAQQDWINLRFQDFKSVAAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+IV++L+LC Q+++D D+IEKTLS
Sbjct  121  SALHRIVTKLRLCGQKITDADMIEKTLS  148



>ref|XP_002442483.1| hypothetical protein SORBIDRAFT_08g020705 [Sorghum bicolor]
 gb|EES16321.1| hypothetical protein SORBIDRAFT_08g020705 [Sorghum bicolor]
Length=324

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQ----KVKALIF  267
            M+ +AKR+F  LA+DGSNYLTWA D+EI L    L +TI++     + +    K KAL +
Sbjct  1    MSDIAKRDFEMLAVDGSNYLTWATDIEIRLDGMGLDHTIVQPEAGKDERTKQDKAKALHY  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK EY TEKDP  LW+SLKDRF +Q ++VLP+A+ DW+NLRFQDFKSV  YN
Sbjct  61   LRHHLHPDLKCEYMTEKDPLVLWQSLKDRFSQQLTIVLPRAQQDWINLRFQDFKSVAAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH++V++L+LC Q+++D D+IEKTLS
Sbjct  121  SALHRVVTKLRLCGQKITDADMIEKTLS  148



>gb|AAT77826.1| putative Zinc knuckle containing protein [Oryza sativa Japonica 
Group]
Length=460

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 113/148 (76%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII----ENSTSDEAQKVKALIF  267
            M+ + K+EF ELALDGSNYLTWALDVEI L S  L +TI+        S +A+K KAL F
Sbjct  118  MSDITKKEFAELALDGSNYLTWALDVEIKLDSIGLDHTIVLPELGTVESTKAEKAKALHF  177

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK+EY TEK+P  LW+SLKDRFD+Q S+VLPQ + DW+ L FQD+KS   YN
Sbjct  178  LRHHLHPDLKSEYMTEKNPLVLWQSLKDRFDQQGSIVLPQVQHDWITLHFQDYKSTAAYN  237

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SA H+I+SQL+ C Q+++D ++IEKTLS
Sbjct  238  SAPHRIISQLRFCGQKITDAEMIEKTLS  265



>emb|CAE05263.2| OSJNBb0115I09.25 [Oryza sativa Japonica Group]
 emb|CAD39881.2| OSJNBb0067G11.4 [Oryza sativa Japonica Group]
Length=986

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII--ENST--SDEAQKVKALIF  267
            M+ +AK+EF+ELALDGSNYLTWALDVEI L    L +TI+  E  T  S +A+K KA  F
Sbjct  1    MSDIAKKEFVELALDGSNYLTWALDVEIKLDYMGLDHTIVLPEVGTVESTKAEKAKAFHF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK EY TEKDP  LW+SLKDRFD+Q S+VLPQA+ DW+ LRFQD KSV  YN
Sbjct  61   LRHHLHPDLKFEYMTEKDPLVLWQSLKDRFDQQGSIVLPQAQHDWITLRFQDNKSVAAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+I+SQL+LC  +++D ++IEKTLS
Sbjct  121  SALHRIISQLRLCGLKITDAEMIEKTLS  148



>ref|XP_002446503.1| hypothetical protein SORBIDRAFT_06g017035 [Sorghum bicolor]
 gb|EES10831.1| hypothetical protein SORBIDRAFT_06g017035 [Sorghum bicolor]
Length=324

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 113/148 (76%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQ----KVKALIF  267
            M+ +AKR+F  LA+DGSNYLTWA D+EI L    L +TI++     + +    K KAL +
Sbjct  1    MSDIAKRDFEMLAVDGSNYLTWATDIEIRLDGMGLDHTIVQPEAGKDERTKQDKAKALHY  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK EY TEKDP  LW+SLKDRF +Q ++VLP+A+ DW+NLRFQDFKSV  YN
Sbjct  61   LRHHLHPDLKCEYMTEKDPLVLWQSLKDRFSQQLTIVLPRAQQDWINLRFQDFKSVAAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+IV++L+LC Q++ D D+I+KTLS
Sbjct  121  SALHRIVTKLRLCGQKIIDADMIKKTLS  148



>gb|AAT77830.1| putative zinc knuckle containing protein [Oryza sativa Japonica 
Group]
 gb|ABF96917.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=777

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII--ENST--SDEAQKVKALIF  267
            M+ +AK+EF ELALDGSNYLTWALDVEI L S  L +TI+  E  T  S +A+K KAL F
Sbjct  1    MSDIAKKEFAELALDGSNYLTWALDVEIKLDSMGLGHTIVLPEVGTVESTKAEKAKALHF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK EY TEKDP   W+ LKDRFD+Q S+VLP+A+ DW+ LRFQD+ SV  YN
Sbjct  61   LRHHLHPDLKFEYMTEKDPLVFWQFLKDRFDQQGSIVLPKAQHDWITLRFQDYMSVAAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+I+SQL+LC  ++ D ++IEKTLS
Sbjct  121  SALHRIISQLRLCGLKIPDAEMIEKTLS  148



>gb|ABF96902.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1370

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII--ENST--SDEAQKVKALIF  267
            M+ + K+EF ELALDGSNYLTWALDVEI L S  L +TI+  E  T  S +A+K KAL F
Sbjct  118  MSDITKKEFAELALDGSNYLTWALDVEIKLDSIGLDHTIVLPELGTVESTKAEKAKALHF  177

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK+EY TEK+P  LW+SLKDRFD+Q S+VLPQ + DW+ L FQD+KS   YN
Sbjct  178  LRHHLHPDLKSEYMTEKNPLVLWQSLKDRFDQQGSIVLPQVQHDWITLHFQDYKSTAAYN  237

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SA H+I+SQL+ C Q+++D ++IEKTLS
Sbjct  238  SAPHRIISQLRFCGQKITDAEMIEKTLS  265



>gb|AAT85780.1| zinc knuckle domain containing protein [Oryza sativa Japonica 
Group]
Length=1329

 Score =   182 bits (463),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII--ENST--SDEAQKVKALIF  267
            M+ + K+EF ELALDGSNYLTWALDVEI L S  L +TI+  E  T  S +A+K KAL F
Sbjct  118  MSDITKKEFAELALDGSNYLTWALDVEIKLDSIGLDHTIVLPELGTVESTKAEKAKALHF  177

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL+ DLK+EY TEK+P  LW+SLKDRFD+Q S+VLPQ + DW+ L FQD+KS   YN
Sbjct  178  LRHHLHPDLKSEYMTEKNPLVLWQSLKDRFDQQGSIVLPQVQHDWITLHFQDYKSTAAYN  237

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SA H+I+SQL+ C Q+++D ++IEKTLS
Sbjct  238  SAPHRIISQLRFCGQKITDAEMIEKTLS  265



>ref|XP_010511862.1| PREDICTED: uncharacterized protein LOC104787903 [Camelina sativa]
Length=345

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AKREF  L + G NY+TWALDV+ YL    L  TI  + T  E +K + ++FLRHH
Sbjct  1    MSNLAKREFAALDISGKNYMTWALDVKFYLKGNGLLKTIDPSETGLEEEKARTMMFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ DLKNEY T ++P +LW +LKDRFD Q  ++LP+AK +WLNLRFQD+KSV+EYNSAL 
Sbjct  61   LHDDLKNEYITRENPADLWIALKDRFDHQKYVILPKAKHEWLNLRFQDYKSVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
             I S++ LC +EVSD D+IEKT 
Sbjct  121  GITSRMALCGEEVSDYDMIEKTF  143



>ref|XP_002467660.1| hypothetical protein SORBIDRAFT_01g031795 [Sorghum bicolor]
 gb|EER94658.1| hypothetical protein SORBIDRAFT_01g031795 [Sorghum bicolor]
Length=314

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = -3

Query  401  LALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQ----KVKALIFLRHHLNYDLKN  234
            LA+DG NYLTWA D+EI L    L +TI++     + +    K KAL +LRHHL+ DLK 
Sbjct  2    LAVDGGNYLTWATDIEIRLDGMGLDHTIVQPEAGKDERTKQDKAKALRYLRHHLHPDLKC  61

Query  233  EYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLK  54
            EY TEKDP  LW+SLKDRF +Q ++VLP+A+ DW+NLRFQDFKSV  YNSALH+IV++L+
Sbjct  62   EYMTEKDPLVLWQSLKDRFSQQLTIVLPRAQQDWINLRFQDFKSVAAYNSALHRIVTKLR  121

Query  53   LCKQEVSDTDLIEKTLS  3
            LC Q+++D D+IEKTLS
Sbjct  122  LCGQKITDADMIEKTLS  138



>dbj|BAF36297.1| hypothetical protein [Ipomoea trifida]
Length=286

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 100/144 (69%), Gaps = 25/144 (17%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+++ KREF EL+LDG NYLTWALD+EI+L S  L  TI+  S   +AQK +ALIFLRHH
Sbjct  1    MSSITKREFTELSLDGGNYLTWALDIEIHLASKGLSQTIVAMSQCTDAQKAQALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            LN+DLKNEY TEKDP  LWK                         FQD+KSV +YNSALH
Sbjct  61   LNHDLKNEYLTEKDPFALWK-------------------------FQDYKSVIDYNSALH  95

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVSQLKLCKQEVS+ DLIEKTLS
Sbjct  96   KIVSQLKLCKQEVSEKDLIEKTLS  119



>ref|XP_009628840.1| PREDICTED: uncharacterized protein LOC104119122 [Nicotiana tomentosiformis]
Length=237

 Score =   166 bits (421),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  437  IMTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRH  258
            IM+ ++K EF+ L + G NYL+W LD +I+L +  L+NTII+ + +    K KA+IFLRH
Sbjct  4    IMSNLSKLEFVALDIFGKNYLSWVLDAKIHLAAKALENTIIQGNETSRQDKAKAMIFLRH  63

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            HL+  LK EY T KDP ELW SLK+R+D   + +LP+A+++W++LR QDFK+V+EYNS +
Sbjct  64   HLDEGLKTEYLTLKDPFELWSSLKERYDHLKATILPRAQYEWIHLRLQDFKTVSEYNSVV  123

Query  77   HKIVSQLKLCKQEVSDTDLIEKTL  6
             +I SQLKLC++ V+D +L+EKTL
Sbjct  124  FRITSQLKLCRKIVNDENLLEKTL  147



>ref|XP_010494165.1| PREDICTED: uncharacterized protein LOC104771345 [Camelina sativa]
Length=345

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF  L + G NY+TWALDV+ YL    L  TI  + T  E +K + ++FLRHH
Sbjct  1    MSNLAKLEFAALDISGKNYMTWALDVKFYLKGNGLLKTIDPSETGLEEEKARTMMFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T ++P +LW +LKDRFD Q  ++LP+AK +WLNLRFQD+KSV+EYNSAL 
Sbjct  61   LHDGLKNEYITRENPADLWIALKDRFDHQKYVILPKAKHEWLNLRFQDYKSVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
             I S++ LC +EVSD D+IEKT 
Sbjct  121  GITSRMALCGEEVSDYDMIEKTF  143



>ref|XP_010478690.1| PREDICTED: uncharacterized protein LOC104757635 [Camelina sativa]
Length=345

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF  L + G NY+TWALDV+ YL    L  TI  + T  E +K + ++FLRHH
Sbjct  1    MSNLAKLEFAALDVSGKNYMTWALDVKFYLKGNGLLKTIDPSETGLEEEKARTMMFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T ++P +LW +LKDRFD Q  ++LP+AK +WLNLRFQD+KSV+EYNSAL 
Sbjct  61   LHDGLKNEYITRENPADLWIALKDRFDHQKYVILPKAKHEWLNLRFQDYKSVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
             I S++ LC +EVSD D+IEKT 
Sbjct  121  GITSRMALCGEEVSDYDMIEKTF  143



>gb|EAZ11596.1| hypothetical protein OsJ_01460 [Oryza sativa Japonica Group]
Length=289

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 109/154 (71%), Gaps = 10/154 (6%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIE----------NSTSDEAQK  285
            MT +AKR+F ELA+ G NYLTWALD +  L + +L N I +          N+    A+K
Sbjct  1    MTYIAKRDFAELAVSGKNYLTWALDTKSCLGAKKLLNCIQDPTIATSAGGVNNLPTSAEK  60

Query  284  VKALIFLRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFK  105
             +AL FLRHHLN  LKNEY TE+DP  LW SLKDR+  Q   +LP+AK +WL+LRFQD+K
Sbjct  61   NQALHFLRHHLNTTLKNEYMTEEDPKVLWDSLKDRYGHQVKALLPKAKREWLHLRFQDYK  120

Query  104  SVTEYNSALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SV +YNS LH+IV+ LKLC ++++D D+I+KTLS
Sbjct  121  SVEQYNSVLHRIVTCLKLCGEKITDADMIDKTLS  154



>ref|XP_010693880.1| PREDICTED: uncharacterized protein LOC104906778 [Beta vulgaris 
subsp. vulgaris]
Length=199

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF  L + G NYL+W LD EI+L + +L +TI E + +    K KA+IFLRHH
Sbjct  1    MSNLTKLEFAALDITGKNYLSWVLDAEIHLDAKDLGDTIKEGNKATSQNKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LK+R+D Q +++LP+A++DWL+LR QDFKSV+EYNSA+ 
Sbjct  61   LHEGLKIEYLTVKDPQVLWSNLKERYDHQKTVILPKARYDWLHLRLQDFKSVSEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I SQLKLC ++++D +++EKT
Sbjct  121  RITSQLKLCGEKITDAEMLEKT  142



>ref|XP_010466947.1| PREDICTED: uncharacterized protein LOC104747075 [Camelina sativa]
Length=345

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF  L + G NY+TWALDV+ YL    L  TI  + T  E +K + ++FLRHH
Sbjct  1    MSNLAKLEFAALDVSGKNYMTWALDVKFYLKGNGLLKTIDPSETGLEEEKARTMMFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T ++P +LW +LKDRFD Q  ++LP+AK +WLNLRFQD+KSV+EYNSAL 
Sbjct  61   LHDGLKNEYITRENPVDLWIALKDRFDHQKYVILPKAKHEWLNLRFQDYKSVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
             I S++ LC +EVSD D+IEKT 
Sbjct  121  GITSRMALCGEEVSDYDMIEKTF  143



>ref|XP_009764303.1| PREDICTED: uncharacterized protein LOC104216046 [Nicotiana sylvestris]
Length=218

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L NTI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLGNTITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK+R+D   + VLP+ +++W++LR QDFK+V+EYNSA+ 
Sbjct  61   LDEGLKVEYLTVKDPLELWTGLKERYDHLKATVLPRTRYEWMHLRLQDFKTVSEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + ++D DL+EKTL+
Sbjct  121  RITSQLKLCGEVMNDEDLLEKTLT  144



>emb|CAN77377.1| hypothetical protein VITISV_020255 [Vitis vinifera]
Length=263

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LDVEI+L +  L NTI E + +      KALIFLRHH
Sbjct  1    MSNLAKLEFVALNISGKNYLSWVLDVEIHLDAMNLGNTIKEGNDASLQDCTKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++  LK EY T KDP  +W +L++R+D Q +++LP+A++DW++LR QDFKSV++YNSAL 
Sbjct  61   IDEGLKGEYLTVKDPFIIWNNLRERYDHQKTVILPKARYDWMHLRLQDFKSVSDYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC ++V+  D++EKT +
Sbjct  121  KISSQLKLCGEKVTKEDMLEKTFT  144



>ref|XP_011100848.1| PREDICTED: uncharacterized protein LOC105178961 [Sesamum indicum]
Length=165

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F+ L + G NYL+W LD E++L S++L  TI EN+ + E    KA+I LRHH
Sbjct  1    MANLTKLDFVALDVSGKNYLSWVLDAELHLASSKLGETIKENTVASEQDCAKAMILLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK++Y T K P +LWKSLKDRFD Q +++LP+A+++W+ LR QDFK++ EYNS + 
Sbjct  61   LHESLKSQYLTVKSPFQLWKSLKDRFDHQKTVILPRARYEWIQLRLQDFKTIAEYNSEMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +IVS+L+LC ++V+D  +++KT S
Sbjct  121  RIVSKLRLCGEDVTDEQMLKKTFS  144



>ref|XP_010695582.1| PREDICTED: uncharacterized protein LOC104908191 [Beta vulgaris 
subsp. vulgaris]
Length=277

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLRHH
Sbjct  1    MSNLAKLEFVALDITGKNYLSWVLDAEIHLAAKGLGNTIKAGNNESDQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP A+++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPEVLWSNLKERYDHQKTMILPSARYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I S+LKLC  +++D +++EKT
Sbjct  121  RITSKLKLCGGKITDDEMLEKT  142



>ref|XP_010681193.1| PREDICTED: uncharacterized protein LOC104896173 [Beta vulgaris 
subsp. vulgaris]
Length=239

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLRHH
Sbjct  1    MSNLAKLEFVALDITGKNYLSWILDAEIHLAAKGLGNTIKAGNNESDQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP A+++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPEVLWSNLKERYDHQKTVILPSARYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I S+LKLC ++++D +++EKT
Sbjct  121  RITSKLKLCGEKITDDEMLEKT  142



>ref|XP_008778764.1| PREDICTED: uncharacterized protein LOC103698516 [Phoenix dactylifera]
Length=157

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD EI+L +  L+NTI E + +    + K +IFLRHH
Sbjct  1    MSNLTKLEFVALDISGKNYLSWILDAEIHLDAMNLENTIKEENQASLQDRAKTMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LK EY T KDP  LW +LK+R++ Q  ++LP+A++DW++LR QDFKSV+EYNSAL 
Sbjct  61   LHEELKTEYLTVKDPLILWNNLKERYEHQKCVILPKARYDWMHLRLQDFKSVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI S LKLC ++V+D D++EKT +
Sbjct  121  KISSLLKLCGEKVTDEDMLEKTFT  144



>ref|XP_004231476.1| PREDICTED: uncharacterized protein LOC101254546 [Solanum lycopersicum]
Length=317

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G +YL+WALD EI+L +  L +TI EN+ +    + KA+IFLRHH
Sbjct  1    MSNLSKLEFLALDILGKSYLSWALDAEIHLDTMGLADTIQENNQASNQNRAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LKDR+D    +VLPQA++DW++LR QDFKS++EYNS++ 
Sbjct  61   LDEGLKMEYLTVKDPLVLWNNLKDRYDHLKLVVLPQARYDWIHLRLQDFKSISEYNSSMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI+SQLKLC + ++D D++EKT S
Sbjct  121  KIISQLKLCGENITDHDMLEKTFS  144



>ref|XP_010673154.1| PREDICTED: uncharacterized protein LOC104889594 [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLRHH
Sbjct  1    MSNLAKLEFVALDITGKNYLSWVLDAEIHLAAKGLGNTIKAGNNESDQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP  +++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPEVLWSNLKERYDHQKTVILPSTRYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I S+LKLC ++++D +++EKT
Sbjct  121  RITSKLKLCGEKITDDEMLEKT  142



>ref|XP_010478536.1| PREDICTED: uncharacterized protein LOC104757488 [Camelina sativa]
Length=294

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A+ E + L + G NY+TWA D  ++L S  L +TI  + T+ +  K KA++FLRHH
Sbjct  1    MSNLARLEILALDVSGKNYMTWASDARMHLRSDGLLSTIDPSKTTSDEDKAKAMVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LKNEY T++DP +LW+SLKDRFD Q  ++LP+A+ +WLNLRF D+KSV E+NSA+ 
Sbjct  61   LHDNLKNEYITKEDPVDLWQSLKDRFDHQKYVILPKARHEWLNLRFLDYKSVGEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +EVSD D+IEKTLS
Sbjct  121  GITSRMALCGEEVSDYDMIEKTLS  144



>ref|XP_010677767.1| PREDICTED: uncharacterized protein LOC104893370 [Beta vulgaris 
subsp. vulgaris]
Length=247

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF  L + G NYL+W LD EI+L + +L +TI E + +    K KA+IFLRHH
Sbjct  1    MSNLTKLEFAALDITGKNYLSWVLDAEIHLDAKDLGDTIKEGNKATSQNKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LK+R+D Q +++LP+A++DWL+LR QDFKSV+EYNSA+ 
Sbjct  61   LHEGLKIEYLTVKDPQALWSNLKERYDHQKTVILPKARYDWLHLRLQDFKSVSEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC +++++ +++EKT +
Sbjct  121  RITSQLKLCGEKITNAEILEKTYT  144



>ref|XP_009798432.1| PREDICTED: uncharacterized protein LOC104244660 [Nicotiana sylvestris]
Length=359

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L+N II+ + +    K K +IFLRHH
Sbjct  1    MSNLSKLEFVALDITGKNYLSWVLDAEIHLAAKALENAIIQGNETSSQDKAKTMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW SLK+R+D   + +LP+A+++W++LR QDFK+V+EYNS + 
Sbjct  61   LDEGLKTEYLTLKDPFELWSSLKERYDHLKATILPRARYEWIHLRLQDFKTVSEYNSTIF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + V+D DL+EKTLS
Sbjct  121  RITSQLKLCGKIVNDEDLLEKTLS  144



>ref|XP_010491896.1| PREDICTED: uncharacterized protein LOC104769391 [Camelina sativa]
Length=322

 Score =   164 bits (414),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A+ E + L + G NY+TWA D  ++L S  L +TI  + T+ +  K KA++FLRHH
Sbjct  1    MSNLARLEILALDVSGKNYMTWASDARMHLRSDGLLSTIDPSKTTSDEDKAKAMVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LKNEY T++DP +LW+SLKDRFD Q  ++LP+A+ +WLNLRF D+KSV E+NSA+ 
Sbjct  61   LHDNLKNEYITKEDPVDLWQSLKDRFDHQKYVILPKARHEWLNLRFLDYKSVGEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +EVSD D+IEKTLS
Sbjct  121  GITSRMALCGEEVSDYDMIEKTLS  144



>ref|XP_010451435.1| PREDICTED: uncharacterized protein LOC104733564 [Camelina sativa]
Length=341

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A+ E + L + G NY+TWA D  ++L S  L +TI  + T+ +  K KA++FLRHH
Sbjct  1    MSNLARLEILALDVSGKNYMTWASDARMHLRSDGLLSTIDPSKTTSDEDKAKAMVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LKNEY T++DP +LW+SLKDRFD Q  ++LP+A+ +WLNLRF D+KSV E+NSA+ 
Sbjct  61   LHDNLKNEYITKEDPVDLWQSLKDRFDHQKYVILPKARHEWLNLRFLDYKSVGEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +EVSD D+IEKTLS
Sbjct  121  GITSRMALCGEEVSDYDMIEKTLS  144



>ref|XP_010466886.1| PREDICTED: uncharacterized protein LOC104747019 [Camelina sativa]
Length=340

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A+ E + L + G NY+TWA D  ++L S  L +TI  + T+ +  K KA++FLRHH
Sbjct  1    MSNLARLEILALDVSGKNYMTWASDARMHLRSDGLLSTIDPSKTTSDEDKAKAMVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LKNEY T++DP +LW+SLKDRFD Q  ++LP+A+ +WLNLRF D+KSV E+NSA+ 
Sbjct  61   LHDNLKNEYITKEDPVDLWQSLKDRFDHQKYVILPKARHEWLNLRFLDYKSVGEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +EVSD D+IEKTLS
Sbjct  121  GITSRMALCGEEVSDYDMIEKTLS  144



>ref|XP_010434008.1| PREDICTED: uncharacterized protein LOC104718045 [Camelina sativa]
Length=340

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A+ E + L + G NY+TWA D  ++L S  L +TI  + T+ +  K KA++FLRHH
Sbjct  1    MSNLARLEILALDVSGKNYMTWASDARMHLRSDGLLSTIDPSKTTSDEDKAKAMVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LKNEY T++DP +LW+SLKDRFD Q  ++LP+A+ +WLNLRF D+KSV E+NSA+ 
Sbjct  61   LHDNLKNEYITKEDPVDLWQSLKDRFDHQKYVILPKARHEWLNLRFLDYKSVGEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +EVSD D+IEKTLS
Sbjct  121  GITSRMALCGEEVSDYDMIEKTLS  144



>ref|XP_010317354.1| PREDICTED: uncharacterized protein LOC104646059 [Solanum lycopersicum]
Length=275

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRFQDFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRARYEWMHLRFQDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_011070180.1| PREDICTED: uncharacterized protein LOC105155895 [Sesamum indicum]
Length=165

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F+ L + G NYL+W LD E++L S++L  TI EN+ + E    KA+I LRHH
Sbjct  1    MANLTKLDFVALDVSGKNYLSWVLDAELHLASSKLGETIKENTVASEQDCAKAMILLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK++Y T K   +LWKSLKDRFD Q +++LP+A+++W+ LR QDFK++ EYNS + 
Sbjct  61   LHESLKSQYLTVKSHFQLWKSLKDRFDHQKTVILPRARYEWIQLRLQDFKTIAEYNSEMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +IVS+L+LC ++V+D  ++EKT S
Sbjct  121  RIVSKLRLCGEDVTDEQMLEKTFS  144



>ref|XP_010684163.1| PREDICTED: uncharacterized protein LOC104898758 [Beta vulgaris 
subsp. vulgaris]
Length=346

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF  L + G NYL+W LD EI+L + +L +TI E + +    K KA+IFLRHH
Sbjct  1    MSNLTKLEFAALDITGKNYLSWVLDAEIHLDAKDLGDTIKEGNKATSQNKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LK+R+D Q +++LP+A++DWL+LR QDFKSV+EYNSA+ 
Sbjct  61   LHEGLKIEYLTVKDPQVLWSNLKERYDHQKTVILPKARYDWLHLRLQDFKSVSEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC ++++D +++EKT +
Sbjct  121  RITSQLKLCGEKITDAEMLEKTYT  144



>ref|XP_010695630.1| PREDICTED: uncharacterized protein LOC104908233 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLRHH
Sbjct  1    MSNLAKLEFVALDITGKNYLSWVLDAEIHLAAKGLGNTIKAGNNESDQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP A+++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPEVLWSNLKERYDHQKTVILPSARYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S+LKLC ++++D +++EKT +
Sbjct  121  RITSKLKLCGEKITDDEMLEKTYT  144



>ref|XP_010694402.1| PREDICTED: uncharacterized protein LOC104907206 [Beta vulgaris 
subsp. vulgaris]
Length=344

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF  L + G NYL+W LD EI+L + +L +TI E + +    K KA+IFLRHH
Sbjct  1    MSNLTKLEFAALDITGKNYLSWVLDAEIHLDAKDLGDTIKEGNKATSQNKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LK+R+D Q +++LP+A++DWL+LR QDFKSV+EYNSA+ 
Sbjct  61   LHEGLKIEYLTVKDPQVLWSNLKERYDHQKTVILPKARYDWLHLRLQDFKSVSEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC ++++D +++EKT +
Sbjct  121  RITSQLKLCGEKITDAEMLEKTYT  144



>ref|XP_010445368.1| PREDICTED: uncharacterized protein LOC104728024 [Camelina sativa]
Length=341

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A+ E + L + G NY+TWA D +++L S  + +TI  + T+ +  K KA++FLRHH
Sbjct  1    MSNLARLEILALDVSGKNYMTWASDAQMHLRSDGVLSTIDPSETTSDEDKAKAMVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LKNEY T++DP +LW+SLKDRFD Q  ++LP+A+ +WLNLRF D+KSV E+NSA+ 
Sbjct  61   LHDNLKNEYITKEDPVDLWQSLKDRFDHQKYVILPKARHEWLNLRFLDYKSVGEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +EVSD D+IEKTLS
Sbjct  121  GITSRMALCGEEVSDYDMIEKTLS  144



>ref|XP_010667383.1| PREDICTED: uncharacterized protein LOC104884435 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=354

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLRHH
Sbjct  1    MSNLAKLEFVALDITGKNYLSWVLDAEIHLAAKGLGNTIKAGNNESDQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP A+++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPEVLWSNLKERYDHQKTVILPSARYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S+LKLC ++++D +++EKT +
Sbjct  121  RITSKLKLCGEKITDDEMLEKTYT  144



>gb|AAK84482.1| unknown [Solanum lycopersicum]
Length=319

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRFQDFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRARYEWMHLRFQDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_010456707.1| PREDICTED: uncharacterized protein LOC104738191 [Camelina sativa]
Length=341

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A+ E + L + G NY+TWA D  ++L S  L +TI  + T+ +  K KA++FLRHH
Sbjct  1    MSNLARLEILALDVSGKNYMTWASDARMHLRSDGLLSTIDPSKTTSDEDKAKAMVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LKNEY T++DP +LW+SLKDRFD Q  ++LP+A+ +WLNLRF D+KSV E+NSA+ 
Sbjct  61   LHDNLKNEYITKEDPVDLWQSLKDRFDHQKYVILPKARHEWLNLRFLDYKSVGEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +EVS+ D+IEKTLS
Sbjct  121  GITSRMALCGEEVSNYDMIEKTLS  144



>ref|XP_004251340.1| PREDICTED: uncharacterized protein LOC101250662 [Solanum lycopersicum]
Length=315

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLATKGLDATITQGNEASSKDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EYPT KDP ELW  L  R+D   + +LP+A+++W++LRFQDFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYPTVKDPLELWTDLNGRYDHLKATMLPRARYEWMHLRFQDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D +EKTL+
Sbjct  121  RITSQLKLCGETIKDEDTLEKTLT  144



>ref|XP_009104473.1| PREDICTED: uncharacterized protein LOC103830446 [Brassica rapa]
Length=333

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++  EF  L + G+NYL WALD E  L++  L+ TI+E + +    K KA+IFLRHH
Sbjct  1    MSKISSLEFEVLDITGNNYLAWALDAEFSLSAKGLEGTILEGNQAGNQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ DLKNEY T KDP  LW  LK+R+D Q +++LP+A+++W +LR QDFKSV++YNSAL 
Sbjct  61   LHGDLKNEYLTVKDPQVLWSDLKERYDHQKTVILPKARYEWAHLRLQDFKSVSDYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI S+L+LC +++++ D +EKT S
Sbjct  121  KITSKLELCGEKITEADKLEKTFS  144



>ref|XP_010673982.1| PREDICTED: uncharacterized protein LOC104890258 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLRHH
Sbjct  1    MSNLAKLEFVALDITGKNYLSWVLDAEIHLAAKGLGNTIKAGNNESDQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP  +++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPEVLWSNLKERYDHQKTVILPSTRYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S+LKLC ++++D +++EKT +
Sbjct  121  RITSKLKLCGEKITDDEMLEKTYT  144



>ref|XP_010322038.1| PREDICTED: uncharacterized protein LOC104647892 [Solanum lycopersicum]
Length=336

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G +YL+W LD EI+L +  L +TI EN+ +    + KA+IF RHH
Sbjct  1    MSNLSKLEFLALDISGKSYLSWVLDAEIHLDAMGLADTIQENNEASNQNRAKAMIFFRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LKDR+D    +VLPQA++DW++LR QDFKS++EYNS++ 
Sbjct  61   LDEGLKMEYLTVKDPLVLWNNLKDRYDHLKLVVLPQARYDWIHLRLQDFKSISEYNSSMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
            KI+SQLKLC + ++D D++EKT 
Sbjct  121  KIISQLKLCGENITDHDMLEKTF  143



>ref|XP_009763091.1| PREDICTED: uncharacterized protein LOC104215050 [Nicotiana sylvestris]
Length=211

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L+NTII+ + +    K KA++FLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKALENTIIQGNEASGQDKAKAIVFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP +LW SLK+R+D   + VLP+ +++W++L  QDFK+V+EYNS + 
Sbjct  61   LDEGLKTEYLTLKDPFKLWSSLKERYDHLKATVLPRTRYEWIHLHLQDFKTVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKL  + V+D DL+EKTLS
Sbjct  121  RITSQLKLWGEIVNDEDLLEKTLS  144



>ref|XP_010685542.1| PREDICTED: uncharacterized protein LOC104899944 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674822.1| PREDICTED: uncharacterized protein LOC104890903 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676970.1| PREDICTED: uncharacterized protein LOC104892678 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010693055.1| PREDICTED: uncharacterized protein LOC104906050 [Beta vulgaris 
subsp. vulgaris]
Length=344

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF  L + G NYL+W LD EI+L + +L +TI   + +    K KA+IFLRHH
Sbjct  1    MSNLTKLEFAALDITGKNYLSWVLDAEIHLDAKDLGDTIKAGNKATSQNKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LK+R+D Q +++LP+A++DWL+LR QDFKSV+EYNSA+ 
Sbjct  61   LHEGLKIEYLTVKDPQVLWSNLKERYDHQKTVILPKARYDWLHLRLQDFKSVSEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC ++++D +++EKT +
Sbjct  121  RITSQLKLCGEKITDAEMLEKTYT  144



>ref|XP_010541843.1| PREDICTED: uncharacterized protein LOC104815222 isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +   +   L   G NY+TWALD +++L + E+  TI +   + EA K KA+IFLRHH
Sbjct  1    MSNLVNLKIAALDASGKNYMTWALDAKMHLKAKEIVTTIDKKQKTSEADKAKAIIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T++DP +LW+SLKDRFD Q  ++ P+AK DWLNLRFQDFKSV EYNSA+ 
Sbjct  61   LDDVLKDEYRTKEDPADLWESLKDRFDHQKYVIHPKAKHDWLNLRFQDFKSVREYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+S+L+LC+++VS+ D +EKTLS
Sbjct  121  EIISRLELCEEKVSEHDKLEKTLS  144



>ref|XP_009599254.1| PREDICTED: uncharacterized protein LOC104094937, partial [Nicotiana 
tomentosiformis]
Length=318

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L+N II+ +      K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKALENIIIQGNEISGQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW SLK+R+D   + +LP+A+++W++LR QDFK+V+EYNS + 
Sbjct  61   LDEWLKTEYLTLKDPFELWSSLKERYDHLKATILPRARYEWIHLRLQDFKTVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + ++D DL+EKTLS
Sbjct  121  RITSQLKLCGKIMNDEDLLEKTLS  144



>ref|XP_010671935.1| PREDICTED: keratin, type I cytoskeletal 9-like [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF  L + G NYL+W LD EI+L + +L +TI   + +    K KA+IFLRHH
Sbjct  1    MSNLTKLEFAALDITGKNYLSWVLDAEIHLDAKDLGDTIKAGNKATSQNKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LW +LK+R+D Q +++LP+A++DWL+LR QDFKSV+EYNSA+ 
Sbjct  61   LHEGLKIEYLTVKDPQVLWSNLKERYDHQKTVILPKARYDWLHLRLQDFKSVSEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC ++++D +++EKT +
Sbjct  121  RITSQLKLCGEKITDAEMLEKTYT  144



>ref|XP_010312898.1| PREDICTED: uncharacterized protein LOC104644539 [Solanum lycopersicum]
Length=352

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRFQDFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRARYEWMHLRFQDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_009626992.1| PREDICTED: uncharacterized protein LOC104117623 [Nicotiana tomentosiformis]
Length=211

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  ++K EF+ L + G+N+L W LD EI+L +  L +TI + + +    K KA+IFLRHH
Sbjct  1    MLNLSKLEFVALDISGNNHLPWLLDAEIHLDAKGLGDTIKKGNEASSEDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T KDP +LW SLK+R+D   + VLP+A+ +W++LR QD+K+++EYNSA++
Sbjct  61   LDEGLKSEYLTLKDPFQLWTSLKERYDHLKATVLPRARREWMHLRLQDYKTISEYNSAVY  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+SQLKLC++ ++D D++EKTLS
Sbjct  121  RIISQLKLCEEPMNDEDMLEKTLS  144



>ref|XP_004235099.1| PREDICTED: uncharacterized protein LOC101249439 [Solanum lycopersicum]
Length=352

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAEGLDATITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRFQDFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRARYEWMHLRFQDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_009586969.1| PREDICTED: uncharacterized protein LOC104084730 [Nicotiana tomentosiformis]
Length=211

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD EI+  +  ++NTII+ +   +  K KA+IFL HH
Sbjct  1    MSNLPKLEFVTLDISGKNYLSWVLDAEIHFAAKAIKNTIIQGNKISDQDKAKAMIFLCHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY   KDP ELW SLK+R+D   + +LP+A+++W++LR Q+FK+V+EYNS + 
Sbjct  61   LDEGLKTEYLILKDPFELWSSLKERYDHLKATILPRARYEWIHLRLQNFKTVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I SQLKLC + V+D DL+EKTLS
Sbjct  121  MITSQLKLCGEIVNDEDLLEKTLS  144



>ref|XP_004252118.1| PREDICTED: uncharacterized protein LOC101264598 [Solanum lycopersicum]
Length=352

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVPLDISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRFQDFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRARYEWMHLRFQDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_009798929.1| PREDICTED: uncharacterized protein LOC104245073 [Nicotiana sylvestris]
 ref|XP_009798930.1| PREDICTED: uncharacterized protein LOC104245073 [Nicotiana sylvestris]
Length=355

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L NTI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLGNTITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK+R+D   + VLP+A+++W++LR QDFK V+EYNS + 
Sbjct  61   LDEGLKVEYLTVKDPLELWTGLKERYDHLKATVLPKARYEWMHLRLQDFKIVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + ++D DL+EKTL+
Sbjct  121  RITSQLKLCGEVMNDEDLLEKTLT  144



>ref|XP_010541842.1| PREDICTED: uncharacterized protein LOC104815222 isoform X1 [Tarenaya 
hassleriana]
Length=384

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +   +   L   G NY+TWALD +++L + E+  TI +   + EA K KA+IFLRHH
Sbjct  43   MSNLVNLKIAALDASGKNYMTWALDAKMHLKAKEIVTTIDKKQKTSEADKAKAIIFLRHH  102

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T++DP +LW+SLKDRFD Q  ++ P+AK DWLNLRFQDFKSV EYNSA+ 
Sbjct  103  LDDVLKDEYRTKEDPADLWESLKDRFDHQKYVIHPKAKHDWLNLRFQDFKSVREYNSAMF  162

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+S+L+LC+++VS+ D +EKTLS
Sbjct  163  EIISRLELCEEKVSEHDKLEKTLS  186



>ref|XP_011079447.1| PREDICTED: uncharacterized protein LOC105162964 [Sesamum indicum]
Length=256

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F+ L + G NYL+W LD E++L S++L  TI EN+ + E    KA+I LRHH
Sbjct  1    MANLTKLDFVALDVSGKNYLSWVLDAELHLASSKLGETIKENTVASEQDCAKAMILLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK++Y T K   +LWKSLKDRFD Q +++LP+A+++W+ LR QDFK++ EYNS + 
Sbjct  61   LHESLKSQYLTVKSHFQLWKSLKDRFDHQKTVILPRARYEWIQLRLQDFKTIAEYNSEMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +IVS+L+LC ++V+D  ++EKT S
Sbjct  121  RIVSKLRLCGEDVTDEQMLEKTFS  144



>ref|XP_008391278.1| PREDICTED: uncharacterized protein LOC103453518 [Malus domestica]
Length=171

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I+L +  L +TI E S+S    + KA+IF+R H
Sbjct  1    MTNLAKLEYAALDITGKNYLTWVLDTKIHLEAGNLGDTIREESSSSSQNRAKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            LN  LK+EY T +DP  LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   LNEALKSEYLTVEDPLALWEALRSRYNHQTTVILPKARYEWSHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   ++   L+EKT S
Sbjct  121  RITSQMKLCGDTITXEXLLEKTYS  144



>emb|CAN82314.1| hypothetical protein VITISV_015643 [Vitis vinifera]
Length=330

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD E++L +  L  TI + + +    + KALIFLRHH
Sbjct  1    MSNITKLEFVALDISGKNYLSWILDAELHLDAMNLXATIKQGNQASLQDRAKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP+A++DW++LR QDFK+V+E NSAL 
Sbjct  61   LHEGLKNEYLTVKDPFTLWSNLKERYDHQKTVILPKARYDWMHLRLQDFKTVSECNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC +++++ D++EKT +
Sbjct  121  KISSQLKLCGEKITEEDMLEKTFT  144



>ref|XP_011075270.1| PREDICTED: uncharacterized protein LOC105159783 [Sesamum indicum]
Length=212

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F+ L + G NYL+W LD E++L S++L  TI EN+ + E    KA+I LRHH
Sbjct  1    MANLTKLDFVALDVSGKNYLSWVLDAELHLASSKLGETIKENTVASEQDCAKAMILLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK++Y T K   +LWKSLKDRFD Q +++LP+A+++W+ LR +DFK++ EYNS + 
Sbjct  61   LHESLKSQYLTVKSIFQLWKSLKDRFDHQKTVILPRARYEWIQLRLEDFKTIAEYNSEMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +IVS+L+LC ++V+D  ++EKT S
Sbjct  121  RIVSKLRLCGEDVTDEQILEKTFS  144



>ref|XP_009613067.1| PREDICTED: uncharacterized protein LOC104106268 [Nicotiana tomentosiformis]
Length=343

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G+NYL W LDVEI+L +  L +TI E + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFMVLDISGNNYLPWVLDVEIHLDAKGLGDTIKEGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK++Y T KDP +LW SLK+R+DR  + VLP+A+ +W++LR QD+K+++EYNS ++
Sbjct  61   LDEGLKSKYLTLKDPFQLWTSLKERYDRLKATVLPRARREWMHLRLQDYKTISEYNSVVY  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+ QLKLC + ++D D++EKTLS
Sbjct  121  RIIFQLKLCGEPMNDEDMLEKTLS  144



>ref|XP_009615854.1| PREDICTED: uncharacterized protein LOC104108500 [Nicotiana tomentosiformis]
Length=233

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L+NTII+ + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVVLDISGKNYLSWVLDAEIHLAAKALKNTIIQENKTSCQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP +LW SLK+R+D   + +LP+A+++ ++LR   FK+V+EYNS + 
Sbjct  61   LDGGLKTEYLTLKDPFKLWSSLKERYDHLKATILPRARYELIHLRLHIFKTVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + V+D DL+EKTLS
Sbjct  121  RITSQLKLCGKIVNDEDLLEKTLS  144



>gb|KCW64414.1| hypothetical protein EUGRSUZ_G02034 [Eucalyptus grandis]
Length=334

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F  L + G NYL+W LD+E++L    L NTI E+ TS+E  K  ALIF+R H
Sbjct  1    MANIEKPKFHILEVSGKNYLSWCLDMEMHLQGQGLANTITEDGTSNEKDKANALIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  L+ +Y + +DPH LW+ LKDR+D   +++LPQA++DW NLR QDFKSV++YNSAL 
Sbjct  61   LHESLQTQYLSVRDPHILWRRLKDRYDHTKTVILPQAQYDWQNLRLQDFKSVSDYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             IVS+L+LC  +++D +L+EKT S
Sbjct  121  DIVSRLELCSIKLTDAELLEKTFS  144



>ref|XP_010682012.1| PREDICTED: uncharacterized protein LOC104896921 [Beta vulgaris 
subsp. vulgaris]
Length=340

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLR+H
Sbjct  1    MSNLAKLEFVALDITGKNYLSWVLDAEIHLAAKGLGNTIKAGNNESDQDKAKAMIFLRYH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP A+++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPDLLWSNLKERYDHQKTVILPSARYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S+LKLC ++++D +++E T +
Sbjct  121  RITSKLKLCGEKITDEEMLENTYT  144



>ref|XP_009789585.1| PREDICTED: uncharacterized protein LOC104237180 [Nicotiana sylvestris]
Length=355

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L NTI   + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLGNTITHGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK+ +D   + VLP+A++ W++LR QDFK+V+EYNS L 
Sbjct  61   LDEGLKVEYLTVKDPLELWTGLKEMYDHLKATVLPRARYKWMHLRLQDFKTVSEYNSTLF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + ++D DL+EKTL+
Sbjct  121  RITSQLKLCGEVMNDEDLLEKTLT  144



>ref|XP_004231307.1| PREDICTED: uncharacterized protein LOC101251134 [Solanum lycopersicum]
Length=352

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRF DFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRARYEWMHLRFHDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RINSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_010678303.1| PREDICTED: uncharacterized protein LOC104893872 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI   +   +  K KA+IFLRHH
Sbjct  1    MSNLAKLEFVALDITGKNYLSWILDAEIHLAAKGLGNTINAGNNESDQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP A+++WLNLR QD+KS+++YNSA+ 
Sbjct  61   LHEALKNEYLTVKDPEVLWSNLKERYDHQKTVILPSARYEWLNLRLQDYKSISDYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S+LKL  ++++D +++EKT +
Sbjct  121  RITSKLKLRGEKITDDEMLEKTYT  144



>ref|XP_004233677.1| PREDICTED: uncharacterized protein LOC101243760 [Solanum lycopersicum]
Length=352

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L   I + + +    K K +IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGLDAAITQGNEASSQDKAKTMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRFQDFK+V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRARYEWMHLRFQDFKTVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_009601014.1| PREDICTED: uncharacterized protein LOC104096354 [Nicotiana tomentosiformis]
Length=211

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L +   NYL+W LD EI+L +  L NTII+ + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDITEKNYLSWVLDAEIHLDAKGLGNTIIQENEASNQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW +LKDR+D     VLP+A+++W++LR QDFK+V+EYNSA+ 
Sbjct  61   LHEGLKTEYLTVKDPLELWINLKDRYDHLKLTVLPKARYEWIHLRLQDFKTVSEYNSAIF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            K+ S LKLC   ++D DL++K  S
Sbjct  121  KVSSLLKLCGDTITDEDLLKKIFS  144



>emb|CAN60947.1| hypothetical protein VITISV_015758 [Vitis vinifera]
Length=1306

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD E++L +  L  TI + + +    + KALIFLRHH
Sbjct  1    MSNITKLEFVALDISGKNYLSWILDAELHLDAMNLGATIKQGNQASLQDRAKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP+A++DW++LR QDFK+V+EYNSAL 
Sbjct  61   LHEGLKNEYLTVKDPFTLWSNLKERYDHQKTVILPKARYDWMHLRLQDFKTVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC +++++ D++EKT +
Sbjct  121  KISSQLKLCGEKITEEDMLEKTFT  144



>ref|XP_004245367.1| PREDICTED: uncharacterized protein LOC101261349 [Solanum lycopersicum]
Length=498

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L +   +YL+WALDVEI+L +  L +TI EN+ +    + KA+IFLRHH
Sbjct  1    MSNLSKLEFLALDISRKSYLSWALDVEIHLDAMGLADTIQENNQASNQNRAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KD  ELW +LKDR+D    +VLPQA++DW++LR QDFKS++EY S++ 
Sbjct  61   LDEGLKMEYLTVKDSLELWNNLKDRYDHLKLVVLPQARYDWIHLRLQDFKSISEYKSSMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI+SQLKLC + ++D D++EK  S
Sbjct  121  KIISQLKLCGENITDHDMLEKMFS  144



>ref|XP_010540305.1| PREDICTED: uncharacterized protein LOC104814122 [Tarenaya hassleriana]
Length=346

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +   E   L   G NY+TW  D +++L + E+  TI +  T+ EA K KA+IF+R H
Sbjct  1    MSNLVNLEIAALDAYGKNYMTWTFDAKMHLKAKEIVKTIDKGQTTSEADKAKAIIFMRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T+++P +LW+SL+DRFD Q  ++ P+AK DWLN+RFQDFKSV EYNSA+ 
Sbjct  61   LDDALKDEYRTKENPADLWESLRDRFDHQKYVIHPRAKHDWLNMRFQDFKSVREYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+S+L+LC ++VSD D +EKTLS
Sbjct  121  EIISRLELCGEKVSDHDKLEKTLS  144



>emb|CAN77974.1| hypothetical protein VITISV_006175 [Vitis vinifera]
Length=1501

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD E++L +  L  TI + + +    + KALIFLRHH
Sbjct  1    MSNITKLEFVALDISGKNYLSWILDAELHLDAMNLGATIKQGNQASLQDRAKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP+A++DW++LR QDFK+V+EYNSAL 
Sbjct  61   LHEGLKNEYFTVKDPFTLWSNLKERYDHQKTVILPKARYDWMHLRLQDFKTVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC +++++ D++EKT +
Sbjct  121  KISSQLKLCGEKITEEDMLEKTFT  144



>ref|XP_009121262.1| PREDICTED: uncharacterized protein LOC103846095 [Brassica rapa]
Length=334

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K E   L + G+NY+TWA+  +++L    L  TI  + T  + +K KA+IFLRHH
Sbjct  1    MSNLTKLEINALDITGNNYMTWAVGAKMHLRGNGLLETIDSSKTVSDEKKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++  LK+EY T++DP +LWKSLK+RFD Q  ++LP+AK +W++LRFQD+KSV+E+NSA+ 
Sbjct  61   IHDGLKDEYITKEDPCDLWKSLKERFDHQKYVILPKAKHEWIHLRFQDYKSVSEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +++SD D+IEKTLS
Sbjct  121  GITSRMMLCGEKISDYDMIEKTLS  144



>ref|XP_009145335.1| PREDICTED: uncharacterized protein LOC103869047 [Brassica rapa]
Length=279

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K E   L + G+NY+TWA+  +++L    L   I  + T  + +K KA+IFLRHH
Sbjct  1    MSNLTKLEINALDITGNNYMTWAVGAKMHLRGNGLLEIIDSSKTVSDERKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++  LK+EY T++DP +LWKSLK+RFD Q  ++LP+AK +W++LRFQD+KSV+E+NSA+ 
Sbjct  61   IHDGLKDEYITKEDPCDLWKSLKERFDHQKYVILPKAKHEWIHLRFQDYKSVSEFNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I S++ LC +++SD D+IEKTLS
Sbjct  121  GITSRMMLCGEKISDYDMIEKTLS  144



>ref|XP_011076490.1| PREDICTED: uncharacterized protein LOC105160709 [Sesamum indicum]
Length=375

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F+ L +   NYL+W LD +++L S++L  TI EN+ + E    KA+I LRHH
Sbjct  1    MANLTKLDFVALDVSEKNYLSWVLDAKLHLASSKLGETIKENTIASEQDCAKAMILLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK++Y T K P +LWKSLKDRFD Q +++LP+A+++W+ LR QDFK++ EYNSA+ 
Sbjct  61   LHESLKSQYLTVKSPFQLWKSLKDRFDHQKTVILPRARYEWIQLRLQDFKTIVEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +IVS+L+LC ++V+D  ++EK  S
Sbjct  121  QIVSKLRLCGEDVTDEQMLEKIFS  144



>emb|CAN77859.1| hypothetical protein VITISV_005455 [Vitis vinifera]
Length=343

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD E++L +  L  TI + + +    + KALIFL HH
Sbjct  1    MSNITKLEFVALDISGKNYLSWILDTELHLDAMNLGATIKQGNQASLQDRTKALIFLLHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R D Q +++LP+A++DW++LR QDFK+V+EYNS+L 
Sbjct  61   LHESLKNEYLTVKDPSTLWSNLKERHDHQKTVILPKARYDWMHLRLQDFKTVSEYNSSLF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC ++++  D++EKT +
Sbjct  121  KINSQLKLCGEKITKKDMLEKTFT  144



>ref|XP_008342091.1| PREDICTED: uncharacterized protein LOC103404905 [Malus domestica]
Length=298

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I+L +  L +TI E S+     + KA+IF+R H
Sbjct  1    MTNLAKLEYAALDITGKNYLTWVLDTKIHLEAGNLGDTIREESSXSSQNRAKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +DP  LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   LDEALKSEYLTIEDPLALWEALRSRYNHQTTVILPKARYEWSHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   ++D  L+EKT S
Sbjct  121  RITSQMKLCGDTITDEMLLEKTYS  144



>emb|CAN66814.1| hypothetical protein VITISV_041767 [Vitis vinifera]
Length=268

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 104/145 (72%), Gaps = 1/145 (1%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K EF+ L + G NYL+W LD E++L +  L  TI E + +      KALIFLRHH
Sbjct  1    MPNITKLEFVALDISGKNYLSWILDAELHLDAMNLGATIKEGNQASLQDHAKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLR-FQDFKSVTEYNSAL  78
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP+A++DW++LR  QDFK+++EYNSAL
Sbjct  61   LHEGLKNEYLTIKDPFTLWSNLKERYDHQKTVILPKARYDWMHLRLLQDFKTISEYNSAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
             KI SQLKL  +++++ D++EKT +
Sbjct  121  FKISSQLKLYGEKITEEDILEKTFT  145



>emb|CAN66208.1| hypothetical protein VITISV_035070 [Vitis vinifera]
Length=1496

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD E++L +  L  TI + + +    + KALIFLRH+
Sbjct  1    MSNITKLEFVALDISGKNYLSWILDAELHLDAMNLGATIKQGNQASLQDRAKALIFLRHN  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T KDP  LW +LK+R+D Q +++LP+A++DW++LR QDFK+V+EYNSAL 
Sbjct  61   LHEGLKNEYLTVKDPFTLWSNLKERYDHQKTVILPKARYDWMHLRLQDFKTVSEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC +++++ D++EKT +
Sbjct  121  KISSQLKLCGEKITEEDMLEKTFT  144



>gb|KEH22941.1| Copia-like polyprotein/retrotransposon, putative [Medicago truncatula]
Length=165

 Score =   149 bits (376),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K  F  L + G NYLTWA+D E+YL +    + I E + + E QK KALIFLRHH
Sbjct  1    MSNLSKLHFEVLKISGHNYLTWAVDAEMYLAAEGNADAIKEGNKASEQQKAKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            +N  LKNEY T KDP  LW  LKDR++   +++LP+A++DW++LR QD+KSVT YNS ++
Sbjct  61   INEALKNEYLTVKDPLVLWNKLKDRYEHLKAIILPKARYDWMHLRLQDYKSVTAYNSEVY  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            KI SQL+LC ++    + + ++
Sbjct  121  KITSQLELCGEKFKKLESVNRS  142



>ref|XP_008392734.1| PREDICTED: uncharacterized protein LOC103454916 [Malus domestica]
Length=185

 Score =   149 bits (377),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L +   NYLTW LD +I+L +  L +TI E S+S    + KA+IF+R H
Sbjct  1    MTNLAKLEYAALDITXKNYLTWVLDTKIHLEAGNLGDTIREESSSSSQNRAKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+ Y T +DP  LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   LDXALKSXYLTVEDPLALWEALRSRYNHQTTVILPKARYEWSHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   ++D  L+EKT S
Sbjct  121  RITSQMKLCGDTITDEILLEKTYS  144



>ref|XP_009607502.1| PREDICTED: uncharacterized protein LOC104101709 [Nicotiana tomentosiformis]
Length=157

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G+NYL+W LD EI+L +  L +TI E + +    K KA+IFLR H
Sbjct  1    MSNLSKLEFMTLDISGNNYLSWVLDAEIHLDAKGLGDTIKEGNEASSKDKAKAIIFLRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK++Y T KD  +LW  LK+R D   + VLP+A+ +W++LR QD+K+++EYNS ++
Sbjct  61   LDEGLKSKYLTLKDQFQLWTGLKERHDHVKATVLPRARHEWMHLRLQDYKTISEYNSVVY  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
            +I+SQLKLC++ ++D D++EKTL
Sbjct  121  RIISQLKLCEEPMNDEDMLEKTL  143



>ref|XP_009610481.1| PREDICTED: uncharacterized protein LOC104104178 [Nicotiana tomentosiformis]
Length=211

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G+NYL W  D EI+L +  L +TI E + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFMALDICGNNYLPWVFDAEIHLDAKGLGDTIKEGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T KDP +LW SLK+R+D     VL +++ +W++LR QD+K+++EYNS ++
Sbjct  61   LDEGLKSEYLTLKDPFQLWTSLKERYDHLKVTVLLRSRREWMHLRLQDYKNISEYNSIVY  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+SQLKLC + ++D D++EKTLS
Sbjct  121  RIISQLKLCGKPMNDEDMLEKTLS  144



>ref|XP_009593720.1| PREDICTED: uncharacterized protein LOC104090362 [Nicotiana tomentosiformis]
 ref|XP_009596404.1| PREDICTED: uncharacterized protein LOC104092499 [Nicotiana tomentosiformis]
Length=303

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +   +NTII+ +   +  K K +IFLRHH
Sbjct  1    MSNLSKFEFVALDISGKNYLSWVLDAEIHLAAKAPENTIIQVNEVSDQDKAKTMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T K+  ELW SLK+R+D   +++LP+A+++W++LR Q+FK+V+EYNS + 
Sbjct  61   LDEGLKTEYLTLKELFELWSSLKERYDHLKAMILPRARYEWIHLRLQNFKNVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ KLC + V+D DL+EK LS
Sbjct  121  RITSQFKLCGEIVNDEDLLEKNLS  144



>ref|XP_009774472.1| PREDICTED: uncharacterized protein LOC104224495 [Nicotiana sylvestris]
Length=239

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = -3

Query  410  FIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNE  231
            F+ L + G NYL+W LDVEI+L +  L NTI   + +    K KA+IFLR HL+  LK E
Sbjct  48   FVALDISGKNYLSWVLDVEIHLDAKGLGNTITHGNEASSQDKAKAVIFLRRHLDEGLKVE  107

Query  230  YPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKL  51
            Y T KDP ELW  LK+++D   + +LP+A+++W++LR QDFK+V+EYNS + +I SQLKL
Sbjct  108  YLTVKDPLELWTGLKEKYDHLKATILPRARYEWIHLRLQDFKTVSEYNSTVFRITSQLKL  167

Query  50   CKQEVSDTDLIEKTLS  3
            C + ++D DL+EKTL+
Sbjct  168  CGEVMNDEDLLEKTLT  183



>ref|XP_004252419.1| PREDICTED: uncharacterized protein LOC101248177 [Solanum lycopersicum]
Length=328

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W L+ EI+L +  L +TI + + +    K KA+IFLR H
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLEAEIHLAAKCLDSTITQGNEASSQDKAKAMIFLRDH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+    + VLP+A+++W++LRFQDFK+V EYNS + 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYHHLKATVLPRARYEWMHLRFQDFKTVIEYNSIVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC++ + D D++EKTL+
Sbjct  121  KITSQLKLCRETIKDEDMLEKTLT  144



>ref|XP_004240332.1| PREDICTED: uncharacterized protein LOC101255496 [Solanum lycopersicum]
Length=319

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  ++K EF+ L + G NYL+W LD EI L +  L  T  + + +    K KA+IFLR+H
Sbjct  1    MLNLSKLEFVALDISGKNYLSWVLDAEIQLAAKGLDATTTQGNEASSQDKAKAMIFLRNH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A+++W++LRFQDFK V EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKAKVLPRARYEWMHLRFQDFKIVIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_004234725.1| PREDICTED: uncharacterized protein LOC101246320 [Solanum lycopersicum]
Length=301

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L L G+NYL+W LD EI+L +  L  TI   +T+    KVK +IFLRHH
Sbjct  1    MSKLSKLEFVALDLSGNNYLSWVLDAEIHLDARGLGVTITNCNTTSSQDKVKTMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            LN  LK EY T KD  +LW SLK+R+D   + VLP+A ++W++LR Q+FK++ EY S ++
Sbjct  61   LNEGLKVEYLTVKDSLDLWTSLKERYDHLKATVLPRACYEWIHLRLQNFKTICEYISVVY  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
            KI SQLKLC + + D D++EKTL
Sbjct  121  KITSQLKLCGENIKDEDMLEKTL  143



>ref|XP_009759843.1| PREDICTED: uncharacterized protein LOC104212322 [Nicotiana sylvestris]
Length=270

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G+NYL+W  D EIYL +  L + I E + +    K KA+IFLRHH
Sbjct  60   MSNLSKLEFMALDISGNNYLSWVFDAEIYLDAKSLGDIIKEGNEASSQDKTKAMIFLRHH  119

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T KDP +LW SLK R+D   + VLP+A+ +W++LR QD+K++ EYNS ++
Sbjct  120  LDEGLKSEYLTLKDPFQLWTSLKKRYDHLKATVLPRARREWMHLRLQDYKTINEYNSVVY  179

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
            +I+ QLKLC + ++D ++++KTL
Sbjct  180  RIIFQLKLCGEPMNDENMLKKTL  202



>ref|XP_008346258.1| PREDICTED: uncharacterized protein LOC103409222 [Malus domestica]
Length=185

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I+L +  L + I E S+S    + KA+IF+R H
Sbjct  1    MTNLAKLEYAALDITGKNYLTWVLDTKIHLEAXNLGDAIREESSSSSQNRAKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +DP  LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   LDEALKSEYLTVEDPLALWEALRSRYNHQTTMILPKARYEWSHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I SQ+KL    ++D  L+EKT
Sbjct  121  RITSQMKLYGDTITDEILLEKT  142



>ref|XP_004231656.1| PREDICTED: uncharacterized protein LOC101250848 [Solanum lycopersicum]
Length=275

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K E + L + G NYL+W LD EI+L +  L  TI + + +    K KA+I +RHH
Sbjct  1    MSNLSKLELVALDISGKNYLSWVLDAEIHLAAKGLDATITQENEASSQDKAKAMILIRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP +LW  LK+R+D+  + VL +A+++W++LRFQDFK++ EYNSA+ 
Sbjct  61   LDEGLKIEYLTVKDPLKLWTDLKERYDQLKATVLRRARYEWMHLRFQDFKTIIEYNSAVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_011074126.1| PREDICTED: uncharacterized protein LOC105158908 [Sesamum indicum]
Length=246

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M    K  F+ L + G NYL+W LD E++L S++L  TI EN+ + E    KA+I L HH
Sbjct  1    MANRTKLNFVALDVSGKNYLSWVLDAELHLASSKLGETIKENTIASEQDCAKAIILLCHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T K P +LWKSLKDRFD Q +++LP+A+++W+ LR QDFK++ EYNS + 
Sbjct  61   LYESLKSQYLTVKSPFQLWKSLKDRFDHQKTVILPRARYEWIQLRLQDFKTIAEYNSEMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +IVS+L+LC+++V+D  +++   S
Sbjct  121  RIVSKLRLCEEDVTDEQMLKTIFS  144



>ref|XP_010687096.1| PREDICTED: uncharacterized protein LOC104901243 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -3

Query  395  LDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEK  216
            ++G NYL+W LD EI+L + +L +TI   + +    K K +IFLRHHL+  LK EY T K
Sbjct  9    VNGKNYLSWVLDAEIHLDAKDLGDTIKAGNKATSQNKAKVIIFLRHHLHEGLKIEYLTVK  68

Query  215  DPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEV  36
            DP  LW +LK+R+D Q +++LP+A++DWL+LR QDFKSV+EYNSA+ +I SQLKLC +++
Sbjct  69   DPQVLWSNLKERYDHQKTVILPEARYDWLHLRLQDFKSVSEYNSAMFRITSQLKLCGEKI  128

Query  35   SDTDLIEKTLS  3
            +D +++EKT +
Sbjct  129  TDAEMLEKTYT  139



>ref|XP_004252451.2| PREDICTED: uncharacterized protein LOC101250381 [Solanum lycopersicum]
Length=266

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K EF  L   G NYL+W LD EI+L +  L +TI E +        +A+IFLRHH
Sbjct  1    MANLTKLEFSALQSSGRNYLSWVLDAEIHLDAMGLGDTIKEENKVSNQNCAQAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LWK+LK+RFD    ++ P+A++DW++LR Q+FKS+ EYNSA+ 
Sbjct  61   LDEILKIEYLTVKDPLVLWKNLKERFDHLKMVIHPKARYDWMHLRLQNFKSIHEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+ D+IEKT S
Sbjct  121  RITSQLKLCGETVSEIDMIEKTFS  144



>gb|AAU89218.1| integrase core domain containing protein [Oryza sativa Japonica 
Group]
Length=1419

 Score =   158 bits (400),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 8/148 (5%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIE----NSTSDEAQKVKALIF  267
            M+ +AKR+F +LA+DGSNYLTWA D E  L    L +TI           +  K KAL F
Sbjct  1    MSDIAKRDFEKLAVDGSNYLTWANDAENRLDGMCLDHTISPFPEGRDERTKPDKAKALYF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            +RHHL+ +LK+EY TE+DP     SLKD F +Q S++LP+A+ DW+ LRFQDFKSVT YN
Sbjct  61   IRHHLDPNLKSEYMTERDP----LSLKDHFGQQQSIMLPRAQQDWITLRFQDFKSVTAYN  116

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALHK+VS+L LC Q+++D D+IEKTLS
Sbjct  117  SALHKLVSRLSLCGQKITDKDMIEKTLS  144



>ref|XP_009138172.1| PREDICTED: uncharacterized protein LOC103862225 [Brassica rapa]
Length=329

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A R++  L L G NYL WALD  I L S  L +TI E++  +E  + +A+ F+RHH
Sbjct  1    MSKIANRDYAALNLSGDNYLQWALDTRISLKSKGLSDTITEDNNENEKNRYRAISFMRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P +LW +LK R+D Q  ++LP+A+ DW++LRF DFKSV EYNSAL 
Sbjct  61   LIEGLKDQYMTIENPLDLWNALKHRYDHQKMVLLPKARHDWMHLRFLDFKSVDEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            KIVS L+LC +EVSD  ++EKT
Sbjct  121  KIVSILRLCGEEVSDVMMLEKT  142



>ref|XP_009630496.1| PREDICTED: uncharacterized protein LOC104120439 [Nicotiana tomentosiformis]
Length=211

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L +  +NYLTW LD EI+L +  L + I E +      K KA+IFLRHH
Sbjct  1    MSNLSKLEFMALDISWNNYLTWVLDAEIHLDARGLGDIIKEENEVSSHDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T KDP +LW SLK+R+D   + +LP+ + +W++LR QD+K+++EYNSA++
Sbjct  61   LDEGLKSEYLTLKDPFQLWTSLKERYDHLKATLLPRTRREWMHLRLQDYKTISEYNSAVY  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+ +LKLC + ++D D++EKTLS
Sbjct  121  RIIFELKLCGKLMNDEDMLEKTLS  144



>emb|CAN61562.1| hypothetical protein VITISV_039565 [Vitis vinifera]
Length=1316

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+ L + G NYL+W LD EI+L +  L NTI E + +    + +ALIF RHH
Sbjct  1    MSNLAKLEFVALDISGKNYLSWVLDAEIHLDAINLGNTIKEGNDASLQDRARALIFFRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++  LK EY   KDP  LW +L +R+D Q +++LP+A++DW++LR QDFK V++YNSAL 
Sbjct  61   IDEGLKGEYLMVKDPFILWNNLGERYDHQNTVILPKARYDWMHLRLQDFKFVSDYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI S+LKLC ++V++ +++EKT +
Sbjct  121  KISSRLKLCGEKVTEENMLEKTFT  144



>gb|KCW80868.1| hypothetical protein EUGRSUZ_C02227 [Eucalyptus grandis]
Length=317

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT + K +F  L + G  YL+W LD+E++    +L NTIIE+  S+E  K  ALIF+R H
Sbjct  1    MTNIEKPKFHILEVSGKIYLSWCLDMEMHFQGQDLANTIIEDGISNEKDKANALIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  L+ +Y + +DPH LW+ LKDR+D    ++LPQA++DW NL  QDFKSV++YNSAL 
Sbjct  61   LHESLQTQYLSVRDPHILWRRLKDRYDHTKIVILPQAQYDWQNLILQDFKSVSDYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             IV QLKLC  +++D +L++K  S
Sbjct  121  DIVFQLKLCGIKLADAELLKKNFS  144



>dbj|BAD46193.1| zinc knuckle domain containing protein-like [Oryza sativa Japonica 
Group]
 gb|EAZ00416.1| hypothetical protein OsI_22433 [Oryza sativa Indica Group]
 gb|EAZ36538.1| hypothetical protein OsJ_20875 [Oryza sativa Japonica Group]
Length=206

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 97/142 (68%), Gaps = 2/142 (1%)
 Frame = -3

Query  425  VAKREFIELALDGSN--YLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHL  252
            + K +F +L + G+N  YL WA  VE +L    L +TI+  S   +A+K   ++FLR HL
Sbjct  1    MVKEDFAKLVISGTNNNYLAWACKVESHLARNGLSDTIVPGSNCTDAEKATTVLFLRRHL  60

Query  251  NYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHK  72
               LKNE+  E DP  LW+SLKDRFD Q  ++L QA++DW +LRFQDF SV EY+S L  
Sbjct  61   GETLKNEFMFEMDPSVLWQSLKDRFDEQKPIILIQARYDWEHLRFQDFDSVAEYDSTLRD  120

Query  71   IVSQLKLCKQEVSDTDLIEKTL  6
            IVS+LKLC ++VS+ ++IEKTL
Sbjct  121  IVSKLKLCGRDVSEDEMIEKTL  142



>ref|XP_004239523.1| PREDICTED: uncharacterized protein LOC101245254 [Solanum lycopersicum]
Length=161

 Score =   143 bits (361),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNY  246
            ++K EF+ L   G NYL+W LD EI+L +  L  TI + + +    K KA++FLRHHL+ 
Sbjct  3    LSKLEFVALNNSGKNYLSWILDAEIHLAAKGLHATITQKNEASSQDKAKAMVFLRHHLDE  62

Query  245  DLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIV  66
            DLK EY T KDP ELW  LK R+D   + +L +A+++W++L  QDFKSVTEYNS + KI 
Sbjct  63   DLKIEYLTVKDPLELWTDLKGRYDHLKATMLRRARYEWMHLLIQDFKSVTEYNSVVFKIT  122

Query  65   SQLKLCKQEVSDTDLIEKTLS  3
            S+LKLC + +   D++EKTL+
Sbjct  123  SELKLCGEIIKIKDMLEKTLT  143



>ref|XP_002455742.1| hypothetical protein SORBIDRAFT_03g023756 [Sorghum bicolor]
 gb|EES00862.1| hypothetical protein SORBIDRAFT_03g023756 [Sorghum bicolor]
Length=257

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 108/148 (73%), Gaps = 6/148 (4%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII----ENSTSDEAQKVKALIF  267
            M+ + KRE  ELA +GSNYL+W+LD EI L    L + I     +N+TS  A++ +AL F
Sbjct  1    MSDLVKREITELAPNGSNYLSWSLDAEIVLDEKNLLHAIKPDKDKNATS--AERAQALHF  58

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHH++  LKNEY T++DP  LW +L +RF++  +++LP+ K +W NLR+QD+K+V +YN
Sbjct  59   LRHHISSSLKNEYMTKRDPQVLWNALHERFEKMETVLLPRVKREWQNLRYQDYKTVEDYN  118

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            + L+ IV+++KLC   ++++DLIEKTLS
Sbjct  119  AKLYGIVTRMKLCGTTLTESDLIEKTLS  146



>emb|CAN63894.1| hypothetical protein VITISV_037389 [Vitis vinifera]
Length=189

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD EI+L +  L  TI E + +      KALIFLRHH
Sbjct  1    MSNLTKLEFVALDILGKNYLSWILDAEIHLDAMNLGATIKEGNQASLQDHAKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LKNEY T K P  LW +LK+R+D Q +++LP+A++DW++LR QDFK V+EYNSA  
Sbjct  61   LYKGLKNEYLTVKVPFTLWSNLKERYDHQKTVILPKARYDWMHLRLQDFKIVSEYNSAFF  120

Query  74   KIVSQLKLCKQE  39
            KI SQLKLC ++
Sbjct  121  KINSQLKLCGEK  132



>ref|XP_002445322.1| hypothetical protein SORBIDRAFT_07g009380 [Sorghum bicolor]
 gb|EES14817.1| hypothetical protein SORBIDRAFT_07g009380 [Sorghum bicolor]
Length=317

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 99/147 (67%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M+ + KR+   LAL+G NY TWALD E++L    L +TI        A    ++ +A IF
Sbjct  1    MSHIIKRQVPFLALNGKNYQTWALDCELHLQGMPLSHTITARQNDAAAPPPHEQAQAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHH++ DLK EY   KDP  LW +L++RF +Q +++ PQA+ DW  LRF D+KSV  YN
Sbjct  61   LRHHIHNDLKQEYLEVKDPLTLWTALQERFGKQKTVIHPQARHDWAQLRFLDYKSVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV QL+ C Q+V+++ +IEKTL
Sbjct  121  TAVHRIVGQLRFCGQKVTESKMIEKTL  147



>ref|XP_004251351.1| PREDICTED: uncharacterized protein LOC101255763 [Solanum lycopersicum]
Length=325

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -3

Query  395  LDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEK  216
            + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLR H +  LK EY T K
Sbjct  21   ISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSQDKAKAMIFLRFHPDEGLKIEYLTVK  80

Query  215  DPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEV  36
            DP ELW  LK R+D   ++VLP+A+++W++LRFQDFK+VTEYNSA+ +I SQLKLC + +
Sbjct  81   DPLELWTDLKGRYDHLKTIVLPRARYEWMHLRFQDFKTVTEYNSAVFRITSQLKLCGETI  140

Query  35   SDTDLIEKTLS  3
             D D++EKTL+
Sbjct  141  KDEDMLEKTLT  151



>ref|XP_010681471.1| PREDICTED: uncharacterized protein LOC104896419 [Beta vulgaris 
subsp. vulgaris]
Length=154

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L   G  YL W +D + YL S  L +TI+E       ++ KAL++L+HH
Sbjct  1    MARLANRDFEILETSGQRYLEWRVDAKAYLKSLSLDHTIVEGGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIITPRAQHEWSVLRFQDFASVREYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGEPVSERAMIEKTLS  144



>ref|XP_008366158.1| PREDICTED: uncharacterized protein LOC103429806 [Malus domestica]
Length=154

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A  +F+ L + G NYLTW +D +IY+  T L  TI E++ +    + KA+IF+  H
Sbjct  1    MANLANLDFVALDITGKNYLTWVMDAKIYMEXTNLGETIKEDNXASSQDRAKAMIFIHRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T KDP  LWK+LK+R++    ++LP A ++W +LR  DFK V EYNSA+ 
Sbjct  61   LDEGLKSEYLTVKDPLTLWKALKNRYNHXKXMILPXAXYEWAHLRIYDFKMVAEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I  Q KLC + +++ D++EKT S
Sbjct  121  RITPQXKLCGETITEEDMLEKTFS  144



>ref|XP_008350466.1| PREDICTED: uncharacterized protein LOC103413801 [Malus domestica]
Length=352

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I+  +  L +TI E S+S    + KA IF+R H
Sbjct  1    MTNLAKLEYAXLDITGKNYLTWVLDTKIHXEAGNLGDTIREESSSSSQNRAKAXIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +D   LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   LDEALKSEYLTVEDXLALWEALRSRYNHQTTVILPKARYEWSHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I SQ+KLC   ++D  L+EKT
Sbjct  121  RITSQMKLCGDTITDEXLLEKT  142



>ref|XP_004236371.1| PREDICTED: uncharacterized protein LOC101249626 [Solanum lycopersicum]
Length=352

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L +   NYL+W LD EI+L +     TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISVKNYLSWVLDAEIHLAAKGFDATITQGNEASSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW  LK R+D   + VLP+A ++W++L FQDFK+V EYNS + 
Sbjct  61   LDEGLKIEYLTVKDPLELWTDLKGRYDHLKATVLPRACYEWMHLWFQDFKTVIEYNSVVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_009150116.1| PREDICTED: uncharacterized protein LOC103873461 [Brassica rapa]
Length=329

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A R++  L L G NYL WALD  I L S  L +TI E++  +E  +  A+ F+R+H
Sbjct  1    MSKIANRDYAALNLSGDNYLQWALDTRISLKSKGLGDTISEDNNENEKNRYMAISFMRYH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK+ Y T ++P +LW +LK R+D Q  ++LP+A+ DW++LRF DFKSV EYNSAL 
Sbjct  61   LIEGLKDHYMTIENPLDLWNALKHRYDHQKMVLLPKARHDWMHLRFLDFKSVDEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            KIVS L+LC +EVSD  ++EKT
Sbjct  121  KIVSILRLCGEEVSDMMMLEKT  142



>ref|XP_008354851.1| PREDICTED: uncharacterized protein LOC103418510 [Malus domestica]
Length=352

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I L +  L +TI E S+S      KA+IF+R H
Sbjct  1    MTNLAKLEYAALDITGKNYLTWVLDTKIXLEAGNLGDTIXEESSSSSQNXAKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +DP  LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   LDEALKSEYLTXEDPLALWEALRSRYNHQTTVILPKARYEWSHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   ++D  L+EKT S
Sbjct  121  RITSQMKLCGDTITDEMLLEKTYS  144



>ref|XP_009149999.1| PREDICTED: uncharacterized protein LOC103873331 [Brassica rapa]
Length=348

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +   E+  L L G NYL W LD +I L S  L +TI E +   +    KA++ +RHH
Sbjct  1    MSKINNLEYASLNLSGDNYLQWELDTKILLRSRNLGDTITEGTEPSDKDNYKAIVVIRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P ELW  LK RF+ Q +++LP+A +DW NLR QD+KSV EYNSAL 
Sbjct  61   LAEGLKDQYLTIENPLELWTELKTRFNHQKTVILPKALYDWRNLRIQDYKSVEEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVS+LKLC + ++D D++EKT S
Sbjct  121  KIVSKLKLCGETITDADMLEKTFS  144



>ref|XP_010675982.1| PREDICTED: uncharacterized protein LOC104891894 [Beta vulgaris 
subsp. vulgaris]
Length=176

 Score =   141 bits (355),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A REF  L   G  YL W +  + YL S  L +T++E       ++ KAL++L+HH
Sbjct  1    MARLANREFEILEASGQRYLEWRVSAKAYLKSLSLDHTVVEGGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVHEYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGEPVSERAMIEKTLS  144



>ref|XP_004239534.1| PREDICTED: uncharacterized protein LOC101251983 [Solanum lycopersicum]
Length=250

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F  L   G NYL+W LD EI+L +  L +TI E + +      +A+IFL HH
Sbjct  1    MVNLTKVQFTALQSSGRNYLSWVLDAEIHLDAMGLGDTIKEENKASNQNCARAMIFLCHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP  LWK+LK+RFD    ++ P+A +DW++LR QDFKS+ EYNSA+ 
Sbjct  61   LDEILKIEYLTVKDPLVLWKNLKERFDHLKMVIRPKAPYDWMHLRLQDFKSIHEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+ D+  KT S
Sbjct  121  RITSQLKLCGETVSEIDMTGKTFS  144



>ref|XP_004244988.1| PREDICTED: uncharacterized protein LOC101256203 [Solanum lycopersicum]
Length=280

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFL HH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWILDAEIHLAAKGLDATITQGNEASTQDKTKAMIFLCHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP EL   LK R+D   + VLP+A+++W+ L FQDFK+V EYNS + 
Sbjct  61   LDEGLKIEYLTVKDPLELSTDLKGRYDHLKATVLPRARYEWMQLWFQDFKTVIEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKT +
Sbjct  121  RITSQLKLCGETIKDEDMLEKTFT  144



>ref|XP_008391920.1| PREDICTED: uncharacterized protein LOC103454107 [Malus domestica]
Length=196

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F+ L + G++YLTW LD +I+L +  L++TI E ++S     VKA+IF R H
Sbjct  1    MGNLVKLDFVALDITGNSYLTWVLDTKIHLEAGNLRDTIREENSSSSLDWVKAMIFNRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T +DP  +WK+L ++++ QT+++LP+A  +W +LR QDFKSV +YNS L 
Sbjct  61   LDEGLKNEYLTVEDPLAIWKTLTNKYNHQTTVILPRAHSEWTHLRIQDFKSVGKYNSVLF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   + + D++EKT S
Sbjct  121  RITSQMKLCGDTIIEEDMLEKTFS  144



>ref|XP_004253487.1| PREDICTED: uncharacterized protein LOC101261606 [Solanum lycopersicum]
Length=229

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL   LD EI+L +  L  TI + + +    K  A+IFL HH
Sbjct  1    MSNLSKLEFMALDISGKNYLLRILDAEIHLAAKGLDATITQGNEASSQDKANAMIFLCHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY   KDP ELW  LK R+D   + VLP+A ++W++LRFQDFK+V  YNS + 
Sbjct  61   LDEGLKIEYLMVKDPLELWTDLKGRYDHLKATVLPRAHYEWMHLRFQDFKTVIVYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + + D D++EKTL+
Sbjct  121  RITSQLKLCGETIKDEDMLEKTLT  144



>ref|XP_009778345.1| PREDICTED: uncharacterized protein LOC104227738 [Nicotiana sylvestris]
Length=353

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L +   N L+W LD EI+L    L +TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFMTLDISEKNCLSWVLDAEIHLAVKGLGDTITQGNEASIQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T  DP ELW  LK+R+D+  + VLP+A+++W++LR QDFK+V+EYNS + 
Sbjct  61   LDEGLKVEYLTVNDPLELWTDLKERYDQLKATVLPRARYEWMHLRLQDFKTVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC+  ++D DL+ KTL+
Sbjct  121  RITSQLKLCRDVMNDEDLLAKTLT  144



>ref|XP_008370034.1| PREDICTED: uncharacterized protein LOC103433544 [Malus domestica]
Length=410

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I+L +  L +TI E  +S    + KA+IF+R H
Sbjct  59   MTNLAKLEYAALDITGKNYLTWVLDTKIHLEAGNLGDTIXEEXSSSSQNRAKAMIFIRRH  118

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
             +  LK+EY   +DP  LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  119  JDEALKSEYLXVEDPLXLWEALRSRYNHQTTVILPKARYEWSHLRIQDFKSVXEYNSALF  178

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   ++D  L+EKT S
Sbjct  179  RITSQMKLCGDTITDEXLLEKTYS  202



>ref|XP_008650141.1| PREDICTED: uncharacterized protein LOC103630875 [Zea mays]
Length=223

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 92/142 (65%), Gaps = 4/142 (3%)
 Frame = -3

Query  419  KREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIFLRHHL  252
            K EF ELALDG NYLTWA D +++L + +L N II             K K+ IFLR H+
Sbjct  57   KLEFEELALDGKNYLTWADDCQVHLDAMQLSNAIIRLGPKAPGLPPHDKAKSTIFLRRHI  116

Query  251  NYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHK  72
            + DLK EY   KDP  LW  LKDRF  Q  ++LPQA+  W NL   DFK+V  YN+A+H+
Sbjct  117  HLDLKMEYLEVKDPLVLWTKLKDRFGTQKQVMLPQARNVWANLCLLDFKAVGAYNTAIHR  176

Query  71   IVSQLKLCKQEVSDTDLIEKTL  6
            IV+QL+ C Q V++ ++IEKTL
Sbjct  177  IVAQLRFCGQIVTEVEMIEKTL  198



>ref|XP_008646609.1| PREDICTED: uncharacterized protein LOC103628118 [Zea mays]
Length=355

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWALD+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWALDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008358231.1| PREDICTED: uncharacterized protein LOC103421969 [Malus domestica]
Length=155

 Score =   138 bits (348),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +   +F+ L + G NYLTW +DV IYL +  L  TI E + +    + K +IF+R H
Sbjct  1    MTNLTNLDFVVLDITGKNYLTWVVDVNIYLGAGNLGETIKEENIASSQDQXKVMIFIRXH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +D   LWK+L++R++ Q +++LP+A ++W++LR  DFKSV EYNSA+ 
Sbjct  61   LDEGLKSEYLTVEDLLALWKTLRNRYNHQKTMILPRALYEWIHLRIXDFKSVAEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            K  S +KLC + +++ D++EKT +
Sbjct  121  KXSSXMKLCGETITEEDMLEKTFT  144



>ref|XP_008381538.1| PREDICTED: uncharacterized protein LOC103444391 [Malus domestica]
Length=155

 Score =   138 bits (347),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +   +F+ L + G NYLTW +DV IYL +  L  TI E + +    + K +IF+R H
Sbjct  1    MTNLTNLDFVVLDITGKNYLTWVVDVNIYLXAGNLGETIKEENIASSQDQXKVMIFIRXH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +D   LWK+L++R++ Q +++LP+A ++W++LR  DFKSV EYNSA+ 
Sbjct  61   LDEGLKSEYLTVEDLLALWKTLRNRYNHQKTMILPRALYEWIHLRIXDFKSVAEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            K  S +KLC + +++ D++EKT +
Sbjct  121  KXSSXMKLCGETITEEDMLEKTFT  144



>ref|XP_008368584.1| PREDICTED: uncharacterized protein LOC103432188 [Malus domestica]
Length=2589

 Score =   149 bits (377),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +AK +F  L + G NYLTW LD +I+L +  L  TI E S S    + K +IF+R H
Sbjct  1    MANLAKLDFAALDITGKNYLTWVLDTKIHLEAANLXXTIKEESXSSSQDRAKXMIFIRXH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +DP  LW  L   ++ QT+++LP+A++DW +LR QDFKSV EYNSAL 
Sbjct  61   LDEALKSEYLTXEDPLALWNXLXSXYNHQTTVILPKARYDWTHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   +++  L+EKT S
Sbjct  121  RITSQMKLCGDTITEEMLLEKTFS  144



>ref|XP_009138461.1| PREDICTED: uncharacterized protein LOC103862508 [Brassica rapa]
Length=359

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A R++  L L G NYL WALD  I L S  + +TI E++  +E  +  A+  +RHH
Sbjct  1    MSKIANRDYAALNLSGDNYLQWALDTRISLKSKGVGDTITEDNNENEKNRYGAIGLMRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P +LW +LK+R+D    ++LP+A+ DW++LRF D+KSV +YNSAL 
Sbjct  61   LIEGLKDQYMTIENPLDLWMALKNRYDHHRMVLLPKARHDWMHLRFLDYKSVDDYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVS LKLC +EV+D+ ++EKT +
Sbjct  121  KIVSILKLCGEEVTDSMMLEKTYT  144



>ref|XP_004234901.1| PREDICTED: uncharacterized protein LOC101254879 [Solanum lycopersicum]
Length=148

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++  EF+ L + G NYL+W LD EI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSNLEFVALDISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSEHKTKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  +  EY T K P EL+  LK R+D     VLP+A++DW++L FQDF +V EYNS + 
Sbjct  61   LDEGVMLEYMTVKYPLELFADLKGRYDHLKETVLPRARYDWMHLLFQDFMTVIEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S+LK C + + D D++EKT S
Sbjct  121  RITSKLKSCGEIIKDEDMLEKTHS  144



>ref|XP_008653954.1| PREDICTED: uncharacterized protein LOC103634125 [Zea mays]
Length=209

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 96/147 (65%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+    +D      +K KA IF
Sbjct  1    MAEGSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLGPNDIGLQLHEKAKAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DLK EY   KDP  LW  L++RF  Q  ++LP+A+ +W   RF DFK+V  YN
Sbjct  61   LRRHIHPDLKMEYLEVKDPLVLWTKLRERFGVQKHVMLPRAQQEWATFRFLDFKTVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV+QL+ C Q V+D ++IEKTL
Sbjct  121  TAIHRIVAQLRFCGQIVTDLEMIEKTL  147



>ref|XP_010681472.1| PREDICTED: uncharacterized protein LOC104896420 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695699.1| PREDICTED: uncharacterized protein LOC104908304 [Beta vulgaris 
subsp. vulgaris]
Length=328

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L   G  YL W +D + YL S  L +TI+E+      ++ KAL++L+HH
Sbjct  1    MARLANRDFEILEASGQRYLEWRVDAKAYLKSLSLDHTIVEDGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVREYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGEPVSERAMIEKTLS  144



>emb|CAN75894.1| hypothetical protein VITISV_024509 [Vitis vinifera]
Length=265

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K +F+ L + G NYL+W  DVEI+L +  L  TI   + +    + K LIFLRHH
Sbjct  1    MSNLTKLKFVALDISGKNYLSWIFDVEIHLDAMNLGATIKXGNQASLQDRTKXLIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+   KNEY T KDP  LW +LK+R+D Q +++LP+A++D ++LR QDFK+++EYNSAL 
Sbjct  61   LHEGFKNEYITVKDPFTLWSNLKERYDHQKTVILPKARYDSMHLRLQDFKTISEYNSALF  120

Query  74   KIVSQLKLCKQE  39
            KI SQLKLC ++
Sbjct  121  KISSQLKLCGEK  132



>ref|XP_008352629.1| PREDICTED: uncharacterized protein LOC103416146 [Malus domestica]
Length=237

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +AK E+  L + G NYLTW LD +I+L +  L +TI + S+S    + KA+IF+R H
Sbjct  1    MANLAKLEYAALDITGKNYLTWVLDTKIHLEAGNLGDTIRDESSSSSQNRAKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
             +  LK+EY T +D   LW++L+ R++ QT+++LP+A ++W +LR QDFK V EYNSAL 
Sbjct  61   FDEALKSEYLTVEDLLALWEALRSRYNHQTTVILPKAXYEWSHLRIQDFKXVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I S +KLC   ++D  L+EKT
Sbjct  121  RITSXMKLCGDTITDEMLLEKT  142



>ref|XP_010682496.1| PREDICTED: uncharacterized protein LOC104897336 [Beta vulgaris 
subsp. vulgaris]
Length=155

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L      YL W +D + YL S  L +TI+E       ++ KAL++L+HH
Sbjct  1    MARLANRDFEILETSCQRYLEWRVDAKAYLKSLSLDHTIVEGGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W   RFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVFRFQDFASVHEYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGEPVSERAMIEKTLS  144



>ref|XP_008646794.1| PREDICTED: uncharacterized protein LOC103628356 [Zea mays]
Length=345

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 101/141 (72%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D   +A K  AL  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK +Y  E++P+ LW SLK+R+++Q +++LP+A  +W ++R QD+KS+ +YN A+HKI
Sbjct  63   PDLKAKYVMEEEPNVLWLSLKNRYEQQKAVILPEANHEWTHIRLQDYKSIGDYNHAVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SDTD IEKTL
Sbjct  123  CARLRFCGKEPSDTDKIEKTL  143



>ref|XP_009589636.1| PREDICTED: uncharacterized protein LOC104086974 [Nicotiana tomentosiformis]
Length=360

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K +F+ L +   +YL+W LD +I+L +  L++TII+ +      K KA+I LR H
Sbjct  1    MSNLSKLKFVALNISEKHYLSWVLDAKIHLAAKALESTIIQGNKISSQDKAKAMISLRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+ +LK EY T KDP ELW +LK+R+D   + +L +A+++W++LR QDFK+V+EYNS + 
Sbjct  61   LDEELKIEYLTLKDPFELWINLKERYDHLKATILLRARYEWIHLRLQDFKTVSEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC++ V+D DLIEKTLS
Sbjct  121  RITSQLKLCEKIVNDEDLIEKTLS  144



>ref|XP_010685744.1| PREDICTED: uncharacterized protein LOC104900098 [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L      YL W +D + Y+ S  L +TI+E       ++ KAL++L+HH
Sbjct  1    MARLANRDFEILEASDQRYLEWRVDAKAYVKSLSLDHTIVEGGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVREYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGKPVSERAMIEKTLS  144



>ref|XP_008671098.1| PREDICTED: uncharacterized protein LOC103648399 [Zea mays]
Length=345

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 100/141 (71%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D   +A K  AL  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q +++LP+A  +W ++R QD+KS+ +YN A+HKI
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNRYEQQKAVILPEANHEWTHIRLQDYKSIGDYNHAVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_009150095.1| PREDICTED: uncharacterized protein LOC103873440 [Brassica rapa]
Length=315

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  377  LTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEKDPHELW  198
            +TWA+  +++L    L  TI  + T  + +K KA+IFLRHH++  LK+EY T++DP +LW
Sbjct  1    MTWAVGAKMHLRGNGLLETIDSSKTVSDEKKAKAMIFLRHHIHDGLKDEYITKEDPCDLW  60

Query  197  KSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEVSDTDLI  18
            KSLK+RFD Q  + LP+AK +W++LRFQD+KSV+E+NSA+  I S++ LC +++SD D+I
Sbjct  61   KSLKERFDHQKYVYLPKAKHEWIHLRFQDYKSVSEFNSAMFGITSRMMLCGEKISDYDMI  120

Query  17   EKTLS  3
            EKTLS
Sbjct  121  EKTLS  125



>ref|XP_008647188.1| PREDICTED: uncharacterized protein LOC103628841 [Zea mays]
Length=355

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 97/145 (67%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I+   T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIVAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_004289434.1| PREDICTED: uncharacterized protein LOC101299333 [Fragaria vesca 
subsp. vesca]
Length=306

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K EF+ L + G NYL W  DV+++LT+ +++ T   ++ + E  K +A+IFLR H
Sbjct  1    MGILNKLEFVALEVSGRNYLKWTQDVKLHLTAQKMRTTSNADNIAPEDMKARAMIFLRKH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            +   L  EY  E+DP  LW +L++RF+ Q ++ LPQ + DW N+RFQDFK+V EYNS + 
Sbjct  61   MEEALTVEYLAEEDPRSLWVALEERFNHQKAIYLPQGRHDWQNIRFQDFKTVNEYNSEIC  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S LK C +E ++ DL+EKTLS
Sbjct  121  RIRSLLKFCGEERTEADLLEKTLS  144



>ref|XP_004248599.1| PREDICTED: uncharacterized protein LOC101264379 [Solanum lycopersicum]
Length=198

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +   +FI L   G NYL+W LD EI+L +  L +TI E + +   +  +A+I LRHH
Sbjct  1    MANLIALDFIALQSSGRNYLSWVLDAEIHLDAMGLGDTINEENKASNKKCARAMILLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KD   LWK LK RFD    ++ P+A++DW++L  QDFKS+ EYNSA+ 
Sbjct  61   LDEILKIEYLTVKDQLVLWKKLKIRFDHLKMVIHPKARYDWMHLSLQDFKSIHEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + V + D+++KT S
Sbjct  121  RITSQLKLCGETVCEIDMMQKTFS  144



>ref|XP_009102426.1| PREDICTED: uncharacterized protein LOC103828570 [Brassica rapa]
Length=298

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +   +F  L L G NYL WALD +I L S  L   I E++ + E  +  A++ +RHH
Sbjct  1    MSKINNLDFAALNLFGDNYLQWALDAKIILKSKGLGECITEDNNASEKDRYNAILIIRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P +LW  LK R+D Q +++LP+A+ DW +LR QD+ SV EYNSAL 
Sbjct  61   LAESLKDQYLTIENPLDLWNELKSRYDHQRTVILPKARSDWRDLRIQDYNSVDEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVS+LKLC + ++D D+ EKT S
Sbjct  121  KIVSKLKLCGESITDQDMPEKTFS  144



>ref|XP_008660757.1| PREDICTED: uncharacterized protein LOC103639842 [Zea mays]
Length=355

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008646917.1| PREDICTED: uncharacterized protein LOC103628507 [Zea mays]
Length=357

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>dbj|BAA97086.1| unnamed protein product [Arabidopsis thaliana]
Length=341

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +    +  L   G NYL WALD +I L S  L   I+E +   E  K +A+  +RHH
Sbjct  1    MSKLTNLMYAALLASGDNYLQWALDTKIELKSKGLAECIVEGNEKTERSKYQAISIIRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            +   LKN+Y T +DP ELW  LK+R+D Q ++ LP+A+ DWLNLR QD+KSV EYNS L 
Sbjct  61   IAESLKNQYLTVEDPLELWLELKNRYDHQKTIQLPKAQHDWLNLRIQDYKSVEEYNSELF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVS L+LC ++V++ D++EKT S
Sbjct  121  KIVSILRLCGEKVTENDMLEKTFS  144



>ref|XP_008666881.1| PREDICTED: uncharacterized protein LOC103645641 [Zea mays]
Length=355

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008664249.1| PREDICTED: uncharacterized protein LOC103642851 [Zea mays]
Length=272

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     ++ +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNDVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008653682.1| PREDICTED: uncharacterized protein LOC103633778 [Zea mays]
Length=322

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 100/141 (71%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D   +A K  AL  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+++++Q +++LP+A  +W ++R QD+KS+ +YN A+HKI
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNKYEQQKAVILPEANHEWTHIRLQDYKSIGDYNHAVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_009124277.1| PREDICTED: uncharacterized protein LOC103849214 [Brassica rapa]
Length=359

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A R++  L L G NYL WALD  I L S  L +TIIEN+  +E  + +AL  +RHH
Sbjct  1    MSKIANRDYAPLNLSGDNYLQWALDTRISLQSKGLGDTIIENNNENEKNRYRALGLMRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P +LW +LK+R+D    ++LP+A+ DW++LRF D+KSV +YNSAL 
Sbjct  61   LIDGLKDQYMTIENPLDLWMALKNRYDHHRMVLLPKARHDWMHLRFLDYKSVDDYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVS LKLC +EV+D+ ++EKT +
Sbjct  121  KIVSILKLCGEEVTDSMMLEKTYT  144



>ref|XP_009138539.1| PREDICTED: uncharacterized protein LOC103862598 [Brassica rapa]
Length=167

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +   +   L L G NYL WALD +I L S  L   I E++ + E  +   ++ +RH+
Sbjct  1    MSKINNLDCYALNLSGDNYLQWALDAKIILKSKGLGECITEDNNASEKDRYNVILIIRHN  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P +LW  LK R+D Q +++LP+ ++DW NLR QDFK V EYNSAL 
Sbjct  61   LIVSLKDQYLTIENPLDLWTELKTRYDHQRTVLLPKVRYDWRNLRIQDFKFVDEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVS+LKLC ++++D D+++KT S
Sbjct  121  KIVSKLKLCGEDITDKDMLDKTFS  144



>ref|XP_010667203.1| PREDICTED: uncharacterized protein LOC104884278 [Beta vulgaris 
subsp. vulgaris]
Length=328

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L   G  YL W +D + YL S  L +TI+E       ++ KAL++L+HH
Sbjct  1    MARLANRDFEILETSGQRYLEWRVDAKAYLKSLSLDHTIVEGGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKFEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVREYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGEPVSERAMIEKTLS  144



>ref|XP_008661035.1| PREDICTED: uncharacterized protein LOC103640181 [Zea mays]
Length=364

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+  S +D      +K KA IF
Sbjct  1    MAEGSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLSPNDIGLQLHEKAKATIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DLK EY   KDP  LW  L++RF  Q  ++LP+A+ +W  LRF DFK+V  YN
Sbjct  61   LRRHIHPDLKMEYLEVKDPLVLWTKLRERFGVQKHVMLPRAQQEWATLRFLDFKTVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV+QL+ C Q V+D ++IEKTL
Sbjct  121  TAIHRIVAQLRFCGQIVTDLEMIEKTL  147



>ref|XP_008664331.1| PREDICTED: uncharacterized protein LOC103642956 [Zea mays]
Length=355

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTST----ELQNTIIENSTSDEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S      +   I  N   +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGNDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E ++ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPTEADKIEKTLS  145



>ref|XP_008673588.1| PREDICTED: uncharacterized protein LOC103649630 [Zea mays]
Length=364

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+  S +D      +K KA IF
Sbjct  1    MAEGSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLSPNDIGLQLHEKAKAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DLK EY   KDP  LW  L++RF  Q  ++LP+A+ +W  LRF DFK+V  YN
Sbjct  61   LRRHIHPDLKMEYLEVKDPLILWTKLRERFGVQKHVMLPRAQQEWATLRFLDFKTVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV+QL+ C Q V+D ++IEKTL
Sbjct  121  TAIHRIVAQLRFCGQIVTDLEMIEKTL  147



>ref|XP_008384441.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica]
Length=699

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A  +F+ L + G NYLTW +D +IY+  T L  TI E++ +    + KA+IF+  H
Sbjct  546  MANLANLDFVALDITGKNYLTWVMDAKIYMEXTNLGETIKEDNXASSQDRAKAMIFIHRH  605

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T KDP  LWK+LK+R++    ++LP A ++W +LR  DFK V EYNSA+ 
Sbjct  606  LDEGLKSEYLTVKDPLTLWKALKNRYNHXKXMILPXAXYEWAHLRIYDFKMVAEYNSAMF  665

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I  QLKLC + +++ D++EKT S
Sbjct  666  RITPQLKLCGETITEEDMLEKTFS  689



>ref|XP_008646549.1| PREDICTED: uncharacterized protein LOC103628043 [Zea mays]
Length=364

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+  S +D      +K KA IF
Sbjct  1    MAEGSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLSPNDIGLQLHEKTKAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DLK EY   KDP  LW  L++RF  Q  ++LP+A+ +W  LRF DFK+V  YN
Sbjct  61   LRRHIHPDLKMEYLEVKDPLVLWTKLRERFGVQKHVMLPRAQQEWATLRFLDFKTVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV+QL+ C Q V+D ++IEKTL
Sbjct  121  TAIHRIVAQLRFCGQIVTDLEMIEKTL  147



>ref|XP_008657946.1| PREDICTED: uncharacterized protein LOC103637561 [Zea mays]
Length=355

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008671773.1| PREDICTED: uncharacterized protein LOC103649237 [Zea mays]
Length=355

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008671123.1| PREDICTED: uncharacterized protein LOC103648428 [Zea mays]
Length=355

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E ++ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPTEADKIEKTLS  145



>ref|XP_008680759.1| PREDICTED: uncharacterized protein LOC103655855 [Zea mays]
Length=355

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008657419.1| PREDICTED: uncharacterized protein LOC103636888 [Zea mays]
Length=290

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  +L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTSLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008660770.1| PREDICTED: uncharacterized protein LOC103639856 [Zea mays]
Length=345

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSDE---AQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D    A K  AL  +RHHL+
Sbjct  3    REFKELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHGAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q +++LP+A  +W ++R QD+ S+ +YN A+HKI
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNRYEQQKAVILPEANHEWTHIRLQDYNSIGDYNHAVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_008666877.1| PREDICTED: uncharacterized protein LOC103645635 [Zea mays]
Length=345

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 99/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D   +A K   L  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDAYKYNTLYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q +++LP+A  +W ++R QD+KS+ +YN A+HKI
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNRYEQQKAVILPEANHEWTHIRLQDYKSIGDYNHAVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_008646761.1| PREDICTED: uncharacterized protein LOC103628316 [Zea mays]
Length=305

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  +L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTSLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANLEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>gb|AAF67379.1| Hypothetical protein T15F17.k [Arabidopsis thaliana]
Length=341

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -3

Query  389  GSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEKDP  210
            G NYL WALD +I L S  L   I+E +   E  K +A+  +RHH+   LKN+Y T +DP
Sbjct  16   GDNYLQWALDTKIELKSKGLAECIVEGNEKTERSKYQAISIIRHHIAESLKNQYLTVEDP  75

Query  209  HELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEVSD  30
             ELW  LK+R+D Q ++ LP+A+ DWLNLR QD+KSV EYNS L KIVS L+LC ++V++
Sbjct  76   LELWLELKNRYDHQRTIQLPKAQHDWLNLRIQDYKSVEEYNSELFKIVSILRLCGEKVTE  135

Query  29   TDLIEKTLS  3
             D++EKT S
Sbjct  136  NDMLEKTFS  144



>ref|XP_008647223.1| PREDICTED: uncharacterized protein LOC103628876 [Zea mays]
Length=355

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  +L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTSLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008666113.1| PREDICTED: uncharacterized protein LOC103644730 [Zea mays]
Length=348

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII---ENSTSDEAQKVKALIFL  264
            MT +  REF  LA  G NYLTWA DV+I L   +L+  I    ++  + + Q  +AL FL
Sbjct  1    MTGIVSREFEVLAPHGQNYLTWASDVQIVLGGKKLKVAIGLGQKDEVATDEQNDQALHFL  60

Query  263  RHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNS  84
            RHHL+  LKNEY +E+    LW +L+ RF+R    VLPQA+ DW  LR+ DFK+V EYN+
Sbjct  61   RHHLSPTLKNEYMSERKASNLWNALQQRFERLKYTVLPQAQQDWARLRYADFKTVGEYNA  120

Query  83   ALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            ALH+I ++L LC + ++D + IEKTLS
Sbjct  121  ALHRICTKLSLCGKVITDEEKIEKTLS  147



>ref|XP_008343356.1| PREDICTED: uncharacterized protein LOC103406118 [Malus domestica]
Length=168

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNY  246
            +AK +F  L + G NYLTW L  +I+L +  L +TI E + S      KA+IF+R HL+ 
Sbjct  20   LAKLDFAALDITGKNYLTWVL--KIHLEAXNLGDTIREENNSSSQDXAKAMIFIRCHLDE  77

Query  245  DLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIV  66
             LK+EY   +DP  +WK+L+++++ QT+++LP+A+++W  LR QDFKSV +YNSAL +I 
Sbjct  78   GLKSEYLMVEDPLAIWKALRNKYNHQTTVILPRARYEWTYLRIQDFKSVAKYNSALFRIT  137

Query  65   SQLKLCKQEVSDTDLIEKTLS  3
            SQ+KLC   + + DL+EKT +
Sbjct  138  SQMKLCGDTIXEEDLLEKTFN  158



>gb|ABA97378.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=294

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 101/145 (70%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSD---EAQKVK-ALIFLRH  258
            +A +EF EL LDG+NY  WA D++I   S  + +TI E +  D   E +K+  AL  LR 
Sbjct  1    MATKEFNELVLDGTNYSIWASDIKINFASRGILSTIEEPNDGDLPIEHRKLNTALFVLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK+EY  E  PH LWK+LK+R+D+Q  L+ P+A ++W++LR QDFK+V EYN A+
Sbjct  61   YIHKDLKHEYMLETSPHTLWKALKERYDQQKELIWPEANYEWIHLRLQDFKTVAEYNHAV  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C+QE ++ + IEKTLS
Sbjct  121  HNICSRLKFCEQEPTEAEKIEKTLS  145



>ref|XP_008661169.1| PREDICTED: uncharacterized protein LOC103640347 [Zea mays]
Length=364

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+    +D      +K KA IF
Sbjct  1    MAEGSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLGPNDIGLQLHEKAKAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DLK EY   KDP  LW  L++RF  Q  ++LP+A+ +W  LRF DFK+V  YN
Sbjct  61   LRRHIHPDLKMEYLEVKDPLILWTKLRERFGVQKHVMLPRAQQEWATLRFLDFKTVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV+QL+ C Q V+D ++IEKTL
Sbjct  121  TAIHRIVAQLRFCGQIVTDLEMIEKTL  147



>ref|XP_010684131.1| PREDICTED: uncharacterized protein LOC104898727 [Beta vulgaris 
subsp. vulgaris]
Length=328

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L   G  YL W +D + YL S  L +TI+E       ++ KAL++L+H+
Sbjct  1    MARLANRDFEILETSGQRYLEWRVDAKAYLKSLSLDHTIVEGGAPTPLEQAKALVYLKHY  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVCEYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             I SQLKLC + VS+  +IEKTLS
Sbjct  121  HITSQLKLCGEPVSERAMIEKTLS  144



>ref|XP_008657641.1| PREDICTED: uncharacterized protein LOC103637168 [Zea mays]
Length=345

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 99/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D   +A K  AL  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q +++LP+A  +W ++R QD+KS+ +YN  +HKI
Sbjct  63   PDLKVEYVMEEEPNVLWLSLKNRYEQQKAVILPEANHEWTHIRLQDYKSIGDYNHVVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_008666735.1| PREDICTED: uncharacterized protein LOC103645462 [Zea mays]
Length=355

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008661225.1| PREDICTED: uncharacterized protein LOC103640415 [Zea mays]
Length=355

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_002458270.1| hypothetical protein SORBIDRAFT_03g030320 [Sorghum bicolor]
 gb|EES03390.1| hypothetical protein SORBIDRAFT_03g030320 [Sorghum bicolor]
Length=227

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 99/144 (69%), Gaps = 4/144 (3%)
 Frame = -3

Query  422  AKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSD----EAQKVKALIFLRHH  255
            +K+EF ELALDG N+ TWA+D+++ L+   +   I      D    E  K  AL  +R+H
Sbjct  12   SKKEFAELALDGHNFPTWAMDLKVSLSLRGMYRAIDTPKQRDAPLSEPSKYHALYIIRNH  71

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ DLK EY  E+DP  LW +L+ R+++Q +++LP+A  +W +LR QDFKSV EYN+A+H
Sbjct  72   IHSDLKAEYLMEEDPRALWLALQQRYEQQKAVILPEATHEWNHLRIQDFKSVNEYNNAMH  131

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            K+ S+L+ C++E SD + IEKTLS
Sbjct  132  KLSSKLRFCEKEPSDAEKIEKTLS  155



>ref|XP_008661188.1| PREDICTED: uncharacterized protein LOC103640372 [Zea mays]
Length=355

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008654167.1| PREDICTED: uncharacterized protein LOC103634422 [Zea mays]
Length=355

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008661115.1| PREDICTED: uncharacterized protein LOC103640278 [Zea mays]
Length=355

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDLVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008653593.1| PREDICTED: uncharacterized protein LOC103633656 [Zea mays]
Length=355

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     ++ +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNDVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  ++ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKEIIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008650603.1| PREDICTED: uncharacterized protein LOC103631479 [Zea mays]
Length=345

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDE----AQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  +   E    A K  AL  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVEPLHDAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q +++LP+A  +W ++R QD+KS+ +YN  +HKI
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNRYEQQKAVILPEANHEWTHIRLQDYKSIGDYNHDVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCDREPSDADKIEKTL  143



>ref|XP_008680688.1| PREDICTED: uncharacterized protein LOC103655768 [Zea mays]
Length=341

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCQKEPSEADKIEKTLS  145



>ref|XP_008657837.1| PREDICTED: uncharacterized protein LOC103637415 [Zea mays]
Length=364

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+  S +D      +K KA IF
Sbjct  1    MAESSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLSPNDIGLQLHEKAKAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DLK EY   KDP  LW  L++RF  Q  ++LP+A+ +W  L F DFK+V  YN
Sbjct  61   LRRHIHPDLKMEYLEVKDPLVLWTKLRERFGVQKHVMLPRAQQEWATLHFLDFKTVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV+QL+ C Q V+D ++IEKTL
Sbjct  121  TAIHRIVAQLRFCGQIVTDLEMIEKTL  147



>ref|XP_008650614.1| PREDICTED: uncharacterized protein LOC103631493 [Zea mays]
Length=348

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII---ENSTSDEAQKVKALIFL  264
            MT +  REF  LA  G NYLTWA DV+I L   +L+  I    ++  + + Q  +AL FL
Sbjct  1    MTGIVSREFEVLAPHGQNYLTWASDVQIVLGGKKLKVAIGLGQKDEVATDEQNDQALHFL  60

Query  263  RHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNS  84
            RHHL+  LKNEY +E+   +LW +L+ RF+R    VLPQA+ DW  LR+ DFK+V EYN+
Sbjct  61   RHHLSPTLKNEYMSERKASKLWNALQQRFERLKYTVLPQAQKDWARLRYADFKTVGEYNA  120

Query  83   ALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            ALH+I ++L LC + +++ + IEKTLS
Sbjct  121  ALHRICTKLSLCGKVITNEEKIEKTLS  147



>ref|XP_008646554.1| PREDICTED: uncharacterized protein LOC103628049 [Zea mays]
Length=353

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 93/142 (65%), Gaps = 4/142 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRHHLN  249
            +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  AL  LR +++
Sbjct  4    KEFEELALDGHNYPTWATDIEITFASRGIIDAIAAPITGTDLVNEVKKNTALFLLRLYIH  63

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  EK PH LWK+LK+ +++Q  L+ P A  +W +LR QDFKSV EYN ALH I
Sbjct  64   KDLKQEYLMEKCPHNLWKALKESYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHALHSI  123

Query  68   VSQLKLCKQEVSDTDLIEKTLS  3
             S+LK C++E S+ D IEKTLS
Sbjct  124  CSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008671793.1| PREDICTED: uncharacterized protein LOC103649260 [Zea mays]
Length=355

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008676149.1| PREDICTED: uncharacterized protein LOC103652313 [Zea mays]
Length=355

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008666759.1| PREDICTED: uncharacterized protein LOC103645496 [Zea mays]
Length=322

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D   +A K  AL  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q  ++LP+A  +W ++R QD+KS+ +YN  +HKI
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNRYEQQKVVILPEANHEWTHIRLQDYKSIGDYNHDVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_010670074.1| PREDICTED: uncharacterized protein LOC104887176 [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L   G  YL W +D + YL S  L +TI+E       ++ KAL++L+HH
Sbjct  1    MARLANRDFEILETSGQRYLEWRVDAKAYLKSLSLDHTIVEGGAPTPLEQTKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYN  + 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVCEYNFVVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGEPVSERAMIEKTLS  144



>ref|XP_009128779.1| PREDICTED: uncharacterized protein LOC103853622 [Brassica rapa]
Length=346

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A  +F  L  +G NYL WALD +I L S  L +TI E++ S +  K +A+  +RHH
Sbjct  1    MSKIANLDFSALKSNGDNYLEWALDAKIMLRSKNLGDTITEDNNSSDKDKYRAIYMIRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L  +LK +Y T ++P +LW +L+ R+D Q +++LP A++DW ++RF D+KSV EYNS L 
Sbjct  61   LQENLKTQYMTMENPFDLWIALQRRYDHQKTVLLPNAQYDWKHIRFLDYKSVDEYNSVLF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +IVS L+LC ++V++ +++ KTLS
Sbjct  121  RIVSLLRLCGEKVTEEEMLNKTLS  144



>ref|XP_008680660.1| PREDICTED: uncharacterized protein LOC103655734 [Zea mays]
Length=355

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_009138606.1| PREDICTED: uncharacterized protein LOC103862680 [Brassica rapa]
Length=319

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++  ++  L L G NYL WALD +I L S  L +TIIE +   +  + KA+  +RHH
Sbjct  1    MSKISNLDYAALNLSGDNYLQWALDTKISLRSKGLGDTIIEGNNKTDKNRYKAISIIRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P +LW +L+ R+D Q +++LP+A+ DW NLRF D+KSV EYNS L 
Sbjct  61   LIEGLKDQYLTMENPLDLWTALQQRYDHQKTVLLPKAQNDWKNLRFMDYKSVDEYNSVLF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KIVS + LC +EV++ +L+ KT S
Sbjct  121  KIVSMMILCGEEVTEKELLNKTFS  144



>ref|XP_004251338.1| PREDICTED: uncharacterized protein LOC101249524 [Solanum lycopersicum]
Length=294

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +   EF  L   G NYL+W LD EI+L +  L +TI E + + +    +A+IFLRHH
Sbjct  1    MANLTILEFTALQSSGKNYLSWVLDAEIHLDAMCLGDTIKEENKTSKQNCARAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T  DP  LWK+LK+RFD    ++  +A++DW++LR QDFKS+ EYNSA+ 
Sbjct  61   LDEILKIEYLTVNDPLFLWKNLKERFDHLKMVIHSKARYDWMHLRLQDFKSIHEYNSAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKL  + +S+ D++EKT S
Sbjct  121  RITSQLKLRGETISEIDMMEKTFS  144



>ref|XP_008676178.1| PREDICTED: uncharacterized protein LOC103652350 [Zea mays]
Length=355

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFILRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E ++ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPTEADKIEKTLS  145



>ref|XP_008675813.1| PREDICTED: uncharacterized protein LOC103651919 [Zea mays]
Length=355

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008380881.1| PREDICTED: uncharacterized protein LOC103443767 [Malus domestica]
Length=316

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            +  +AK E+  L + G NYLTW LD +IYL +  L +TI E S+S    + KA+IF+R H
Sbjct  32   IANLAKLEYXALDITGKNYLTWVLDTKIYLEAGNLGDTIKEESSSSSQDREKAMIFIRCH  91

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +D   LW++L+++++ QT+++LP+A ++W +LR QDFKSV EYNSAL 
Sbjct  92   LDEALKSEYLTVEDQLALWEALRNKYNHQTTVILPKAHYEWSHLRIQDFKSVAEYNSALF  151

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
             I  Q+KLC   +++  L+EKT
Sbjct  152  SITFQMKLCGDTITEEMLLEKT  173



>ref|XP_009102747.1| PREDICTED: uncharacterized protein LOC103828860 [Brassica rapa]
Length=316

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 102/145 (70%), Gaps = 0/145 (0%)
 Frame = -3

Query  437  IMTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRH  258
            +M+ + K E   L +  +NY+T A+  +++L    L  T   +    + +K KA+IFLRH
Sbjct  1    MMSNLTKLEINALDITENNYMTLAVGAKMHLRGNRLLETSDSSKRVSDEKKAKAMIFLRH  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            H++  LK+EY T++DP +LWKSLK+RFD Q  ++LP+AK +W++LRFQD+KSV+E+NSA+
Sbjct  61   HIHDGLKDEYITKEDPCDLWKSLKERFDHQKYVILPKAKHEWIHLRFQDYKSVSEFNSAM  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
              I S++ LC +++ D D+IEK LS
Sbjct  121  LGITSRIMLCAEKIIDYDMIEKILS  145



>ref|XP_008378553.1| PREDICTED: uncharacterized protein LOC103441644 [Malus domestica]
Length=352

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I+  +  L +TI E S+S    + KA IF+  H
Sbjct  1    MTNLAKLEYAALDITGXNYLTWVLDTKIHXEAGNLGDTIXEESSSSSQNRAKAXIFIXRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY T +D   LW++L+ R++ QT+++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   LDEALKSEYLTVEDXLALWEALRSRYNHQTTVILPKARYEWSHLRIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   ++D  L+EKT S
Sbjct  121  RITSQMKLCGDTITDEILLEKTYS  144



>ref|XP_008647058.1| PREDICTED: uncharacterized protein LOC103628671 [Zea mays]
Length=364

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 96/147 (65%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+  S +D      +K KA IF
Sbjct  1    MAEGSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLSPNDIGLQLHEKAKAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DLK EY   KDP  LW  L++RF  Q  ++LP+A+ +W  LRF DFK+V  YN
Sbjct  61   LRRHIHPDLKMEYLEVKDPLILWTKLRERFGVQKHVMLPRAQQEWATLRFLDFKTVEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            + +H+IV+QL+ C Q V D ++IEKTL
Sbjct  121  TVIHRIVAQLRFCGQIVIDLEMIEKTL  147



>ref|XP_008650659.1| PREDICTED: uncharacterized protein LOC103631554 [Zea mays]
Length=355

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     ++ +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNDVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_004245369.1| PREDICTED: uncharacterized protein LOC101262235 [Solanum lycopersicum]
Length=352

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+  LD EI+L +     TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVALDISGKNYLSLVLDAEIHLAAKGRDATITQRNEATSQDKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T K+  ELW  LK R+D   + VLP+A+++W++L+FQDFK V EYNS + 
Sbjct  61   LDEGLKIEYLTVKNLLELWTDLKGRYDHLKTTVLPRARYEWMHLQFQDFKIVIEYNSVVF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I S LKLC + + D D++EKT +
Sbjct  121  RITSPLKLCGETIKDEDMLEKTFT  144



>gb|AAL68850.1|AF466199_9 putative copia polyprotein [Sorghum bicolor]
Length=360

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 98/144 (68%), Gaps = 4/144 (3%)
 Frame = -3

Query  422  AKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSD----EAQKVKALIFLRHH  255
            +K+EF ELALDG N+ TWA+D+++ L+   +   I      D    E  K  AL  +R+H
Sbjct  12   SKKEFAELALDGHNFPTWAMDLKVSLSLRGMYRAIDTPKQGDAPLSEPSKYHALYIIRNH  71

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ DLK EY  E+DP  LW +L+ R+++Q +++LP+A  +W +LR QDFKSV EYN A+H
Sbjct  72   IHSDLKAEYLMEEDPRALWLALQQRYEQQKAVILPEATHEWNHLRIQDFKSVNEYNHAMH  131

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            K+ S+L+ C++E SD + IEKTLS
Sbjct  132  KLSSKLRFCEKEPSDAEKIEKTLS  155



>gb|EAY79627.1| hypothetical protein OsI_34772 [Oryza sativa Indica Group]
Length=336

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 96/143 (67%), Gaps = 4/143 (3%)
 Frame = -3

Query  422  AKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRHH  255
            AK+EF  L ++G NY TW++D EI LT+ EL  +I             ++ KAL F+R H
Sbjct  7    AKKEFPILTVNGGNYQTWSMDCEINLTAMELSESIRRQGAGVAPLPMPKRAKALAFIRKH  66

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ DLK EY   + P +LW++L++R+  + + +LP+A+ +W  LRF DFK+V  YNSA+H
Sbjct  67   IHEDLKAEYLELRGPLQLWEALRERYTAEKTAILPKARAEWAQLRFCDFKTVESYNSAVH  126

Query  74   KIVSQLKLCKQEVSDTDLIEKTL  6
            +IVS+L+ C Q V+D D+IEKTL
Sbjct  127  RIVSKLRFCNQVVTDEDMIEKTL  149



>ref|XP_010687794.1| PREDICTED: uncharacterized protein LOC104901867 [Beta vulgaris 
subsp. vulgaris]
Length=219

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 92/142 (65%), Gaps = 21/142 (15%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF  L + G NYL+W LD EI+L + +L +TI E + +    K KA+IFLRHH
Sbjct  1    MSNLTKLEFAALDITGKNYLSWVLDAEIHLDAKDLGDTIKEGNKATSQNKAKAMIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L                     K+R+D Q +L+LP+A +DWL+LR QDFKSV+EYNSA+ 
Sbjct  61   L---------------------KERYDHQKTLILPKAHYDWLHLRLQDFKSVSEYNSAMF  99

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I SQLKLC ++++D +++EKT
Sbjct  100  RITSQLKLCGEKITDAEMLEKT  121



>emb|CAD40420.3| OSJNBa0065J03.16 [Oryza sativa Japonica Group]
Length=347

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 100/145 (69%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVK----ALIFLRH  258
            +A +EF ELALDG+NY  WA D++I   S E+ NTI E +  D A + +    AL  LR 
Sbjct  1    MATKEFDELALDGTNYPIWASDIKINFASREILNTIEEPNDGDPAIEPRKLNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK+EY  E  P  LWK+LK+R+D+Q  L+ P+A ++W++L  QDF++V EYN A+
Sbjct  61   YIHKDLKHEYMLETSPLNLWKALKERYDQQKELIWPKANYEWVHLCLQDFQTVAEYNHAV  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C+QE ++ + IEKTLS
Sbjct  121  HNICSRLKFCEQEPTEAEKIEKTLS  145



>ref|XP_008341470.1| PREDICTED: uncharacterized protein LOC103404345 [Malus domestica]
Length=222

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = -3

Query  395  LDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEK  216
            + G+NYLTW +D +I+L +  L+ TI E +++    + KA+IF+R HL+  LKNEY   +
Sbjct  10   ITGNNYLTWVVDAKIHLETGNLRETIKEENSASSQDRAKAMIFIRCHLDEGLKNEYLIVE  69

Query  215  DPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEV  36
            DP  LW  L+++++ Q  ++LP+A ++W +LR QDFK+V EYNSA+ KI  Q+KLC + +
Sbjct  70   DPLALWNELRNKYNHQKMMILPRACYEWTHLRIQDFKTVVEYNSAMFKISFQMKLCGETI  129

Query  35   SDTDLIEKTLS  3
            ++ D++EKT S
Sbjct  130  TEEDMLEKTFS  140



>ref|XP_008647124.1| PREDICTED: uncharacterized protein LOC103628759 [Zea mays]
Length=364

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEA----QKVKALIF  267
            M   +K +F ELAL+G NYLTWA D + +L + +L   I+  S +D      +K KA IF
Sbjct  1    MAEGSKTDFAELALNGKNYLTWADDCQFHLEAMQLGKAIVRLSPNDIGLQLHEKAKAAIF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LR H++ DL  EY   KDP  LW  L++RF  Q  ++LP+A+ +W  LRF DFK++  YN
Sbjct  61   LRRHIHPDLNIEYLEVKDPLVLWTKLRERFGVQKHVMLPRAQQEWATLRFLDFKTMEAYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTL  6
            +A+H+IV+QL+ C Q V+D ++IEKTL
Sbjct  121  TAIHRIVAQLRFCGQIVTDLEMIEKTL  147



>ref|XP_008354241.1| PREDICTED: uncharacterized protein LOC103417860 [Malus domestica]
Length=352

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I+  +  L +TI E S+S    +  A IF+R H
Sbjct  1    MTNLAKLEYAXLDITGKNYLTWVLDTKIHXEAGNLGDTIXEESSSSSQNRAXAXIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
             +  LK+EY T +D   LW++L+ R++ QT ++LP+A+++W +LR QDFKSV EYNSAL 
Sbjct  61   JDEALKSEYLTVEDXLALWEALRSRYNHQTXVILPKARYEWSHLRIQDFKSVXEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I SQ+KLC   ++D  L+EKT
Sbjct  121  RITSQMKLCGDTITDEXLLEKT  142



>ref|XP_004234874.1| PREDICTED: uncharacterized protein LOC101266608 [Solanum lycopersicum]
Length=339

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = -3

Query  395  LDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEK  216
            + G NYL+W LD EI+L +  L  TI + + +    KVKA++FLR+HL+  LK E+ T K
Sbjct  1    MSGKNYLSWVLDAEIHLAAKGLDVTITQGNEASSKDKVKAMVFLRYHLDEGLKIEHLTVK  60

Query  215  DPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEV  36
            D  ELW  LK R D   + VLP+A++DW++LRFQ+FK+VTEYNS + +I S+LKLC + +
Sbjct  61   DQLELWTDLKGRDDHLKATVLPRARYDWMHLRFQEFKTVTEYNSDVFRITSKLKLCGETI  120

Query  35   SDTDLIEKTLS  3
             D D+++KTL+
Sbjct  121  KDEDMLKKTLT  131



>ref|XP_010689613.1| PREDICTED: uncharacterized protein LOC104903294 [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +A R+F  L      YL W +D + YL S  L +TI+E       ++ KAL +L+HH
Sbjct  1    MTRLANRDFEILETSSQRYLEWRVDAKAYLKSLSLDHTIVEGGAPTPLEQAKALAYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP ELW +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYILVEDPKELWDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVREYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I  QLKLC + VS+  +IEKTLS
Sbjct  121  RITLQLKLCGEPVSERAMIEKTLS  144



>ref|XP_008650487.1| PREDICTED: uncharacterized protein LOC103631329 [Zea mays]
Length=345

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TWALD++I L S  + + ++  N   D   +A K   L  +RHHL+
Sbjct  3    REFEELALDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDACKYNTLYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q  ++LP+A  +W ++R QD+KS+ +Y+ A+HKI
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNRYEQQKVVILPEANHEWTHIRLQDYKSIGDYSHAVHKI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_008680667.1| PREDICTED: uncharacterized protein LOC103655744 [Zea mays]
Length=432

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 94/145 (65%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  78   MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  137

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  138  YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWPSANHEWNHLRLQDFKSVAEYNHAL  197

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E  + D IEKTLS
Sbjct  198  HSICSKLKFCEKEPYEGDKIEKTLS  222



>ref|XP_008676230.1| PREDICTED: uncharacterized protein LOC103652422 [Zea mays]
Length=355

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K  +L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDIVNEVKKNTSLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+   A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWSSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSELKFCEKEPSEADKIEKTLS  145



>ref|XP_009145077.1| PREDICTED: uncharacterized protein LOC103868759 [Brassica rapa]
Length=247

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  353  IYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEKDPHELWKSLKDRFD  174
            ++L    L  TI  + T  + +K KA+IFLRHH++  LK+EY T++DP +LWKSLK+RFD
Sbjct  1    MHLRGNGLLETIDSSKTVSDEKKAKAMIFLRHHIHDGLKDEYITKEDPCDLWKSLKERFD  60

Query  173  RQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEVSDTDLIEKTLS  3
             Q  ++LP+AK +W++LRFQD+KSV+E+NSA+  I S++ LC +++SD D+IEKTLS
Sbjct  61   HQKYVILPKAKHEWIHLRFQDYKSVSEFNSAMFGITSRMMLCGEKISDYDMIEKTLS  117



>emb|CAN72204.1| hypothetical protein VITISV_001821 [Vitis vinifera]
Length=420

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +AK EF+   + G NYL+W LD EI+L +  L+NTI E + +      + LIFLRHH
Sbjct  1    MSNLAKLEFVVFDISGKNYLSWVLDAEIHLDAMNLENTIKEGNDASLQDCTRXLIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++  LK EY    D   LW +L+++ D Q +++LP+A++DW+ LR QDFKS + YN  L 
Sbjct  61   IDEGLKGEYLXVXDSFILWNNLREQHDHQKTIILPKARYDWMYLRLQDFKSXSNYNLTLF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC ++V++ D +E T +
Sbjct  121  KISSQLKLCGKKVTEEDXLEXTFT  144



>ref|XP_008661222.1| PREDICTED: uncharacterized protein LOC103640412 [Zea mays]
Length=355

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 94/145 (65%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K      LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDTVNEVKKNTTPFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKKLIWPSANHEWNHLRLQDFKSVVEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_009801527.1| PREDICTED: uncharacterized protein LOC104247269 [Nicotiana sylvestris]
Length=310

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 94/144 (65%), Gaps = 5/144 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +    NTI   + +    K K +IFL HH
Sbjct  1    MSNLSKLEFVALDISGKNYLSWVLDAEIHLAAKGFGNTITHGNEASSQDKAKTMIFLCHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW           + VLP+A+++W++L+ QDFK+V EYNS + 
Sbjct  61   LDEGLKVEYLTVKDPLELWIG-----HHLKATVLPRARYEWMHLQLQDFKTVGEYNSDVF  115

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + ++D DL+EKTL+
Sbjct  116  RITSQLKLCGEVINDEDLLEKTLT  139



>ref|XP_008680675.1| PREDICTED: uncharacterized protein LOC103655752 [Zea mays]
Length=355

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     ++ +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNDVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+   A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWSSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_008657334.1| PREDICTED: uncharacterized protein LOC103636791 [Zea mays]
Length=348

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII---ENSTSDEAQKVKALIFL  264
            MT +  REF  LA  G NYLTWA DV+I     +L+  I    ++  + + Q  +AL FL
Sbjct  1    MTGIVSREFEVLAPHGQNYLTWASDVQIVFGGKKLKVAIGLGQKDEVATDEQNDQALHFL  60

Query  263  RHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNS  84
            RHH++  LKNEY +E+    LW +L+ RF+R    VLPQA+ DW  LR+ DFK+V EYN+
Sbjct  61   RHHISPTLKNEYMSERKASNLWNALQQRFERLKYTVLPQAQQDWARLRYADFKTVGEYNA  120

Query  83   ALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            ALH+I ++L LC + ++D +  EKTLS
Sbjct  121  ALHRICTKLSLCGKVITDEEKFEKTLS  147



>ref|XP_008646602.1| PREDICTED: uncharacterized protein LOC103628111 [Zea mays]
Length=351

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 94/145 (65%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S    + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGTTDAIAAPITGTDPVNEVKKNITLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+ P A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERYPHNLWKALKERYEQQMELIWPSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LKLC++E  + D IEKTLS
Sbjct  121  HSICSKLKLCEKEPFEADKIEKTLS  145



>ref|XP_009378832.1| PREDICTED: uncharacterized protein LOC103967280 [Pyrus x bretschneideri]
Length=153

 Score =   130 bits (328),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +AK  F+ L + G NYL W +D +I+L +  L+ TI E + +    + K +IF+ HH
Sbjct  1    MANLAKLNFVALDITGKNYLIWVVDPKIHLEARNLKETIKEMNNAFSQDQAKVMIFIYHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T ++P  LWK+L++R++ Q +++L +A+++W +LR QDFKS  EYN A+ 
Sbjct  61   LDEGLKNEYLTVENPLALWKALENRYNHQKTVILLRARYEWTHLRIQDFKSAAEYNFAMF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I  Q KLC + +++ D++EKT +
Sbjct  121  RISFQKKLCGETITENDMLEKTFN  144



>ref|XP_009630959.1| PREDICTED: uncharacterized protein LOC104120816 [Nicotiana tomentosiformis]
Length=177

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LD EI+L +  L NTII+ + +    KVKA+IF RHH
Sbjct  1    MSNLSKLEFVALDITGKNYLSWVLDAEIHLDAKGLGNTIIQGNEASNQDKVKAMIFFRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T KDP ELW +LKDR+D     VLP+A+ +W++LR Q FK+V+EYNS + 
Sbjct  61   LHEGLKTEYLTVKDPLELWINLKDRYDHLKLTVLPKARHEWIHLRLQYFKTVSEYNSVIF  120

Query  74   K  72
            K
Sbjct  121  K  121



>ref|XP_009124037.1| PREDICTED: uncharacterized protein LOC103848956 [Brassica rapa]
Length=350

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ +A R++  L L G NYL WALD  I L S  L +TI +++  +E  + +A+ F+RHH
Sbjct  1    MSKIANRDYAALNLSGDNYLQWALDTNISLRSKGLGDTITKDNNENEKNRYRAISFIRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T ++P +LW +L+ R+D Q +++LP+A+ DW+NLRF DFKSV EYNSAL 
Sbjct  61   LIEGLKDQYMTIENPLDLWNALQHRYDHQKTVLLPKARNDWMNLRFLDFKSVDEYNSALF  120

Query  74   KIVSQLKLC  48
            K VS L+LC
Sbjct  121  KTVSILRLC  129



>ref|XP_008657919.1| PREDICTED: uncharacterized protein LOC103637531 [Zea mays]
Length=355

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 94/145 (65%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     +E +K   L  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTTLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+   A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYIMERCPHNLWKSLKERYEQQKELIWSSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>emb|CAN72352.1| hypothetical protein VITISV_019854 [Vitis vinifera]
Length=176

 Score =   130 bits (328),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 95/144 (66%), Gaps = 18/144 (13%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ + K EF+ L + G NYL+W LD E++L +  L  TI + + +    + KALIFLRHH
Sbjct  1    MSNITKLEFVALDISGKNYLSWILDXELHLDAMNLGATIKQGNQASLQDRAKALIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LKNEY T+                  +++LP+A++DW++LR QDFK+V+EYNSAL 
Sbjct  61   LHEGLKNEYLTK------------------TVILPKARYDWMHLRLQDFKTVSEYNSALF  102

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI SQLKLC +++++ D++EKT +
Sbjct  103  KISSQLKLCGEKITEEDMLEKTFT  126



>ref|XP_010430940.1| PREDICTED: uncharacterized protein LOC104715207 [Camelina sativa]
Length=232

 Score =   132 bits (333),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = -3

Query  410  FIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNE  231
            +  L   G NYL WALD +I+L S EL   I +++   +  K KA++++RHH++  LK++
Sbjct  9    YTALNASGDNYLQWALDTKIHLKSKELCECIEDDNNCSKGDKYKAIMYIRHHMDESLKSQ  68

Query  230  YPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKL  51
            Y T +DP ELW  L +++  Q  ++LP+A+ DW  LR QDFKS+  YN  L KI S+LKL
Sbjct  69   YLTIEDPLELWTELTNKYGHQKMVLLPKAQVDWKTLRVQDFKSMDRYNLELFKIASRLKL  128

Query  50   CKQEVSDTDLIEKTLS  3
            C  EV+D DLIEKTLS
Sbjct  129  CGIEVTDEDLIEKTLS  144



>ref|XP_008347476.1| PREDICTED: uncharacterized protein LOC103410566 [Malus domestica]
Length=212

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +AK +F+ L + G NYLTW +D++I+L +  L  TI E + +    + K +IF+R H
Sbjct  1    MANLAKLDFVILDITGKNYLTWVVDIKIHLEAGNLGETIKEENNASSQDRAKTMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  L +EY T +DP  LWK+L+++++    ++LP A++ W  LR Q+FKSV EYNS + 
Sbjct  61   LDEGLNSEYLTVEDPLALWKALRNKYNHHKPMILPMARYKWTYLRIQNFKSVVEYNSEML  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            KI  Q+KLC + ++  +++EKT +
Sbjct  121  KINFQMKLCGETITKDNMLEKTFN  144



>ref|XP_010675436.1| PREDICTED: uncharacterized protein LOC104891438 [Beta vulgaris 
subsp. vulgaris]
Length=324

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F      G  YL W +D + YL S    +TI+E       ++ KAL++L+HH
Sbjct  1    MARLANRDFEIFETSGQRYLEWRVDAKAYLKSLSFDHTIVEGGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK+EY   +DP EL  +LKDRF+    ++ P+A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKSEYIFVEDPKELCDNLKDRFEHLQRIIAPRAQHEWSVLRFQDFASVREYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQLKLC + VS+  +IEKTLS
Sbjct  121  RITSQLKLCGEPVSERAMIEKTLS  144



>ref|XP_008680769.1| PREDICTED: uncharacterized protein LOC103655871 [Zea mays]
Length=348

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTII---ENSTSDEAQKVKALIFL  264
            MT +  REF  LA  G NYLTWA DV+I L   +L+  I    ++  + + Q  +AL FL
Sbjct  1    MTGIVSREFEVLAPHGQNYLTWASDVQIVLGGKKLKVAIGLGKKDEVATDEQNDQALHFL  60

Query  263  RHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNS  84
            RHH +  LKNEY +E+    LW +L+  F+R    VLPQA+ DW  LR+ DFK+V EYN+
Sbjct  61   RHHFSPTLKNEYMSERKVSNLWNALQQHFERLKYTVLPQAQQDWARLRYADFKTVGEYNA  120

Query  83   ALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            ALH+I ++L LC + ++D + IEKTLS
Sbjct  121  ALHRICTKLSLCGKVITDEEKIEKTLS  147



>emb|CAD39859.2| OSJNBa0036B17.9 [Oryza sativa Japonica Group]
Length=421

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 100/145 (69%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSD---EAQKVKALIFL-RH  258
            +A +EF ELALDG+NY  W  D++I   S  + NTI E +  D   E +K+   +FL R 
Sbjct  91   MATKEFDELALDGTNYPIWVSDIKINFASRGILNTIEEPNDGDPAIEPRKLNTTLFLLRL  150

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK+EY  E  P  LWK+LK+R+D+Q  L+ P+A ++W++LR QDFK++ EYN A+
Sbjct  151  YIHKDLKHEYMLETSPLNLWKALKERYDQQKELIWPEANYEWVHLRLQDFKTMAEYNHAV  210

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C+QE ++ + IEKTLS
Sbjct  211  HNICSRLKFCEQEPTEAEKIEKTLS  235



>ref|XP_010675250.1| PREDICTED: uncharacterized protein LOC104891280 [Beta vulgaris 
subsp. vulgaris]
Length=153

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 92/144 (64%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +A R+F  L   G   L W +D + YL S  L +TI+E       ++ KAL++L+HH
Sbjct  1    MARLANRDFEILETSGQRCLEWRVDAKAYLKSLSLDHTIVEGGAPTPLEQAKALVYLKHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            ++ +LK EY   +DP ELW +LKDR +    ++  +A+ +W  LRFQDF SV EYNSA+ 
Sbjct  61   IHEELKYEYILVEDPKELWDNLKDRIEHLQRIIALRAQHEWSVLRFQDFASVREYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+ QLKLC + VS+  +IEKTLS
Sbjct  121  RIILQLKLCGEPVSERAMIEKTLS  144



>ref|XP_008671310.1| PREDICTED: uncharacterized protein LOC103648658 [Zea mays]
Length=357

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELALDG NY TWA D+EI   S  + + I    T     ++ +K  AL  LR 
Sbjct  1    MSTKEFEELALDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNDVKKNTALFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWKSLK+R+++Q  L+   A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKSLKERYEQQKELIWSSANHEWNHLRLQDFKSVAEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E ++ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPTEADKIEKTLS  145



>ref|XP_009113854.1| PREDICTED: uncharacterized protein LOC103839116 [Brassica rapa]
Length=307

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  353  IYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEKDPHELWKSLKDRFD  174
            ++L    L  TI  + T  + +K KA+IFLRHH++  LK+EY T++DP +LWKSLK+RFD
Sbjct  1    MHLRGNGLLETIDSSKTVSDEKKAKAMIFLRHHIHDGLKDEYITKEDPCDLWKSLKERFD  60

Query  173  RQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEVSDTDLIEKTLS  3
             Q  ++LP+AK +W++LRFQD+KSV+E+NSA+  I S++ LC +++SD D+IEKTLS
Sbjct  61   HQKYVILPKAKHEWIHLRFQDYKSVSEFNSAMFGITSRMMLCGEKISDYDMIEKTLS  117



>ref|XP_009117188.1| PREDICTED: uncharacterized protein LOC103842328 [Brassica rapa]
Length=307

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  353  IYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEKDPHELWKSLKDRFD  174
            ++L    L  TI  + T  + +K KA+IFLRHH++  LK+EY T++DP +LWKSLK+RFD
Sbjct  1    MHLRGNGLLETIDSSKTVSDEKKAKAMIFLRHHIHDGLKDEYITKEDPCDLWKSLKERFD  60

Query  173  RQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEVSDTDLIEKTLS  3
             Q  ++LP+AK +W++LRFQD+KSV+E+NSA+  I S++ LC +++SD D+IEKTLS
Sbjct  61   HQKYVILPKAKHEWIHLRFQDYKSVSEFNSAMFGITSRMMLCGEKISDYDMIEKTLS  117



>ref|XP_008347144.1| PREDICTED: uncharacterized protein LOC103410172 [Malus domestica]
Length=147

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 97/143 (68%), Gaps = 2/143 (1%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS--DEAQKVKALIFLR  261
            M+ + K +FI L + G NY  W  D++++LT   L+ TI E +    DEAQK  A+IF+R
Sbjct  1    MSNLNKLDFIALEVFGRNYPKWVQDMKLHLTVKSLRATIKEPTDDLVDEAQKANAMIFIR  60

Query  260  HHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSA  81
             H++  L+ EY  +KDPH LW +L D FD Q ++ LP+A++DW +L FQDFKS+ EYN  
Sbjct  61   RHIHDALQTEYLAKKDPHTLWIALADHFDHQKNIYLPEARYDWQHLCFQDFKSINEYNYE  120

Query  80   LHKIVSQLKLCKQEVSDTDLIEK  12
            + +I S LK C++++++ DL+++
Sbjct  121  VCRIRSLLKFCEEDLTEEDLLDR  143



>ref|XP_009114821.1| PREDICTED: uncharacterized protein LOC103840095 [Brassica rapa]
Length=307

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  353  IYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEKDPHELWKSLKDRFD  174
            ++L    L  TI  + T  + +K KA+IFLRHH++  LK+EY T++DP +LWKSLK+RFD
Sbjct  1    MHLRGNGLLETIDSSKTVSDEKKAKAMIFLRHHIHDGLKDEYITKEDPCDLWKSLKERFD  60

Query  173  RQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEVSDTDLIEKTLS  3
             Q  ++LP+AK +W++LRFQD+KSV+E+NSA+  I S++ LC +++SD D+IEKTLS
Sbjct  61   HQKYVILPKAKHEWIHLRFQDYKSVSEFNSAMFGITSRMMLCGEKISDYDMIEKTLS  117



>ref|XP_008346628.1| PREDICTED: uncharacterized protein LOC103409593 [Malus domestica]
Length=352

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT +AK E+  L + G NYLTW LD +I L +  L +TI E  +S      KA+IF+R H
Sbjct  1    MTNLAKLEYXALDITGXNYLTWVLDTKIXLEAGNLGDTIXEEXSSSSQNXAKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
             +  LK+ Y   +DP  LW++L+ R++ QT+++LP+A+++  +LR QDFKSV  YNSAL 
Sbjct  61   JDXALKSXYLXXEDPLALWEALRSRYNHQTTVILPKARYEXSHLRIQDFKSVXXYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKT  9
            +I SQ+KLC   +++  L+EKT
Sbjct  121  RITSQMKLCGDTITBEXLLEKT  142



>ref|XP_008650661.1| PREDICTED: uncharacterized protein LOC103631556 [Zea mays]
Length=345

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 97/141 (69%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF EL LDG NY TWALD++I L S  + + ++  N   D   +A K   L  +RHHL+
Sbjct  3    REFEELDLDGHNYPTWALDIKISLASKNILSALLPPNERVDPLHDAYKYNTLYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q  ++LP++  +W ++R QD+KS+ +YN A+H+I
Sbjct  63   PDLKAEYVMEEEPNVLWLSLKNRYEQQKVVILPESNHEWTHIRLQDYKSIGDYNHAVHQI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E SD D IEKTL
Sbjct  123  CARLRFCGKEPSDADKIEKTL  143



>ref|XP_008646982.1| PREDICTED: uncharacterized protein LOC103628588 [Zea mays]
Length=345

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 97/141 (69%), Gaps = 4/141 (3%)
 Frame = -3

Query  416  REFIELALDGSNYLTWALDVEIYLTSTELQNTIIE-NSTSD---EAQKVKALIFLRHHLN  249
            REF ELALDG NY TW LD++I L S  + + ++  N   D   +A K  AL  +RHHL+
Sbjct  3    REFEELALDGHNYPTWTLDIKISLVSKNILSALLPPNERVDPLHDAYKYNALYIIRHHLH  62

Query  248  YDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKI  69
             DLK EY  E++P+ LW SLK+R+++Q +++LP+A  +W ++R QD+KS+ +YN  +H+I
Sbjct  63   LDLKAEYVMEEEPNVLWLSLKNRYEQQKAVILPEANHEWTHIRLQDYKSIGDYNHVVHQI  122

Query  68   VSQLKLCKQEVSDTDLIEKTL  6
             ++L+ C +E  D D IEKTL
Sbjct  123  YARLRFCGKEPLDADKIEKTL  143



>ref|XP_004243077.1| PREDICTED: uncharacterized protein LOC101256103 [Solanum lycopersicum]
Length=317

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = -3

Query  395  LDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHHLNYDLKNEYPTEK  216
            + G NYL+W LD EI+L +  L  TI + + +    K  A+IFLRHHL+  LK +Y T K
Sbjct  4    ISGKNYLSWVLDAEIHLAAKGLDATITQGNEASSQDKANAMIFLRHHLDEGLKIKYLTVK  63

Query  215  DPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALHKIVSQLKLCKQEV  36
            D  ELW  LK R+    + +LP+A+++W++LRFQDFK+V  YNS + +I SQLKLC + +
Sbjct  64   DLLELWTDLKGRYGHLKATLLPRARYEWMHLRFQDFKNVIAYNSIVFRITSQLKLCGETI  123

Query  35   SDTDLIEKTLS  3
             D D++ KTL+
Sbjct  124  KDEDMLVKTLA  134



>ref|XP_009337903.1| PREDICTED: uncharacterized protein LOC103930307 [Pyrus x bretschneideri]
Length=149

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  VAK EF  L + G NYLTW L  +I+L +  L +TI + S+S    +VKA+IF+R H
Sbjct  1    MANVAKLEFAALDIIGKNYLTWVLVTKIHLEAGNLGDTIRKESSSSSQDRVKAMIFIRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+EY   ++   LW +L++R++ QT+++ P  +++W +LR QDFKSV EYNSAL 
Sbjct  61   LDKALKSEYLMVENSLALWNALRNRYNHQTTVIFPGTRYEWTHLRIQDFKSVVEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEK  12
            +I  Q+KL    ++   ++EK
Sbjct  121  RITPQMKLYGDTITVEYMLEK  141



>ref|XP_008358118.1| PREDICTED: uncharacterized protein LOC103421859 [Malus domestica]
Length=383

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 92/144 (64%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  +AK +F  L + G NYL W LD +I+L +  L +TI E S+S    + KA+IF+R H
Sbjct  1    MANLAKLDFAALBITGKNYLXWVLDTKIHLEAXNLXBTIKEESSSSSQDRAKAMIFIRXH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK+ Y T +DP     +L   ++ QT+++LP+A++DW +L  QDFKSV EYNSAL 
Sbjct  61   LDXALKSXYLTVEDPLAXXBALXXXYNHQTTVILPKARYDWTHLXIQDFKSVAEYNSALF  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I SQ+KLC   +    L+EK  S
Sbjct  121  RITSQMKLCGDTIXXEMLLEKXFS  144



>ref|XP_010229530.1| PREDICTED: uncharacterized protein LOC104581995 [Brachypodium 
distachyon]
Length=355

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 91/148 (61%), Gaps = 4/148 (3%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENS----TSDEAQKVKALIF  267
            M+ + KREF ELA  G NYL WA DVEI+L   +L + I  +      +  A+  +AL F
Sbjct  1    MSAITKREFDELAQHGGNYLAWATDVEIWLEGKQLWSPIALSGKGAPAATSAENAQALHF  60

Query  266  LRHHLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYN  87
            LRHHL   LK EY  E+    LW +LK RF+R       QA+ +W  LRF DF SV EYN
Sbjct  61   LRHHLCATLKIEYMAERSALALWTALKRRFERLKYSTQSQAEAEWARLRFADFWSVGEYN  120

Query  86   SALHKIVSQLKLCKQEVSDTDLIEKTLS  3
            SALH+I ++L+LC   V+D+  IEKTLS
Sbjct  121  SALHRICTRLQLCGVTVTDSQKIEKTLS  148



>ref|XP_009108120.1| PREDICTED: uncharacterized protein LOC103833812 [Brassica rapa]
Length=328

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M  + K +F  L + G+NY++W  +VE++L S  L  T+ E +TS   +K K++IFLR H
Sbjct  1    MANMEKLQFPALDITGTNYISWVTNVELHLESLGLSETVKEINTSTPQEKAKSVIFLRRH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  +  +Y   +DP ELWKSLKDRFD Q  + LP A+ +W +LRFQDF  V  YNSA+ 
Sbjct  61   LDESIIYDYANMRDPKELWKSLKDRFDHQKDITLPLARDEWQSLRFQDFDKVMNYNSAVL  120

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
             IV++L+ C + ++++ ++EKT +
Sbjct  121  GIVAKLRYCGETITESQMLEKTYT  144



>ref|XP_004229128.1| PREDICTED: uncharacterized protein LOC101256322 [Solanum lycopersicum]
Length=145

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 92/144 (64%), Gaps = 19/144 (13%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            M+ ++K EF+ L + G NYL+W LDVEI+L +  L  TI + + +    K KA+IFLRHH
Sbjct  1    MSNLSKLEFVGLDIFGKNYLSWVLDVEIHLAAKRLDATITQGNEASSQDKAKAVIFLRHH  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L+  LK EY T                   + VLP+A+++W++LRFQDFK+V EYNS + 
Sbjct  61   LDEGLKIEYLT-------------------ATVLPRARYEWMHLRFQDFKTVIEYNSVVF  101

Query  74   KIVSQLKLCKQEVSDTDLIEKTLS  3
            +I+SQL+LC + + D D++EK L+
Sbjct  102  RIISQLQLCGETIKDEDMLEKRLT  125



>ref|XP_008650293.1| PREDICTED: uncharacterized protein LOC103631064 [Zea mays]
Length=355

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 94/145 (65%), Gaps = 4/145 (3%)
 Frame = -3

Query  425  VAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTS----DEAQKVKALIFLRH  258
            ++ +EF ELA DG NY TWA D+EI   S  + + I    T     +E +K  +L  LR 
Sbjct  1    MSTKEFEELAFDGHNYPTWASDIEITFASRGIIDAIAAPITGTDPVNEVKKNTSLFLLRL  60

Query  257  HLNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSAL  78
            +++ DLK EY  E+ PH LWK+LK+R+++Q  L+   A  +W +LR QDFKSV EYN AL
Sbjct  61   YIHKDLKQEYLMERCPHNLWKALKERYEQQKELIWLSANHEWNHLRLQDFKSVVEYNHAL  120

Query  77   HKIVSQLKLCKQEVSDTDLIEKTLS  3
            H I S+LK C++E S+ D IEKTLS
Sbjct  121  HSICSKLKFCEKEPSEADKIEKTLS  145



>ref|XP_009361107.1| PREDICTED: uncharacterized protein LOC103951466 [Pyrus x bretschneideri]
Length=130

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -3

Query  434  MTTVAKREFIELALDGSNYLTWALDVEIYLTSTELQNTIIENSTSDEAQKVKALIFLRHH  255
            MT + K +F+ L + G NYLTW +D +I L +  L++TI E++ +    + K +IF+   
Sbjct  1    MTNLGKLDFVTLDITGKNYLTWVMDAKIPLEAGNLEDTIKEDTGASSQDRAKPMIFIHCQ  60

Query  254  LNYDLKNEYPTEKDPHELWKSLKDRFDRQTSLVLPQAKFDWLNLRFQDFKSVTEYNSALH  75
            L   LK++Y T +DP  LWK+LK+R++ Q  ++LP A+++W +LR QDFK   EYNS + 
Sbjct  61   LGEGLKSKYLTVEDPLTLWKALKNRYNHQKMVILPMARYEWAHLRIQDFKPAAEYNSTMF  120

Query  74   KIVSQLKLC  48
            KI SQLKLC
Sbjct  121  KIRSQLKLC  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517811659326