BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c113803_g1_i1 len=141 path=[1:0-140]

Length=141
                                                                      Score     E

emb|CAN82075.1|  hypothetical protein VITISV_016661                   88.6    1e-18   Vitis vinifera
emb|CAN60609.1|  hypothetical protein VITISV_036599                   87.8    3e-18   Vitis vinifera
emb|CAN71773.1|  hypothetical protein VITISV_002508                   87.0    3e-18   Vitis vinifera
ref|XP_009778353.1|  PREDICTED: uncharacterized protein LOC104227744  87.4    3e-18   
emb|CAN80469.1|  hypothetical protein VITISV_008623                   87.0    4e-18   Vitis vinifera
emb|CAN81139.1|  hypothetical protein VITISV_018760                   87.0    4e-18   Vitis vinifera
emb|CAN65421.1|  hypothetical protein VITISV_001858                   86.7    4e-18   Vitis vinifera
emb|CAN75922.1|  hypothetical protein VITISV_030752                   86.7    5e-18   Vitis vinifera
emb|CAN80753.1|  hypothetical protein VITISV_003323                   86.7    5e-18   Vitis vinifera
emb|CAN62317.1|  hypothetical protein VITISV_026526                   85.9    7e-18   Vitis vinifera
emb|CAN74286.1|  hypothetical protein VITISV_036410                   86.3    7e-18   Vitis vinifera
emb|CAN80771.1|  hypothetical protein VITISV_027574                   86.3    8e-18   Vitis vinifera
emb|CAN74104.1|  hypothetical protein VITISV_008952                   86.3    8e-18   Vitis vinifera
emb|CAN62074.1|  hypothetical protein VITISV_001619                   86.3    9e-18   Vitis vinifera
emb|CAN80088.1|  hypothetical protein VITISV_021656                   85.5    1e-17   Vitis vinifera
emb|CAN78715.1|  hypothetical protein VITISV_030863                   85.1    2e-17   Vitis vinifera
emb|CAN77210.1|  hypothetical protein VITISV_000141                   85.1    2e-17   Vitis vinifera
emb|CAN73250.1|  hypothetical protein VITISV_027047                   84.3    3e-17   Vitis vinifera
gb|ABI34329.1|  Integrase core domain containing protein              84.7    3e-17   Solanum demissum
emb|CAN67925.1|  hypothetical protein VITISV_021168                   84.3    4e-17   Vitis vinifera
emb|CAN67447.1|  hypothetical protein VITISV_031398                   83.6    5e-17   Vitis vinifera
emb|CAN60498.1|  hypothetical protein VITISV_027869                   84.0    6e-17   Vitis vinifera
gb|AFN88207.1|  integrase core domain containing protein              83.6    7e-17   
emb|CAN74964.1|  hypothetical protein VITISV_006810                   83.2    1e-16   Vitis vinifera
emb|CAN80763.1|  hypothetical protein VITISV_017069                   82.8    1e-16   Vitis vinifera
emb|CAN73234.1|  hypothetical protein VITISV_033857                   82.8    1e-16   Vitis vinifera
gb|AAT38747.2|  Polyprotein, putative                                 82.8    1e-16   Solanum demissum
gb|AEJ72555.1|  putative retroelement polyprotein                     82.4    2e-16   
emb|CAN76965.1|  hypothetical protein VITISV_043961                   82.4    2e-16   Vitis vinifera
emb|CAN61011.1|  hypothetical protein VITISV_038445                   82.4    2e-16   Vitis vinifera
ref|XP_007033295.1|  Uncharacterized protein TCM_019488               82.0    2e-16   
emb|CAN68461.1|  hypothetical protein VITISV_037728                   81.3    2e-16   Vitis vinifera
emb|CAN80547.1|  hypothetical protein VITISV_010898                   82.0    2e-16   Vitis vinifera
emb|CAN72663.1|  hypothetical protein VITISV_031849                   82.0    2e-16   Vitis vinifera
emb|CAN84135.1|  hypothetical protein VITISV_000113                   82.0    2e-16   Vitis vinifera
emb|CAN63730.1|  hypothetical protein VITISV_030286                   82.0    2e-16   Vitis vinifera
emb|CAN61179.1|  hypothetical protein VITISV_032292                   82.0    2e-16   Vitis vinifera
emb|CAN76032.1|  hypothetical protein VITISV_040150                   82.0    2e-16   Vitis vinifera
emb|CAN63081.1|  hypothetical protein VITISV_016842                   82.0    2e-16   Vitis vinifera
emb|CAN70029.1|  hypothetical protein VITISV_010388                   82.0    2e-16   Vitis vinifera
emb|CAN71185.1|  hypothetical protein VITISV_014270                   81.6    2e-16   Vitis vinifera
emb|CAN65410.1|  hypothetical protein VITISV_040416                   82.0    3e-16   Vitis vinifera
emb|CAN75744.1|  hypothetical protein VITISV_040125                   82.0    3e-16   Vitis vinifera
emb|CAN72018.1|  hypothetical protein VITISV_001841                   81.6    3e-16   Vitis vinifera
emb|CAN63955.1|  hypothetical protein VITISV_034255                   81.6    3e-16   Vitis vinifera
emb|CAN72440.1|  hypothetical protein VITISV_039162                   81.6    3e-16   Vitis vinifera
emb|CAN67119.1|  hypothetical protein VITISV_017483                   82.0    3e-16   Vitis vinifera
emb|CAN75564.1|  hypothetical protein VITISV_032580                   81.6    3e-16   Vitis vinifera
emb|CAN73074.1|  hypothetical protein VITISV_032386                   81.6    3e-16   Vitis vinifera
emb|CAN60149.1|  hypothetical protein VITISV_016363                   81.6    3e-16   Vitis vinifera
emb|CAN70756.1|  hypothetical protein VITISV_014702                   81.6    3e-16   Vitis vinifera
emb|CAN79221.1|  hypothetical protein VITISV_038587                   80.9    4e-16   Vitis vinifera
emb|CAN71931.1|  hypothetical protein VITISV_013418                   80.9    4e-16   Vitis vinifera
emb|CAN68902.1|  hypothetical protein VITISV_031323                   81.3    5e-16   Vitis vinifera
emb|CAN76679.1|  hypothetical protein VITISV_034325                   80.9    5e-16   Vitis vinifera
emb|CAN82359.1|  hypothetical protein VITISV_027367                   80.9    5e-16   Vitis vinifera
emb|CAN60274.1|  hypothetical protein VITISV_024841                   80.9    6e-16   Vitis vinifera
emb|CAN63530.1|  hypothetical protein VITISV_038849                   80.5    7e-16   Vitis vinifera
emb|CAN67317.1|  hypothetical protein VITISV_019719                   80.5    7e-16   Vitis vinifera
emb|CAN62535.1|  hypothetical protein VITISV_041880                   80.5    8e-16   Vitis vinifera
gb|AAO26687.1|AF478374_1  gag-pol polyprotein                         77.0    8e-16   Vitis vinifera
gb|AAO26688.1|AF478375_1  gag-pol polyprotein                         76.6    8e-16   Vitis vinifera
gb|AAO26689.1|AF478376_1  gag-pol polyprotein                         76.6    9e-16   Vitis vinifera
emb|CAN60593.1|  hypothetical protein VITISV_023128                   80.1    9e-16   Vitis vinifera
emb|CAN70260.1|  hypothetical protein VITISV_002223                   79.7    1e-15   Vitis vinifera
emb|CAN67076.1|  hypothetical protein VITISV_042382                   79.7    1e-15   Vitis vinifera
emb|CAN63507.1|  hypothetical protein VITISV_029435                   79.7    2e-15   Vitis vinifera
gb|ABI34342.1|  Polyprotein, putative                                 79.3    2e-15   Solanum demissum
emb|CAN75900.1|  hypothetical protein VITISV_033582                   79.3    2e-15   Vitis vinifera
emb|CAN74241.1|  hypothetical protein VITISV_006638                   79.3    2e-15   Vitis vinifera
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...  79.3    2e-15   
emb|CAN81362.1|  hypothetical protein VITISV_013815                   79.3    2e-15   Vitis vinifera
emb|CAN79281.1|  hypothetical protein VITISV_034553                   79.0    2e-15   Vitis vinifera
emb|CAN65144.1|  hypothetical protein VITISV_026080                   79.3    2e-15   Vitis vinifera
ref|XP_004137882.1|  PREDICTED: ABC transporter C family member 1...  79.3    2e-15   
emb|CAN71748.1|  hypothetical protein VITISV_019194                   79.3    2e-15   Vitis vinifera
emb|CAN74310.1|  hypothetical protein VITISV_037517                   79.3    2e-15   Vitis vinifera
gb|ABY49842.1|  hypothetical protein                                  79.0    2e-15   Vitis hybrid cultivar
emb|CAN69307.1|  hypothetical protein VITISV_001120                   79.0    2e-15   Vitis vinifera
emb|CAN66243.1|  hypothetical protein VITISV_015916                   79.0    3e-15   Vitis vinifera
ref|XP_010646662.1|  PREDICTED: retrovirus-related Pol polyprotei...  76.6    4e-15   
emb|CAN75516.1|  hypothetical protein VITISV_021838                   78.2    4e-15   Vitis vinifera
emb|CAN82064.1|  hypothetical protein VITISV_022772                   78.2    5e-15   Vitis vinifera
ref|XP_009348351.1|  PREDICTED: uncharacterized protein LOC103939989  77.8    6e-15   
emb|CAN66416.1|  hypothetical protein VITISV_044133                   78.2    6e-15   Vitis vinifera
emb|CAN62266.1|  hypothetical protein VITISV_025647                   77.8    6e-15   Vitis vinifera
emb|CAN71163.1|  hypothetical protein VITISV_015706                   77.8    7e-15   Vitis vinifera
emb|CAN70277.1|  hypothetical protein VITISV_022230                   77.4    9e-15   Vitis vinifera
ref|XP_010318106.1|  PREDICTED: uncharacterized protein LOC101244...  76.3    9e-15   
emb|CAN80367.1|  hypothetical protein VITISV_014719                   77.4    1e-14   Vitis vinifera
ref|XP_010318103.1|  PREDICTED: uncharacterized protein LOC101244...  75.9    1e-14   
ref|XP_010318097.1|  PREDICTED: uncharacterized protein LOC101244...  75.9    1e-14   
ref|XP_010318102.1|  PREDICTED: uncharacterized protein LOC101244...  75.9    2e-14   
emb|CAN82711.1|  hypothetical protein VITISV_004468                   76.6    2e-14   Vitis vinifera
ref|XP_003621710.1|  Receptor-like protein kinase                     76.6    2e-14   
ref|XP_009802348.1|  PREDICTED: uncharacterized protein LOC104247899  76.3    2e-14   
ref|XP_010318104.1|  PREDICTED: uncharacterized protein LOC101244...  75.5    2e-14   
emb|CAN72710.1|  hypothetical protein VITISV_018096                   76.3    2e-14   Vitis vinifera
emb|CAN80074.1|  hypothetical protein VITISV_018877                   75.9    3e-14   Vitis vinifera
ref|XP_004499927.1|  PREDICTED: uncharacterized protein LOC101502660  73.9    3e-14   
emb|CAN68348.1|  hypothetical protein VITISV_032025                   75.5    4e-14   Vitis vinifera
emb|CAN76133.1|  hypothetical protein VITISV_036298                   75.1    6e-14   Vitis vinifera
ref|XP_007028466.1|  Uncharacterized protein TCM_024268               74.7    7e-14   
emb|CAN65932.1|  hypothetical protein VITISV_016257                   73.2    1e-13   Vitis vinifera
emb|CAN60317.1|  hypothetical protein VITISV_002851                   73.6    2e-13   Vitis vinifera
emb|CAN71132.1|  hypothetical protein VITISV_007235                   73.6    2e-13   Vitis vinifera
emb|CAN77834.1|  hypothetical protein VITISV_024733                   73.6    2e-13   Vitis vinifera
gb|AAT58770.1|  putative polyprotein                                  70.5    3e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83548.1|  hypothetical protein VITISV_035575                   70.1    3e-12   Vitis vinifera
ref|XP_010275349.1|  PREDICTED: uncharacterized protein LOC104610431  68.9    5e-12   
ref|XP_008450155.1|  PREDICTED: uncharacterized protein LOC103491828  68.6    7e-12   
emb|CAN74064.1|  hypothetical protein VITISV_028146                   68.9    7e-12   Vitis vinifera
emb|CAN75051.1|  hypothetical protein VITISV_020117                   68.9    9e-12   Vitis vinifera
emb|CAN60732.1|  hypothetical protein VITISV_010209                   68.6    1e-11   Vitis vinifera
emb|CAN65966.1|  hypothetical protein VITISV_005935                   68.2    1e-11   Vitis vinifera
emb|CAN77046.1|  hypothetical protein VITISV_035257                   68.2    1e-11   Vitis vinifera
gb|AAC12735.1|  putative retrovirus-related polyprotein               65.5    1e-11   Lithospermum erythrorhizon
ref|XP_004955256.1|  PREDICTED: uncharacterized protein LOC101756543  67.0    1e-11   
emb|CAN74101.1|  hypothetical protein VITISV_039542                   68.2    2e-11   Vitis vinifera
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...  68.2    2e-11   
gb|ABA95797.1|  retrotransposon protein, putative, unclassified       68.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010269632.1|  PREDICTED: uncharacterized protein LOC104606229  67.4    2e-11   
gb|ACS74199.1|  putative gag-pol polyprotein                          67.4    3e-11   Fragaria x ananassa
ref|XP_008674201.1|  PREDICTED: uncharacterized protein LOC100279...  67.4    3e-11   
emb|CAN82960.1|  hypothetical protein VITISV_004472                   66.6    3e-11   Vitis vinifera
emb|CAN71267.1|  hypothetical protein VITISV_017889                   67.4    3e-11   Vitis vinifera
emb|CAN70357.1|  hypothetical protein VITISV_013713                   67.4    3e-11   Vitis vinifera
emb|CAC95126.1|  gag-pol polyprotein                                  67.4    3e-11   Populus deltoides
ref|XP_008372142.1|  PREDICTED: uncharacterized protein LOC103435525  67.0    4e-11   
emb|CAN73765.1|  hypothetical protein VITISV_035279                   67.0    4e-11   Vitis vinifera
ref|XP_003597218.1|  Beta-galactosidase                               67.0    4e-11   
emb|CAN69870.1|  hypothetical protein VITISV_032283                   66.6    4e-11   Vitis vinifera
emb|CAN74794.1|  hypothetical protein VITISV_041689                   66.6    5e-11   Vitis vinifera
gb|AAK51235.1|AF287471_1  polyprotein                                 66.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79175.1|  hypothetical protein VITISV_001884                   66.6    5e-11   Vitis vinifera
emb|CAN63881.1|  hypothetical protein VITISV_039357                   66.6    5e-11   Vitis vinifera
gb|KFY82599.1|  hypothetical protein V500_10440                       66.6    5e-11   
ref|XP_008647645.1|  PREDICTED: uncharacterized protein LOC100502...  66.6    5e-11   
emb|CAN82928.1|  hypothetical protein VITISV_025045                   66.6    6e-11   Vitis vinifera
emb|CAN59964.1|  hypothetical protein VITISV_022757                   66.6    6e-11   Vitis vinifera
emb|CAN71164.1|  hypothetical protein VITISV_031057                   66.6    6e-11   Vitis vinifera
emb|CAN79422.1|  hypothetical protein VITISV_002126                   66.2    6e-11   Vitis vinifera
emb|CAN64765.1|  hypothetical protein VITISV_009574                   66.2    6e-11   Vitis vinifera
emb|CAN62538.1|  hypothetical protein VITISV_031159                   66.2    6e-11   Vitis vinifera
emb|CAN81385.1|  hypothetical protein VITISV_012324                   66.2    7e-11   Vitis vinifera
emb|CAN72886.1|  hypothetical protein VITISV_019713                   66.2    7e-11   Vitis vinifera
emb|CAN76332.1|  hypothetical protein VITISV_006269                   65.9    7e-11   Vitis vinifera
emb|CAN72567.1|  hypothetical protein VITISV_044177                   65.9    7e-11   Vitis vinifera
emb|CAN81715.1|  hypothetical protein VITISV_032902                   65.9    8e-11   Vitis vinifera
emb|CAN67970.1|  hypothetical protein VITISV_025093                   65.9    8e-11   Vitis vinifera
emb|CAN72168.1|  hypothetical protein VITISV_004170                   66.2    8e-11   Vitis vinifera
ref|XP_008387850.1|  PREDICTED: uncharacterized protein LOC103450292  65.9    8e-11   
emb|CAN65222.1|  hypothetical protein VITISV_038665                   65.9    9e-11   Vitis vinifera
emb|CAN78598.1|  hypothetical protein VITISV_001332                   65.9    9e-11   Vitis vinifera
ref|XP_010526678.1|  PREDICTED: retrovirus-related Pol polyprotei...  65.9    9e-11   
emb|CAN83937.1|  hypothetical protein VITISV_042335                   65.5    9e-11   Vitis vinifera
ref|XP_010526682.1|  PREDICTED: retrovirus-related Pol polyprotei...  65.9    9e-11   
ref|XP_008672007.1|  PREDICTED: uncharacterized protein LOC100191...  63.2    1e-10   
ref|XP_010526681.1|  PREDICTED: retrovirus-related Pol polyprotei...  65.9    1e-10   
emb|CAN69597.1|  hypothetical protein VITISV_038518                   65.9    1e-10   Vitis vinifera
emb|CAN68802.1|  hypothetical protein VITISV_008809                   65.9    1e-10   Vitis vinifera
ref|NP_001174869.1|  Os06g0583500                                     62.4    1e-10   
ref|XP_010526680.1|  PREDICTED: retrovirus-related Pol polyprotei...  65.5    1e-10   
ref|XP_010526683.1|  PREDICTED: retrovirus-related Pol polyprotei...  65.5    1e-10   
gb|AGJ83729.1|  gag-pol polyprotein                                   65.1    1e-10   
ref|XP_010051428.1|  PREDICTED: uncharacterized protein LOC104440152  65.1    1e-10   
ref|XP_010526684.1|  PREDICTED: retrovirus-related Pol polyprotei...  65.1    1e-10   
emb|CAN71436.1|  hypothetical protein VITISV_039529                   65.5    1e-10   Vitis vinifera
emb|CAN67449.1|  hypothetical protein VITISV_031400                   65.5    1e-10   Vitis vinifera
ref|XP_008338000.1|  PREDICTED: uncharacterized protein LOC103401070  65.1    1e-10   
ref|XP_008465178.1|  PREDICTED: uncharacterized protein LOC103502842  63.9    2e-10   
gb|AAT47108.1|  putative polyprotein                                  65.1    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDP17738.1|  unnamed protein product                              65.1    2e-10   
emb|CAN81712.1|  hypothetical protein VITISV_038973                   65.1    2e-10   Vitis vinifera
emb|CAN75041.1|  hypothetical protein VITISV_027174                   65.1    2e-10   Vitis vinifera
ref|XP_010263164.1|  PREDICTED: uncharacterized protein LOC104601508  64.3    2e-10   
emb|CAN83177.1|  hypothetical protein VITISV_042114                   65.1    2e-10   Vitis vinifera
emb|CAN83125.1|  hypothetical protein VITISV_015109                   65.1    2e-10   Vitis vinifera
gb|AAF69161.1|AC007915_13  F27F5.19                                   65.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAN69647.1|  hypothetical protein VITISV_022133                   65.1    2e-10   Vitis vinifera
gb|ABO36622.1|  copia LTR rider                                       64.7    2e-10   Solanum lycopersicum
emb|CAN61929.1|  hypothetical protein VITISV_014855                   64.7    2e-10   Vitis vinifera
ref|XP_008347438.1|  PREDICTED: uncharacterized protein LOC103410522  64.3    2e-10   
emb|CAN64452.1|  hypothetical protein VITISV_009528                   64.7    2e-10   Vitis vinifera
emb|CAN73014.1|  hypothetical protein VITISV_007603                   64.7    2e-10   Vitis vinifera
emb|CAN63534.1|  hypothetical protein VITISV_001206                   64.7    3e-10   Vitis vinifera
emb|CAN62394.1|  hypothetical protein VITISV_021305                   64.7    3e-10   Vitis vinifera
emb|CDN96898.1|  putative Ty-1 copia retrotransposon                  64.3    3e-10   
gb|AAC33963.1|  contains similarity to reverse transcriptases (Pf...  64.7    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAN81355.1|  hypothetical protein VITISV_039158                   64.7    3e-10   Vitis vinifera
emb|CAN67992.1|  hypothetical protein VITISV_015686                   64.7    3e-10   Vitis vinifera
emb|CAN66125.1|  hypothetical protein VITISV_044030                   64.3    3e-10   Vitis vinifera
emb|CAN67362.1|  hypothetical protein VITISV_001157                   64.3    3e-10   Vitis vinifera
emb|CAN59952.1|  hypothetical protein VITISV_006720                   64.3    3e-10   Vitis vinifera
emb|CAN79492.1|  hypothetical protein VITISV_033373                   64.3    3e-10   Vitis vinifera
emb|CDP17739.1|  unnamed protein product                              63.5    3e-10   
emb|CAA19696.1|  putative LTR retrotransposon (fragment)              62.4    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAN67240.1|  hypothetical protein VITISV_037460                   64.3    3e-10   Vitis vinifera
emb|CAN70669.1|  hypothetical protein VITISV_037506                   64.3    3e-10   Vitis vinifera
ref|XP_004229082.1|  PREDICTED: uncharacterized protein LOC101247852  63.5    3e-10   
ref|XP_008348795.1|  PREDICTED: uncharacterized protein LOC103411964  63.9    3e-10   
emb|CAN67009.1|  hypothetical protein VITISV_004754                   63.9    4e-10   Vitis vinifera
ref|XP_008372204.1|  PREDICTED: uncharacterized protein LOC103435597  63.9    4e-10   
emb|CDO78107.1|  hypothetical protein BN946_scf184638.g3              63.9    4e-10   
emb|CAN80320.1|  hypothetical protein VITISV_034560                   63.9    4e-10   Vitis vinifera
gb|AAD26943.1|  putative retroelement pol polyprotein                 63.9    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EMT17614.1|  DNA-directed RNA polymerase I subunit RPA2            63.9    5e-10   
ref|XP_008654354.1|  PREDICTED: uncharacterized protein LOC100193...  63.5    5e-10   
emb|CAN76196.1|  hypothetical protein VITISV_041073                   63.9    5e-10   Vitis vinifera
emb|CAN69184.1|  hypothetical protein VITISV_004341                   63.9    5e-10   Vitis vinifera
ref|XP_008654353.1|  PREDICTED: uncharacterized protein LOC100193...  63.5    5e-10   
emb|CAN78022.1|  hypothetical protein VITISV_015518                   63.5    5e-10   Vitis vinifera
ref|XP_008654352.1|  PREDICTED: uncharacterized protein LOC100193...  63.5    5e-10   
emb|CAN79936.1|  hypothetical protein VITISV_033548                   63.5    5e-10   Vitis vinifera
ref|XP_008669041.1|  PREDICTED: uncharacterized protein LOC103646095  63.2    6e-10   
emb|CAN63642.1|  hypothetical protein VITISV_038695                   63.5    6e-10   Vitis vinifera
ref|XP_008674202.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.2    6e-10   
ref|XP_008651726.1|  PREDICTED: hypothetical protein isoform X1       63.2    7e-10   
emb|CAB40035.1|  retrotransposon like protein                         63.5    7e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73071.1|  hypothetical protein VITISV_032383                   63.2    7e-10   Vitis vinifera
ref|XP_010051209.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.5    7e-10   
emb|CAB43904.1|  putative protein                                     63.2    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264759.1|  PREDICTED: uncharacterized protein LOC104602675  62.8    8e-10   
ref|XP_009377992.1|  PREDICTED: uncharacterized protein LOC103966547  62.8    9e-10   
gb|AAD25646.1|  putative retroelement pol polyprotein                 63.2    9e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61630.1|  hypothetical protein VITISV_003191                   63.2    9e-10   Vitis vinifera
emb|CAN62271.1|  hypothetical protein VITISV_010713                   62.8    9e-10   Vitis vinifera
gb|EKV14391.1|  Gag/polymerase/env polyprotein, putative              61.2    9e-10   
ref|XP_008778555.1|  PREDICTED: uncharacterized protein LOC103698337  62.8    1e-09   
emb|CAN80566.1|  hypothetical protein VITISV_029672                   63.2    1e-09   Vitis vinifera
emb|CAN74695.1|  hypothetical protein VITISV_024648                   62.8    1e-09   Vitis vinifera
emb|CAN75466.1|  hypothetical protein VITISV_025054                   62.8    1e-09   Vitis vinifera
emb|CAN72222.1|  hypothetical protein VITISV_028929                   62.4    1e-09   Vitis vinifera
ref|XP_010513552.1|  PREDICTED: uncharacterized protein LOC104789576  62.8    1e-09   
gb|AAF79879.1|AC000348_32  T7N9.5                                     62.8    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377550.1|  PREDICTED: uncharacterized protein LOC103440632  62.4    1e-09   
emb|CAN68148.1|  hypothetical protein VITISV_035665                   62.8    1e-09   Vitis vinifera
emb|CAN70229.1|  hypothetical protein VITISV_024789                   62.8    1e-09   Vitis vinifera
emb|CAN74984.1|  hypothetical protein VITISV_035210                   62.8    1e-09   Vitis vinifera
ref|NP_001172143.1|  Os01g0116166                                     62.4    1e-09   
emb|CAN82851.1|  hypothetical protein VITISV_027998                   62.8    1e-09   Vitis vinifera
dbj|BAB10503.1|  retroelement pol polyprotein-like                    62.8    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAN82483.1|  hypothetical protein VITISV_006799                   62.4    1e-09   Vitis vinifera
emb|CAN63782.1|  hypothetical protein VITISV_010855                   62.0    2e-09   Vitis vinifera
emb|CAN71586.1|  hypothetical protein VITISV_009568                   62.4    2e-09   Vitis vinifera
emb|CAN64963.1|  hypothetical protein VITISV_002891                   62.4    2e-09   Vitis vinifera
ref|NP_001065797.2|  Os11g0157000                                     62.4    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN67587.1|  hypothetical protein VITISV_036279                   62.4    2e-09   Vitis vinifera
ref|XP_009612717.1|  PREDICTED: uncharacterized protein LOC104105976  62.0    2e-09   
emb|CAN72951.1|  hypothetical protein VITISV_020157                   62.0    2e-09   Vitis vinifera
ref|XP_004514853.1|  PREDICTED: uncharacterized protein LOC101509170  62.0    2e-09   
emb|CAN67245.1|  hypothetical protein VITISV_008680                   62.4    2e-09   Vitis vinifera
ref|XP_008344799.1|  PREDICTED: uncharacterized protein LOC103407689  62.0    2e-09   
ref|XP_004149950.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.0    2e-09   
emb|CAN63276.1|  hypothetical protein VITISV_000400                   62.0    2e-09   Vitis vinifera
emb|CAN79930.1|  hypothetical protein VITISV_007488                   62.0    2e-09   Vitis vinifera
emb|CAN71205.1|  hypothetical protein VITISV_025164                   62.0    2e-09   Vitis vinifera
emb|CAN82201.1|  hypothetical protein VITISV_011128                   61.6    2e-09   Vitis vinifera
gb|AGW47867.1|  polyprotein                                           62.0    2e-09   
emb|CAN60930.1|  hypothetical protein VITISV_012765                   62.0    2e-09   Vitis vinifera
emb|CAN72006.1|  hypothetical protein VITISV_010449                   61.6    2e-09   Vitis vinifera
emb|CAN69819.1|  hypothetical protein VITISV_025708                   62.0    2e-09   Vitis vinifera
gb|AAD41979.1|  putative retroelement pol polyprotein                 62.0    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009801985.1|  PREDICTED: uncharacterized protein LOC104247620  61.6    2e-09   
emb|CAE03644.2|  OSJNBa0060N03.9                                      61.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74430.1|  hypothetical protein VITISV_010987                   62.0    2e-09   Vitis vinifera
emb|CAD40363.2|  OSJNBa0093P23.9                                      61.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66022.1|  OSIGBa0105O19.1                                      61.6    2e-09   Oryza sativa [red rice]
gb|AAT85194.1|  putative polyprotein                                  61.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72141.1|  hypothetical protein VITISV_017108                   61.6    2e-09   Vitis vinifera
gb|AAX92941.1|  retrotransposon protein, putative, Ty1-copia sub-...  62.0    3e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83869.1|  hypothetical protein VITISV_037705                   61.6    3e-09   Vitis vinifera
ref|XP_008374284.1|  PREDICTED: uncharacterized protein LOC103437576  61.2    3e-09   
emb|CAN80715.1|  hypothetical protein VITISV_042933                   61.6    3e-09   Vitis vinifera
emb|CAA72989.1|  unnamed protein product                              61.6    3e-09   Brassica oleracea
gb|EKV07696.1|  hypothetical protein PDIG_71260                       61.6    3e-09   
gb|EKV06543.1|  Retrovirus-related Pol polyprotein from transposo...  61.6    3e-09   
dbj|BAB01972.1|  copia-like retrotransposable element                 61.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EKV04353.1|  hypothetical protein PDIG_89880                       61.6    3e-09   
gb|EKV17278.1|  hypothetical protein PDIG_16000                       61.6    3e-09   
gb|EKV13902.1|  hypothetical protein PDIG_35550                       61.6    3e-09   
gb|EKV12256.1|  hypothetical protein PDIG_45810                       61.6    3e-09   
gb|EKV12000.1|  hypothetical protein PDIG_47150                       61.6    3e-09   
gb|EKV08726.1|  hypothetical protein PDIG_65900                       61.6    3e-09   
emb|CAN73941.1|  hypothetical protein VITISV_013119                   60.8    3e-09   
emb|CAN82285.1|  hypothetical protein VITISV_039753                   61.2    3e-09   
emb|CAN71161.1|  hypothetical protein VITISV_009113                   61.2    3e-09   
emb|CAN80247.1|  hypothetical protein VITISV_027801                   61.2    3e-09   
ref|XP_009335215.1|  PREDICTED: uncharacterized protein LOC103927954  61.2    3e-09   
emb|CAN68136.1|  hypothetical protein VITISV_035653                   61.2    4e-09   
emb|CAN62755.1|  hypothetical protein VITISV_008109                   61.2    4e-09   
emb|CAN70298.1|  hypothetical protein VITISV_001396                   61.2    4e-09   
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...  61.2    4e-09   
gb|AAP53216.2|  retrotransposon protein, putative, Ty1-copia subc...  61.2    4e-09   
gb|AAM08562.1|AC092749_15  Putative retroelement                      61.2    4e-09   
emb|CAN70109.1|  hypothetical protein VITISV_001696                   61.2    4e-09   
emb|CAN61272.1|  hypothetical protein VITISV_039063                   61.2    4e-09   
emb|CAN76439.1|  hypothetical protein VITISV_001759                   60.8    4e-09   
emb|CAN77304.1|  hypothetical protein VITISV_008048                   60.5    4e-09   
emb|CAN67506.1|  hypothetical protein VITISV_026948                   61.2    4e-09   
ref|XP_010424680.1|  PREDICTED: uncharacterized protein LOC104709822  61.2    4e-09   
emb|CAN79949.1|  hypothetical protein VITISV_044422                   60.8    4e-09   
emb|CAN63629.1|  hypothetical protein VITISV_018697                   60.8    4e-09   
emb|CAN78464.1|  hypothetical protein VITISV_025101                   60.8    4e-09   
dbj|BAK64102.1|  gag-pol polyprotein                                  60.8    5e-09   
emb|CAA36615.1|  unnamed protein product                              60.5    5e-09   
emb|CAN67418.1|  hypothetical protein VITISV_005919                   60.8    5e-09   
ref|XP_009123006.1|  PREDICTED: uncharacterized protein LOC103847675  60.8    5e-09   
ref|XP_010025850.1|  PREDICTED: uncharacterized protein LOC104416112  60.8    5e-09   
emb|CAN66087.1|  hypothetical protein VITISV_044185                   60.5    5e-09   
emb|CAN69607.1|  hypothetical protein VITISV_009561                   60.8    5e-09   
gb|AAG09097.1|AC009323_8  Putative retroelement polyprotein           60.8    5e-09   
emb|CAN75533.1|  hypothetical protein VITISV_024796                   60.5    6e-09   
ref|XP_010412743.1|  PREDICTED: uncharacterized protein LOC104699096  60.5    6e-09   
gb|ABW74573.1|  putative pol polyprotein                              60.5    6e-09   
emb|CAN67539.1|  hypothetical protein VITISV_021584                   60.8    6e-09   
emb|CAN67912.1|  hypothetical protein VITISV_004101                   60.5    6e-09   
gb|KGO39027.1|  Integrase, catalytic core                             60.5    6e-09   
ref|XP_010273338.1|  PREDICTED: uncharacterized protein LOC104608907  60.5    6e-09   
emb|CAN82041.1|  hypothetical protein VITISV_033522                   60.5    6e-09   
emb|CAA19715.1|  putative protein                                     60.5    6e-09   
ref|XP_009774503.1|  PREDICTED: uncharacterized protein LOC104224521  60.1    6e-09   
emb|CAN77807.1|  hypothetical protein VITISV_036095                   60.5    7e-09   
emb|CAN83290.1|  hypothetical protein VITISV_018945                   60.1    7e-09   
emb|CAN73395.1|  hypothetical protein VITISV_003815                   60.5    7e-09   
ref|XP_009596230.1|  PREDICTED: uncharacterized protein LOC104092345  58.5    7e-09   
emb|CAN77868.1|  hypothetical protein VITISV_001383                   60.1    7e-09   
ref|XP_010542220.1|  PREDICTED: uncharacterized protein LOC104815...  60.1    7e-09   
gb|AAR06328.1|  putative polyprotein                                  60.5    7e-09   
gb|ABF97393.1|  retrotransposon protein, putative, Ty1-copia subc...  60.5    7e-09   
emb|CAB10225.1|  retrovirus-related like polyprotein                  60.5    7e-09   
emb|CAN61435.1|  hypothetical protein VITISV_033767                   60.5    7e-09   
emb|CAN70361.1|  hypothetical protein VITISV_033646                   60.1    8e-09   
emb|CAN80507.1|  hypothetical protein VITISV_025269                   60.1    8e-09   
gb|ABA27053.1|  TO88-23                                               56.2    8e-09   
ref|XP_010317322.1|  PREDICTED: uncharacterized protein LOC104646029  60.1    8e-09   
gb|AAC67200.1|  putative retroelement pol polyprotein                 60.1    9e-09   
ref|XP_010675539.1|  PREDICTED: uncharacterized protein LOC104891530  60.1    1e-08   
ref|XP_010675988.1|  PREDICTED: uncharacterized protein LOC104891900  59.7    1e-08   
emb|CAD41912.2|  OSJNBa0033G05.13                                     60.1    1e-08   
gb|ACZ04926.1|  polyprotein                                           60.1    1e-08   
emb|CAN81130.1|  hypothetical protein VITISV_003944                   59.7    1e-08   
emb|CAN72429.1|  hypothetical protein VITISV_006530                   58.9    1e-08   
ref|WP_039533890.1|  hypothetical protein                             56.6    1e-08   
gb|EKV07191.1|  hypothetical protein PDIG_74650                       59.7    1e-08   
emb|CAN63563.1|  hypothetical protein VITISV_003097                   59.7    1e-08   
emb|CAN60796.1|  hypothetical protein VITISV_015834                   59.7    1e-08   
gb|ABD32334.2|  Polynucleotidyl transferase, Ribonuclease H fold      59.3    1e-08   
gb|AFP55546.1|  gag-pol polyprotein                                   59.7    1e-08   
ref|XP_009377534.1|  PREDICTED: uncharacterized protein LOC103966118  59.7    1e-08   
gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...  59.7    1e-08   
gb|AAB61111.1|  Strong similarity to Zea mays retrotransposon Hop...  59.7    1e-08   
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins         59.7    1e-08   
emb|CAN65867.1|  hypothetical protein VITISV_034935                   59.7    1e-08   
emb|CAN76896.1|  hypothetical protein VITISV_010605                   59.7    1e-08   
emb|CAN66375.1|  hypothetical protein VITISV_037549                   59.7    1e-08   
emb|CAN66898.1|  hypothetical protein VITISV_037436                   59.7    1e-08   
emb|CAN69998.1|  hypothetical protein VITISV_006839                   59.7    1e-08   
gb|ACI62137.1|  polyprotein                                           59.7    1e-08   
emb|CAN71109.1|  hypothetical protein VITISV_001479                   59.7    1e-08   
emb|CAN74624.1|  hypothetical protein VITISV_024822                   59.7    1e-08   
emb|CAN62181.1|  hypothetical protein VITISV_044399                   59.7    1e-08   
ref|WP_036673399.1|  hypothetical protein                             58.2    1e-08   
emb|CAN69340.1|  hypothetical protein VITISV_032634                   59.7    1e-08   
emb|CAN67882.1|  hypothetical protein VITISV_022356                   59.7    1e-08   
emb|CAN65504.1|  hypothetical protein VITISV_028342                   59.3    1e-08   
emb|CCA23551.1|  putative polyprotein                                 58.2    2e-08   
emb|CDP21887.1|  unnamed protein product                              58.9    2e-08   
emb|CAC37623.1|  copia-like polyprotein                               59.3    2e-08   
emb|CAN62623.1|  hypothetical protein VITISV_001656                   59.3    2e-08   
emb|CAE04999.2|  OSJNBb0093G06.7                                      58.9    2e-08   
gb|AAC35532.1|  contains similarity to proteases                      59.3    2e-08   
emb|CAD39797.2|  OSJNBa0071G03.10                                     58.9    2e-08   
ref|XP_008384570.1|  PREDICTED: uncharacterized protein LOC103447138  58.9    2e-08   
emb|CBL94154.1|  putative polyprotein (retrotrasposon protein)        59.3    2e-08   
emb|CAN60188.1|  hypothetical protein VITISV_002117                   58.9    2e-08   
gb|AAX96781.1|  retrotransposon protein, putative, Ty1-copia sub-...  59.3    2e-08   
ref|XP_010495376.1|  PREDICTED: uncharacterized protein LOC104772464  58.9    2e-08   
emb|CAN66871.1|  hypothetical protein VITISV_021425                   58.2    2e-08   
ref|XP_008367623.1|  PREDICTED: uncharacterized protein LOC103431265  58.9    2e-08   
gb|EMT07582.1|  Wall-associated receptor kinase 5                     58.9    2e-08   
gb|ADB85429.1|  putative retrotransposon protein                      58.9    2e-08   
emb|CAN61548.1|  hypothetical protein VITISV_043524                   59.3    2e-08   
emb|CAN71029.1|  hypothetical protein VITISV_001707                   58.9    2e-08   
ref|XP_010684008.1|  PREDICTED: uncharacterized protein LOC104898610  58.9    2e-08   
dbj|BAA22288.1|  polyprotein                                          58.9    2e-08   
emb|CAN68489.1|  hypothetical protein VITISV_037543                   58.9    2e-08   
ref|XP_004499523.1|  PREDICTED: uncharacterized protein LOC101509950  57.8    2e-08   
emb|CAN66607.1|  hypothetical protein VITISV_017554                   58.9    2e-08   
ref|XP_007009039.1|  Copia-like retrotransposable element, putative   58.5    3e-08   
gb|ABA99022.2|  retrotransposon protein, putative, Ty1-copia subc...  58.5    3e-08   
emb|CAN62328.1|  hypothetical protein VITISV_029806                   58.5    3e-08   
emb|CAN63660.1|  hypothetical protein VITISV_008416                   58.5    3e-08   
emb|CAN83721.1|  hypothetical protein VITISV_003961                   58.5    3e-08   
emb|CAN80881.1|  hypothetical protein VITISV_018650                   58.5    3e-08   
ref|XP_010430968.1|  PREDICTED: uncharacterized protein LOC104715244  58.2    3e-08   
gb|ABA94321.1|  retrotransposon protein, putative, unclassified       58.5    3e-08   
emb|CAN79142.1|  hypothetical protein VITISV_040460                   58.5    3e-08   
emb|CAN73451.1|  hypothetical protein VITISV_028991                   58.2    3e-08   
gb|KFY68619.1|  hypothetical protein V498_10589                       58.5    3e-08   
ref|XP_010674610.1|  PREDICTED: uncharacterized protein LOC104890733  58.2    3e-08   
emb|CAE03687.2|  OSJNBb0026E15.5                                      57.8    3e-08   
gb|ABW74566.1|  integrase                                             58.5    3e-08   
ref|XP_010671949.1|  PREDICTED: uncharacterized protein LOC104888623  58.2    3e-08   
emb|CAN65235.1|  hypothetical protein VITISV_040876                   58.5    3e-08   
ref|XP_009128559.1|  PREDICTED: uncharacterized protein LOC103853393  58.2    3e-08   
ref|XP_008350396.1|  PREDICTED: uncharacterized protein LOC103413729  58.2    4e-08   
gb|AAM91886.1|  putative polyprotein                                  58.2    4e-08   
emb|CAN60263.1|  hypothetical protein VITISV_026496                   58.5    4e-08   
ref|XP_006605109.1|  PREDICTED: uncharacterized protein LOC102665838  57.0    4e-08   
emb|CAB10380.1|  reverse transcriptase like protein                   58.2    4e-08   
gb|AAG10817.1|AC011808_5  Putative retroelement polyprotein           58.2    4e-08   
gb|AAP54315.2|  retrotransposon protein, putative, Ty1-copia subc...  58.2    4e-08   
ref|XP_003605102.1|  Peptide transporter PTR2                         58.2    4e-08   
ref|XP_008363328.1|  PREDICTED: uncharacterized protein LOC103427031  58.2    4e-08   
emb|CAN79977.1|  hypothetical protein VITISV_029183                   58.2    4e-08   
ref|XP_008360633.1|  PREDICTED: uncharacterized protein LOC103424318  57.8    4e-08   
emb|CAN79134.1|  hypothetical protein VITISV_000843                   58.2    4e-08   
emb|CAN61322.1|  hypothetical protein VITISV_012106                   58.2    5e-08   
emb|CAN69851.1|  hypothetical protein VITISV_009554                   58.2    5e-08   
emb|CAN60972.1|  hypothetical protein VITISV_032051                   58.2    5e-08   
gb|ABA98367.2|  retrotransposon protein, putative, Ty1-copia subc...  58.2    5e-08   
gb|AAD21687.1|  Strong similarity to gi|3600044 T12H20.12 proteas...  58.2    5e-08   
emb|CAN62921.1|  hypothetical protein VITISV_032126                   57.8    5e-08   
gb|ABA91380.1|  retrotransposon protein, putative, Ty1-copia subc...  57.8    5e-08   
ref|XP_010677705.1|  PREDICTED: uncharacterized protein LOC104893304  57.8    5e-08   
emb|CAJ86192.1|  H0306F03.15                                          57.8    5e-08   
emb|CAN69102.1|  hypothetical protein VITISV_042048                   57.8    5e-08   
emb|CAJ86151.1|  H0413E07.4                                           57.8    5e-08   
emb|CAN62498.1|  hypothetical protein VITISV_000081                   57.8    5e-08   
ref|XP_009631565.1|  PREDICTED: uncharacterized protein LOC104121310  57.4    5e-08   
emb|CBI36090.3|  unnamed protein product                              57.8    5e-08   
ref|XP_010317833.1|  PREDICTED: uncharacterized protein LOC104646241  57.8    5e-08   
emb|CAN69367.1|  hypothetical protein VITISV_035520                   57.8    5e-08   
ref|XP_010675125.1|  PREDICTED: uncharacterized protein LOC104891164  57.8    6e-08   
emb|CAN76546.1|  hypothetical protein VITISV_010420                   57.8    6e-08   
gb|ABB47665.1|  retrotransposon protein, putative, unclassified, ...  57.8    6e-08   
ref|XP_003599760.1|  Peptide transporter PTR2                         57.8    6e-08   
emb|CAN67762.1|  hypothetical protein VITISV_040650                   57.8    6e-08   
emb|CAN62509.1|  hypothetical protein VITISV_039839                   57.8    6e-08   
emb|CAN77295.1|  hypothetical protein VITISV_005638                   57.8    6e-08   
emb|CAN83990.1|  hypothetical protein VITISV_018454                   57.8    6e-08   
emb|CAN60445.1|  hypothetical protein VITISV_032468                   57.8    6e-08   
gb|ABR67407.1|  integrase                                             57.8    6e-08   
emb|CAN73532.1|  hypothetical protein VITISV_012827                   57.8    6e-08   
ref|XP_010034499.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.8    6e-08   
emb|CAN74198.1|  hypothetical protein VITISV_005765                   57.8    7e-08   
ref|XP_009784856.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.8    7e-08   
ref|XP_008337064.1|  PREDICTED: uncharacterized protein LOC103400173  57.0    7e-08   
emb|CAN64225.1|  hypothetical protein VITISV_016222                   57.4    7e-08   
ref|XP_003599761.1|  Peptide transporter PTR2                         57.4    7e-08   
emb|CAN76321.1|  hypothetical protein VITISV_044445                   57.4    7e-08   
ref|XP_010650252.1|  PREDICTED: uncharacterized protein LOC104879339  57.0    7e-08   
emb|CAN69688.1|  hypothetical protein VITISV_026774                   57.4    7e-08   
emb|CAN71214.1|  hypothetical protein VITISV_039504                   57.4    7e-08   
ref|XP_009613779.1|  PREDICTED: uncharacterized protein LOC104106841  57.4    8e-08   
emb|CAN67123.1|  hypothetical protein VITISV_040164                   57.4    8e-08   
ref|XP_006651032.1|  PREDICTED: uncharacterized protein LOC102707106  57.4    8e-08   
gb|AAB87099.1|  putative retroelement pol polyprotein                 57.4    8e-08   
ref|XP_008352155.1|  PREDICTED: beta-adaptin-like protein A           57.0    8e-08   
emb|CAN81099.1|  hypothetical protein VITISV_017741                   57.4    9e-08   
sp|P10978.1|POLX_TOBAC  RecName: Full=Retrovirus-related Pol poly...  57.4    9e-08   
ref|XP_009348182.1|  PREDICTED: uncharacterized protein LOC103939788  57.0    9e-08   
emb|CAN79884.1|  hypothetical protein VITISV_002539                   57.4    9e-08   
emb|CAH65740.1|  OSIGBa0127D24.3                                      57.0    9e-08   
dbj|BAA11674.1|  unnamed protein product                              57.0    9e-08   
ref|XP_010030630.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.0    1e-07   
gb|ADK92880.1|  retrotransposon 4 protein                             57.0    1e-07   
gb|ABF97213.1|  retrotransposon protein, putative, Ty1-copia subc...  57.0    1e-07   
emb|CAN82207.1|  hypothetical protein VITISV_000177                   56.6    1e-07   
emb|CAN79061.1|  hypothetical protein VITISV_024577                   57.0    1e-07   
emb|CAN72268.1|  hypothetical protein VITISV_017854                   57.0    1e-07   
emb|CAN65095.1|  hypothetical protein VITISV_011639                   57.0    1e-07   
ref|XP_010542100.1|  PREDICTED: uncharacterized protein LOC104815417  56.6    1e-07   
emb|CAN59979.1|  hypothetical protein VITISV_015228                   57.0    1e-07   
ref|XP_004509781.1|  PREDICTED: uncharacterized protein LOC101498326  56.6    1e-07   
gb|AAS01945.1|  putative polyprotein                                  57.0    1e-07   
emb|CAN66596.1|  hypothetical protein VITISV_019893                   57.0    1e-07   
emb|CAN65502.1|  hypothetical protein VITISV_014793                   56.6    1e-07   
emb|CAN65540.1|  hypothetical protein VITISV_029946                   57.0    1e-07   
emb|CDO74401.1|  hypothetical protein BN946_scf185023.g1              57.0    1e-07   
emb|CAN62633.1|  hypothetical protein VITISV_031441                   57.0    1e-07   
gb|ABF97047.1|  retrotransposon protein, putative, Ty1-copia subc...  56.6    1e-07   
gb|AAP44605.1|  putative polyprotein                                  56.6    1e-07   
ref|XP_010668141.1|  PREDICTED: uncharacterized protein LOC104885134  56.6    1e-07   
ref|XP_004240625.1|  PREDICTED: uncharacterized protein LOC101261123  56.6    1e-07   
ref|XP_004513130.1|  PREDICTED: uncharacterized protein LOC101488260  56.6    1e-07   
emb|CAN76550.1|  hypothetical protein VITISV_031906                   56.6    1e-07   
dbj|BAG98101.1|  unnamed protein product                              56.2    1e-07   
gb|AAV85747.1|  Integrase core domain, putative                       56.6    1e-07   
emb|CAN76645.1|  hypothetical protein VITISV_004685                   56.6    1e-07   
gb|EEE57553.1|  hypothetical protein OsJ_07890                        56.2    1e-07   
emb|CAN74229.1|  hypothetical protein VITISV_000584                   56.6    1e-07   
gb|AAT44282.1|  putative polyprotein                                  56.6    1e-07   
gb|ABA95799.2|  retrotransposon protein, putative, unclassified, ...  56.6    1e-07   
emb|CAN83808.1|  hypothetical protein VITISV_026963                   56.6    2e-07   
emb|CAN82574.1|  hypothetical protein VITISV_034720                   56.6    2e-07   
ref|XP_008385533.1|  PREDICTED: uncharacterized protein LOC103448069  56.2    2e-07   
gb|ABA98728.2|  retrotransposon protein, putative, Ty1-copia subc...  56.6    2e-07   
gb|AAD32906.1|  putative retroelement pol polyprotein                 56.2    2e-07   



>emb|CAN82075.1| hypothetical protein VITISV_016661 [Vitis vinifera]
Length=960

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR TS  GF+YFVTF++D+SRCTWL+LMK+R ELF +F
Sbjct  544  VHTDVWGPCRTTSTLGFQYFVTFINDYSRCTWLFLMKNRAELFSIF  589



>emb|CAN60609.1| hypothetical protein VITISV_036599 [Vitis vinifera]
Length=1455

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  640  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  685



>emb|CAN71773.1| hypothetical protein VITISV_002508 [Vitis vinifera]
Length=680

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  522  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  567



>ref|XP_009778353.1| PREDICTED: uncharacterized protein LOC104227744 [Nicotiana sylvestris]
Length=1133

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP RV+S  GFRYFV+F+DD+SRCTWL+LMK R ELF +F
Sbjct  689  VHSDIWGPSRVSSTLGFRYFVSFIDDYSRCTWLFLMKDRSELFSIF  734



>emb|CAN80469.1| hypothetical protein VITISV_008623 [Vitis vinifera]
Length=1041

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  368  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  413



>emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera]
Length=1403

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  613  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  658



>emb|CAN65421.1| hypothetical protein VITISV_001858 [Vitis vinifera]
Length=729

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  524  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFXIF  569



>emb|CAN75922.1| hypothetical protein VITISV_030752 [Vitis vinifera]
Length=1214

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  479  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  524



>emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera]
Length=1304

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  484  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  529



>emb|CAN62317.1| hypothetical protein VITISV_026526 [Vitis vinifera]
Length=768

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPC+ TS  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  453  VHTDVWGPCQTTSTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  498



>emb|CAN74286.1| hypothetical protein VITISV_036410 [Vitis vinifera]
Length=1262

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  495  VHXDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  540



>emb|CAN80771.1| hypothetical protein VITISV_027574 [Vitis vinifera]
Length=1193

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  418  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  463



>emb|CAN74104.1| hypothetical protein VITISV_008952 [Vitis vinifera]
Length=1211

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+D+WGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  489  VHTDIWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  534



>emb|CAN62074.1| hypothetical protein VITISV_001619 [Vitis vinifera]
Length=1237

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  446  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  491



>emb|CAN80088.1| hypothetical protein VITISV_021656 [Vitis vinifera]
Length=1099

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPCR+ S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  418  VHIDVWGPCRIASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  463



>emb|CAN78715.1| hypothetical protein VITISV_030863 [Vitis vinifera]
Length=1228

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R +LF +F
Sbjct  407  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAKLFSIF  452



>emb|CAN77210.1| hypothetical protein VITISV_000141 [Vitis vinifera]
Length=1236

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  427  VHIDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  472



>emb|CAN73250.1| hypothetical protein VITISV_027047 [Vitis vinifera]
Length=940

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR+ S  GF+YFVTF+DD+ RCTWL+LMK+R +LF +F
Sbjct  371  VHTDVWGPCRIASTLGFQYFVTFIDDYPRCTWLFLMKNRAKLFSIF  416



>gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum]
Length=1775

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP RV+S  GFRYFV+F+DD+S+CTW++LMK R ELF +F
Sbjct  543  VHSDIWGPSRVSSTLGFRYFVSFIDDYSKCTWVFLMKDRSELFSIF  588



>emb|CAN67925.1| hypothetical protein VITISV_021168 [Vitis vinifera]
Length=1354

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+L K+R ELF +F
Sbjct  483  VHTDVWGPCRTXSTLGFQYFVTFIDDYSRCTWLFLXKNRAELFSIF  528



>emb|CAN67447.1| hypothetical protein VITISV_031398 [Vitis vinifera]
Length=795

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTW +LMK+R ELF +F
Sbjct  467  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWFFLMKNRAELFSIF  512



>emb|CAN60498.1| hypothetical protein VITISV_027869 [Vitis vinifera]
Length=2077

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR+ S  GF+YFVT +DD+SRCTWL+LMK++ ELF +F
Sbjct  697  VHTDVWGPCRIASTLGFQYFVTLIDDYSRCTWLFLMKNQNELFSIF  742



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP R+ S  GF+YFVTF+DD+SRCTW++LMK+R ELF +F
Sbjct  538  VHSDIWGPSRIKSNLGFQYFVTFIDDYSRCTWVFLMKNRSELFSIF  583



>emb|CAN74964.1| hypothetical protein VITISV_006810 [Vitis vinifera]
Length=1248

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPC +TSK GFRYFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  474  VHFDVWGPCPITSKTGFRYFVTFVDDFSRMTWIYFMKNRSEVFSHF  519



>emb|CAN80763.1| hypothetical protein VITISV_017069 [Vitis vinifera]
Length=1127

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC VTSK GFRYFVTFVDDFS+ TW+Y MK+R E+F  F
Sbjct  445  VHSDVWGPCPVTSKTGFRYFVTFVDDFSQTTWIYFMKNRFEVFSHF  490



>emb|CAN73234.1| hypothetical protein VITISV_033857 [Vitis vinifera]
Length=1402

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            V +DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  598  VXTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  643



>gb|AAT38747.2| Polyprotein, putative [Solanum demissum]
Length=1402

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC V SK GFRYFVTF+DDFSR TW+Y MK+R E+F  F
Sbjct  549  VHSDVWGPCPVVSKVGFRYFVTFMDDFSRMTWIYFMKNRSEVFSHF  594



>gb|AEJ72555.1| putative retroelement polyprotein [Malus domestica]
Length=1249

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP  + S  GFRYFVTFVDDFSRCTWLYL+KS+ E+ +VF
Sbjct  497  VHSDVWGPAPLVSFDGFRYFVTFVDDFSRCTWLYLLKSKDEVINVF  542



>emb|CAN76965.1| hypothetical protein VITISV_043961 [Vitis vinifera]
Length=1136

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  417  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  462



>emb|CAN61011.1| hypothetical protein VITISV_038445 [Vitis vinifera]
Length=1038

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  421  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  466



>ref|XP_007033295.1| Uncharacterized protein TCM_019488 [Theobroma cacao]
 gb|EOY04221.1| Uncharacterized protein TCM_019488 [Theobroma cacao]
Length=1008

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPC VTSK  F+YFVT VDDFSR TWLYLMKSR +LF +F
Sbjct  482  VHFDVWGPCPVTSKTNFKYFVTLVDDFSRSTWLYLMKSRSKLFSIF  527



>emb|CAN68461.1| hypothetical protein VITISV_037728 [Vitis vinifera]
Length=472

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H+DVWGPC+  S  GF+YFVTF+DD+SR TWL+LMK+R ELF +F
Sbjct  427  IHTDVWGPCQTASTLGFQYFVTFIDDYSRYTWLFLMKNRAELFSIF  472



>emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera]
Length=1181

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  355  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  400



>emb|CAN72663.1| hypothetical protein VITISV_031849 [Vitis vinifera]
Length=912

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  185  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  230



>emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera]
Length=1323

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  472  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  517



>emb|CAN63730.1| hypothetical protein VITISV_030286 [Vitis vinifera]
Length=1205

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  479  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  524



>emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera]
Length=1237

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  495  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  540



>emb|CAN76032.1| hypothetical protein VITISV_040150 [Vitis vinifera]
Length=1152

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  471  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  516



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  427  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  472



>emb|CAN70029.1| hypothetical protein VITISV_010388 [Vitis vinifera]
Length=1222

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  439  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  484



>emb|CAN71185.1| hypothetical protein VITISV_014270 [Vitis vinifera]
Length=1024

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  231  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  276



>emb|CAN65410.1| hypothetical protein VITISV_040416 [Vitis vinifera]
Length=2253

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  1060  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  1105



>emb|CAN75744.1| hypothetical protein VITISV_040125 [Vitis vinifera]
Length=1257

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  495  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  540



>emb|CAN72018.1| hypothetical protein VITISV_001841 [Vitis vinifera]
Length=1225

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  476  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  521



>emb|CAN63955.1| hypothetical protein VITISV_034255 [Vitis vinifera]
Length=1117

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  460  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  505



>emb|CAN72440.1| hypothetical protein VITISV_039162 [Vitis vinifera]
Length=1253

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  479  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  524



>emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera]
Length=1970

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  477  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  522



>emb|CAN75564.1| hypothetical protein VITISV_032580 [Vitis vinifera]
Length=1191

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  1137  VHTDVWGPCRTASXLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  1182



>emb|CAN73074.1| hypothetical protein VITISV_032386 [Vitis vinifera]
Length=1195

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  457  VHTDVWGPCRXASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  502



>emb|CAN60149.1| hypothetical protein VITISV_016363 [Vitis vinifera]
Length=1092

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGP R  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  455  VHTDVWGPYRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFFIF  500



>emb|CAN70756.1| hypothetical protein VITISV_014702 [Vitis vinifera]
Length=1212

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DV GPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  432  VHTDVXGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  477



>emb|CAN79221.1| hypothetical protein VITISV_038587 [Vitis vinifera]
Length=620

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF++D+ RCTWL+LMK+R ELF +F
Sbjct  457  VHTDVWGPCRTASTLGFQYFVTFINDYFRCTWLFLMKNRAELFSIF  502



>emb|CAN71931.1| hypothetical protein VITISV_013418 [Vitis vinifera]
Length=670

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+S+CTWL+LMK+R ELF +F
Sbjct  421  VHTDVWGPCRTASTLGFQYFVTFIDDYSQCTWLFLMKNRAELFSIF  466



>emb|CAN68902.1| hypothetical protein VITISV_031323 [Vitis vinifera]
Length=1206

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  1107  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  1152



>emb|CAN76679.1| hypothetical protein VITISV_034325 [Vitis vinifera]
Length=1117

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R EL+ +F
Sbjct  350  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELYSIF  395



>emb|CAN82359.1| hypothetical protein VITISV_027367 [Vitis vinifera]
Length=984

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H+DVWG CR  S  GF+YFVTF+DD+SRCTWL+LMK+R +LF +F
Sbjct  321  IHTDVWGLCRXASTLGFQYFVTFIDDYSRCTWLFLMKNRAKLFSIF  366



>emb|CAN60274.1| hypothetical protein VITISV_024841 [Vitis vinifera]
Length=1573

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK++ ELF +F
Sbjct  326  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNQAELFSIF  371



>emb|CAN63530.1| hypothetical protein VITISV_038849 [Vitis vinifera]
Length=938

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H++VWGP R  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  384  IHTNVWGPSRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  429



>emb|CAN67317.1| hypothetical protein VITISV_019719 [Vitis vinifera]
Length=1240

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  510  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKTRVELFSIF  555



>emb|CAN62535.1| hypothetical protein VITISV_041880 [Vitis vinifera]
Length=1314

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK++ ELF +F
Sbjct  495  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNQAELFSIF  540



>gb|AAO26687.1|AF478374_1 gag-pol polyprotein [Vitis vinifera]
Length=197

 Score = 77.0 bits (188),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  HSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            HSDVWGPC VTS+ GFRYFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  1    HSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIYFMKNRSEVFSHF  45



>gb|AAO26688.1|AF478375_1 gag-pol polyprotein [Vitis vinifera]
Length=197

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  HSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            HSDVWGPC VTS+ GFRYFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  1    HSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIYFMKNRSEVFSHF  45



>gb|AAO26689.1|AF478376_1 gag-pol polyprotein [Vitis vinifera]
Length=197

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  136  HSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            HSDVWGPC VTS+ GFRYFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  1    HSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIYFMKNRSEVFSHF  45



>emb|CAN60593.1| hypothetical protein VITISV_023128 [Vitis vinifera]
Length=1285

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  359  VHIDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  404



>emb|CAN70260.1| hypothetical protein VITISV_002223 [Vitis vinifera]
Length=956

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCT L+LMK+  ELF +F
Sbjct  518  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTXLFLMKNXAELFSIF  563



>emb|CAN67076.1| hypothetical protein VITISV_042382 [Vitis vinifera]
Length=1236

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+S+CTWL+LMK+R ELF +F
Sbjct  420  VHTDVWGPCRTASILGFQYFVTFIDDYSQCTWLFLMKNRAELFSIF  465



>emb|CAN63507.1| hypothetical protein VITISV_029435 [Vitis vinifera]
Length=1211

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            V++DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  491  VNTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  536



>gb|ABI34342.1| Polyprotein, putative [Solanum demissum]
Length=1054

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP RV+S  GFRYFV+F+DD+SRCTW++LMK R ELF +F
Sbjct  304  VHSDIWGPSRVSSTLGFRYFVSFIDDYSRCTWVFLMKDRSELFSIF  349



>emb|CAN75900.1| hypothetical protein VITISV_033582 [Vitis vinifera]
Length=1041

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            V++DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  227  VYTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  272



>emb|CAN74241.1| hypothetical protein VITISV_006638 [Vitis vinifera]
Length=1280

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC VTS+ GFRYFVTFVDDFSR T +Y MK+R E+F  F
Sbjct  480  VHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTXIYFMKNRSEVFSHF  525



>gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1353

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP RV+S  GFRYFVTF+D+FSRCTW+YLMK R EL  +F
Sbjct  486  IHSDIWGPSRVSS-FGFRYFVTFIDEFSRCTWVYLMKDRSELLPIF  530



>emb|CAN81362.1| hypothetical protein VITISV_013815 [Vitis vinifera]
Length=1535

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VH+DVWGPC      GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  957   VHTDVWGPCWTAFTLGFQYFVTFIDDYSRCTWLFLMKNRAELFYIF  1002



>emb|CAN79281.1| hypothetical protein VITISV_034553 [Vitis vinifera]
Length=713

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRC+WL+LMK+R ELF +F
Sbjct  41   VHTDVWGPCRTASTFGFQYFVTFIDDYSRCSWLFLMKNRVELFSIF  86



>emb|CAN65144.1| hypothetical protein VITISV_026080 [Vitis vinifera]
Length=1220

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC VTS+ GFRYFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  476  VHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIYFMKNRSEVFSHF  521



>ref|XP_004137882.1| PREDICTED: ABC transporter C family member 13-like [Cucumis sativus]
Length=2377

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VHSD+WGPC V S+ GFRYFVTFVDD SR TWLYLMK+R EL   F
Sbjct  1071  VHSDIWGPCPVVSQTGFRYFVTFVDDHSRLTWLYLMKNRSELLSHF  1116



>emb|CAN71748.1| hypothetical protein VITISV_019194 [Vitis vinifera]
Length=1306

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC VTS+ GFRYFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  515  VHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIYFMKNRSEVFSHF  560



>emb|CAN74310.1| hypothetical protein VITISV_037517 [Vitis vinifera]
Length=1266

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+ D+SRCTWL+LMK+R ELF +F
Sbjct  492  VHTDVWGPCRTASTLGFQYFVTFIXDYSRCTWLFLMKNRAELFSIF  537



>gb|ABY49842.1| hypothetical protein [Vitis hybrid cultivar]
Length=1382

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC VTS+ GFRYFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  515  VHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIYFMKNRSEVFSHF  560



>emb|CAN69307.1| hypothetical protein VITISV_001120 [Vitis vinifera]
Length=1215

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVW PCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  443  VHTDVWDPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  488



>emb|CAN66243.1| hypothetical protein VITISV_015916 [Vitis vinifera]
Length=1258

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+L K+R ELF +F
Sbjct  470  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLTKNRTELFSIF  515



>ref|XP_010646662.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Vitis vinifera]
Length=378

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC VTSK GFRYFVTF+DDFSR TW+Y MK+R ++F  F
Sbjct  92   VHSDVWGPCPVTSKTGFRYFVTFMDDFSRMTWIYFMKNRSKVFSHF  137



>emb|CAN75516.1| hypothetical protein VITISV_021838 [Vitis vinifera]
Length=996

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWG C+ TS  GF+YFVTF+DD+SRCTWL+LMK+R EL  +F
Sbjct  487  VHTDVWGLCQTTSTLGFQYFVTFIDDYSRCTWLFLMKNRAELLSIF  532



>emb|CAN82064.1| hypothetical protein VITISV_022772 [Vitis vinifera]
Length=1224

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVW PCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  498  VHXDVWXPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  543



>ref|XP_009348351.1| PREDICTED: uncharacterized protein LOC103939989 [Pyrus x bretschneideri]
Length=911

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP RV S  G++YFVTF+DD+SR TWLYL+KS+ E F  F
Sbjct  550  VHSDIWGPSRVESFDGYKYFVTFIDDYSRVTWLYLLKSKSEFFTAF  595



>emb|CAN66416.1| hypothetical protein VITISV_044133 [Vitis vinifera]
Length=1549

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWG CR  S  GF+YFVTF++D+SRCTWL+LMK++ ELF +F
Sbjct  932  VHIDVWGLCRTASILGFQYFVTFINDYSRCTWLFLMKNQAELFSIF  977



>emb|CAN62266.1| hypothetical protein VITISV_025647 [Vitis vinifera]
Length=1254

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPC   S  GF+YFVTF+DD+SRCTWL+LMK++ ELF +F
Sbjct  476  VHTDVWGPCXTASTLGFQYFVTFIDDYSRCTWLFLMKNQAELFSIF  521



>emb|CAN71163.1| hypothetical protein VITISV_015706 [Vitis vinifera]
Length=1127

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWG CR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  424  VHTDVWGXCRTVSTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  469



>emb|CAN70277.1| hypothetical protein VITISV_022230 [Vitis vinifera]
Length=1166

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR TS   F+YFVTF+D++SRCTWL+LMK+R +LF +F
Sbjct  502  VHTDVWGPCRTTSTLRFQYFVTFIDNYSRCTWLFLMKNRAKLFSIF  547



>ref|XP_010318106.1| PREDICTED: uncharacterized protein LOC101244063 isoform X6 [Solanum 
lycopersicum]
 ref|XP_010318107.1| PREDICTED: uncharacterized protein LOC101244063 isoform X6 [Solanum 
lycopersicum]
 ref|XP_010318108.1| PREDICTED: uncharacterized protein LOC101244063 isoform X6 [Solanum 
lycopersicum]
Length=438

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+ GP RV+S  GFRYFV+F+DD+ RCTW++LMK R ELF +F
Sbjct  334  LHSDILGPSRVSSPLGFRYFVSFIDDYFRCTWVFLMKDRSELFSIF  379



>emb|CAN80367.1| hypothetical protein VITISV_014719 [Vitis vinifera]
Length=1573

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRG  20
            +H+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R 
Sbjct  706  IHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRA  745



>ref|XP_010318103.1| PREDICTED: uncharacterized protein LOC101244063 isoform X3 [Solanum 
lycopersicum]
Length=484

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+ GP RV+S  GFRYFV+F+DD+ RCTW++LMK R ELF +F
Sbjct  380  LHSDILGPSRVSSPLGFRYFVSFIDDYFRCTWVFLMKDRSELFSIF  425



>ref|XP_010318097.1| PREDICTED: uncharacterized protein LOC101244063 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318098.1| PREDICTED: uncharacterized protein LOC101244063 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318099.1| PREDICTED: uncharacterized protein LOC101244063 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318100.1| PREDICTED: uncharacterized protein LOC101244063 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318101.1| PREDICTED: uncharacterized protein LOC101244063 isoform X1 [Solanum 
lycopersicum]
Length=503

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+ GP RV+S  GFRYFV+F+DD+ RCTW++LMK R ELF +F
Sbjct  399  LHSDILGPSRVSSPLGFRYFVSFIDDYFRCTWVFLMKDRSELFSIF  444



>ref|XP_010318102.1| PREDICTED: uncharacterized protein LOC101244063 isoform X2 [Solanum 
lycopersicum]
Length=500

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+ GP RV+S  GFRYFV+F+DD+ RCTW++LMK R ELF +F
Sbjct  396  LHSDILGPSRVSSPLGFRYFVSFIDDYFRCTWVFLMKDRSELFSIF  441



>emb|CAN82711.1| hypothetical protein VITISV_004468 [Vitis vinifera]
Length=1157

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPC++ S  GF YFVTF+DD SRCT L+LMK+R ELF +F
Sbjct  437  VHIDVWGPCQIASTLGFHYFVTFIDDHSRCTLLFLMKNRAELFSIF  482



>ref|XP_003621710.1| Receptor-like protein kinase [Medicago truncatula]
Length=1085

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELF  11
            VHSDVWGP RV S  G++Y+VTF+DDFSRCTW+ L+K R +LF
Sbjct  211  VHSDVWGPSRVMSTLGYKYYVTFIDDFSRCTWITLLKDRSQLF  253



>ref|XP_009802348.1| PREDICTED: uncharacterized protein LOC104247899 [Nicotiana sylvestris]
Length=1269

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+ GP RV+S  GFRYFV  +DD++RCTWL+LMK R +LF +F
Sbjct  624  VHSDILGPSRVSSTLGFRYFVALIDDYTRCTWLFLMKDRSKLFSIF  669



>ref|XP_010318104.1| PREDICTED: uncharacterized protein LOC101244063 isoform X4 [Solanum 
lycopersicum]
Length=470

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+ GP RV+S  GFRYFV+F+DD+ RCTW++LMK R ELF +F
Sbjct  366  LHSDILGPSRVSSPLGFRYFVSFIDDYFRCTWVFLMKDRSELFSIF  411



>emb|CAN72710.1| hypothetical protein VITISV_018096 [Vitis vinifera]
Length=1110

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPC   S  GFRYFVTF+D++SRCTWL+LMK+R +LF +F
Sbjct  274  VHTDVWGPCWTASTLGFRYFVTFIDNYSRCTWLFLMKNRAKLFSIF  319



>emb|CAN80074.1| hypothetical protein VITISV_018877 [Vitis vinifera]
Length=1001

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR  S  GF+YFVTF+DD+SR T L+LMK+R ELF +F
Sbjct  450  VHTDVWGPCRTASTLGFQYFVTFIDDYSRYTRLFLMKTRAELFSIF  495



>ref|XP_004499927.1| PREDICTED: uncharacterized protein LOC101502660 [Cicer arietinum]
Length=347

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGE  17
            VHSDVWGP R  S    RYFVTF+DDFSRCTWL+LMK+R E
Sbjct  170  VHSDVWGPSRTISTLESRYFVTFIDDFSRCTWLFLMKNRSE  210



>emb|CAN68348.1| hypothetical protein VITISV_032025 [Vitis vinifera]
Length=1670

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGPCR      F+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  457  VHTDVWGPCRTAFTLXFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  502



>emb|CAN76133.1| hypothetical protein VITISV_036298 [Vitis vinifera]
Length=1161

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVW  CR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  415  VHTDVWSLCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  460



>ref|XP_007028466.1| Uncharacterized protein TCM_024268 [Theobroma cacao]
 gb|EOY08968.1| Uncharacterized protein TCM_024268 [Theobroma cacao]
Length=786

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGPC + SK  F+YF TFVDD+SR TW YLMK+  +LF +F
Sbjct  130  VHSDVWGPCPIVSKSSFKYFATFVDDYSRVTWRYLMKNHSKLFFIF  175



>emb|CAN65932.1| hypothetical protein VITISV_016257 [Vitis vinifera]
Length=498

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLM  32
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LM
Sbjct  461  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLM  496



>emb|CAN60317.1| hypothetical protein VITISV_002851 [Vitis vinifera]
Length=975

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HS + GPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  488  IHSRL-GPCRTVSTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  532



>emb|CAN71132.1| hypothetical protein VITISV_007235 [Vitis vinifera]
Length=1259

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWG C VTS+ GF+YFVTFVDDFSR TW+Y MK+R E+F  F
Sbjct  496  VHSDVWGXCPVTSQTGFQYFVTFVDDFSRMTWIYFMKNRSEVFSHF  541



>emb|CAN77834.1| hypothetical protein VITISV_024733 [Vitis vinifera]
Length=1300

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGE  17
            VH+DVWGPCR  S  GF+YFVTF+DD+SRCTWL+LMK+R +
Sbjct  392  VHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAD  432



>gb|AAT58770.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1419

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP    SK G RY+V FVDDFSR TW+Y MK R EL+ V+
Sbjct  697  VHSDVWGPAPFHSKGGHRYYVIFVDDFSRYTWIYFMKHRSELYQVY  742



>emb|CAN83548.1| hypothetical protein VITISV_035575 [Vitis vinifera]
Length=1225

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWG C VTS+  FRYFVTFVDDFS+ TW+Y MK+R E+F  F
Sbjct  489  VHSDVWGSCLVTSQTWFRYFVTFVDDFSQMTWIYFMKNRSEVFSYF  534



>ref|XP_010275349.1| PREDICTED: uncharacterized protein LOC104610431 [Nelumbo nucifera]
Length=510

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  VT+  GFR+F  FVDD +R TWLYLMK + E+  VF
Sbjct  199  IHSDVWGPSSVTTVSGFRWFAIFVDDCTRMTWLYLMKHKYEVLTVF  244



>ref|XP_008450155.1| PREDICTED: uncharacterized protein LOC103491828 [Cucumis melo]
Length=536

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP   T+ +G+RYFV F+DD+SR TW+Y +K+R  L+ ++
Sbjct  413  IHSDIWGPAPCTTVNGYRYFVLFIDDYSRFTWIYFLKNRSSLYQIY  458



>emb|CAN74064.1| hypothetical protein VITISV_028146 [Vitis vinifera]
Length=1203

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  GPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            GPCR+ S  GF+YFVTF+DD+SRCTWL+LMK+R +LF +F
Sbjct  369  GPCRIASTLGFQYFVTFIDDYSRCTWLFLMKNRAKLFSIF  408



>emb|CAN75051.1| hypothetical protein VITISV_020117 [Vitis vinifera]
Length=1625

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  VT+  G R+FV FVDD +R TWLYL+K + E+F +F
Sbjct  522  IHSDVWGPSLVTTSSGHRWFVIFVDDCTRMTWLYLLKHKDEVFXIF  567



>emb|CAN60732.1| hypothetical protein VITISV_010209 [Vitis vinifera]
Length=1409

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP  +T     R+FVTFVDD +R TWLY+MK++ E+F++F
Sbjct  519  VHSDVWGPAPITISSSVRWFVTFVDDCTRMTWLYVMKNKHEVFEIF  564



>emb|CAN65966.1| hypothetical protein VITISV_005935 [Vitis vinifera]
Length=1154

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD WGP  +T   G R+FVTFVDD +R TWLY+MK++ E+F++F
Sbjct  486  VHSDXWGPTPITISFGVRWFVTFVDDCTRMTWLYVMKNKHEVFEIF  531



>emb|CAN77046.1| hypothetical protein VITISV_035257 [Vitis vinifera]
Length=1478

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  GPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            GPC+  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  633  GPCQTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  672



>gb|AAC12735.1| putative retrovirus-related polyprotein, partial [Lithospermum 
erythrorhizon]
Length=244

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+D+WGP +V SK G  YFVTFVDD+SR  W+Y +K + E+FD+F
Sbjct  170  VHTDLWGPAKVNSKDGSWYFVTFVDDYSRYAWIYFLKHKNEVFDIF  215



>ref|XP_004955256.1| PREDICTED: uncharacterized protein LOC101756543 [Setaria italica]
Length=421

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H D+WGPC V S  G R+FV F+D FSR TWLYL+K + ++F VF
Sbjct  280  IHYDIWGPCEVNSILGHRWFVNFIDGFSRYTWLYLLKHKSDVFSVF  325



>emb|CAN74101.1| hypothetical protein VITISV_039542 [Vitis vinifera]
Length=1265

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  GPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            GPC+  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  419  GPCQTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  458



>ref|XP_010113352.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXC35359.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=3263

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP R+ +  G R+FVTFVDD +R TW+YLMK + E+  +F
Sbjct  576  IHSDVWGPSRIKNVSGTRWFVTFVDDHTRVTWVYLMKEKSEVGQIF  621



>gb|ABA95797.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1588

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGPC VTS  GF++FVTF+D ++R TW+Y+++ + E+   F
Sbjct  620  IHSDVWGPCPVTSVSGFKWFVTFIDCYTRMTWIYMLRHKNEVLRCF  665



>ref|XP_010269632.1| PREDICTED: uncharacterized protein LOC104606229 [Nelumbo nucifera]
Length=692

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  VT+   FR+FV FVDD +R TWLYLMK + E+  VF
Sbjct  333  IHSDVWGPSPVTTVSRFRWFVIFVDDCTRMTWLYLMKHKDEVLTVF  378



>gb|ACS74199.1| putative gag-pol polyprotein [Fragaria x ananassa]
Length=1297

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H+DVWGP    SK G RYFV+F+DDFSR  W++ MK++ E+F  F
Sbjct  456  IHTDVWGPSATISKGGARYFVSFIDDFSRKVWIFFMKTKNEVFTKF  501



>ref|XP_008674201.1| PREDICTED: uncharacterized protein LOC100279087 isoform X1 [Zea 
mays]
Length=1376

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  803  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  848



>emb|CAN82960.1| hypothetical protein VITISV_004472 [Vitis vinifera]
Length=437

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V+S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  389  IHSDVWGPSLVSSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVFRTF  434



>emb|CAN71267.1| hypothetical protein VITISV_017889 [Vitis vinifera]
Length=1576

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V+S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  697  IHSDVWGPSPVSSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVFRTF  742



>emb|CAN70357.1| hypothetical protein VITISV_013713 [Vitis vinifera]
Length=1568

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ S  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  672  VHSDVWGPSRIKSISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  717



>emb|CAC95126.1| gag-pol polyprotein [Populus deltoides]
Length=1382

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V++K G RY+V+F+DD +R  W+YLMK R E F+++
Sbjct  540  IHSDVWGPSPVSTKGGSRYYVSFIDDHTRYCWVYLMKHRSEFFEIY  585



>ref|XP_008372142.1| PREDICTED: uncharacterized protein LOC103435525 [Malus domestica]
Length=1565

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -3

Query  136  HSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            HSDVWGP  + S  G++YFVTFVDDF+R TWLYL+K + E+ +VF
Sbjct  783  HSDVWGPI-LESFDGYKYFVTFVDDFTRITWLYLLKFKSEVMEVF  826



>emb|CAN73765.1| hypothetical protein VITISV_035279 [Vitis vinifera]
Length=2260

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP   ++  G R+FV FVDD +R TWLYLMK++ E+F VF
Sbjct  485  IHSDVWGPSPKSTISGVRWFVIFVDDCTRMTWLYLMKNKDEVFSVF  530



>ref|XP_003597218.1| Beta-galactosidase [Medicago truncatula]
Length=2260

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             +HSDVWGP    + +G R+FVTFVDD +R TWLY +K + +LF VF
Sbjct  1024  IHSDVWGPSPFPTNNGMRWFVTFVDDCTRMTWLYFLKHKSDLFSVF  1069



>emb|CAN69870.1| hypothetical protein VITISV_032283 [Vitis vinifera]
Length=959

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  191  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  236



>emb|CAN74794.1| hypothetical protein VITISV_041689 [Vitis vinifera]
Length=845

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V+S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  532  IHSDVWGPSPVSSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVFXTF  577



>gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana]
Length=1453

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H D+WGP  V SK GF+Y+V FVDD+SR +W Y +K++ + F VF
Sbjct  518  IHCDLWGPSPVVSKQGFKYYVVFVDDYSRYSWFYPLKAKSDFFAVF  563



>emb|CAN79175.1| hypothetical protein VITISV_001884 [Vitis vinifera]
Length=1487

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  491  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  536



>emb|CAN63881.1| hypothetical protein VITISV_039357 [Vitis vinifera]
Length=1611

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  566  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  611



>gb|KFY82599.1| hypothetical protein V500_10440 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=1364

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFR-YFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP RV   HG   YFVTF DD++R TW+Y+M+SRG+L  +F
Sbjct  480  IHSDIWGPYRVPDIHGKSIYFVTFTDDYTRKTWVYVMRSRGQLRAIF  526



>ref|XP_008647645.1| PREDICTED: uncharacterized protein LOC100502300 isoform X2 [Zea 
mays]
Length=1180

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  319  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  364



>emb|CAN82928.1| hypothetical protein VITISV_025045 [Vitis vinifera]
Length=1468

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  561  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  606



>emb|CAN59964.1| hypothetical protein VITISV_022757 [Vitis vinifera]
Length=1481

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  561  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  606



>emb|CAN71164.1| hypothetical protein VITISV_031057 [Vitis vinifera]
Length=1303

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V+S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  675  IHSDVWGPSPVSSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVFRTF  720



>emb|CAN79422.1| hypothetical protein VITISV_002126 [Vitis vinifera]
Length=1065

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  300  VHSDVWGPSRIKNISGNRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  345



>emb|CAN64765.1| hypothetical protein VITISV_009574 [Vitis vinifera]
Length=1426

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  561  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  606



>emb|CAN62538.1| hypothetical protein VITISV_031159 [Vitis vinifera]
Length=1481

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  561  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  606



>emb|CAN81385.1| hypothetical protein VITISV_012324 [Vitis vinifera]
Length=1369

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  561  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  606



>emb|CAN72886.1| hypothetical protein VITISV_019713 [Vitis vinifera]
Length=1504

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  752  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  797



>emb|CAN76332.1| hypothetical protein VITISV_006269 [Vitis vinifera]
Length=850

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  489  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  534



>emb|CAN72567.1| hypothetical protein VITISV_044177 [Vitis vinifera]
Length=950

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP  V S  G RY+VTF+DDFSR  W+Y +K++ E+F  F
Sbjct  449  IHSDLWGPSPVESHSGCRYYVTFIDDFSRKVWVYFLKAKDEVFGKF  494



>emb|CAN81715.1| hypothetical protein VITISV_032902 [Vitis vinifera]
Length=848

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  GPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            G CR  S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  3    GSCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  42



>emb|CAN67970.1| hypothetical protein VITISV_025093 [Vitis vinifera]
Length=1023

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  ++S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  451  IHSDVWGPSPISSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVFRTF  496



>emb|CAN72168.1| hypothetical protein VITISV_004170 [Vitis vinifera]
Length=1415

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  527  VHSDVWGPSRIKNIFGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  572



>ref|XP_008387850.1| PREDICTED: uncharacterized protein LOC103450292 [Malus domestica]
Length=778

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    S  G++YF+ FVDD+SR TWLYL+KS+ E+  VF
Sbjct  441  VHSDIWGPSS-ESFDGYKYFIIFVDDYSRTTWLYLLKSKSEVXXVF  485



>emb|CAN65222.1| hypothetical protein VITISV_038665 [Vitis vinifera]
Length=1562

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP  V S  G RY+VTF+DDFSR  W+Y +K++ E+F  F
Sbjct  594  IHSDLWGPSPVESHSGCRYYVTFIDDFSRKVWVYFLKAKDEVFGKF  639



>emb|CAN78598.1| hypothetical protein VITISV_001332 [Vitis vinifera]
Length=1701

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  808  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  853



>ref|XP_010526678.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=1275

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGPC   S  G R+F++ VDD+SRCTW+YL+KS+ ++   F
Sbjct  637  LHVDVWGPCSEISTDGHRFFLSIVDDYSRCTWVYLLKSKSDVLQKF  682



>emb|CAN83937.1| hypothetical protein VITISV_042335 [Vitis vinifera]
Length=641

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  523  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  568



>ref|XP_010526682.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X4 [Tarenaya hassleriana]
Length=940

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGPC   S  G R+F++ VDD+SRCTW+YL+KS+ ++   F
Sbjct  302  LHVDVWGPCSEISTDGHRFFLSIVDDYSRCTWVYLLKSKSDVLQKF  347



>ref|XP_008672007.1| PREDICTED: uncharacterized protein LOC100191195 isoform X3 [Zea 
mays]
Length=257

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  180  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  225



>ref|XP_010526681.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X3 [Tarenaya hassleriana]
Length=1238

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGPC   S  G R+F++ VDD+SRCTW+YL+KS+ ++   F
Sbjct  637  LHVDVWGPCSEISTDGHRFFLSIVDDYSRCTWVYLLKSKSDVLQKF  682



>emb|CAN69597.1| hypothetical protein VITISV_038518 [Vitis vinifera]
Length=1893

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  990   VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  1035



>emb|CAN68802.1| hypothetical protein VITISV_008809 [Vitis vinifera]
Length=1397

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  561  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKXEVGHIF  606



>ref|NP_001174869.1| Os06g0583500 [Oryza sativa Japonica Group]
 dbj|BAH93597.1| Os06g0583500, partial [Oryza sativa Japonica Group]
Length=174

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP    SK G +Y+V F+DD+SR TW+Y MK R +L  ++
Sbjct  129  VHSDVWGPAPFASKGGHKYYVIFIDDYSRYTWIYFMKHRSQLLSIY  174



>ref|XP_010526680.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Tarenaya hassleriana]
Length=1244

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGPC   S  G R+F++ VDD+SRCTW+YL+KS+ ++   F
Sbjct  606  LHVDVWGPCSEISTDGHRFFLSIVDDYSRCTWVYLLKSKSDVLQKF  651



>ref|XP_010526683.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X5 [Tarenaya hassleriana]
Length=886

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGPC   S  G R+F++ VDD+SRCTW+YL+KS+ ++   F
Sbjct  248  LHVDVWGPCSEISTDGHRFFLSIVDDYSRCTWVYLLKSKSDVLQKF  293



>gb|AGJ83729.1| gag-pol polyprotein, partial [Caragana korshinskii]
Length=732

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP  V +K G RY+V+F+DD++R  W+YLMK R E  D++
Sbjct  56   VHSDVWGPSPVPTKGGSRYYVSFIDDYTRYCWVYLMKHRSEFLDIY  101



>ref|XP_010051428.1| PREDICTED: uncharacterized protein LOC104440152 [Eucalyptus grandis]
Length=645

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGP  V+S  GFRY+V F+D+FSR +W+Y M+ + + +D+F
Sbjct  586  IHCDVWGPSPVSSVQGFRYYVLFIDNFSRYSWVYPMRLKSDFYDIF  631



>ref|XP_010526684.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X6 [Tarenaya hassleriana]
Length=789

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGPC   S  G R+F++ VDD+SRCTW+YL+KS+ ++   F
Sbjct  151  LHVDVWGPCSEISTDGHRFFLSIVDDYSRCTWVYLLKSKSDVLQKF  196



>emb|CAN71436.1| hypothetical protein VITISV_039529 [Vitis vinifera]
Length=1169

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  467  IHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWIFPMKSRSEILSIY  512



>emb|CAN67449.1| hypothetical protein VITISV_031400 [Vitis vinifera]
Length=1618

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTF+DD +R TW++LMK + E+  +F
Sbjct  698  VHSDVWGPSRIKNISGTRWFVTFIDDHTRVTWVFLMKEKSEVGHIF  743



>ref|XP_008338000.1| PREDICTED: uncharacterized protein LOC103401070 [Malus domestica]
Length=952

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGP    S  G++YFV FV DFSR TWLYL+KS+ E+ +VF
Sbjct  575  VHXDVWGPTS-ESFDGYKYFVIFVXDFSRVTWLYLLKSKNEVMEVF  619



>ref|XP_008465178.1| PREDICTED: uncharacterized protein LOC103502842 [Cucumis melo]
Length=385

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGEL  14
            +HSD+WGP   ++ HG+RY+V F+DDFSR TW+Y +K   +L
Sbjct  303  IHSDIWGPAPSSTVHGYRYYVLFIDDFSRFTWIYFLKHHSKL  344



>gb|AAT47108.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1204

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP    SK G RY++ F+DDFSR TW+Y M  R E+  ++
Sbjct  557  VHSDVWGPAPFVSKGGHRYYIIFIDDFSRHTWIYFMTHRSEVLAIY  602



>emb|CDP17738.1| unnamed protein product [Coffea canephora]
Length=798

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP +  S  G  YFVTF+DDFSR  W++ MKS+ E+  +F
Sbjct  505  VHSDVWGPAKTPSLGGRYYFVTFIDDFSRRVWVFTMKSKDEMLKIF  550



>emb|CAN81712.1| hypothetical protein VITISV_038973 [Vitis vinifera]
Length=1615

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++ MK + E+  +F
Sbjct  734  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFFMKEKSEVGHIF  779



>emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera]
Length=1381

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  541  IHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWIFPMKSRSEILSIY  586



>ref|XP_010263164.1| PREDICTED: uncharacterized protein LOC104601508 [Nelumbo nucifera]
Length=531

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  133  SDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            SDVWGP  VT+  GFR+FV FVDD +R TWLYL+K + E+  VF
Sbjct  365  SDVWGPSLVTTVSGFRWFVIFVDDCTRMTWLYLLKHKDEVLTVF  408



>emb|CAN83177.1| hypothetical protein VITISV_042114 [Vitis vinifera]
Length=1085

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  GPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            GPCR  S  GF+YFVTF+DD+SRCTWL+L+K++ ELF +F
Sbjct  425  GPCRTASTLGFQYFVTFIDDYSRCTWLFLIKNQAELFFIF  464



>emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera]
Length=1355

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP  + S  GF+YFVTF+DDFS+ TW+YL+KS+ E+F+ F
Sbjct  553  VHSDVWGPFSL-SIDGFKYFVTFIDDFSKVTWVYLLKSKSEVFECF  597



>gb|AAF69161.1|AC007915_13 F27F5.19 [Arabidopsis thaliana]
Length=1309

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH D WGP  V +K GFRYF+T VDDFSR TW YL+K++ ++   F
Sbjct  593  VHIDTWGPFYVLTKDGFRYFLTIVDDFSRATWNYLLKNKSDVLHAF  638



>emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera]
Length=2655

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             +HSDVWGP  V S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  1832  IHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWIFPMKSRSEILPIY  1877



>gb|ABO36622.1| copia LTR rider [Solanum lycopersicum]
 gb|ABO36636.1| copia LTR rider [Solanum lycopersicum]
Length=1307

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD WGPCRV S  G R+FV+ +DD+SR TW+Y+MK + E F  F
Sbjct  473  IHSDCWGPCRVESLGGCRFFVSIIDDYSRMTWVYMMKHKSEAFQKF  518



>emb|CAN61929.1| hypothetical protein VITISV_014855 [Vitis vinifera]
Length=1271

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  533  IHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWIFPMKSRSEILSIY  578



>ref|XP_008347438.1| PREDICTED: uncharacterized protein LOC103410522 [Malus domestica]
Length=791

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH+DVWGP    S  GF+YFV FVDDFSR ++LYLMKS+ E+  +F
Sbjct  583  VHTDVWGPA-TESMEGFKYFVLFVDDFSRTSFLYLMKSKSEVPTIF  627



>emb|CAN64452.1| hypothetical protein VITISV_009528 [Vitis vinifera]
Length=2220

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VHSDVWGP R+ +  G ++FVTFVDD +R TW++LMK + E+  +F
Sbjct  1343  VHSDVWGPSRIKNISGTQWFVTFVDDHTRVTWVFLMKEKSEVGHIF  1388



>emb|CAN73014.1| hypothetical protein VITISV_007603 [Vitis vinifera]
Length=1121

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSR---GELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK +   G +F  F
Sbjct  701  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSKVGHIFQTF  749



>emb|CAN63534.1| hypothetical protein VITISV_001206 [Vitis vinifera]
Length=1189

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTW  44
            VHSDVWGPC VTS+ GFRYFVTFVDDFSR TW
Sbjct  515  VHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTW  546



>emb|CAN62394.1| hypothetical protein VITISV_021305 [Vitis vinifera]
Length=1287

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  508  IHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWIFPMKSRSEILSIY  553



>emb|CDN96898.1| putative Ty-1 copia retrotransposon [Phaseolus vulgaris]
Length=813

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP +  S  G  YFVTFVDDFSR  W++ MK++ ++ ++F
Sbjct  419  VHSDVWGPAKTPSIGGRHYFVTFVDDFSRRVWVFTMKNKNDVLEIF  464



>gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, 
score: 11.19) [Arabidopsis thaliana]
Length=1633

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H D+WGP  + S  GFRYF+T VDD +R TW+Y+MK++ E+ ++F
Sbjct  559  IHLDIWGPFSIESVDGFRYFLTLVDDCTRTTWVYMMKNKSEVSNIF  604



>emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera]
Length=1402

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            V++D+WGP  VTS  G +YF+ FVDD+SR TWLYL++S+ +   +F
Sbjct  544  VYTDIWGPASVTSTSGAKYFILFVDDYSRYTWLYLLQSKDQALPIF  589



>emb|CAN67992.1| hypothetical protein VITISV_015686 [Vitis vinifera]
Length=1308

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V+S   F+Y+VTF+DD +R TW+Y ++S+ E+F  F
Sbjct  492  IHSDVWGPSPVSSHEKFKYYVTFIDDHNRFTWVYFLRSKSEVFRTF  537



>emb|CAN66125.1| hypothetical protein VITISV_044030 [Vitis vinifera]
Length=1070

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  824  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  869



>emb|CAN67362.1| hypothetical protein VITISV_001157 [Vitis vinifera]
Length=1259

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGE  17
            VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E
Sbjct  538  VHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSE  578



>emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera]
Length=1365

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            V++D+WGP  VTS  G +YF+ FVDD+SR TWLYL++S+ +   +F
Sbjct  494  VYTDIWGPASVTSTSGAKYFILFVDDYSRYTWLYLLQSKDQALPIF  539



>emb|CAN79492.1| hypothetical protein VITISV_033373 [Vitis vinifera]
Length=2116

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             +HSD WGP  ++S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  1317  IHSDFWGPSPISSYEKFKYYVTFIDDHSRFTWVYFLRSKSEVFRTF  1362



>emb|CDP17739.1| unnamed protein product [Coffea canephora]
Length=435

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHS+VWGP +  S  G  YFVTF+DDFSR  W++ MKS+ E+ ++F
Sbjct  113  VHSNVWGPAKTPSLGGRYYFVTFIDDFSRRVWVFTMKSKDEVLEIF  158



>emb|CAA19696.1| putative LTR retrotransposon (fragment) [Arabidopsis thaliana]
 emb|CAB78981.1| putative LTR retrotransposon (fragment) [Arabidopsis thaliana]
Length=281

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH D WGP  V +  GF+YF+T VDDFSR TW+YL+K++ ++  VF
Sbjct  207  VHIDTWGPFSVPTNDGFKYFLTIVDDFSRATWIYLLKNKSDVLHVF  252



>emb|CAN67240.1| hypothetical protein VITISV_037460 [Vitis vinifera]
Length=1174

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  360  IHSDVWGPSPVASIGGSRYFVIFIDDYSRYSWIFPMKSRSEILPIY  405



>emb|CAN70669.1| hypothetical protein VITISV_037506 [Vitis vinifera]
Length=2825

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VHSDVWGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  2001  VHSDVWGPSRIKNISGTRWFVTFVDDHTRGTWVFLMKEKSEVGHIF  2046



>ref|XP_004229082.1| PREDICTED: uncharacterized protein LOC101247852 [Solanum lycopersicum]
Length=575

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGP RV +  G RYF+T VDD+SRCTW++LM+ + ++  + 
Sbjct  473  VHLDVWGPYRVETFDGMRYFLTVVDDYSRCTWIFLMRLKSDVVSLL  518



>ref|XP_008348795.1| PREDICTED: uncharacterized protein LOC103411964 [Malus domestica]
Length=892

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGPC V+S  G++Y+V FVD+FS+ +WL+ +K++ E+  +F
Sbjct  725  VHCDVWGPCPVSSLSGYKYYVLFVDEFSKYSWLFPLKAKSEVLSIF  770



>emb|CAN67009.1| hypothetical protein VITISV_004754 [Vitis vinifera]
Length=1237

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP R+ +  G R+FVTFVDD +R TW++LMK + E+  +F
Sbjct  351  LHSDMWGPSRIKNISGTRWFVTFVDDHTRVTWVFLMKEKSEVGHIF  396



>ref|XP_008372204.1| PREDICTED: uncharacterized protein LOC103435597 [Malus domestica]
Length=1159

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP    S   ++Y+V FVDDFSR TWLYL KS+ E+ +VF
Sbjct  575  VHSDVWGPT-FESFDXYKYYVIFVDDFSRATWLYLXKSKSEVIEVF  619



>emb|CDO78107.1| hypothetical protein BN946_scf184638.g3 [Trametes cinnabarina]
Length=909

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+T+  G +Y+V+F DD +R T LYLM+ + E+F++F
Sbjct  615  VHSDVWGPARITTLGGRKYYVSFTDDKTRFTVLYLMRQKSEVFELF  660



>emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera]
Length=1261

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  451  IHSDVWGPFPVASIGGSRYFVVFIDDYSRYSWIFPMKSRSEILSIY  496



>gb|AAD26943.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1454

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGP  V +  G++YF+T VDD SR TW+YL+K++ E+  VF
Sbjct  617  LHIDVWGPFSVETVEGYKYFLTIVDDHSRATWMYLLKTKSEVLTVF  662



>gb|EMT17614.1| DNA-directed RNA polymerase I subunit RPA2 [Aegilops tauschii]
Length=1856

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             VHSDVWGP    SK G RY++ F+DDFSR T LY+MKSR E+  ++
Sbjct  1342  VHSDVWGPAPFDSKGGHRYYILFIDDFSRYTLLYIMKSRSEVLSIY  1387



>ref|XP_008654354.1| PREDICTED: uncharacterized protein LOC100193261 isoform X3 [Zea 
mays]
Length=721

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  354  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  399



>emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera]
Length=1505

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP R+++  G ++FVTF+DD +R +W+YL++ + E+ +VF
Sbjct  554  IHSDVWGPSRISTLSGKKWFVTFIDDHTRVSWVYLLREKSEVEEVF  599



>emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera]
Length=1360

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWG  R+ +  G R+FVTFVDD +R TW++LMK + E+ ++F
Sbjct  507  IHSDVWGASRINNITGSRWFVTFVDDHTRVTWVFLMKKKSEVREIF  552



>ref|XP_008654353.1| PREDICTED: uncharacterized protein LOC100193261 isoform X2 [Zea 
mays]
Length=725

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  358  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  403



>emb|CAN78022.1| hypothetical protein VITISV_015518 [Vitis vinifera]
Length=1501

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H D+WGP  + S  GF Y+V F+DD+SR TWLY +K + + FD+F
Sbjct  468  IHCDLWGPSPIKSNSGFLYYVIFIDDYSRFTWLYPLKFKSDFFDIF  513



>ref|XP_008654352.1| PREDICTED: uncharacterized protein LOC100193261 isoform X1 [Zea 
mays]
Length=761

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  394  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  439



>emb|CAN79936.1| hypothetical protein VITISV_033548 [Vitis vinifera]
Length=981

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HS+VWGP  V+S   F+Y+VTF+DD S+ TW+Y ++S+ E+F  F
Sbjct  256  IHSNVWGPSPVSSHEKFKYYVTFIDDHSKFTWVYFLRSKSEVFRTF  301



>ref|XP_008669041.1| PREDICTED: uncharacterized protein LOC103646095 [Zea mays]
Length=704

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  425  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  470



>emb|CAN63642.1| hypothetical protein VITISV_038695 [Vitis vinifera]
Length=1069

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELF  11
            +HSD WGP  V+S   F+Y+VTF+DD SR TW+Y ++S+ E+F
Sbjct  475  IHSDAWGPSPVSSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVF  517



>ref|XP_008674202.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Zea mays]
Length=756

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  136  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  181



>ref|XP_008651726.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=989

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP    SK G++Y+V F+DD SR TW+Y MK R EL  ++
Sbjct  128  VHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIYFMKRRSELISIY  173



>emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1515

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H D+WGP  VTS  GF+Y+V F+D++SR TW Y +K + + F VF
Sbjct  516  IHCDLWGPAPVTSAQGFQYYVIFIDNYSRFTWFYPLKLKSDFFSVF  561



>emb|CAN73071.1| hypothetical protein VITISV_032383 [Vitis vinifera]
Length=1239

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H D+WGP  + S  GF Y+V F+DD+SR TWLY +K + + FD+F
Sbjct  490  IHCDLWGPSPIKSNSGFLYYVIFIDDYSRFTWLYPLKFKSDFFDIF  535



>ref|XP_010051209.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104439906 
[Eucalyptus grandis]
Length=2021

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH D+WGP  V S   F+Y+V  VDDFSR +W+Y M+++ + +D+F
Sbjct  590  VHCDIWGPSPVISFQNFKYYVILVDDFSRFSWIYPMRAKADFYDIF  635



>emb|CAB43904.1| putative protein [Arabidopsis thaliana]
 emb|CAB81478.1| putative protein [Arabidopsis thaliana]
Length=1415

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH D+WGP  V S  GFRY+V F+D++SR TW Y ++ + + F VF
Sbjct  485  VHCDLWGPAPVVSSQGFRYYVIFIDNYSRFTWFYPLRLKSDFFSVF  530



>ref|XP_010264759.1| PREDICTED: uncharacterized protein LOC104602675 [Nelumbo nucifera]
Length=636

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HS+VWG   VT+  GFR+FV FVDD +R TWLYL+K + E+  VF
Sbjct  485  IHSNVWGSSLVTTVFGFRWFVIFVDDCTRMTWLYLLKHKDEVLTVF  530



>ref|XP_009377992.1| PREDICTED: uncharacterized protein LOC103966547 [Pyrus x bretschneideri]
Length=608

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP    S  G++YFV FVDDFS+ TWLYL+KS+ E+ +VF
Sbjct  527  VHSDVWGPTS-ESFDGYKYFVIFVDDFSQVTWLYLLKSKSEVVEVF  571



>gb|AAD25646.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1461

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGP  V +  G++YF+T VDD SR TW+YL+KS+ ++  VF
Sbjct  628  LHIDVWGPFSVETVEGYKYFLTIVDDHSRATWIYLLKSKSDVLTVF  673



>emb|CAN61630.1| hypothetical protein VITISV_003191 [Vitis vinifera]
Length=1208

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP RV S  G RYF+T +DD+SR  W+Y +K++ E F  F
Sbjct  453  IHSDLWGPSRVPSIGGARYFLTLIDDYSRKVWIYFLKNKSETFLKF  498



>emb|CAN62271.1| hypothetical protein VITISV_010713 [Vitis vinifera]
Length=711

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVW P  V+S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  406  IHSDVWEPSPVSSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVFRTF  451



>gb|EKV14391.1| Gag/polymerase/env polyprotein, putative [Penicillium digitatum 
PHI26]
Length=295

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H DVWGP  + S  G  YFVTF DD +R TWL+L+KSR ++ +V+
Sbjct  90   IHLDVWGPISIASHGGEHYFVTFTDDATRFTWLFLLKSRSQVTEVY  135



>ref|XP_008778555.1| PREDICTED: uncharacterized protein LOC103698337 [Phoenix dactylifera]
Length=848

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDV  5
            +H D+WGP   TS  G +YF+T VDD+SR TW+YLM+S+ +  D+
Sbjct  468  IHCDIWGPFSTTSLDGSKYFLTIVDDYSRATWVYLMQSKAQTRDI  512



>emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera]
Length=1636

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP R+ +  G R+FV+F+DD +R TW++LMK + E   +F
Sbjct  577  IHSDIWGPSRIKNVTGTRWFVSFIDDHTRLTWVFLMKEKSETSQIF  622



>emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera]
Length=1424

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H+D+WGP    S HG +Y++ F+D +SR TW+Y++K + E F VF
Sbjct  566  IHTDLWGPASTPSSHGHQYYIHFIDAYSRFTWIYMLKHKSEAFQVF  611



>emb|CAN75466.1| hypothetical protein VITISV_025054 [Vitis vinifera]
Length=1576

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP R+ +  G R+FV+F+DD +R TW++LMK + E   +F
Sbjct  692  IHSDIWGPSRIKNVTGTRWFVSFIDDHTRLTWVFLMKEKSETSQIF  737



>emb|CAN72222.1| hypothetical protein VITISV_028929 [Vitis vinifera]
Length=651

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  103  SKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            S  GF+YFVTF+DD+SRCTWL+LMK+R ELF +F
Sbjct  51   STLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIF  84



>ref|XP_010513552.1| PREDICTED: uncharacterized protein LOC104789576 [Camelina sativa]
Length=824

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH D+WGP  + S  GFRYF+T VDD +R TW+YL++++ E+  VF
Sbjct  570  VHLDIWGPFSIESVEGFRYFLTLVDDCTRTTWVYLLRNKKEVNTVF  615



>gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana]
Length=1436

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH D WGP  V +   +RYF+T VDDFSR TW+YL+K + ++  VF
Sbjct  618  VHIDTWGPFSVPTVDSYRYFLTIVDDFSRATWIYLLKQKSDVLTVF  663



>ref|XP_008377550.1| PREDICTED: uncharacterized protein LOC103440632 [Malus domestica]
Length=793

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP  V + HG  +FV FVDD +R TWLY MK + ++  +F
Sbjct  606  VHSDVWGPSPVATNHGVXWFVXFVDDCTRMTWLYTMKHKSDVGQIF  651



>emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera]
Length=1813

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGE  17
            +H DVWGP ++ +  G RYF+T VDDFSRCTW++LM  + E
Sbjct  827  LHCDVWGPHKIPAHTGSRYFLTIVDDFSRCTWIFLMHHKSE  867



>emb|CAN70229.1| hypothetical protein VITISV_024789 [Vitis vinifera]
Length=1472

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSDVWGP R+ +  G R+FVTFVDD +  TW++LMK + E+  +F
Sbjct  552  VHSDVWGPSRIKNISGTRWFVTFVDDHTWVTWVFLMKEKSEVGHIF  597



>emb|CAN74984.1| hypothetical protein VITISV_035210 [Vitis vinifera]
Length=2408

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139   VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
             +HSDVWGP  V S    RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  1659  IHSDVWGPSPVASIGXSRYFVVFIDDYSRYSWIFPMKSRSEILSIY  1704



>ref|NP_001172143.1| Os01g0116166 [Oryza sativa Japonica Group]
 dbj|BAH90873.1| Os01g0116166 [Oryza sativa Japonica Group]
Length=778

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP R TS  G RY +T VDD+SR  W Y +K + + FDVF
Sbjct  461  VHSDLWGPARKTSFGGARYIMTIVDDYSRKVWPYFLKHKYQAFDVF  506



>emb|CAN82851.1| hypothetical protein VITISV_027998 [Vitis vinifera]
Length=1239

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP R+ +  G R+FV+F+DD +R TW++LMK + E   +F
Sbjct  371  IHSDIWGPSRIKNVTGTRWFVSFIDDHTRLTWVFLMKEKSETSQIF  416



>dbj|BAB10503.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1475

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +H D WGP    +  G++YF+T VDD+SR TW+YLMK++ ++  +F
Sbjct  645  IHIDTWGPFATPTTEGYKYFLTIVDDYSRATWVYLMKAKNDVLQIF  690



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSD+WGP R+ +  G R+FV+F+DD +R TW++LMK + E   +F
Sbjct  296  IHSDIWGPSRIKNVTGTRWFVSFIDDHTRLTWVFLMKEKSETSQIF  341



>emb|CAN63782.1| hypothetical protein VITISV_010855 [Vitis vinifera]
Length=698

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V+S   F+Y+VTF+D+ SR TW+Y ++S+ ++F  F
Sbjct  146  IHSDVWGPFLVSSHEKFKYYVTFIDNHSRFTWVYFLRSKSKVFRTF  191



>emb|CAN71586.1| hypothetical protein VITISV_009568 [Vitis vinifera]
Length=1303

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HS+VWGP +V +  G R+FVTFVDD++R TWL LMK++ E+  +F
Sbjct  198  IHSNVWGPSKVPTLSGSRWFVTFVDDYTRMTWLCLMKTKDEMNLLF  243


 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP +V +  G R+FVTF+DD +R TWL LMK++ E+  +F
Sbjct  590  IHSDVWGPSKVLTLSGSRWFVTFIDDCTRMTWLCLMKTKDEVNLLF  635



>emb|CAN64963.1| hypothetical protein VITISV_002891 [Vitis vinifera]
Length=1318

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  + S  G RYFV F+DD+SR +W++ MKSR E+  ++
Sbjct  499  IHSDVWGPSPIASIGGSRYFVVFIDDYSRYSWIFPMKSRFEILPIY  544



>ref|NP_001065797.2| Os11g0157000 [Oryza sativa Japonica Group]
 dbj|BAF27642.2| Os11g0157000 [Oryza sativa Japonica Group]
Length=1601

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VHSD+WGP R TS  G RY +T VDD+SR  W Y +K + + FDVF
Sbjct  495  VHSDLWGPARKTSFGGTRYMMTIVDDYSRKVWPYFLKHKYQAFDVF  540



>emb|CAN67587.1| hypothetical protein VITISV_036279 [Vitis vinifera]
Length=1034

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP  V+S   F+Y+VTF+DD SR TW+Y ++S+ E+F  F
Sbjct  514  IHSDVWGPSSVSSHEKFKYYVTFIDDHSRFTWVYFLRSKSEVFRTF  559



>ref|XP_009612717.1| PREDICTED: uncharacterized protein LOC104105976 [Nicotiana tomentosiformis]
Length=706

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            VH DVWGP RV +  G RYF+T VDD+S+ TWL+L+ S+ ++ +V 
Sbjct  462  VHGDVWGPYRVPTHDGKRYFLTLVDDYSKYTWLFLLHSKSDIVEVL  507



>emb|CAN72951.1| hypothetical protein VITISV_020157 [Vitis vinifera]
Length=644

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  139  VHSDVWGPCRVTSKHGFRYFVTFVDDFSRCTWLYLMKSRGELFDVF  2
            +HSDVWGP +V++  G  +FVTF+DD +R TWLYLMK++ E+  +F
Sbjct  232  IHSDVWGPSKVSTLSGSCWFVTFIDDCTRMTWLYLMKTKDEVNLLF  277



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507653521284