BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c113662_g1_i1 len=359 path=[337:0-358]

Length=359
                                                                      Score     E

ref|XP_009765362.1|  PREDICTED: vacuolar protein sorting-associat...  59.7    1e-08   
ref|XP_008459153.1|  PREDICTED: vacuolar protein sorting-associat...  58.5    3e-08   
ref|XP_002283066.1|  PREDICTED: vacuolar protein sorting-associat...  58.5    4e-08   Vitis vinifera
ref|XP_004141038.1|  PREDICTED: vacuolar protein sorting-associat...  58.2    5e-08   
ref|XP_004239323.1|  PREDICTED: vacuolar protein sorting-associat...  57.4    8e-08   
ref|XP_008782995.1|  PREDICTED: vacuolar protein sorting-associat...  56.6    1e-07   
ref|XP_010244367.1|  PREDICTED: vacuolar protein sorting-associat...  55.8    3e-07   
ref|XP_008812733.1|  PREDICTED: vacuolar protein sorting-associat...  55.5    4e-07   
ref|XP_010267087.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    6e-07   
ref|XP_006584796.1|  PREDICTED: vacuolar protein sorting-associat...  55.1    6e-07   
ref|XP_006338191.1|  PREDICTED: vacuolar protein sorting-associat...  54.7    7e-07   
ref|XP_006371958.1|  hypothetical protein POPTR_0018s06680g           54.7    8e-07   
ref|XP_009593196.1|  PREDICTED: vacuolar protein sorting-associat...  53.9    1e-06   
ref|XP_006451365.1|  hypothetical protein CICLE_v10009534mg           53.5    2e-06   
ref|XP_010942547.1|  PREDICTED: vacuolar protein sorting-associat...  53.5    2e-06   
ref|XP_002466250.1|  hypothetical protein SORBIDRAFT_01g004370        53.1    2e-06   Sorghum bicolor [broomcorn]
ref|XP_007012940.1|  Vacuolar protein sorting-associated protein ...  53.5    3e-06   
ref|XP_010086896.1|  Vacuolar protein sorting-associated protein ...  53.9    3e-06   
ref|XP_006451366.1|  hypothetical protein CICLE_v10009534mg           53.1    3e-06   
gb|KDP33761.1|  hypothetical protein JCGZ_07332                       53.1    3e-06   
ref|XP_006580488.1|  PREDICTED: vacuolar protein sorting-associat...  52.4    4e-06   
ref|XP_007160256.1|  hypothetical protein PHAVU_002G305900g           52.8    4e-06   
gb|KHG25043.1|  VPS32.2: Vacuolar protein sorting-associated prot...  52.8    4e-06   
ref|XP_003525301.1|  PREDICTED: vacuolar protein sorting-associat...  52.4    5e-06   
gb|KHG10442.1|  Uncharacterized protein F383_09141                    52.0    7e-06   
ref|NP_001130288.1|  uncharacterized protein LOC100191382             52.0    7e-06   Zea mays [maize]
ref|XP_011008899.1|  PREDICTED: vacuolar protein sorting-associat...  52.0    8e-06   
ref|XP_002455955.1|  hypothetical protein SORBIDRAFT_03g027900        52.0    8e-06   Sorghum bicolor [broomcorn]
ref|XP_004287507.1|  PREDICTED: vacuolar protein sorting-associat...  51.6    1e-05   
ref|XP_011094781.1|  PREDICTED: vacuolar protein sorting-associat...  51.2    1e-05   
ref|XP_004503518.1|  PREDICTED: vacuolar protein sorting-associat...  51.2    2e-05   
ref|NP_001147424.1|  charged multivesicular body protein 4b           51.2    2e-05   Zea mays [maize]
ref|XP_010047627.1|  PREDICTED: vacuolar protein sorting-associat...  50.8    2e-05   
ref|XP_004513085.1|  PREDICTED: vacuolar protein sorting-associat...  50.8    2e-05   
ref|XP_009398754.1|  PREDICTED: vacuolar protein sorting-associat...  50.8    2e-05   
ref|XP_008673975.1|  PREDICTED: charged multivesicular body prote...  51.2    2e-05   
gb|AFK48250.1|  unknown                                               50.8    2e-05   
ref|XP_009399850.1|  PREDICTED: vacuolar protein sorting-associat...  50.4    3e-05   
ref|XP_006572922.1|  PREDICTED: vacuolar protein sorting-associat...  50.4    3e-05   
ref|NP_001130264.1|  uncharacterized protein LOC100191358             50.1    3e-05   Zea mays [maize]
ref|XP_011081721.1|  PREDICTED: vacuolar protein sorting-associat...  50.4    3e-05   
ref|NP_001241771.1|  charged multivesicular body protein 4b           50.1    4e-05   
ref|XP_006583569.1|  PREDICTED: vacuolar protein sorting-associat...  49.7    5e-05   
gb|KHN40351.1|  Vacuolar protein sorting-associated protein 32 li...  50.1    5e-05   
ref|XP_009394690.1|  PREDICTED: vacuolar protein sorting-associat...  49.7    5e-05   
ref|XP_007152939.1|  hypothetical protein PHAVU_004G173000g           49.3    7e-05   
ref|XP_010548688.1|  PREDICTED: vacuolar protein sorting-associat...  49.3    8e-05   
ref|XP_009610483.1|  PREDICTED: vacuolar protein sorting-associat...  49.3    9e-05   
ref|XP_004969169.1|  PREDICTED: vacuolar protein sorting-associat...  49.3    9e-05   
ref|XP_006340250.1|  PREDICTED: vacuolar protein sorting-associat...  48.9    1e-04   
ref|XP_006284502.1|  hypothetical protein CARUB_v10005703mg           48.9    1e-04   
gb|KCW44187.1|  hypothetical protein EUGRSUZ_L02392                   48.5    1e-04   
gb|KCW44188.1|  hypothetical protein EUGRSUZ_L02392                   48.5    1e-04   
ref|XP_011014015.1|  PREDICTED: vacuolar protein sorting-associat...  48.5    2e-04   
ref|XP_011016035.1|  PREDICTED: vacuolar protein sorting-associat...  48.5    2e-04   
ref|XP_009800252.1|  PREDICTED: vacuolar protein sorting-associat...  48.5    2e-04   
ref|XP_002514179.1|  Charged multivesicular body protein 4b, puta...  48.1    2e-04   Ricinus communis
ref|XP_004251182.1|  PREDICTED: vacuolar protein sorting-associat...  48.1    2e-04   
ref|XP_008337624.1|  PREDICTED: vacuolar protein sorting-associat...  47.8    3e-04   
ref|XP_009352595.1|  PREDICTED: vacuolar protein sorting-associat...  47.8    3e-04   
ref|XP_006601673.1|  PREDICTED: vacuolar protein sorting-associat...  46.2    3e-04   
ref|XP_004245128.1|  PREDICTED: vacuolar protein sorting-associat...  47.4    3e-04   
gb|ABK25827.1|  unknown                                               47.4    4e-04   Picea sitchensis
gb|ACG30556.1|  charged multivesicular body protein 4b                47.4    4e-04   Zea mays [maize]
ref|XP_006355308.1|  PREDICTED: vacuolar protein sorting-associat...  47.0    5e-04   
emb|CDP03214.1|  unnamed protein product                              47.0    5e-04   
ref|XP_010526425.1|  PREDICTED: vacuolar protein sorting-associat...  47.0    6e-04   
gb|AFK47195.1|  unknown                                               45.4    6e-04   
gb|EYU20388.1|  hypothetical protein MIMGU_mgv1a013694mg              47.0    6e-04   
dbj|BAJ91819.1|  predicted protein                                    46.6    6e-04   
ref|XP_008803193.1|  PREDICTED: vacuolar protein sorting-associat...  47.0    6e-04   
ref|XP_002281551.1|  PREDICTED: vacuolar protein sorting-associat...  47.0    6e-04   Vitis vinifera
gb|ACJ86115.1|  unknown                                               47.0    6e-04   Medicago truncatula
ref|XP_009586832.1|  PREDICTED: vacuolar protein sorting-associat...  46.6    6e-04   
gb|EMT15574.1|  Vacuolar protein sorting-associated 32-2-like pro...  46.2    7e-04   
ref|XP_006660479.1|  PREDICTED: vacuolar protein sorting-associat...  46.6    7e-04   
ref|XP_009395523.1|  PREDICTED: vacuolar protein sorting-associat...  46.6    7e-04   
dbj|BAK08135.1|  predicted protein                                    46.6    7e-04   
ref|XP_007227579.1|  hypothetical protein PRUPE_ppa011190mg           46.6    7e-04   



>ref|XP_009765362.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana sylvestris]
Length=218

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P V Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAVRQPARPIPQRRTAEED-------ELAALQAEMAL  218



>ref|XP_008459153.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008459161.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
 ref|XP_008459166.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Cucumis melo]
Length=218

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPA ST PA PV 
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEDLESAELEEQLLQPA-STAPAAPVS  187

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P     A+ +   RT E D       E+A LQ EMAL
Sbjct  188  VPAGRVPARPAPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_002283066.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN61998.1| hypothetical protein VITISV_007873 [Vitis vinifera]
 emb|CBI27961.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSTPIGSAADFDEDELEAELEELEGFELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+ +   RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQPARAAPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_004141038.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 ref|XP_004157906.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cucumis sativus]
 gb|KGN60554.1| hypothetical protein Csa_2G000620 [Cucumis sativus]
Length=218

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPA ST PA PV 
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEDLESAELEEQLLQPA-STAPAAPVS  187

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P     A+ +   RT E D       E+A LQ EMAL
Sbjct  188  VPGGRVPARPAPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_004239323.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Solanum lycopersicum]
Length=218

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P  +Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGKQPARPIPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_008782995.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=171

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+APLG+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  82   INEQTENMKQIQEALSAPLGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  140

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+ +    T E D       E+A LQ EMA+
Sbjct  141  VPAGRQQARPAPQKNTAEED-------ELAALQAEMAM  171



>ref|XP_010244367.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nelumbo nucifera]
 ref|XP_010244368.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nelumbo nucifera]
Length=218

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P   QS + +    T E D       E+A LQ EMAL
Sbjct  188  VPAGRQSTRPAPQKNTAEED-------ELAALQAEMAL  218



>ref|XP_008812733.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Phoenix dactylifera]
Length=218

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+ +    T E D       E+A LQ EMA+
Sbjct  188  VPAGRQQARPAPQKNTAEED-------ELAALQAEMAM  218



>ref|XP_010267087.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nelumbo nucifera]
Length=218

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQTSSR--TGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + + R  T E D       E+A LQ EMAL
Sbjct  188  VPAGRQPTRPAPRKNTAEED-------ELAALQAEMAL  218



>ref|XP_006584796.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Glycine max]
 ref|XP_006584797.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Glycine max]
 ref|XP_006584798.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Glycine max]
 gb|KHN16666.1| Vacuolar protein sorting-associated protein 32 like 1 [Glycine 
soja]
Length=218

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN+RQIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMRQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q     +S  T E D       E+A LQ EMAL
Sbjct  188  VPAGRQPTHPVSSKLTAEED-------ELAALQAEMAL  218



>ref|XP_006338191.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=218

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT+ + A PVH
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPATTAL-AAPVH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P  +Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGKQPARPIPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_006371958.1| hypothetical protein POPTR_0018s06680g [Populus trichocarpa]
 gb|ERP49755.1| hypothetical protein POPTR_0018s06680g [Populus trichocarpa]
Length=215

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 9/96 (9%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P  ++ A    RT E +       E+A LQ EMAL
Sbjct  188  VPAGKKPA-PKKRTAEEE-------ELADLQAEMAL  215



>ref|XP_009593196.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana tomentosiformis]
 ref|XP_009593197.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Nicotiana tomentosiformis]
Length=218

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T P  P+H
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPDAPIH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQPARPIPQRRTAEED-------ELAALQAEMAL  218



>ref|XP_006451365.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|ESR64605.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
Length=200

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 69/99 (70%), Gaps = 11/99 (11%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  110  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  168

Query  181  IPPVEQSAQ---TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+      RT E D       E+A LQ EMAL
Sbjct  169  VPAGRQQARPVPQKQRTAEED-------ELAALQAEMAL  200



>ref|XP_010942547.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Elaeis guineensis]
 ref|XP_010942548.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Elaeis guineensis]
Length=218

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +    T E D       E+A LQ EMA+
Sbjct  188  VPAGRQQVRPAPQKNTAEED-------ELAALQAEMAM  218



>ref|XP_002466250.1| hypothetical protein SORBIDRAFT_01g004370 [Sorghum bicolor]
 gb|EER93248.1| hypothetical protein SORBIDRAFT_01g004370 [Sorghum bicolor]
Length=191

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG+A DFDEDELEAEL+ L+  +LE QLL+P  +  P  PVH
Sbjct  102  INEQTENMKQIQDALSAPLGAAADFDEDELEAELEELEGAELESQLLEPVAAP-PMHPVH  160

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P  +Q A+ +    T E D       E+A LQ EMAL
Sbjct  161  VPANKQPARPAPQKATAEDD-------ELAALQAEMAL  191



>ref|XP_007012940.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 ref|XP_007012941.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 gb|EOY30559.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
 gb|EOY30560.1| Vacuolar protein sorting-associated protein 32 isoform 1 [Theobroma 
cacao]
Length=218

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA P+ 
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPIQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQPARPVPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_010086896.1| Vacuolar protein sorting-associated protein 32-2-like protein 
[Morus notabilis]
 gb|EXB24687.1| Vacuolar protein sorting-associated protein 32-2-like protein 
[Morus notabilis]
Length=283

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  194  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  252

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+     RT E D       E+A LQ EMAL
Sbjct  253  VPAGRQPARPVPQRRTAEED-------ELAALQAEMAL  283



>ref|XP_006451366.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 ref|XP_006451367.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 ref|XP_006475370.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Citrus sinensis]
 gb|ESR64606.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|ESR64607.1| hypothetical protein CICLE_v10009534mg [Citrus clementina]
 gb|KDO55910.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55911.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55912.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55913.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
 gb|KDO55914.1| hypothetical protein CISIN_1g027751mg [Citrus sinensis]
Length=219

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 69/99 (70%), Gaps = 11/99 (11%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQ---TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+      RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQQARPVPQKQRTAEED-------ELAALQAEMAL  219



>gb|KDP33761.1| hypothetical protein JCGZ_07332 [Jatropha curcas]
Length=218

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQPARPVPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_006580488.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Glycine max]
Length=191

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  102  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  160

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +  +S  T E D       E+A LQ EMAL
Sbjct  161  VPAGWQPTRPVSSKPTAEED-------ELAALQAEMAL  191



>ref|XP_007160256.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 ref|XP_007160257.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 gb|ESW32250.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
 gb|ESW32251.1| hypothetical protein PHAVU_002G305900g [Phaseolus vulgaris]
Length=218

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +  +S  T E D       E+A LQ EMAL
Sbjct  188  VPAGRQPTRPASSKPTAEED-------ELAALQAEMAL  218



>gb|KHG25043.1| VPS32.2: Vacuolar protein sorting-associated protein 32 2 [Gossypium 
arboreum]
Length=218

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ PLG+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSTPLGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQPARPIPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_003525301.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoformX2 [Glycine max]
 gb|KHM99831.1| Vacuolar protein sorting-associated protein 32 like 1 [Glycine 
soja]
Length=218

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +  +S  T E D       E+A LQ EMAL
Sbjct  188  VPAGWQPTRPVSSKPTAEED-------ELAALQAEMAL  218



>gb|KHG10442.1| Uncharacterized protein F383_09141 [Gossypium arboreum]
Length=218

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGSQPARPVPQKRTAEED-------ELAALQAEMAL  218



>ref|NP_001130288.1| uncharacterized protein LOC100191382 [Zea mays]
 ref|XP_008672012.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 ref|XP_008672013.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 ref|XP_008672014.1| PREDICTED: uncharacterized protein LOC100191382 isoform X1 [Zea 
mays]
 gb|ACF78462.1| unknown [Zea mays]
Length=222

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+ PLG++ DFDEDELEAEL+ L+  +LE QLL+P  + +P  PVH
Sbjct  133  INEQTENMKQIQDALSTPLGASADFDEDELEAELEELEGAELESQLLEP-VAALPVHPVH  191

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P  +Q A+ +    T E D       E+A LQ EMAL
Sbjct  192  VPGNKQPARPAPQKATAEDD-------ELAALQAEMAL  222



>ref|XP_011008899.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
 ref|XP_011008900.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
Length=215

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 9/96 (9%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV+
Sbjct  129  INEQTENMKQIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVY  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P  ++ A    RT E +       E+A LQ EMAL
Sbjct  188  VPAGKKPA-PQKRTAEEE-------ELADLQAEMAL  215



>ref|XP_002455955.1| hypothetical protein SORBIDRAFT_03g027900 [Sorghum bicolor]
 gb|EES01075.1| hypothetical protein SORBIDRAFT_03g027900 [Sorghum bicolor]
Length=222

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +  P  PVH
Sbjct  133  INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVAAP-PVHPVH  191

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P  +Q A+ +    T E D       E+A LQ EMAL
Sbjct  192  VPANKQPARPAPQKATAEDD-------ELAALQAEMAL  222



>ref|XP_004287507.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT   PA PV 
Sbjct  129  INEQTENMKQIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQPATQA-PAAPVQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+     RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQPARPLPQKRTAEED-------ELAALQAEMAL  218



>ref|XP_011094781.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
 ref|XP_011094857.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
 ref|XP_011094936.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=214

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 10/96 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVR  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q AQ      +         E+A LQ EMAL
Sbjct  188  VPAGRQPAQKVQNDDD---------ELAELQREMAL  214



>ref|XP_004503518.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Cicer arietinum]
 ref|XP_004503519.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Cicer arietinum]
 ref|XP_004503520.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X3 [Cicer arietinum]
 ref|XP_004503521.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X4 [Cicer arietinum]
Length=218

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT+T P +P+H
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPATTT-PESPMH  187

Query  181  IPPVEQSAQTSSR--TGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +  S   T E D       E+A LQ EMAL
Sbjct  188  VPAGRQPTRPVSVKPTAEED-------ELAALQAEMAL  218



>ref|NP_001147424.1| charged multivesicular body protein 4b [Zea mays]
 ref|XP_008673987.1| PREDICTED: charged multivesicular body protein 4b isoform X1 
[Zea mays]
 ref|XP_008673991.1| PREDICTED: charged multivesicular body protein 4b isoform X1 
[Zea mays]
 gb|ACF81163.1| unknown [Zea mays]
 gb|ACF87539.1| unknown [Zea mays]
 gb|ACG27468.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACN28696.1| unknown [Zea mays]
Length=222

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG+  DFDEDELEAEL+ L+  +LE QLL+P  +  P  PVH
Sbjct  133  INEQTENMKQIQDALSAPLGAFADFDEDELEAELEELEGAELESQLLEPVAAP-PVHPVH  191

Query  181  IPPVEQSAQTSSR--TGERDkekeeeeeVATLQTEMAL  288
            +P  +Q A+ + +  T E D       E+A LQ EMAL
Sbjct  192  VPANKQPARPAPQKVTAEDD-------ELAALQAEMAL  222



>ref|XP_010047627.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Eucalyptus grandis]
 gb|KCW79566.1| hypothetical protein EUGRSUZ_C00934 [Eucalyptus grandis]
 gb|KCW79567.1| hypothetical protein EUGRSUZ_C00934 [Eucalyptus grandis]
Length=219

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 70/105 (67%), Gaps = 23/105 (22%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IP---------PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P         PV Q      RT E D       E+A LQ EMAL
Sbjct  188  VPTGPGPRPARPVPQ------RTAEED-------ELAALQAEMAL  219



>ref|XP_004513085.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Cicer arietinum]
Length=219

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  130  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  188

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +   +  T E D       E+A LQ EMAL
Sbjct  189  VPAGRQPTRPVPAKPTPEED-------ELAALQAEMAL  219



>ref|XP_009398754.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398755.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398756.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
 ref|XP_009398757.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Musa acuminata subsp. malaccensis]
Length=218

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 69/103 (67%), Gaps = 20/103 (19%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IP-------PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P       PV Q       T E D       E+A LQ EMA+
Sbjct  188  VPAGRVPARPVPQ-----KNTAEED-------ELAALQAEMAM  218



>ref|XP_008673975.1| PREDICTED: charged multivesicular body protein 4b isoform X2 
[Zea mays]
 ref|XP_008673980.1| PREDICTED: charged multivesicular body protein 4b isoform X2 
[Zea mays]
 gb|ACF83653.1| unknown [Zea mays]
Length=251

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG+  DFDEDELEAEL+ L+  +LE QLL+P  +  P  PVH
Sbjct  162  INEQTENMKQIQDALSAPLGAFADFDEDELEAELEELEGAELESQLLEPVAAP-PVHPVH  220

Query  181  IPPVEQSAQTSSR--TGERDkekeeeeeVATLQTEMAL  288
            +P  +Q A+ + +  T E D       E+A LQ EMAL
Sbjct  221  VPANKQPARPAPQKVTAEDD-------ELAALQAEMAL  251



>gb|AFK48250.1| unknown [Lotus japonicus]
Length=218

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 69/101 (68%), Gaps = 16/101 (16%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA  VH
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAASVH  187

Query  181  IPPVEQ-----SAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q     SA+T+    E          +A LQ EMAL
Sbjct  188  VPAGRQPTRPVSAKTTPEEDE----------LAALQAEMAL  218



>ref|XP_009399850.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009399858.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFD+DELEAEL+ L+  +LEEQLLQPAT T P+ PVH
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDDDELEAELEELEGAELEEQLLQPAT-TAPSAPVH  187

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P     A+ +    T E D       E+A LQ EMA+
Sbjct  188  VPAGRVPARLAPQKNTAEED-------ELAALQAEMAM  218



>ref|XP_006572922.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X1 [Glycine max]
 ref|XP_006572923.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like isoform X2 [Glycine max]
 gb|KHN32901.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=218

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQDALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P  +Q  +   + RT E D       E+A LQ EMAL
Sbjct  188  VPAGQQPTRPVPAKRTPEED-------ELAALQAEMAL  218



>ref|NP_001130264.1| uncharacterized protein LOC100191358 [Zea mays]
 gb|ACF78433.1| unknown [Zea mays]
Length=196

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +  P  PVH
Sbjct  107  INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVAAP-PVHPVH  165

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
             P  +Q A+ +    T E D       E+A LQ EMAL
Sbjct  166  APANKQPARPAPQKATAEDD-------ELAALQAEMAL  196



>ref|XP_011081721.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Sesamum indicum]
Length=214

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 67/100 (67%), Gaps = 18/100 (18%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  187

Query  181  IP----PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P    PV++ A                  +A LQ EMAL
Sbjct  188  VPAGRQPVKKVADEDDE-------------LAELQREMAL  214



>ref|NP_001241771.1| charged multivesicular body protein 4b [Zea mays]
 ref|XP_008654219.1| PREDICTED: uncharacterized protein LOC100191358 isoform X1 [Zea 
mays]
 ref|XP_008654220.1| PREDICTED: uncharacterized protein LOC100191358 isoform X1 [Zea 
mays]
 gb|ACG36930.1| charged multivesicular body protein 4b [Zea mays]
 gb|ACN31860.1| unknown [Zea mays]
 gb|AFW83261.1| putative SNF domain containing family protein isoform 1 [Zea 
mays]
 gb|AFW83262.1| putative SNF domain containing family protein isoform 2 [Zea 
mays]
 gb|AFW83263.1| putative SNF domain containing family protein isoform 3 [Zea 
mays]
Length=222

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +  P  PVH
Sbjct  133  INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVAAP-PVHPVH  191

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
             P  +Q A+ +    T E D       E+A LQ EMAL
Sbjct  192  APANKQPARPAPQKATAEDD-------ELAALQAEMAL  222



>ref|XP_006583569.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Glycine max]
Length=218

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQDALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +   + RT E D       E+A LQ EMAL
Sbjct  188  VPAGRQPTRPVPAKRTPEED-------ELAALQAEMAL  218



>gb|KHN40351.1| Vacuolar protein sorting-associated protein 32 like 2 [Glycine 
soja]
Length=241

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  152  INEQTENMKQIQDALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  210

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +   + RT E D       E+A LQ EMAL
Sbjct  211  VPAGRQPTRPVPAKRTPEED-------ELAALQAEMAL  241



>ref|XP_009394690.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G A+DFDEDELEAEL+ L+  +LEEQLLQPAT T P  PVH
Sbjct  129  INEQTENMKQIQEALSAPVGPAIDFDEDELEAELEELEGAELEEQLLQPAT-TAPLLPVH  187

Query  181  IP--PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P  P          T E D       E+ATLQ EMA+
Sbjct  188  VPASPSPTRPADQKNTTEED-------ELATLQAEMAM  218



>ref|XP_007152939.1| hypothetical protein PHAVU_004G173000g [Phaseolus vulgaris]
 gb|ESW24933.1| hypothetical protein PHAVU_004G173000g [Phaseolus vulgaris]
Length=218

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQ+AL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT+T PA PVH
Sbjct  129  INEQTENMKMIQDALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPATTT-PAAPVH  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +   +  T E D       E+A LQ EMAL
Sbjct  188  VPAGRQPTRPVAAKPTPEED-------ELAALQAEMAL  218



>ref|XP_010548688.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Tarenaya hassleriana]
 ref|XP_010548689.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Tarenaya hassleriana]
Length=220

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 11/99 (11%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA  V 
Sbjct  130  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAATVS  188

Query  181  IPPVEQSAQTSS---RTGERDkekeeeeeVATLQTEMAL  288
            +P   Q+A+ ++   RT E D       E+A LQ EMAL
Sbjct  189  VPAGRQTARPAAQKQRTEEED-------ELAALQAEMAL  220



>ref|XP_009610483.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
 ref|XP_009610484.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
 ref|XP_009610485.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=216

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQEALA P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT T P  P++
Sbjct  129  INEQTENMKLIQEALATPIGSAADFDEDELEAELEELEGAELEEQLLQPAT-TAPVAPIN  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +++  E D       E+A LQ EMAL
Sbjct  188  VPAGRQQVRPAAQKTEED-------ELAALQAEMAL  216



>ref|XP_004969169.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Setaria italica]
Length=221

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 66/102 (65%), Gaps = 19/102 (19%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +  P  PVH
Sbjct  133  INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVAAP-PVHPVH  191

Query  181  IP------PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P      P  Q A     T E D       E+A LQ EMAL
Sbjct  192  VPTKQPARPAPQKA-----TAEDD-------ELAALQAEMAL  221



>ref|XP_006340250.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=218

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 12/99 (12%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T P+ P+H
Sbjct  129  INEQTENMKMIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPSAPIH  187

Query  181  IPPVEQS---AQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q    A   SRT E +        +A LQ EMAL
Sbjct  188  LPAGRQQVRPAAQHSRTEEDE--------LAALQAEMAL  218



>ref|XP_006284502.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 ref|XP_006284503.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 gb|EOA17400.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
 gb|EOA17401.1| hypothetical protein CARUB_v10005703mg [Capsella rubella]
Length=218

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAELD L+  +LEEQLLQP T+T P   V 
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELDELEGAELEEQLLQP-TTTAPLPSVP  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q+A+     RT E +       E+A LQ EMAL
Sbjct  188  VPAGRQTARPVPQKRTAEEE-------ELAALQAEMAL  218



>gb|KCW44187.1| hypothetical protein EUGRSUZ_L02392 [Eucalyptus grandis]
Length=206

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  130  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  188

Query  181  IPPVEQSA  204
            +P    SA
Sbjct  189  VPNWSWSA  196



>gb|KCW44188.1| hypothetical protein EUGRSUZ_L02392 [Eucalyptus grandis]
Length=213

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PVH
Sbjct  137  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVH  195

Query  181  IPPVEQSA  204
            +P    SA
Sbjct  196  VPNWSWSA  203



>ref|XP_011014015.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
 ref|XP_011014016.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Populus euphratica]
Length=215

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 69/100 (69%), Gaps = 17/100 (17%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IP----PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P    PV Q      RT E +       E+A LQ EMAL
Sbjct  188  VPTGKKPVPQ-----KRTAEEE-------ELANLQAEMAL  215



>ref|XP_011016035.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Populus euphratica]
Length=215

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 69/100 (69%), Gaps = 17/100 (17%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IP----PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P    PV Q      RT E +       E+A LQ EMAL
Sbjct  188  VPTGKKPVPQ-----KRTAEEE-------ELANLQAEMAL  215



>ref|XP_009800252.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
 ref|XP_009800253.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana sylvestris]
Length=216

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT T P  P++
Sbjct  129  INEQTENMKMIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQPAT-TAPVAPIN  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +++  E D       E+A LQ EMAL
Sbjct  188  LPAGRQQVRPAAQKTEED-------ELAALQAEMAL  216



>ref|XP_002514179.1| Charged multivesicular body protein 4b, putative [Ricinus communis]
 gb|EEF48133.1| Charged multivesicular body protein 4b, putative [Ricinus communis]
Length=218

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQ--TSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  +     +T E D       E+A LQ EMAL
Sbjct  188  VPAGRQPNRPAAQKQTAEED-------ELAALQAEMAL  218



>ref|XP_004251182.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
 ref|XP_010313446.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
 ref|XP_010313447.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum lycopersicum]
Length=218

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 12/99 (12%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT+  P+ P+H
Sbjct  129  INEQTENMKMIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPATAA-PSAPIH  187

Query  181  IPPVEQS---AQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q    A   SRT E +        +A LQ EMAL
Sbjct  188  MPAGRQQVRPAAQHSRTEEDE--------LAALQAEMAL  218



>ref|XP_008337624.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008337625.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
 ref|XP_008337626.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Malus domestica]
Length=221

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT   PA PV 
Sbjct  132  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPATQA-PAAPVQ  190

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +   RT E D       E+A LQ EMAL
Sbjct  191  VPAGRQPTRPAPQRRTEEED-------ELAALQAEMAL  221



>ref|XP_009352595.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
 ref|XP_009352596.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Pyrus x bretschneideri]
Length=221

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT   PA PV 
Sbjct  132  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPATQA-PAAPVQ  190

Query  181  IPPVEQSAQTS--SRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +   RT E D       E+A LQ EMAL
Sbjct  191  VPAGRQPTRPAPQRRTEEED-------ELAALQAEMAL  221



>ref|XP_006601673.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Glycine max]
Length=135

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 10/98 (10%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ AL+ P+G+   F+ED+LE EL+ L+  +LEEQLLQPAT T P   VH
Sbjct  46   INEQTENMKQIQVALSTPIGATTYFNEDKLEVELEDLEGVELEEQLLQPAT-TAPTATVH  104

Query  181  IPPVEQSAQTSSR--TGERDkekeeeeeVATLQTEMAL  288
            +P   Q  ++ S   T E D       E+A LQ +MAL
Sbjct  105  VPAGLQPTRSVSSKPTTEED-------ELAALQDKMAL  135



>ref|XP_004245128.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Solanum lycopersicum]
Length=216

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT T P  P++
Sbjct  129  INEQTENMKLIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQPAT-TAPVAPIN  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +++  E D       E+A LQ EMAL
Sbjct  188  LPAGRQQVRPAAQKTEED-------ELAALQAEMAL  216



>gb|ABK25827.1| unknown [Picea sitchensis]
 gb|ACN40190.1| unknown [Picea sitchensis]
 gb|ACN40855.1| unknown [Picea sitchensis]
Length=217

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 66/96 (69%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  DLEEQLLQPA  T PA  V 
Sbjct  130  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGADLEEQLLQPAV-TAPA--VQ  186

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
              P  Q     +R   R+     E+E+A LQ EMAL
Sbjct  187  YTPASQQLARPTRQQARE-----EDELAALQAEMAL  217



>gb|ACG30556.1| charged multivesicular body protein 4b [Zea mays]
Length=208

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+ PLG++ DFDEDELEAEL+ L+  +LE QLL+P  + +P  PVH
Sbjct  133  INEQTENMKQIQDALSTPLGASADFDEDELEAELEELEGAELESQLLEP-VAALPVHPVH  191

Query  181  IPPVEQSAQ  207
            +P  +Q A+
Sbjct  192  VPGNKQPAR  200



>ref|XP_006355308.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Solanum tuberosum]
Length=216

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQPAT T P  P++
Sbjct  129  INEQTENMKLIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQPAT-TAPNAPIN  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +++  E D       E+A LQ EMAL
Sbjct  188  LPAGRQQVRPAAQKTEED-------ELAALQAEMAL  216



>emb|CDP03214.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 67/107 (63%), Gaps = 26/107 (24%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEALA P+G+A DFDEDELEAEL+ L+  +LEEQLLQPA +T PA PVH
Sbjct  129  INEQTENMKQIQEALATPIGAAADFDEDELEAELEELEGAELEEQLLQPAINT-PAAPVH  187

Query  181  IP-----------PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
             P           P +QSA+                 +A LQ EMAL
Sbjct  188  APTPAGRQPARPAPQKQSAEEDE--------------LAALQAEMAL  220



>ref|XP_010526425.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526426.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526428.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526429.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
 ref|XP_010526430.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Tarenaya hassleriana]
Length=220

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 11/99 (11%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA  V 
Sbjct  130  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAATVP  188

Query  181  IPPVEQSAQTSS---RTGERDkekeeeeeVATLQTEMAL  288
            +P   Q A+ ++   RT E D       E+A LQ EMAL
Sbjct  189  MPAGRQPARPAAQKQRTDEED-------ELAALQAEMAL  220



>gb|AFK47195.1| unknown [Medicago truncatula]
Length=107

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQE L+AP+G+A DFDEDELEAEL+ L+  +LEEQL QPA +T P   VH
Sbjct  20   INEQTENMKQIQELLSAPIGAAADFDEDELEAELEELEGAELEEQLFQPAITT-PEASVH  78

Query  181  IP  186
            +P
Sbjct  79   VP  80



>gb|EYU20388.1| hypothetical protein MIMGU_mgv1a013694mg [Erythranthe guttata]
 gb|EYU20389.1| hypothetical protein MIMGU_mgv1a013694mg [Erythranthe guttata]
Length=213

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 63/96 (66%), Gaps = 11/96 (11%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T P  PV 
Sbjct  129  INEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPDGPVR  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            IP   Q  +      E          +A LQ EMAL
Sbjct  188  IPAGRQPVKVEDDDDE----------LAELQREMAL  213



>dbj|BAJ91819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 16/101 (16%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +     P+H
Sbjct  93   INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVVT----IPIH  148

Query  181  IPPVEQSAQTS-----SRTGERDkekeeeeeVATLQTEMAL  288
              PV   AQ +       + E D       E+A LQ EMAL
Sbjct  149  TAPVPGKAQPTRPAPQKASAEED-------ELAALQAEMAL  182



>ref|XP_008803193.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803194.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803195.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
 ref|XP_008803197.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Phoenix dactylifera]
Length=219

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 11/99 (11%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T PA PV 
Sbjct  129  INEQTENMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPAAPVQ  187

Query  181  IPPVEQSAQT---SSRTGERDkekeeeeeVATLQTEMAL  288
              PV +          T E D       E+A LQ EMAL
Sbjct  188  YVPVGRQPTRPAPQKNTAEED-------ELAALQAEMAL  219



>ref|XP_002281551.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654573.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654574.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 ref|XP_010654575.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2 [Vitis vinifera]
 emb|CAN76335.1| hypothetical protein VITISV_021984 [Vitis vinifera]
Length=220

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQEAL+ P+GSA DFDEDELEAEL+ L+  +LEEQLLQP T+T PA PV 
Sbjct  131  INEQTENMKQIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQP-TTTAPAAPVS  189

Query  181  IPPVEQSAQ  207
            IP   Q A+
Sbjct  190  IPAARQPAR  198



>gb|ACJ86115.1| unknown [Medicago truncatula]
 gb|AFK44534.1| unknown [Medicago truncatula]
Length=221

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 11/98 (11%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            + EQTE +RQ+QEAL+AP+G A D+DEDELEAEL+ L+  +LEEQL QP T T PA PVH
Sbjct  133  ITEQTEKMRQVQEALSAPIGPA-DYDEDELEAELEELEGAELEEQLFQP-TITTPAAPVH  190

Query  181  IPPVEQSAQTSSR--TGERDkekeeeeeVATLQTEMAL  288
            +P  +Q     S   T E D       E+A LQ EMAL
Sbjct  191  VPAGQQHTHPVSVKPTAEED-------ELAKLQAEMAL  221



>ref|XP_009586832.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Nicotiana tomentosiformis]
Length=218

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++ IQEAL+ P+G+A DFDEDELEAEL+ L+  +LEEQLLQPAT T P+ P+H
Sbjct  129  INEQTENMKMIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPAT-TAPSAPIH  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P   Q  + +++  + +     E+E+A LQ EMAL
Sbjct  188  LPAGRQQVRPAAQQNKAE-----EDELAALQAEMAL  218



>gb|EMT15574.1| Vacuolar protein sorting-associated 32-2-like protein [Aegilops 
tauschii]
Length=186

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 16/101 (16%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +     P+H
Sbjct  97   INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVVT----IPIH  152

Query  181  IPPVEQSAQTS-----SRTGERDkekeeeeeVATLQTEMAL  288
              PV   AQ +       + E D       E+A LQ EMAL
Sbjct  153  TTPVPGKAQPTRPAPQKASAEED-------ELAALQAEMAL  186



>ref|XP_006660479.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Oryza brachyantha]
Length=218

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 66/101 (65%), Gaps = 18/101 (18%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +  P  PV 
Sbjct  131  INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVAAP-PVHPVQ  189

Query  181  IP-----PVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P     PV Q A     + E D       E+A LQ EMAL
Sbjct  190  VPTRPNRPVPQKA-----SAEED-------ELAALQAEMAL  218



>ref|XP_009395523.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395524.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395525.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395526.1| PREDICTED: vacuolar protein sorting-associated protein 32 homolog 
2-like [Musa acuminata subsp. malaccensis]
Length=218

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 6/96 (6%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTE+++QIQEAL+AP+G A DFDEDELEAEL+ L+   LEEQ+LQ AT T PA PV 
Sbjct  129  INEQTESMKQIQEALSAPIGGAADFDEDELEAELEELEGLKLEEQVLQTAT-TAPAPPVQ  187

Query  181  IPPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +P V    Q        D      +E A LQ EMA+
Sbjct  188  VPAVRIPTQPVPHKNTSD-----ADEFAALQAEMAM  218



>dbj|BAK08135.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89470.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=220

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 16/101 (16%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +NEQTEN++QIQ+AL+APLG++ DFDEDELEAEL+ L+  +LE QLL+P  +     P+H
Sbjct  131  INEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPVVT----IPIH  186

Query  181  IPPVEQSAQTS-----SRTGERDkekeeeeeVATLQTEMAL  288
              PV   AQ +       + E D       E+A LQ EMAL
Sbjct  187  TAPVPGKAQPTRPAPQKASAEED-------ELAALQAEMAL  220



>ref|XP_007227579.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
 gb|EMJ28778.1| hypothetical protein PRUPE_ppa011190mg [Prunus persica]
Length=220

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 70/98 (71%), Gaps = 8/98 (8%)
 Frame = +1

Query  1    VNEQTENIRQIQEALAAPLGSAVdfdedeleaeldalkiddleeQLLQPATSTIPATPVH  180
            +N+QTE+++QIQEAL+AP+G+A DFDEDELEAEL+ L+  +LEE+L QPAT T PA  VH
Sbjct  129  INDQTESMKQIQEALSAPIGAAADFDEDELEAELEELEGAELEEELFQPAT-TAPAATVH  187

Query  181  I--PPVEQSAQTSSRTGERDkekeeeeeVATLQTEMAL  288
            +  P   Q  Q + +   RD     E+E+A LQ EMAL
Sbjct  188  VNAPVGRQPTQPAPQRNNRD-----EDELAALQAEMAL  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520238967072