BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c114818_g1_i1 len=122 path=[1:0-121]

Length=122
                                                                      Score     E

ref|XP_010645307.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.4    3e-13   
emb|CAN80761.1|  hypothetical protein VITISV_014604                   72.4    4e-13   Vitis vinifera
emb|CBI23333.3|  unnamed protein product                              72.0    4e-13   
ref|XP_010277800.1|  PREDICTED: uncharacterized protein LOC104612174  69.7    3e-12   
gb|KDP45206.1|  hypothetical protein JCGZ_15071                       69.7    3e-12   
ref|XP_010495443.1|  PREDICTED: testis-expressed sequence 11 prot...  68.2    9e-12   
gb|ABO71664.1|  ZIP4/SPO22                                            68.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199650.3|  ZIP4-like protein                                   68.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA96959.1|  unnamed protein product                              68.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442262.1|  PREDICTED: testis-expressed sequence 11 prot...  68.2    1e-11   
emb|CDX86307.1|  BnaA06g30240D                                        68.2    1e-11   
ref|XP_010326219.1|  PREDICTED: testis-expressed sequence 11 protein  67.8    1e-11   
ref|XP_009151641.1|  PREDICTED: uncharacterized protein LOC103874954  67.4    2e-11   
ref|XP_006395187.1|  hypothetical protein EUTSA_v10005371mg           67.4    2e-11   
ref|XP_010482091.1|  PREDICTED: uncharacterized protein LOC104760822  67.0    2e-11   
ref|XP_009760587.1|  PREDICTED: testis-expressed sequence 11 protein  67.0    3e-11   
ref|XP_010547171.1|  PREDICTED: uncharacterized protein LOC104819011  66.6    4e-11   
ref|XP_009629355.1|  PREDICTED: testis-expressed sequence 11 protein  66.6    4e-11   
emb|CDX85335.1|  BnaC07g26460D                                        66.6    4e-11   
ref|XP_006350431.1|  PREDICTED: testis-expressed sequence 11 prot...  65.5    1e-10   
ref|XP_010679001.1|  PREDICTED: uncharacterized protein LOC104894...  65.1    1e-10   
ref|XP_010679000.1|  PREDICTED: uncharacterized protein LOC104894...  65.1    1e-10   
emb|CDP03991.1|  unnamed protein product                              65.1    1e-10   
ref|XP_002863893.1|  hypothetical protein ARALYDRAFT_331248           64.7    2e-10   
ref|XP_009415625.1|  PREDICTED: uncharacterized protein LOC103996429  64.7    2e-10   
ref|XP_004290113.1|  PREDICTED: uncharacterized protein LOC101290914  64.3    2e-10   
ref|XP_011010342.1|  PREDICTED: testis-expressed sequence 11 prot...  64.3    2e-10   
ref|XP_002320560.2|  hypothetical protein POPTR_0014s17370g           64.3    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011010341.1|  PREDICTED: testis-expressed sequence 11 prot...  63.9    3e-10   
ref|XP_002527288.1|  conserved hypothetical protein                   63.9    3e-10   Ricinus communis
ref|XP_008441875.1|  PREDICTED: testis-expressed sequence 11 protein  63.2    6e-10   
ref|XP_006279966.1|  hypothetical protein CARUB_v10025833mg           62.8    7e-10   
gb|EYU46075.1|  hypothetical protein MIMGU_mgv1a026556mg              62.8    7e-10   
ref|XP_004155124.1|  PREDICTED: uncharacterized protein LOC101224301  62.0    8e-10   
ref|XP_006279967.1|  hypothetical protein CARUB_v10025833mg           62.8    8e-10   
ref|XP_007199165.1|  hypothetical protein PRUPE_ppa019875mg           62.8    9e-10   
ref|XP_007049536.1|  Tetratricopeptide repeat (TPR)-like superfam...  62.4    1e-09   
ref|XP_007049535.1|  Tetratricopeptide repeat (TPR)-like superfam...  62.4    1e-09   
gb|AES80461.2|  SPO22/ZIP4-like meiosis protein                       62.0    1e-09   
ref|XP_010095586.1|  Testis-expressed sequence 11 protein             62.0    1e-09   
gb|KDO43510.1|  hypothetical protein CISIN_1g004720mg                 61.6    2e-09   
ref|XP_003624242.1|  hypothetical protein MTR_7g080870                61.2    2e-09   
gb|ABN08994.1|  TPR repeat                                            61.2    2e-09   Medicago truncatula
ref|XP_004152883.1|  PREDICTED: testis-expressed sequence 11 prot...  61.6    2e-09   
gb|KGN61247.1|  hypothetical protein Csa_2G074090                     61.6    2e-09   
ref|XP_011080558.1|  PREDICTED: testis-expressed sequence 11 protein  61.2    2e-09   
ref|XP_006602853.1|  PREDICTED: testis-expressed sequence 11 prot...  60.8    4e-09   
ref|XP_009358939.1|  PREDICTED: uncharacterized protein LOC103949548  60.8    4e-09   
ref|XP_006469346.1|  PREDICTED: testis-expressed sequence 11 prot...  59.7    8e-09   
ref|XP_006447939.1|  hypothetical protein CICLE_v10018269mg           59.7    8e-09   
ref|XP_010034967.1|  PREDICTED: testis-expressed sequence 11 protein  59.7    8e-09   
ref|XP_004309150.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  58.9    1e-08   
gb|EPS68179.1|  hypothetical protein M569_06585                       57.0    7e-08   
ref|XP_007139686.1|  hypothetical protein PHAVU_008G050500g           56.6    1e-07   
ref|XP_008235930.1|  PREDICTED: uncharacterized protein LOC103334734  55.5    3e-07   
ref|XP_010909836.1|  PREDICTED: uncharacterized protein LOC105035829  54.7    5e-07   
ref|XP_008788260.1|  PREDICTED: uncharacterized protein LOC103706066  53.5    1e-06   



>ref|XP_010645307.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100242929 
[Vitis vinifera]
Length=941

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAW+V+DRNL +TLLNR+KNLLFG+AE+YK
Sbjct  177  LLDLNIARSRTAWDVSDRNLAVTLLNRAKNLLFGSAEHYK  216



>emb|CAN80761.1| hypothetical protein VITISV_014604 [Vitis vinifera]
Length=930

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAW+V+DRNL +TLLNR+KNLLFG+AE+YK
Sbjct  177  LLDLNIARSRTAWDVSDRNLAVTLLNRAKNLLFGSAEHYK  216



>emb|CBI23333.3| unnamed protein product [Vitis vinifera]
Length=848

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAW+V+DRNL +TLLNR+KNLLFG+AE+YK
Sbjct  177  LLDLNIARSRTAWDVSDRNLAVTLLNRAKNLLFGSAEHYK  216



>ref|XP_010277800.1| PREDICTED: uncharacterized protein LOC104612174 [Nelumbo nucifera]
Length=942

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAWEV+DRNL + LLNRSKN+LFG +E+YK
Sbjct  178  LLDLNIARSRTAWEVSDRNLSLMLLNRSKNMLFGYSESYK  217



>gb|KDP45206.1| hypothetical protein JCGZ_15071 [Jatropha curcas]
Length=945

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLN+ARSRTAWEV+DRNL ITLLNRSK LLFG++++YK
Sbjct  187  LLDLNLARSRTAWEVSDRNLAITLLNRSKTLLFGSSDHYK  226



>ref|XP_010495443.1| PREDICTED: testis-expressed sequence 11 protein-like [Camelina 
sativa]
Length=887

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARS+TAWE++DRNL +TLLNR+KNLLFG+ E+YK
Sbjct  181  FLDLNLARSQTAWEISDRNLAVTLLNRAKNLLFGSPEHYK  220



>gb|ABO71664.1| ZIP4/SPO22 [Arabidopsis thaliana]
Length=936

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE++DRNL +TLLNR+KNLLFG+ ++YK
Sbjct  181  FLDLNLARSRTAWEISDRNLAVTLLNRAKNLLFGSPDHYK  220



>ref|NP_199650.3| ZIP4-like protein [Arabidopsis thaliana]
 dbj|BAG07186.1| ZIP4-like protein [Arabidopsis thaliana]
 gb|AED95664.1| ZIP4-like protein [Arabidopsis thaliana]
Length=936

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE++DRNL +TLLNR+KNLLFG+ ++YK
Sbjct  181  FLDLNLARSRTAWEISDRNLAVTLLNRAKNLLFGSPDHYK  220



>dbj|BAA96959.1| unnamed protein product [Arabidopsis thaliana]
Length=1337

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE++DRNL +TLLNR+KNLLFG+ ++YK
Sbjct  618  FLDLNLARSRTAWEISDRNLAVTLLNRAKNLLFGSPDHYK  657



>ref|XP_010442262.1| PREDICTED: testis-expressed sequence 11 protein-like [Camelina 
sativa]
Length=936

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARS+TAWE++DRNL +TLLNR+KNLLFG+ E+YK
Sbjct  181  FLDLNLARSQTAWEISDRNLAVTLLNRAKNLLFGSPEHYK  220



>emb|CDX86307.1| BnaA06g30240D [Brassica napus]
Length=1493

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE++DRNL +TLLNR+KN+LFG+ ++YK
Sbjct  738  FLDLNLARSRTAWEISDRNLAVTLLNRAKNMLFGSPDHYK  777



>ref|XP_010326219.1| PREDICTED: testis-expressed sequence 11 protein [Solanum lycopersicum]
Length=918

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAWEV+DRNL I LL+RSKNLLF  A+NYK
Sbjct  173  LLDLNIARSRTAWEVSDRNLAIALLSRSKNLLFAFADNYK  212



>ref|XP_009151641.1| PREDICTED: uncharacterized protein LOC103874954 [Brassica rapa]
Length=936

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE++DRNL +TLLNR+KN+LFG+ ++YK
Sbjct  181  FLDLNLARSRTAWEISDRNLAVTLLNRAKNMLFGSPDHYK  220



>ref|XP_006395187.1| hypothetical protein EUTSA_v10005371mg [Eutrema salsugineum]
 gb|ESQ32473.1| hypothetical protein EUTSA_v10005371mg [Eutrema salsugineum]
Length=941

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE++DRNL +TLLNR+KN+LFG+ ++YK
Sbjct  181  FLDLNLARSRTAWEISDRNLAVTLLNRAKNMLFGSPDHYK  220



>ref|XP_010482091.1| PREDICTED: uncharacterized protein LOC104760822 [Camelina sativa]
Length=936

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARS+TAWE +DRNL +TLLNR+KNLLFG+ E+YK
Sbjct  181  FLDLNLARSQTAWETSDRNLAVTLLNRAKNLLFGSPEHYK  220



>ref|XP_009760587.1| PREDICTED: testis-expressed sequence 11 protein [Nicotiana sylvestris]
Length=921

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAWEV+DRNL + LL+RSK++LF  AENYK
Sbjct  177  LLDLNIARSRTAWEVSDRNLAVALLSRSKSMLFAVAENYK  216



>ref|XP_010547171.1| PREDICTED: uncharacterized protein LOC104819011 [Tarenaya hassleriana]
Length=949

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            +LDLN+ARSRTAWEV+DRNL +TLL+R+KN LFG+ ++YK
Sbjct  182  ILDLNLARSRTAWEVSDRNLAVTLLHRAKNFLFGSPDHYK  221



>ref|XP_009629355.1| PREDICTED: testis-expressed sequence 11 protein [Nicotiana tomentosiformis]
Length=921

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAWEV+DRNL + LL+RSK++LF  AENYK
Sbjct  177  LLDLNIARSRTAWEVSDRNLAVALLSRSKSVLFAVAENYK  216



>emb|CDX85335.1| BnaC07g26460D [Brassica napus]
Length=1617

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            +LDLN+ARSRTAWE++DR L +TLLNR+KN+LFG+ ++YK
Sbjct  862  ILDLNLARSRTAWEISDRTLAVTLLNRAKNMLFGSPDHYK  901



>ref|XP_006350431.1| PREDICTED: testis-expressed sequence 11 protein-like [Solanum 
tuberosum]
Length=930

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARSRTAWEV+DRNL I LL RSKN+LF  A+NYK
Sbjct  173  LLDLNIARSRTAWEVSDRNLAIALLCRSKNVLFAFADNYK  212



>ref|XP_010679001.1| PREDICTED: uncharacterized protein LOC104894465 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=937

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLD+N+ARSRTAWEV+DRN+ ITLLNRSK  LF  AEN++
Sbjct  169  LLDINVARSRTAWEVSDRNVSITLLNRSKKFLFETAENFR  208



>ref|XP_010679000.1| PREDICTED: uncharacterized protein LOC104894465 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=943

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLD+N+ARSRTAWEV+DRN+ ITLLNRSK  LF  AEN++
Sbjct  169  LLDINVARSRTAWEVSDRNVSITLLNRSKKFLFETAENFR  208



>emb|CDP03991.1| unnamed protein product [Coffea canephora]
Length=943

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            +L+LN+ARSRTAWEV+DRNL I LL+RSKN LFG +ENYK
Sbjct  178  VLNLNLARSRTAWEVSDRNLSIMLLSRSKNALFGISENYK  217



>ref|XP_002863893.1| hypothetical protein ARALYDRAFT_331248 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40152.1| hypothetical protein ARALYDRAFT_331248 [Arabidopsis lyrata subsp. 
lyrata]
Length=1334

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAW ++DRNL +TLLNR+KN+LFG+ ++YK
Sbjct  617  FLDLNLARSRTAWGISDRNLAVTLLNRAKNMLFGSPDHYK  656



>ref|XP_009415625.1| PREDICTED: uncharacterized protein LOC103996429 [Musa acuminata 
subsp. malaccensis]
Length=950

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLN+AR+RTAWEVADRNL I LLNRSKNL+FG+   ++
Sbjct  187  LLDLNLARARTAWEVADRNLAIALLNRSKNLIFGSPLGFR  226



>ref|XP_004290113.1| PREDICTED: uncharacterized protein LOC101290914 [Fragaria vesca 
subsp. vesca]
Length=944

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDL+IARS+TAWEV+DRNL + LLNR+K+LLFG+ E+YK
Sbjct  183  FLDLSIARSKTAWEVSDRNLAVALLNRAKSLLFGSPEHYK  222



>ref|XP_011010342.1| PREDICTED: testis-expressed sequence 11 protein isoform X2 [Populus 
euphratica]
Length=779

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLN+ARSRTAWE++DRNL I LL R+K LLFG++++YK
Sbjct  188  LLDLNLARSRTAWEISDRNLAIILLTRAKTLLFGSSDHYK  227



>ref|XP_002320560.2| hypothetical protein POPTR_0014s17370g [Populus trichocarpa]
 gb|EEE98875.2| hypothetical protein POPTR_0014s17370g [Populus trichocarpa]
Length=956

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLN+ARSRTAWE++DRNL I LL R+K LLFG++++YK
Sbjct  192  LLDLNLARSRTAWEISDRNLAIILLTRAKTLLFGSSDHYK  231



>ref|XP_011010341.1| PREDICTED: testis-expressed sequence 11 protein isoform X1 [Populus 
euphratica]
Length=952

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLN+ARSRTAWE++DRNL I LL R+K LLFG++++YK
Sbjct  188  LLDLNLARSRTAWEISDRNLAIILLTRAKTLLFGSSDHYK  227



>ref|XP_002527288.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35132.1| conserved hypothetical protein [Ricinus communis]
Length=938

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            +LDLN++RSR+AWEV+D+NL ITLLNR+KN+LFG  ++YK
Sbjct  184  ILDLNLSRSRSAWEVSDKNLAITLLNRAKNMLFGTFDHYK  223



>ref|XP_008441875.1| PREDICTED: testis-expressed sequence 11 protein [Cucumis melo]
 ref|XP_008441876.1| PREDICTED: testis-expressed sequence 11 protein [Cucumis melo]
 ref|XP_008441877.1| PREDICTED: testis-expressed sequence 11 protein [Cucumis melo]
 ref|XP_008441878.1| PREDICTED: testis-expressed sequence 11 protein [Cucumis melo]
Length=944

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIAR+RTAW+V+DRNL + LL+R+K L+FG+ E+YK
Sbjct  190  LLDLNIARARTAWQVSDRNLAMVLLSRAKGLMFGSPEHYK  229



>ref|XP_006279966.1| hypothetical protein CARUB_v10025833mg [Capsella rubella]
 gb|EOA12864.1| hypothetical protein CARUB_v10025833mg [Capsella rubella]
Length=936

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE +DRNL +TLLNR+K+LLFG  ++YK
Sbjct  181  FLDLNLARSRTAWENSDRNLAVTLLNRAKSLLFGLPDHYK  220



>gb|EYU46075.1| hypothetical protein MIMGU_mgv1a026556mg [Erythranthe guttata]
Length=943

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLNI+RS+ AWEV+DRNL I LLNRSKN+LFG + NY
Sbjct  176  LLDLNISRSKAAWEVSDRNLAINLLNRSKNVLFGVSRNY  214



>ref|XP_004155124.1| PREDICTED: uncharacterized protein LOC101224301 [Cucumis sativus]
Length=454

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIAR+RTAW+V+D+NL + LL+R+K L+FG+ E+YK
Sbjct  194  LLDLNIARARTAWQVSDKNLAMVLLSRAKGLMFGSPEHYK  233



>ref|XP_006279967.1| hypothetical protein CARUB_v10025833mg [Capsella rubella]
 gb|EOA12865.1| hypothetical protein CARUB_v10025833mg [Capsella rubella]
Length=926

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLN+ARSRTAWE +DRNL +TLLNR+K+LLFG  ++YK
Sbjct  181  FLDLNLARSRTAWENSDRNLAVTLLNRAKSLLFGLPDHYK  220



>ref|XP_007199165.1| hypothetical protein PRUPE_ppa019875mg [Prunus persica]
 gb|EMJ00364.1| hypothetical protein PRUPE_ppa019875mg [Prunus persica]
Length=948

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARS+TAWE+ DRNL I LLNR+K LLFG  +++K
Sbjct  183  LLDLNIARSKTAWEIRDRNLAIALLNRAKGLLFGTPDHHK  222



>ref|XP_007049536.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX93693.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
Length=982

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARS TAWE++D+NL ITLLNRSK LLFG+  ++K
Sbjct  215  LLDLNIARSLTAWEISDKNLAITLLNRSKTLLFGSPVHFK  254



>ref|XP_007049535.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX93692.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=969

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIARS TAWE++D+NL ITLLNRSK LLFG+  ++K
Sbjct  215  LLDLNIARSLTAWEISDKNLAITLLNRSKTLLFGSPVHFK  254



>gb|AES80461.2| SPO22/ZIP4-like meiosis protein [Medicago truncatula]
Length=927

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLN+ARSRTAWEV D+NL I LLNRSK+++ G++ENY
Sbjct  181  LLDLNLARSRTAWEVRDQNLAIALLNRSKSMVSGSSENY  219



>ref|XP_010095586.1| Testis-expressed sequence 11 protein [Morus notabilis]
 gb|EXB61159.1| Testis-expressed sequence 11 protein [Morus notabilis]
Length=968

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDL+IARSRTAWEV+DRNL + LLNR+K+ LFG+ E+ K
Sbjct  190  LLDLSIARSRTAWEVSDRNLAVALLNRAKDFLFGSPEHQK  229



>gb|KDO43510.1| hypothetical protein CISIN_1g004720mg [Citrus sinensis]
Length=733

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLD+NIARSRTAWEV ++NL ITLLNR+K LLFG  E+YK
Sbjct  179  LLDINIARSRTAWEVLEQNLAITLLNRAKCLLFGLFEHYK  218



>ref|XP_003624242.1| hypothetical protein MTR_7g080870 [Medicago truncatula]
Length=501

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLN+ARSRTAWEV D+NL I LLNRSK+++ G++ENY
Sbjct  181  LLDLNLARSRTAWEVRDQNLAIALLNRSKSMVSGSSENY  219



>gb|ABN08994.1| TPR repeat [Medicago truncatula]
Length=468

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLN+ARSRTAWEV D+NL I LLNRSK+++ G++ENY
Sbjct  181  LLDLNLARSRTAWEVRDQNLAIALLNRSKSMVSGSSENY  219



>ref|XP_004152883.1| PREDICTED: testis-expressed sequence 11 protein-like [Cucumis 
sativus]
Length=948

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIAR+RTAW+V+D+NL + LL+R+K L+FG+ E+YK
Sbjct  194  LLDLNIARARTAWQVSDKNLAMVLLSRAKGLMFGSPEHYK  233



>gb|KGN61247.1| hypothetical protein Csa_2G074090 [Cucumis sativus]
Length=950

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDLNIAR+RTAW+V+D+NL + LL+R+K L+FG+ E+YK
Sbjct  196  LLDLNIARARTAWQVSDKNLAMVLLSRAKGLMFGSPEHYK  235



>ref|XP_011080558.1| PREDICTED: testis-expressed sequence 11 protein [Sesamum indicum]
Length=944

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLN+ARSR AW+V DRNL I LLNRSKN+LFG + NY
Sbjct  177  LLDLNLARSRAAWDVLDRNLAIALLNRSKNVLFGVSRNY  215



>ref|XP_006602853.1| PREDICTED: testis-expressed sequence 11 protein-like [Glycine 
max]
Length=953

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLN+ARSRTAWEV D NL + LLNRSK+ LFG  E+Y
Sbjct  204  LLDLNLARSRTAWEVRDPNLAVALLNRSKSFLFGACEHY  242



>ref|XP_009358939.1| PREDICTED: uncharacterized protein LOC103949548 [Pyrus x bretschneideri]
Length=938

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLDL+IARS+TAW+V+DRN+ I LLNR+K+LLFG+ +++K
Sbjct  187  LLDLSIARSKTAWDVSDRNVAIALLNRAKSLLFGSPDHHK  226



>ref|XP_006469346.1| PREDICTED: testis-expressed sequence 11 protein-like [Citrus 
sinensis]
Length=935

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLD+NIARSRTAWEV ++NL ITLLNR+K LLFG  E++K
Sbjct  179  LLDINIARSRTAWEVLEQNLAITLLNRAKCLLFGLFEHHK  218



>ref|XP_006447939.1| hypothetical protein CICLE_v10018269mg, partial [Citrus clementina]
 gb|ESR61179.1| hypothetical protein CICLE_v10018269mg, partial [Citrus clementina]
Length=913

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            LLD+NIARSRTAWEV ++NL ITLLNR+K LLFG  E++K
Sbjct  179  LLDINIARSRTAWEVLEQNLAITLLNRAKCLLFGLFEHHK  218



>ref|XP_010034967.1| PREDICTED: testis-expressed sequence 11 protein [Eucalyptus grandis]
 gb|KCW46208.1| hypothetical protein EUGRSUZ_K00106 [Eucalyptus grandis]
Length=947

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
             LDL IARSRTAWEV+D+ L +TLLNRSK LLFG++++Y
Sbjct  186  FLDLQIARSRTAWEVSDQILAVTLLNRSKCLLFGSSDHY  224



>ref|XP_004309150.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=585

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
             LDLNIARS+TA +V+DRNL + LLNR+K+LLFG+ E+YK
Sbjct  494  FLDLNIARSKTARKVSDRNLAVALLNRAKSLLFGSPEHYK  533



>gb|EPS68179.1| hypothetical protein M569_06585, partial [Genlisea aurea]
Length=912

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLN+ARSR AW++ DRNL I LLNRSKN+L G + NY
Sbjct  158  LLDLNLARSRLAWDIPDRNLAIALLNRSKNVLCGISRNY  196



>ref|XP_007139686.1| hypothetical protein PHAVU_008G050500g [Phaseolus vulgaris]
 gb|ESW11680.1| hypothetical protein PHAVU_008G050500g [Phaseolus vulgaris]
Length=800

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCITLLNRSKNLLFGNAENY  4
            LLDLN+ARSRTAWE+ D +L + LLNRSK+ LFG+  +Y
Sbjct  178  LLDLNLARSRTAWEIRDSSLSVALLNRSKSFLFGSCNHY  216



>ref|XP_008235930.1| PREDICTED: uncharacterized protein LOC103334734 [Prunus mume]
Length=954

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 4/44 (9%)
 Frame = -3

Query  120  LLDLNIARSRTAWEVADRNLCI----TLLNRSKNLLFGNAENYK  1
            LLDLNIARS+TAWE+ DR+L I     LLNR+K LLFG  +++K
Sbjct  185  LLDLNIARSKTAWEIRDRSLAIAVVLPLLNRAKGLLFGTPDHHK  228



>ref|XP_010909836.1| PREDICTED: uncharacterized protein LOC105035829 [Elaeis guineensis]
Length=954

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  ARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            ARSRTAWEVADRNL I LLNRSK+LLFG+   ++
Sbjct  184  ARSRTAWEVADRNLAIALLNRSKSLLFGSPAAFR  217



>ref|XP_008788260.1| PREDICTED: uncharacterized protein LOC103706066 [Phoenix dactylifera]
Length=956

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  ARSRTAWEVADRNLCITLLNRSKNLLFGNAENYK  1
            +RSRTAWEVADRNL I LLNRSK+LLFG+   ++
Sbjct  184  SRSRTAWEVADRNLAIALLNRSKSLLFGSPAAFR  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518182412384