BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c113651_g1_i1 len=190 path=[1:0-189]

Length=190
                                                                      Score     E

ref|XP_006594457.1|  PREDICTED: uncharacterized protein LOC100819...    118   5e-29   
gb|KHN37531.1|  Pyrimidine-specific ribonucleoside hydrolase rihA       118   5e-29   
ref|XP_006594456.1|  PREDICTED: uncharacterized protein LOC100819...    118   5e-29   
gb|AES91756.2|  inosine-uridine preferring nucleoside hydrolase         115   6e-28   
gb|KHN37530.1|  Pyrimidine-specific ribonucleoside hydrolase rihA       115   6e-28   
gb|KDP40052.1|  hypothetical protein JCGZ_02050                         115   6e-28   
ref|XP_003609559.1|  Non-specific ribonucleoside hydrolase rihC         115   6e-28   
ref|XP_010558508.1|  PREDICTED: uncharacterized protein LOC104827...    115   7e-28   
ref|XP_010558509.1|  PREDICTED: uncharacterized protein LOC104827...    115   1e-27   
ref|XP_007147841.1|  hypothetical protein PHAVU_006G1594001g            111   2e-27   
ref|XP_007147840.1|  hypothetical protein PHAVU_006G1594001g            111   3e-27   
ref|XP_007147839.1|  hypothetical protein PHAVU_006G1594001g            110   3e-27   
ref|XP_009352319.1|  PREDICTED: uncharacterized protein LOC103943704    113   4e-27   
gb|KHG23714.1|  Pyrimidine-specific ribonucleoside hydrolase rihA       110   4e-27   
gb|EYU43866.1|  hypothetical protein MIMGU_mgv1a025646mg                113   4e-27   
ref|XP_011006093.1|  PREDICTED: uncharacterized protein LOC105112...    112   5e-27   
ref|XP_008360311.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   6e-27   
ref|XP_006594458.1|  PREDICTED: uncharacterized protein LOC100819...    112   7e-27   
ref|XP_007154207.1|  hypothetical protein PHAVU_003G099100g             112   7e-27   
gb|KFK24302.1|  hypothetical protein AALP_AAs66884U000100               110   9e-27   
ref|XP_011006091.1|  PREDICTED: uncharacterized protein LOC105112...    112   1e-26   
ref|XP_011006092.1|  PREDICTED: uncharacterized protein LOC105112...    112   1e-26   
ref|XP_006380040.1|  inosine-uridine preferring nucleoside hydrol...    112   1e-26   
ref|XP_007225500.1|  hypothetical protein PRUPE_ppa001181mg             111   1e-26   
gb|KHG17802.1|  Pyrimidine-specific ribonucleoside hydrolase rihA       111   2e-26   
ref|NP_197390.1|  Inosine-uridine preferring nucleoside hydrolase...    109   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223073.1|  PREDICTED: uncharacterized protein LOC103322899    111   2e-26   
ref|XP_007035420.1|  Inosine-uridine preferring nucleoside hydrol...    110   2e-26   
gb|KHN03406.1|  Pyrimidine-specific ribonucleoside hydrolase rihA       110   3e-26   
ref|XP_003550523.1|  PREDICTED: uncharacterized protein LOC100788041    110   3e-26   
gb|KHN03019.1|  Inosine-uridine preferring nucleoside hydrolase         110   3e-26   
ref|XP_007035419.1|  Inosine-uridine preferring nucleoside hydrol...    110   3e-26   
ref|XP_010105673.1|  hypothetical protein L484_011284                   110   5e-26   
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    110   7e-26   
ref|XP_010546906.1|  PREDICTED: uncharacterized protein LOC104818...    109   8e-26   
ref|XP_006489269.1|  PREDICTED: uncharacterized protein LOC102620115    109   1e-25   
ref|XP_003541647.1|  PREDICTED: uncharacterized protein LOC100819865    108   1e-25   
ref|XP_006419733.1|  hypothetical protein CICLE_v10004275mg             108   1e-25   
ref|XP_010546907.1|  PREDICTED: uncharacterized protein LOC104818...    108   1e-25   
gb|KDO74955.1|  hypothetical protein CISIN_1g003674mg                   108   1e-25   
ref|XP_011011453.1|  PREDICTED: uncharacterized protein LOC105116...    108   2e-25   
ref|XP_004229485.1|  PREDICTED: uncharacterized protein LOC101244900    108   2e-25   
ref|XP_011011456.1|  PREDICTED: uncharacterized protein LOC105116...    108   2e-25   
ref|XP_002871849.1|  inosine-uridine preferring nucleoside hydrol...    107   2e-25   
ref|XP_009607061.1|  PREDICTED: uncharacterized protein LOC104101328    108   2e-25   
ref|XP_002311814.2|  hypothetical protein POPTR_0008s20200g             108   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010649815.1|  PREDICTED: uncharacterized protein LOC100263026    107   3e-25   
ref|XP_004486297.1|  PREDICTED: uncharacterized protein LOC101496568    107   3e-25   
ref|XP_009774488.1|  PREDICTED: uncharacterized protein LOC104224...    107   3e-25   
ref|XP_009774487.1|  PREDICTED: uncharacterized protein LOC104224...    107   3e-25   
ref|XP_011090885.1|  PREDICTED: uncharacterized protein LOC105171...    107   4e-25   
ref|XP_011090884.1|  PREDICTED: uncharacterized protein LOC105171...    107   4e-25   
ref|XP_004298086.1|  PREDICTED: uncharacterized protein LOC101302065    107   4e-25   
ref|XP_011090886.1|  PREDICTED: uncharacterized protein LOC105171...    107   4e-25   
emb|CDY13927.1|  BnaC09g38990D                                          107   5e-25   
ref|XP_002516835.1|  inosine-uridine preferring nucleoside hydrol...    107   6e-25   Ricinus communis
ref|XP_006400442.1|  hypothetical protein EUTSA_v10012637mg             107   7e-25   
ref|XP_008347819.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    106   7e-25   
ref|XP_004229568.1|  PREDICTED: uncharacterized protein LOC101247751    106   1e-24   
ref|XP_003609561.1|  Pyrimidine-specific ribonucleoside hydrolase...    106   1e-24   
ref|XP_010025129.1|  PREDICTED: uncharacterized protein LOC104415...    105   1e-24   
ref|XP_008357556.1|  PREDICTED: uncharacterized protein LOC103421...    105   1e-24   
ref|XP_006365268.1|  PREDICTED: uncharacterized protein LOC102590399    106   1e-24   
ref|XP_004229486.1|  PREDICTED: uncharacterized protein LOC101245...    106   1e-24   
ref|XP_010322993.1|  PREDICTED: uncharacterized protein LOC101245...    106   1e-24   
ref|XP_009369077.1|  PREDICTED: uncharacterized protein LOC103958...    106   1e-24   
ref|XP_009369078.1|  PREDICTED: uncharacterized protein LOC103958...    105   1e-24   
ref|XP_008357555.1|  PREDICTED: uncharacterized protein LOC103421...    105   1e-24   
ref|XP_006287032.1|  hypothetical protein CARUB_v10000179mg             105   2e-24   
ref|XP_009607062.1|  PREDICTED: uncharacterized protein LOC104101329    104   6e-24   
ref|XP_004296774.1|  PREDICTED: uncharacterized protein LOC101313205    103   7e-24   
ref|XP_010024480.1|  PREDICTED: uncharacterized protein LOC104414...    103   8e-24   
ref|XP_002871847.1|  predicted protein                                  103   9e-24   
gb|KFK26124.1|  hypothetical protein AALP_AA8G206800                    103   9e-24   
ref|XP_004508326.1|  PREDICTED: uncharacterized protein LOC101511066    103   1e-23   
ref|XP_004134177.1|  PREDICTED: uncharacterized protein LOC101216049    103   1e-23   
emb|CDY47186.1|  BnaAnng08560D                                          100   1e-23   
ref|XP_008438766.1|  PREDICTED: uncharacterized protein LOC103483...    103   1e-23   
ref|XP_010420664.1|  PREDICTED: uncharacterized protein LOC104706201    103   2e-23   
ref|XP_008438767.1|  PREDICTED: uncharacterized protein LOC103483...    102   2e-23   
emb|CDX92576.1|  BnaA10g16150D                                          102   2e-23   
ref|XP_010693771.1|  PREDICTED: uncharacterized protein LOC104906683    102   2e-23   
ref|XP_009120935.1|  PREDICTED: uncharacterized protein LOC103845800    102   2e-23   
gb|KEH32264.1|  inosine-uridine preferring nucleoside hydrolase         101   4e-23   
ref|NP_197387.1|  nucleoside hydrolase 3                                101   4e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDO98943.1|  unnamed protein product                                101   5e-23   
gb|KFK26123.1|  hypothetical protein AALP_AA8G206700                    101   6e-23   
gb|KDP23570.1|  hypothetical protein JCGZ_23403                         101   7e-23   
ref|XP_010454139.1|  PREDICTED: uncharacterized protein LOC104735943    101   7e-23   
ref|XP_010492928.1|  PREDICTED: uncharacterized protein LOC104770...    100   8e-23   
ref|XP_006857013.1|  hypothetical protein AMTR_s00197p00032700          100   8e-23   
ref|XP_010024478.1|  PREDICTED: uncharacterized protein LOC104414...    100   8e-23   
gb|KCW61722.1|  hypothetical protein EUGRSUZ_H04434                     100   1e-22   
ref|XP_006356996.1|  PREDICTED: uncharacterized protein LOC102590451    100   1e-22   
ref|XP_010025128.1|  PREDICTED: uncharacterized protein LOC104415...    100   1e-22   
ref|XP_010687819.1|  PREDICTED: uncharacterized protein LOC104901895    100   1e-22   
ref|XP_010025127.1|  PREDICTED: uncharacterized protein LOC104415...    100   1e-22   
ref|XP_010279299.1|  PREDICTED: uncharacterized protein LOC104613...  99.8    2e-22   
ref|XP_010279283.1|  PREDICTED: uncharacterized protein LOC104613...    100   2e-22   
ref|XP_006286427.1|  hypothetical protein CARUB_v10003350mg             100   2e-22   
ref|XP_010492926.1|  PREDICTED: uncharacterized protein LOC104770...  99.8    2e-22   
ref|XP_010492925.1|  PREDICTED: uncharacterized protein LOC104770...  99.8    2e-22   
emb|CDY02599.1|  BnaC02g08360D                                        99.0    4e-22   
gb|KDO48505.1|  hypothetical protein CISIN_1g0037942mg                98.6    6e-22   
ref|XP_006433230.1|  hypothetical protein CICLE_v10003811mg           98.6    6e-22   
ref|XP_006480259.1|  PREDICTED: uncharacterized protein LOC102619994  98.6    6e-22   
ref|XP_004229495.1|  PREDICTED: uncharacterized protein LOC101247...  98.6    6e-22   
ref|XP_010323037.1|  PREDICTED: uncharacterized protein LOC101247...  98.2    6e-22   
gb|KEH36722.1|  inosine-uridine preferring nucleoside hydrolase       97.8    1e-21   
gb|AES64298.2|  inosine-uridine preferring nucleoside hydrolase       97.8    1e-21   
ref|XP_003594047.1|  Pyrimidine-specific ribonucleoside hydrolase...  97.8    1e-21   
gb|KEH36723.1|  inosine-uridine preferring nucleoside hydrolase       97.1    2e-21   
ref|XP_010242573.1|  PREDICTED: uncharacterized protein LOC104586891  96.7    3e-21   
ref|XP_010102681.1|  hypothetical protein L484_002096                 96.3    4e-21   
gb|KGN66123.1|  hypothetical protein Csa_1G572440                     95.9    5e-21   
ref|XP_010660036.1|  PREDICTED: uncharacterized protein LOC100245...  95.5    5e-21   
ref|XP_008450714.1|  PREDICTED: uncharacterized protein LOC103492...  95.9    5e-21   
ref|XP_008450713.1|  PREDICTED: uncharacterized protein LOC103492...  95.9    6e-21   
ref|XP_007030760.1|  Inosine-uridine preferring nucleoside hydrol...  92.8    7e-20   
ref|XP_010660033.1|  PREDICTED: uncharacterized protein LOC100245...  92.0    1e-19   
ref|XP_010660034.1|  PREDICTED: uncharacterized protein LOC100245...  92.0    1e-19   
ref|XP_010660035.1|  PREDICTED: uncharacterized protein LOC100245...  92.0    1e-19   
emb|CBI34322.3|  unnamed protein product                              92.0    1e-19   
ref|XP_008246540.1|  PREDICTED: uncharacterized protein LOC103344698  91.3    2e-19   
ref|XP_007208173.1|  hypothetical protein PRUPE_ppa001219mg           90.5    4e-19   
gb|AAT38027.1|  putative inosine-uridine preferring nucleoside hy...  82.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85087.1|  putative inosine-uridine preferring nucleoside hy...  82.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010904834.1|  PREDICTED: uncharacterized protein LOC105032165  82.8    2e-16   
ref|XP_009373945.1|  PREDICTED: uncharacterized protein LOC103962...  82.4    3e-16   
ref|XP_009373944.1|  PREDICTED: uncharacterized protein LOC103962...  82.4    3e-16   
ref|NP_001055512.1|  Os05g0406100                                     82.4    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009373947.1|  PREDICTED: uncharacterized protein LOC103962...  82.4    3e-16   
ref|XP_008388984.1|  PREDICTED: uncharacterized protein LOC103451348  82.4    3e-16   
ref|XP_009373946.1|  PREDICTED: uncharacterized protein LOC103962...  82.0    3e-16   
gb|EMS45992.1|  hypothetical protein TRIUR3_02299                     82.4    3e-16   
gb|EEE63686.1|  hypothetical protein OsJ_18504                        81.3    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79209.1|  hypothetical protein OsI_19926                        81.3    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006655311.1|  PREDICTED: uncharacterized protein LOC102712817  79.7    2e-15   
ref|XP_004962124.1|  PREDICTED: uncharacterized protein LOC101758353  79.3    3e-15   
gb|EMT21035.1|  hypothetical protein F775_19841                       79.7    3e-15   
ref|XP_008359878.1|  PREDICTED: uncharacterized protein LOC103423...  79.3    3e-15   
ref|XP_002441080.1|  hypothetical protein SORBIDRAFT_09g019990        79.3    3e-15   Sorghum bicolor [broomcorn]
ref|XP_009402039.1|  PREDICTED: uncharacterized protein LOC103985909  78.6    7e-15   
ref|XP_008795103.1|  PREDICTED: uncharacterized protein LOC103710...  77.8    1e-14   
ref|XP_008795104.1|  PREDICTED: uncharacterized protein LOC103710...  77.0    1e-14   
ref|XP_008366854.1|  PREDICTED: uncharacterized protein LOC103430...  77.4    1e-14   
ref|XP_008366855.1|  PREDICTED: uncharacterized protein LOC103430...  77.4    2e-14   
ref|XP_008366853.1|  PREDICTED: uncharacterized protein LOC103430...  77.0    2e-14   
ref|XP_006368132.1|  PREDICTED: uncharacterized protein LOC102590315  72.4    3e-14   
ref|XP_002441081.1|  hypothetical protein SORBIDRAFT_09g020000        76.3    4e-14   Sorghum bicolor [broomcorn]
ref|XP_008809281.1|  PREDICTED: uncharacterized protein LOC103721032  75.1    1e-13   
dbj|BAJ90435.1|  predicted protein                                    74.7    1e-13   
ref|XP_002961673.1|  hypothetical protein SELMODRAFT_403751           75.1    1e-13   
dbj|BAJ97131.1|  predicted protein                                    74.7    1e-13   
dbj|BAJ86153.1|  predicted protein                                    74.7    1e-13   
ref|XP_010938876.1|  PREDICTED: uncharacterized protein LOC105057...  73.9    2e-13   
gb|EAY98014.1|  hypothetical protein OsI_19927                        73.6    3e-13   Oryza sativa Indica Group [Indian rice]
gb|EMT33428.1|  hypothetical protein F775_14363                       73.6    3e-13   
gb|EEE63687.1|  hypothetical protein OsJ_18505                        73.6    3e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AAT38028.1|  putative inosine-uridine preferring nucleoside hy...  73.6    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055513.2|  Os05g0406200                                     73.6    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963777.1|  PREDICTED: uncharacterized protein LOC101778777  73.6    3e-13   
gb|EMT26893.1|  hypothetical protein F775_13652                       73.6    3e-13   
dbj|BAJ97741.1|  predicted protein                                    73.2    5e-13   
ref|XP_003594048.1|  Pyrimidine-specific ribonucleoside hydrolase...  72.4    6e-13   
gb|AFW81969.1|  hypothetical protein ZEAMMB73_452326                  72.8    6e-13   
ref|XP_008655288.1|  PREDICTED: hypothetical protein isoform X1       72.8    6e-13   
ref|XP_006654387.1|  PREDICTED: uncharacterized protein LOC102700802  72.8    6e-13   
ref|NP_001169740.1|  hypothetical protein                             72.8    6e-13   Zea mays [maize]
ref|XP_004962122.1|  PREDICTED: uncharacterized protein LOC101757...  72.8    7e-13   
ref|XP_004962121.1|  PREDICTED: uncharacterized protein LOC101757...  72.8    7e-13   
ref|XP_004962120.1|  PREDICTED: uncharacterized protein LOC101757...  72.8    7e-13   
gb|AES64299.2|  inosine-uridine preferring nucleoside hydrolase       72.0    8e-13   
ref|XP_003566252.2|  PREDICTED: uncharacterized protein LOC100844761  72.0    1e-12   
dbj|BAJ84781.1|  predicted protein                                    72.0    1e-12   
ref|XP_002439787.1|  hypothetical protein SORBIDRAFT_09g020040        71.6    1e-12   Sorghum bicolor [broomcorn]
gb|EMS48374.1|  hypothetical protein TRIUR3_05635                     70.9    2e-12   
ref|XP_010938879.1|  PREDICTED: uncharacterized protein LOC105057...  70.9    3e-12   
ref|XP_010938874.1|  PREDICTED: uncharacterized protein LOC105057...  70.9    3e-12   
ref|XP_010938872.1|  PREDICTED: uncharacterized protein LOC105057...  70.5    3e-12   
ref|XP_010938873.1|  PREDICTED: uncharacterized protein LOC105057...  70.5    3e-12   
gb|EMT33427.1|  hypothetical protein F775_22335                       70.5    3e-12   
ref|XP_010938871.1|  PREDICTED: uncharacterized protein LOC105057...  70.5    4e-12   
ref|XP_010938875.1|  PREDICTED: uncharacterized protein LOC105057...  70.5    4e-12   
ref|XP_010102680.1|  hypothetical protein L484_002095                 63.2    1e-10   
ref|XP_010233227.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.2    1e-05   
ref|XP_007147842.1|  hypothetical protein PHAVU_006G1594000g          50.8    2e-05   
ref|XP_009786043.1|  PREDICTED: uncharacterized protein LOC104234211  47.4    1e-04   
ref|XP_011006094.1|  PREDICTED: inosine-uridine preferring nucleo...  46.6    3e-04   
ref|XP_009421179.1|  PREDICTED: uncharacterized protein LOC104000771  47.0    5e-04   
ref|XP_010024481.1|  PREDICTED: uncharacterized protein LOC104414...  45.4    7e-04   
ref|XP_009774490.1|  PREDICTED: uncharacterized protein C1683.06c...  45.4    0.001   



>ref|XP_006594457.1| PREDICTED: uncharacterized protein LOC100819333 isoform X3 [Glycine 
max]
Length=869

 Score =   118 bits (296),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD FPMN +DPI P  G+CKY K IPHG+GGF+DSDTLYGLARD
Sbjct  536  YDLLHMMGRDDIPVGLGDFFPMNQSDPIFPTAGNCKYVKAIPHGNGGFLDSDTLYGLARD  595

Query  9    LPR  1
            LPR
Sbjct  596  LPR  598


 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 4/63 (6%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPN----VGDCKYQKVIPHGSGGFIDSDTLYG  22
            YD+ +MMGRDDI VG+G    +     I+PN     G C+Y++ IP G  G +D DT+YG
Sbjct  74   YDILYMMGRDDIAVGMGGEGGILPDGTILPNGMTTTGGCRYRQAIPIGHRGILDIDTIYG  133

Query  21   LAR  13
            + +
Sbjct  134  IRK  136



>gb|KHN37531.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Glycine soja]
Length=879

 Score =   118 bits (296),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD FPMN +DPI P  G+CKY K IPHG+GGF+DSDTLYGLARD
Sbjct  546  YDLLHMMGRDDIPVGLGDFFPMNQSDPIFPTAGNCKYVKAIPHGNGGFLDSDTLYGLARD  605

Query  9    LPR  1
            LPR
Sbjct  606  LPR  608


 Score = 52.0 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G  
Sbjct  74   YDILYMMGRDDIAVGMGGEGGILPDGTILPNVGGYLSIIEQGMTTTGGCRYRQAIPIGHR  133

Query  51   GFIDSDTLYGLAR  13
            G +D DT+YG+ +
Sbjct  134  GILDIDTIYGIRK  146



>ref|XP_006594456.1| PREDICTED: uncharacterized protein LOC100819333 isoform X2 [Glycine 
max]
 ref|XP_003541646.2| PREDICTED: uncharacterized protein LOC100819333 isoform X1 [Glycine 
max]
Length=879

 Score =   118 bits (296),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD FPMN +DPI P  G+CKY K IPHG+GGF+DSDTLYGLARD
Sbjct  546  YDLLHMMGRDDIPVGLGDFFPMNQSDPIFPTAGNCKYVKAIPHGNGGFLDSDTLYGLARD  605

Query  9    LPR  1
            LPR
Sbjct  606  LPR  608


 Score = 52.0 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G  
Sbjct  74   YDILYMMGRDDIAVGMGGEGGILPDGTILPNVGGYLSIIEQGMTTTGGCRYRQAIPIGHR  133

Query  51   GFIDSDTLYGLAR  13
            G +D DT+YG+ +
Sbjct  134  GILDIDTIYGIRK  146



>gb|AES91756.2| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=851

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF MN  DPI+P VGDCKY K IPHGSGG++DSDTLYGLAR 
Sbjct  505  YDILHMMGRDDIPVGLGDVFAMNQEDPILPVVGDCKYVKAIPHGSGGYLDSDTLYGLARH  564

Query  9    LPR  1
            LPR
Sbjct  565  LPR  567


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  91   YDLLYMMGRDDIAVGVGGEGGILPNGTILPNVGGYLPIIDQGMTTTGGCRYRQTIPIGLG  150

Query  51   GFIDSDTLYGLAR  13
            G +D D  YG+ +
Sbjct  151  GRLDVDANYGIRK  163



>gb|KHN37530.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Glycine soja]
Length=769

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD F MN +DPI P VGDCKY K IPHG+GG +DSDTLYGLARD
Sbjct  438  YDLLHMMGRDDIPVGLGDAFAMNQSDPIFPIVGDCKYVKAIPHGNGGLLDSDTLYGLARD  497

Query  9    LPR  1
            LPR
Sbjct  498  LPR  500


 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSG  52
            YD+ +MMG+DDI VG+G    +     I+PNVG               C+Y++ IP G  
Sbjct  80   YDILYMMGQDDITVGMGGEGGILPNGTILPNVGGYLSIIEQGMTTTRGCRYRQAIPMGLR  139

Query  51   GFIDSDTLYGLAR  13
            G +D DT +G+ +
Sbjct  140  GLLDIDTNFGIRK  152



>gb|KDP40052.1| hypothetical protein JCGZ_02050 [Jatropha curcas]
Length=882

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +DPI   VGDCKY KVIPHGSGGF+DSDTLYGLAR+
Sbjct  547  YDLLHMMGRDDIPVGLGDVFALNQSDPIFSAVGDCKYVKVIPHGSGGFLDSDTLYGLARN  606

Query  9    LPR  1
            LPR
Sbjct  607  LPR  609


 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YD+ +MMGRDDIPVG+G    +     I+PNV              G C+Y++ IP G G
Sbjct  78   YDILYMMGRDDIPVGVGGEGGILEDGTILPNVGGYLPIIEQGNSTAGGCRYRQAIPIGPG  137

Query  51   GFIDSDTLYGLAR  13
            G +D D+ YG+ +
Sbjct  138  GRLDIDSNYGIRK  150



>ref|XP_003609559.1| Non-specific ribonucleoside hydrolase rihC [Medicago truncatula]
Length=909

 Score =   115 bits (289),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF MN  DPI+P VGDCKY K IPHGSGG++DSDTLYGLAR 
Sbjct  558  YDILHMMGRDDIPVGLGDVFAMNQEDPILPVVGDCKYVKAIPHGSGGYLDSDTLYGLARH  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  103  YDLLYMMGRDDIAVGVGGEGGILPNGTILPNVGGYLPIIDQGMTTTGGCRYRQTIPIGLG  162

Query  51   GFIDSDTLYGLAR  13
            G +D D  YG+ +
Sbjct  163  GRLDVDANYGIRK  175



>ref|XP_010558508.1| PREDICTED: uncharacterized protein LOC104827126 isoform X1 [Tarenaya 
hassleriana]
Length=922

 Score =   115 bits (288),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F +N +DPI P VGDCKY+K +P GSGGF+DSDTLYGLARD
Sbjct  590  YDLLHMMGRDDIPVGLGDMFAVNQSDPIFPAVGDCKYEKAVPQGSGGFLDSDTLYGLARD  649

Query  9    LPR  1
            LPR
Sbjct  650  LPR  652


 Score = 48.9 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+P+VG               C+Y++ IP G G
Sbjct  122  YDVLYMMGRDDIDVGVGGEGGILDDGSILPDVGGYLPIIEQGMTTTGWCRYRQAIPKGLG  181

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D DT YG  +  LP+
Sbjct  182  GRLDIDTNYGFRKQFLPQ  199



>ref|XP_010558509.1| PREDICTED: uncharacterized protein LOC104827126 isoform X2 [Tarenaya 
hassleriana]
 gb|ABD96887.1| hypothetical protein [Cleome spinosa]
Length=880

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F +N +DPI P VGDCKY+K +P GSGGF+DSDTLYGLARD
Sbjct  548  YDLLHMMGRDDIPVGLGDMFAVNQSDPIFPAVGDCKYEKAVPQGSGGFLDSDTLYGLARD  607

Query  9    LPR  1
            LPR
Sbjct  608  LPR  610


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+P+VG               C+Y++ IP G G
Sbjct  80   YDVLYMMGRDDIDVGVGGEGGILDDGSILPDVGGYLPIIEQGMTTTGWCRYRQAIPKGLG  139

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D DT YG  +  LP+
Sbjct  140  GRLDIDTNYGFRKQFLPQ  157



>ref|XP_007147841.1| hypothetical protein PHAVU_006G1594001g, partial [Phaseolus vulgaris]
 gb|ESW19835.1| hypothetical protein PHAVU_006G1594001g, partial [Phaseolus vulgaris]
Length=396

 Score =   111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+VF MN +DP+ P +GDC Y K IPHG+GG +DSDTLYGLARD
Sbjct  85   YDLLHMMGRDDIPVGLGEVFAMNESDPLFPLIGDCNYAKAIPHGNGGLLDSDTLYGLARD  144

Query  9    LPR  1
             PR
Sbjct  145  FPR  147



>ref|XP_007147840.1| hypothetical protein PHAVU_006G1594001g, partial [Phaseolus vulgaris]
 gb|ESW19834.1| hypothetical protein PHAVU_006G1594001g, partial [Phaseolus vulgaris]
Length=417

 Score =   111 bits (277),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+VF MN +DP+ P +GDC Y K IPHG+GG +DSDTLYGLARD
Sbjct  85   YDLLHMMGRDDIPVGLGEVFAMNESDPLFPLIGDCNYAKAIPHGNGGLLDSDTLYGLARD  144

Query  9    LPR  1
             PR
Sbjct  145  FPR  147



>ref|XP_007147839.1| hypothetical protein PHAVU_006G1594001g, partial [Phaseolus vulgaris]
 gb|ESW19833.1| hypothetical protein PHAVU_006G1594001g, partial [Phaseolus vulgaris]
Length=321

 Score =   110 bits (274),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+VF MN +DP+ P +GDC Y K IPHG+GG +DSDTLYGLARD
Sbjct  85   YDLLHMMGRDDIPVGLGEVFAMNESDPLFPLIGDCNYAKAIPHGNGGLLDSDTLYGLARD  144

Query  9    LPR  1
             PR
Sbjct  145  FPR  147



>ref|XP_009352319.1| PREDICTED: uncharacterized protein LOC103943704 [Pyrus x bretschneideri]
Length=895

 Score =   113 bits (282),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF  N +DPI P VG CKYQ+ IPHG+GG +DSDTLYGLARD
Sbjct  558  YDLLHMMGRDDIPVGLGDVFATNQSDPIFPAVGGCKYQQAIPHGNGGLLDSDTLYGLARD  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620



>gb|KHG23714.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Gossypium 
arboreum]
Length=376

 Score =   110 bits (275),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF M+ +D I   VGDCKY K IPHGSGGF+DSDTLYGLARD
Sbjct  44   YDLLHMMGRDDIPVGLGDVFAMSQSDQIFHLVGDCKYAKAIPHGSGGFLDSDTLYGLARD  103

Query  9    LPR  1
            LPR
Sbjct  104  LPR  106



>gb|EYU43866.1| hypothetical protein MIMGU_mgv1a025646mg [Erythranthe guttata]
Length=867

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +DP+ P VGDC Y+K IPHGSGGFIDSDTLYGLARD
Sbjct  535  YDLLHMMGRDDIPVGLGDVFALNQSDPVFPAVGDCMYKKAIPHGSGGFIDSDTLYGLARD  594

Query  9    LPR  1
            LPR
Sbjct  595  LPR  597


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  66   YDLLYMMGRDDIAVGVGGEGGILEDGTILPNVGGYHPIIQQGIGTSGYCRYRQAIPVGQG  125

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ +G  +  
Sbjct  126  GILDIDSNFGFRKSF  140



>ref|XP_011006093.1| PREDICTED: uncharacterized protein LOC105112187 isoform X3 [Populus 
euphratica]
Length=671

 Score =   112 bits (280),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD  HMMGRDDIPVGLGDVF MN +DP+   VGDCKY K IPHGSGG +DSDTLYGLARD
Sbjct  329  YDFLHMMGRDDIPVGLGDVFAMNQSDPVFSAVGDCKYLKAIPHGSGGLLDSDTLYGLARD  388

Query  9    LPR  1
            LPR
Sbjct  389  LPR  391



>ref|XP_008360311.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103424026 
[Malus domestica]
Length=895

 Score =   112 bits (281),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF  N +DPI P VG CKYQ+ IPHG+GG +DSDTLYGLARD
Sbjct  558  YDLLHMMGRDDIPVGLGDVFATNQSDPIFPAVGGCKYQQAIPHGNGGLLDSDTLYGLARD  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620



>ref|XP_006594458.1| PREDICTED: uncharacterized protein LOC100819333 isoform X4 [Glycine 
max]
 ref|XP_006594459.1| PREDICTED: uncharacterized protein LOC100819333 isoform X5 [Glycine 
max]
 ref|XP_006594460.1| PREDICTED: uncharacterized protein LOC100819333 isoform X6 [Glycine 
max]
Length=801

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD FPMN +DPI P  G+CKY K IPHG+GGF+DSDTLYGLARD
Sbjct  468  YDLLHMMGRDDIPVGLGDFFPMNQSDPIFPTAGNCKYVKAIPHGNGGFLDSDTLYGLARD  527

Query  9    LPR  1
            LPR
Sbjct  528  LPR  530



>ref|XP_007154207.1| hypothetical protein PHAVU_003G099100g [Phaseolus vulgaris]
 gb|ESW26201.1| hypothetical protein PHAVU_003G099100g [Phaseolus vulgaris]
Length=759

 Score =   112 bits (280),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DPI   VG+CKY K IPHGSGG +DSDTLYGLARD
Sbjct  428  YDLLHMMGRDDIPVGLGDVFAMNESDPIFGGVGECKYIKAIPHGSGGLLDSDTLYGLARD  487

Query  9    LPR  1
            LPR
Sbjct  488  LPR  490



>gb|KFK24302.1| hypothetical protein AALP_AAs66884U000100 [Arabis alpina]
Length=486

 Score =   110 bits (274),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F MN +DPI P VGDCKY K +P G GGF+DSDTLYG ARD
Sbjct  340  YDLLHMMGRDDIPVGLGDMFAMNQSDPIFPPVGDCKYVKAVPQGCGGFLDSDTLYGFARD  399

Query  9    LPR  1
            LPR
Sbjct  400  LPR  402



>ref|XP_011006091.1| PREDICTED: uncharacterized protein LOC105112187 isoform X1 [Populus 
euphratica]
Length=872

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD  HMMGRDDIPVGLGDVF MN +DP+   VGDCKY K IPHGSGG +DSDTLYGLARD
Sbjct  530  YDFLHMMGRDDIPVGLGDVFAMNQSDPVFSAVGDCKYLKAIPHGSGGLLDSDTLYGLARD  589

Query  9    LPR  1
            LPR
Sbjct  590  LPR  592


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGD---------VFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+ +MMGRDD+ VG+G          +FP     + I +      G C+Y++ IP G  
Sbjct  83   YDILYMMGRDDVSVGMGGEGGIAEDGRIFPDVGGFLPIVEQGKTTAGGCRYRQAIPAGPR  142

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YGL R L
Sbjct  143  GRLDLDSNYGLRRAL  157



>ref|XP_011006092.1| PREDICTED: uncharacterized protein LOC105112187 isoform X2 [Populus 
euphratica]
Length=868

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD  HMMGRDDIPVGLGDVF MN +DP+   VGDCKY K IPHGSGG +DSDTLYGLARD
Sbjct  530  YDFLHMMGRDDIPVGLGDVFAMNQSDPVFSAVGDCKYLKAIPHGSGGLLDSDTLYGLARD  589

Query  9    LPR  1
            LPR
Sbjct  590  LPR  592


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGD---------VFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+ +MMGRDD+ VG+G          +FP     + I +      G C+Y++ IP G  
Sbjct  83   YDILYMMGRDDVSVGMGGEGGIAEDGRIFPDVGGFLPIVEQGKTTAGGCRYRQAIPAGPR  142

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YGL R L
Sbjct  143  GRLDLDSNYGLRRAL  157



>ref|XP_006380040.1| inosine-uridine preferring nucleoside hydrolase-related family 
protein [Populus trichocarpa]
 gb|ERP57837.1| inosine-uridine preferring nucleoside hydrolase-related family 
protein [Populus trichocarpa]
Length=872

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD  HMMGRDDIPVGLGDVF MN +DP+   VGDCKY K IPHGSGG +DSDTLYGLARD
Sbjct  530  YDFLHMMGRDDIPVGLGDVFAMNQSDPVFSAVGDCKYLKAIPHGSGGLLDSDTLYGLARD  589

Query  9    LPR  1
            LPR
Sbjct  590  LPR  592


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+ +MMGRDD+ VG+G          +FP     + I +      G C+Y++ IP G  
Sbjct  83   YDILYMMGRDDVSVGMGGEGGIAEDGHIFPDVGGFLPIVEQGKSTAGGCRYRQAIPVGPR  142

Query  51   GFIDSDTLYGLAR  13
            G +D D+ YGL R
Sbjct  143  GRLDLDSNYGLRR  155



>ref|XP_007225500.1| hypothetical protein PRUPE_ppa001181mg [Prunus persica]
 gb|EMJ26699.1| hypothetical protein PRUPE_ppa001181mg [Prunus persica]
Length=886

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DP+   VGDCKY K IPHG+GG +DSDTLYGLARD
Sbjct  549  YDLLHMMGRDDIPVGLGDVFAMNQSDPVFSAVGDCKYLKAIPHGNGGLLDSDTLYGLARD  608

Query  9    LPR  1
             PR
Sbjct  609  FPR  611



>gb|KHG17802.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Gossypium 
arboreum]
Length=866

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +D + P VGDCKY K +PHGSGGF+DSDTLYGLARD
Sbjct  551  YDLLHMMGRDDIPVGLGDVFAMNQSDNVFPGVGDCKYAKAVPHGSGGFLDSDTLYGLARD  610

Query  9    LPR  1
            LPR
Sbjct  611  LPR  613



>ref|NP_197390.1| Inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis thaliana]
 gb|AED92625.1| Inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis thaliana]
Length=550

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F +N ++P+ P+ GDCKY K +P G GGF+DSDTLYGLARD
Sbjct  211  YDLLHMMGRDDIPVGLGDMFAINQSEPVFPSAGDCKYAKAVPQGCGGFLDSDTLYGLARD  270

Query  9    LPR  1
            LPR
Sbjct  271  LPR  273



>ref|XP_008223073.1| PREDICTED: uncharacterized protein LOC103322899 [Prunus mume]
Length=886

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DP+   VGDCKY K IPHG+GG +DSDTLYGLARD
Sbjct  549  YDLLHMMGRDDIPVGLGDVFAMNQSDPVFSAVGDCKYLKAIPHGNGGLLDSDTLYGLARD  608

Query  9    LPR  1
             PR
Sbjct  609  FPR  611



>ref|XP_007035420.1| Inosine-uridine preferring nucleoside hydrolase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY06346.1| Inosine-uridine preferring nucleoside hydrolase family protein 
isoform 2 [Theobroma cacao]
Length=698

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +D + P VGDCKY K IPHGSGGF+DSDTLYGLARD
Sbjct  549  YDLLHMMGRDDIPVGLGDVFAMNQSDKVFPPVGDCKYVKAIPHGSGGFLDSDTLYGLARD  608

Query  9    LPR  1
            LPR
Sbjct  609  LPR  611


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  80   YDILYMMGRDDIAVGVGGEGGILEDGTILPNVGGYLPIIEQGMTTAGGCRYRQAIPVGLG  139

Query  51   GFIDSDTLYGLAR  13
            G +D DT YG+ +
Sbjct  140  GRLDIDTNYGIRK  152



>gb|KHN03406.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Glycine soja]
Length=878

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DPI P VG+CKY K IPHGSGG +DSDTLYGLARD
Sbjct  545  YDLLHMMGRDDIPVGLGDVFAMNQSDPIFPPVGECKYVKAIPHGSGGLLDSDTLYGLARD  604

Query  9    LPR  1
            LPR
Sbjct  605  LPR  607



>ref|XP_003550523.1| PREDICTED: uncharacterized protein LOC100788041 [Glycine max]
Length=878

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DPI P VG+CKY K IPHGSGG +DSDTLYGLARD
Sbjct  545  YDLLHMMGRDDIPVGLGDVFAMNQSDPIFPPVGECKYVKAIPHGSGGLLDSDTLYGLARD  604

Query  9    LPR  1
            LPR
Sbjct  605  LPR  607



>gb|KHN03019.1| Inosine-uridine preferring nucleoside hydrolase [Glycine soja]
Length=826

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DPI P VG+CKY K IPHGSGG +DSDTLYGLARD
Sbjct  493  YDLLHMMGRDDIPVGLGDVFAMNQSDPIFPPVGECKYVKAIPHGSGGLLDSDTLYGLARD  552

Query  9    LPR  1
            LPR
Sbjct  553  LPR  555



>ref|XP_007035419.1| Inosine-uridine preferring nucleoside hydrolase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY06345.1| Inosine-uridine preferring nucleoside hydrolase family protein 
isoform 1 [Theobroma cacao]
Length=949

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +D + P VGDCKY K IPHGSGGF+DSDTLYGLARD
Sbjct  616  YDLLHMMGRDDIPVGLGDVFAMNQSDKVFPPVGDCKYVKAIPHGSGGFLDSDTLYGLARD  675

Query  9    LPR  1
            LPR
Sbjct  676  LPR  678


 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  147  YDILYMMGRDDIAVGVGGEGGILEDGTILPNVGGYLPIIEQGMTTAGGCRYRQAIPVGLG  206

Query  51   GFIDSDTLYGLAR  13
            G +D DT YG+ +
Sbjct  207  GRLDIDTNYGIRK  219



>ref|XP_010105673.1| hypothetical protein L484_011284 [Morus notabilis]
 gb|EXC05704.1| hypothetical protein L484_011284 [Morus notabilis]
Length=881

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+ F MN +DPI   VGDCKY K IPHGSGGF+DSDTLYGLARD
Sbjct  549  YDLLHMMGRDDIPVGLGEAFAMNQSDPIFSAVGDCKYVKAIPHGSGGFLDSDTLYGLARD  608

Query  9    LPR  1
            LPR
Sbjct  609  LPR  611


 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNV              G C+Y++ IP G G
Sbjct  80   YDILYMMGRDDIAVGVGGEGGIQEDGTILPNVGGYLPIIEQGMTTSGGCRYRQAIPVGPG  139

Query  51   GFIDSDTLYGLAR  13
            G +D D+ YG+ +
Sbjct  140  GRLDIDSNYGIRK  152



>ref|XP_009126346.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851256 
[Brassica rapa]
Length=1690

 Score =   110 bits (274),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189   YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
             YDL HMMGRDDIPVGLGD+  +N +DP  P+VGDC Y K IP G GGF+DSDTLYGLARD
Sbjct  1335  YDLLHMMGRDDIPVGLGDMLALNQSDPTSPSVGDCLYAKAIPQGCGGFLDSDTLYGLARD  1394

Query  9     LPR  1
             LPR
Sbjct  1395  LPR  1397



>ref|XP_010546906.1| PREDICTED: uncharacterized protein LOC104818832 isoform X1 [Tarenaya 
hassleriana]
Length=958

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF +N +DP  P  GDCKY+K +P G GGF+DSDTLYGLARD
Sbjct  618  YDVLHMMGRDDIPVGLGDVFAVNQSDPNFPTAGDCKYEKAVPQGYGGFLDSDTLYGLARD  677

Query  9    LPR  1
            LPR
Sbjct  678  LPR  680


 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G          V P     + I D  +   G C++++ IP G G
Sbjct  158  YDVLYMMGRDDIDVGVGGEGGILDDGTVRPDVGGYLPIIDQGMTTTGGCRFRQAIPKGLG  217

Query  51   GFIDSDTLYGL-ARDLPR  1
            G +D+DT +GL  R LP+
Sbjct  218  GRLDTDTNFGLRKRFLPQ  235



>ref|XP_006489269.1| PREDICTED: uncharacterized protein LOC102620115 [Citrus sinensis]
Length=891

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDD+ VGLGD+F  N +DPI P+VGDCKY K IPHG GGF+DSDTLYGLARD
Sbjct  552  YDLLHMMGRDDVQVGLGDLFATNQSDPIDPSVGDCKYVKSIPHGCGGFLDSDTLYGLARD  611

Query  9    LPR  1
            +PR
Sbjct  612  MPR  614



>ref|XP_003541647.1| PREDICTED: uncharacterized protein LOC100819865 [Glycine max]
Length=881

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD F MN +DPI P VGDCKY K IPHG+GG +DSDTLYGLARD
Sbjct  550  YDLLHMMGRDDIPVGLGDAFAMNQSDPIFPIVGDCKYVKAIPHGNGGLLDSDTLYGLARD  609

Query  9    LPR  1
            LPR
Sbjct  610  LPR  612



>ref|XP_006419733.1| hypothetical protein CICLE_v10004275mg [Citrus clementina]
 gb|ESR32973.1| hypothetical protein CICLE_v10004275mg [Citrus clementina]
Length=891

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDD+ VGLGD+F  N +DPI P+VGDCKY K IPHG GGF+DSDTLYGLARD
Sbjct  552  YDLLHMMGRDDVQVGLGDLFATNQSDPIDPSVGDCKYVKSIPHGCGGFLDSDTLYGLARD  611

Query  9    LPR  1
            +PR
Sbjct  612  MPR  614



>ref|XP_010546907.1| PREDICTED: uncharacterized protein LOC104818832 isoform X2 [Tarenaya 
hassleriana]
Length=796

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF +N +DP  P  GDCKY+K +P G GGF+DSDTLYGLARD
Sbjct  456  YDVLHMMGRDDIPVGLGDVFAVNQSDPNFPTAGDCKYEKAVPQGYGGFLDSDTLYGLARD  515

Query  9    LPR  1
            LPR
Sbjct  516  LPR  518



>gb|KDO74955.1| hypothetical protein CISIN_1g003674mg [Citrus sinensis]
Length=804

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDD+ VGLGD+F  N +DPI P+VGDCKY K IPHG GGF+DSDTLYGLARD
Sbjct  465  YDLLHMMGRDDVQVGLGDLFATNQSDPIDPSVGDCKYVKSIPHGCGGFLDSDTLYGLARD  524

Query  9    LPR  1
            +PR
Sbjct  525  MPR  527



>ref|XP_011011453.1| PREDICTED: uncharacterized protein LOC105116020 isoform X1 [Populus 
euphratica]
 ref|XP_011011454.1| PREDICTED: uncharacterized protein LOC105116020 isoform X1 [Populus 
euphratica]
 ref|XP_011011455.1| PREDICTED: uncharacterized protein LOC105116020 isoform X1 [Populus 
euphratica]
Length=883

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+VF MN +DPI   VGDCKY K IPHGSGG +DSDTLYGLARD
Sbjct  550  YDLLHMMGRDDIPVGLGEVFAMNQSDPIFSAVGDCKYLKAIPHGSGGLLDSDTLYGLARD  609

Query  9    LPR  1
            LPR
Sbjct  610  LPR  612



>ref|XP_004229485.1| PREDICTED: uncharacterized protein LOC101244900 [Solanum lycopersicum]
Length=880

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DP+   VGDCKY KVIP GSGGF+DSDTLYGL+R 
Sbjct  554  YDLLHMMGRDDIPVGLGDVFAMNQSDPVFSAVGDCKYNKVIPQGSGGFLDSDTLYGLSRS  613

Query  9    LPR  1
            LPR
Sbjct  614  LPR  616



>ref|XP_011011456.1| PREDICTED: uncharacterized protein LOC105116020 isoform X2 [Populus 
euphratica]
 ref|XP_011011457.1| PREDICTED: uncharacterized protein LOC105116020 isoform X2 [Populus 
euphratica]
Length=798

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+VF MN +DPI   VGDCKY K IPHGSGG +DSDTLYGLARD
Sbjct  465  YDLLHMMGRDDIPVGLGEVFAMNQSDPIFSAVGDCKYLKAIPHGSGGLLDSDTLYGLARD  524

Query  9    LPR  1
            LPR
Sbjct  525  LPR  527



>ref|XP_002871849.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH48108.1| inosine-uridine preferring nucleoside hydrolase family protein 
[Arabidopsis lyrata subsp. lyrata]
Length=540

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIP+GLGD+F +N ++P  P+ GDCKY K +P G GGF+DSDTLYGLARD
Sbjct  211  YDLLHMMGRDDIPIGLGDMFALNQSEPGFPSAGDCKYAKAVPQGCGGFLDSDTLYGLARD  270

Query  9    LPR  1
            LPR
Sbjct  271  LPR  273



>ref|XP_009607061.1| PREDICTED: uncharacterized protein LOC104101328 [Nicotiana tomentosiformis]
Length=895

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DP+   VGDCKY KVIP GSGGF+DSDTLYGL+R 
Sbjct  557  YDLLHMMGRDDIPVGLGDVFAMNQSDPVFYEVGDCKYNKVIPQGSGGFLDSDTLYGLSRS  616

Query  9    LPR  1
            LPR
Sbjct  617  LPR  619



>ref|XP_002311814.2| hypothetical protein POPTR_0008s20200g [Populus trichocarpa]
 gb|EEE89181.2| hypothetical protein POPTR_0008s20200g [Populus trichocarpa]
Length=883

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+VF MN +DP+   VGDCKY K IPHGSGG +DSDTLYGLARD
Sbjct  550  YDLLHMMGRDDIPVGLGEVFAMNQSDPVFSAVGDCKYLKAIPHGSGGLLDSDTLYGLARD  609

Query  9    LPR  1
            LPR
Sbjct  610  LPR  612



>ref|XP_010649815.1| PREDICTED: uncharacterized protein LOC100263026 [Vitis vinifera]
 ref|XP_010649816.1| PREDICTED: uncharacterized protein LOC100263026 [Vitis vinifera]
 ref|XP_010649817.1| PREDICTED: uncharacterized protein LOC100263026 [Vitis vinifera]
 ref|XP_010649818.1| PREDICTED: uncharacterized protein LOC100263026 [Vitis vinifera]
 emb|CBI26140.3| unnamed protein product [Vitis vinifera]
Length=893

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDV+ MN +DPI  +VGDCKY K IPHGSGGF+DSDTLYG AR 
Sbjct  555  YDLLHMMGRDDIPVGLGDVYAMNQSDPIFSSVGDCKYVKAIPHGSGGFLDSDTLYGFARH  614

Query  9    LPR  1
            LPR
Sbjct  615  LPR  617


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 15/74 (20%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGS-  55
            YDL +MMGRDDIPVG+G    +     I+PNV              G C+Y++ IP G  
Sbjct  84   YDLLYMMGRDDIPVGVGGEGGIREDGTILPNVGGYLPIIEQGLTTTGGCRYRQAIPKGRY  143

Query  54   GGFIDSDTLYGLAR  13
            GG +D D+ YG+ +
Sbjct  144  GGILDIDSNYGIRK  157



>ref|XP_004486297.1| PREDICTED: uncharacterized protein LOC101496568 [Cicer arietinum]
Length=882

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVG+GD F MN ++P+ P VGDC Y K IPHG+GG IDSDTL+GLARD
Sbjct  549  YDLLHMMGRDDIPVGIGDFFAMNQSNPMFPPVGDCNYIKAIPHGNGGLIDSDTLFGLARD  608

Query  9    LPR  1
            LPR
Sbjct  609  LPR  611


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP GSG
Sbjct  80   YDILYMMGRDDIAVGVGGEGGILPNGTILPNVGGYLPIIEQGMTTTGGCRYRQAIPVGSG  139

Query  51   GFIDSDTLYGLAR  13
            G +D D  YG+ +
Sbjct  140  GRLDVDANYGIRK  152



>ref|XP_009774488.1| PREDICTED: uncharacterized protein LOC104224512 isoform X2 [Nicotiana 
sylvestris]
Length=854

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DP+   VGDCKY KVIP GSGGF+DSDTLYGL+R 
Sbjct  516  YDLLHMMGRDDIPVGLGDVFAMNQSDPVFYAVGDCKYNKVIPQGSGGFLDSDTLYGLSRS  575

Query  9    LPR  1
            LPR
Sbjct  576  LPR  578



>ref|XP_009774487.1| PREDICTED: uncharacterized protein LOC104224512 isoform X1 [Nicotiana 
sylvestris]
Length=895

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DP+   VGDCKY KVIP GSGGF+DSDTLYGL+R 
Sbjct  557  YDLLHMMGRDDIPVGLGDVFAMNQSDPVFYAVGDCKYNKVIPQGSGGFLDSDTLYGLSRS  616

Query  9    LPR  1
            LPR
Sbjct  617  LPR  619



>ref|XP_011090885.1| PREDICTED: uncharacterized protein LOC105171457 isoform X2 [Sesamum 
indicum]
Length=880

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +D I P VGDCKY + IP+GSGGF+DSDTLYGLARD
Sbjct  548  YDLLHMMGRDDIPVGLGDVFALNQSDLIFPAVGDCKYSRAIPYGSGGFLDSDTLYGLARD  607

Query  9    LPR  1
            LPR
Sbjct  608  LPR  610


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G+G
Sbjct  79   YDILYMMGRDDIAVGVGGEGGILEDGTILPNVGGYHPIIEQGNSTAGYCRYRQAIPVGAG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D DT +G+ +  
Sbjct  139  GKLDIDTNFGIRKSF  153



>ref|XP_011090884.1| PREDICTED: uncharacterized protein LOC105171457 isoform X1 [Sesamum 
indicum]
Length=890

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +D I P VGDCKY + IP+GSGGF+DSDTLYGLARD
Sbjct  558  YDLLHMMGRDDIPVGLGDVFALNQSDLIFPAVGDCKYSRAIPYGSGGFLDSDTLYGLARD  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G+G
Sbjct  79   YDILYMMGRDDIAVGVGGEGGILEDGTILPNVGGYHPIIEQGNSTAGYCRYRQAIPVGAG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D DT +G+ +  
Sbjct  139  GKLDIDTNFGIRKSF  153



>ref|XP_004298086.1| PREDICTED: uncharacterized protein LOC101302065 [Fragaria vesca 
subsp. vesca]
Length=972

 Score =   107 bits (268),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F M  +DP    VGDCKY K IPHG GG +DSDTLYGLARD
Sbjct  630  YDLLHMMGRDDIPVGLGDLFAMKQSDPSFSAVGDCKYVKAIPHGGGGLLDSDTLYGLARD  689

Query  9    LPR  1
            LPR
Sbjct  690  LPR  692


 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDD+ VG G    +     I+PNVG               C+Y++ IP G G
Sbjct  160  YDMLYMMGRDDVAVGFGGEGGILEDGTIVPNVGGYLPLIDQGTTTAGGCRYRQAIPVGLG  219

Query  51   GFIDSDTLYGLAR  13
            G +D+DT +G+ +
Sbjct  220  GRLDTDTNFGIRK  232



>ref|XP_011090886.1| PREDICTED: uncharacterized protein LOC105171457 isoform X3 [Sesamum 
indicum]
Length=863

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +D I P VGDCKY + IP+GSGGF+DSDTLYGLARD
Sbjct  558  YDLLHMMGRDDIPVGLGDVFALNQSDLIFPAVGDCKYSRAIPYGSGGFLDSDTLYGLARD  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G+G
Sbjct  79   YDILYMMGRDDIAVGVGGEGGILEDGTILPNVGGYHPIIEQGNSTAGYCRYRQAIPVGAG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D DT +G+ +  
Sbjct  139  GKLDIDTNFGIRKSF  153



>emb|CDY13927.1| BnaC09g38990D [Brassica napus]
Length=840

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F +N +DPI P VGDCKY KVIP G GGF+DSDTLYG ARD
Sbjct  532  YDLLHMMGRDDIPVGLGDLFALNQSDPIFPPVGDCKYVKVIPQGCGGFLDSDTLYGFARD  591

Query  9    LPR  1
            LPR
Sbjct  592  LPR  594


 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDD----------------IPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDD                I   +G  FP  I +  +   G+C+Y++ +P G
Sbjct  82   YDLLHMMGRDDVAVGVGGEGGILDDGTILSDVGGYFP--IIEQGMKTTGECRYRQAVPKG  139

Query  57   SGGFIDSDTLYGLARDL  7
            SGG +D D+ YG  +  
Sbjct  140  SGGLLDIDSNYGFRKQF  156



>ref|XP_002516835.1| inosine-uridine preferring nucleoside hydrolase, putative [Ricinus 
communis]
 gb|EEF45449.1| inosine-uridine preferring nucleoside hydrolase, putative [Ricinus 
communis]
Length=885

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG+VF  N +D I   VGDCKY KVIPHGSGGF+DSDTLYGLARD
Sbjct  550  YDLLHMMGRDDIPVGLGNVFARNQSDRIFSAVGDCKYVKVIPHGSGGFLDSDTLYGLARD  609

Query  9    LPR  1
            LPR
Sbjct  610  LPR  612



>ref|XP_006400442.1| hypothetical protein EUTSA_v10012637mg [Eutrema salsugineum]
 gb|ESQ41895.1| hypothetical protein EUTSA_v10012637mg [Eutrema salsugineum]
Length=891

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F +N +DPI P VGDCKY K IP G GGF+DSDTLYGLARD
Sbjct  559  YDLLHMMGRDDIPVGLGDMFALNQSDPIFPPVGDCKYVKAIPQGCGGFLDSDTLYGLARD  618

Query  9    LPR  1
            LPR
Sbjct  619  LPR  621


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G C+Y++ IP G
Sbjct  86   YDLLHMMGRDDIPVGVGGEGGILDDGTILSDVGGYFP--IIEQGMTTTGGCRYRQAIPKG  143

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ +G  +  
Sbjct  144  FGGLLDIDSNFGFRKQF  160



>ref|XP_008347819.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103410950 
[Malus domestica]
Length=827

 Score =   106 bits (265),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF  N +D I   VGDCKY + IPHG+GG +DSDTLYGLARD
Sbjct  490  YDLLHMMGRDDIPVGLGDVFATNQSDSIFSAVGDCKYLQAIPHGNGGLLDSDTLYGLARD  549

Query  9    LPR  1
            LPR
Sbjct  550  LPR  552



>ref|XP_004229568.1| PREDICTED: uncharacterized protein LOC101247751 [Solanum lycopersicum]
Length=834

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL H+MGRDDIPVGLGD+F MN +DP+   VGDCKY KVIP GSGGFIDSDTLYGL+R 
Sbjct  522  YDLLHIMGRDDIPVGLGDMFAMNQSDPVFSAVGDCKYNKVIPQGSGGFIDSDTLYGLSRS  581

Query  9    LPR  1
            LPR
Sbjct  582  LPR  584



>ref|XP_003609561.1| Pyrimidine-specific ribonucleoside hydrolase rihB [Medicago truncatula]
 gb|AES91758.1| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=888

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF MN  DPI   VG CKY K IPHG+GG+IDSDTLYGLAR 
Sbjct  544  YDILHMMGRDDIPVGLGDVFAMNQRDPIFGAVGGCKYVKAIPHGNGGYIDSDTLYGLARY  603

Query  9    LPR  1
            LPR
Sbjct  604  LPR  606


 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YDL +MMGRDD+ VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  75   YDLLYMMGRDDVAVGIGGEGGILSNGTILPNVGGYLPIIEQGMTTIGGCRYRQAIPVGLG  134

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D D  YG+ +  LP+
Sbjct  135  GRLDIDANYGIRKSFLPQ  152



>ref|XP_010025129.1| PREDICTED: uncharacterized protein LOC104415509 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010025130.1| PREDICTED: uncharacterized protein LOC104415509 isoform X3 [Eucalyptus 
grandis]
Length=736

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGD F     DP  P +GDCKY+K IPHG GGF+DSDTLYGL+RD
Sbjct  369  YDVLHMMGRDDIPVGLGDAFAHEQTDPTFPAIGDCKYRKAIPHGGGGFLDSDTLYGLSRD  428

Query  9    LP  4
            LP
Sbjct  429  LP  430



>ref|XP_008357556.1| PREDICTED: uncharacterized protein LOC103421307 isoform X2 [Malus 
domestica]
Length=614

 Score =   105 bits (262),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF  N +D I   VGDCKY + IPHG+GG +DSDTLYGLARD
Sbjct  376  YDLLHMMGRDDIPVGLGDVFATNQSDSIFSAVGDCKYLQAIPHGNGGLLDSDTLYGLARD  435

Query  9    LPR  1
            LPR
Sbjct  436  LPR  438



>ref|XP_006365268.1| PREDICTED: uncharacterized protein LOC102590399 [Solanum tuberosum]
Length=888

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DPI   VGDCKY KVIP G GGF+DSDTLYGL+R 
Sbjct  550  YDLLHMMGRDDIPVGLGDVFAMNQSDPIFYAVGDCKYNKVIPQGCGGFLDSDTLYGLSRS  609

Query  9    LPR  1
            LPR
Sbjct  610  LPR  612



>ref|XP_004229486.1| PREDICTED: uncharacterized protein LOC101245199 isoform X1 [Solanum 
lycopersicum]
Length=888

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DPI   VGDCKY KVIP G GGF+DSDTLYGL+R 
Sbjct  550  YDLLHMMGRDDIPVGLGDVFAMNQSDPIFYAVGDCKYNKVIPQGCGGFLDSDTLYGLSRS  609

Query  9    LPR  1
            LPR
Sbjct  610  LPR  612



>ref|XP_010322993.1| PREDICTED: uncharacterized protein LOC101245199 isoform X2 [Solanum 
lycopersicum]
Length=858

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +DPI   VGDCKY KVIP G GGF+DSDTLYGL+R 
Sbjct  520  YDLLHMMGRDDIPVGLGDVFAMNQSDPIFYAVGDCKYNKVIPQGCGGFLDSDTLYGLSRS  579

Query  9    LPR  1
            LPR
Sbjct  580  LPR  582



>ref|XP_009369077.1| PREDICTED: uncharacterized protein LOC103958535 isoform X1 [Pyrus 
x bretschneideri]
Length=895

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF  N +D I   VGDCKY + IPHG+GG +DSDTLYGLARD
Sbjct  558  YDLLHMMGRDDIPVGLGDVFATNQSDSIFSAVGDCKYLQAIPHGNGGLLDSDTLYGLARD  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620



>ref|XP_009369078.1| PREDICTED: uncharacterized protein LOC103958535 isoform X2 [Pyrus 
x bretschneideri]
Length=688

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF  N +D I   VGDCKY + IPHG+GG +DSDTLYGLARD
Sbjct  351  YDLLHMMGRDDIPVGLGDVFATNQSDSIFSAVGDCKYLQAIPHGNGGLLDSDTLYGLARD  410

Query  9    LPR  1
            LPR
Sbjct  411  LPR  413



>ref|XP_008357555.1| PREDICTED: uncharacterized protein LOC103421307 isoform X1 [Malus 
domestica]
Length=713

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF  N +D I   VGDCKY + IPHG+GG +DSDTLYGLARD
Sbjct  376  YDLLHMMGRDDIPVGLGDVFATNQSDSIFSAVGDCKYLQAIPHGNGGLLDSDTLYGLARD  435

Query  9    LPR  1
            LPR
Sbjct  436  LPR  438



>ref|XP_006287032.1| hypothetical protein CARUB_v10000179mg [Capsella rubella]
 gb|EOA19930.1| hypothetical protein CARUB_v10000179mg [Capsella rubella]
Length=893

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VG CKY K +P G GGF+DSDTL+GLARD
Sbjct  561  YDLLHMMGRDDIPVGLGDILALNQSDPIFPPVGGCKYVKAVPRGCGGFLDSDTLFGLARD  620

Query  9    LPR  1
            LPR
Sbjct  621  LPR  623


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 19/80 (24%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G+C+Y++ IP G
Sbjct  86   YDLLHMMGRDDIPVGVGGEGGIRDDGTIHSDVGGYFP--IIEQGMTTTGECRYRQAIPKG  143

Query  57   SGGFIDSDTLYGLARD-LPR  1
             GG +D D+ YG  +  LP+
Sbjct  144  LGGLLDIDSNYGFRKQFLPQ  163



>ref|XP_009607062.1| PREDICTED: uncharacterized protein LOC104101329 [Nicotiana tomentosiformis]
Length=895

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF MN +D +   VG+CKY KVIP GSGGF+DSDTLYGL+R 
Sbjct  563  YDLLHMMGRDDIPVGLGDVFAMNQSDLVFSAVGECKYNKVIPQGSGGFLDSDTLYGLSRS  622

Query  9    LPR  1
            LPR
Sbjct  623  LPR  625



>ref|XP_004296774.1| PREDICTED: uncharacterized protein LOC101313205 [Fragaria vesca 
subsp. vesca]
Length=889

 Score =   103 bits (258),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VG GD+F MN +DP    VGDCKY K IPHG GG +DSDTLYGLARD
Sbjct  552  YDLLHMMGRDDILVGRGDLFAMNQSDPSFSAVGDCKYAKAIPHGGGGLLDSDTLYGLARD  611

Query  9    LPR  1
            LPR
Sbjct  612  LPR  614



>ref|XP_010024480.1| PREDICTED: uncharacterized protein LOC104414950 isoform X2 [Eucalyptus 
grandis]
Length=736

 Score =   103 bits (257),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG VF +N +D I   VGDCKY K IPHGSGG +DSDTLYGLAR 
Sbjct  399  YDMLHMMGRDDIPVGLGKVFALNQSDAIFSAVGDCKYVKAIPHGSGGLLDSDTLYGLART  458

Query  9    LPR  1
            LPR
Sbjct  459  LPR  461



>ref|XP_002871847.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48106.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=891

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VGDCKY K +P G GGF+DSDTLYGLARD
Sbjct  560  YDLLHMMGRDDIPVGLGDMLALNQSDPIFPPVGDCKYVKAVPRGCGGFLDSDTLYGLARD  619

Query  9    LPR  1
            LPR
Sbjct  620  LPR  622


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G+C+Y++ IP G
Sbjct  87   YDLLHMMGRDDIPVGVGGEGGIRDDGTIHSDVGGYFP--IIEQGMTTTGECRYRQAIPKG  144

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ YG  +  
Sbjct  145  LGGLLDIDSNYGFRKQF  161



>gb|KFK26124.1| hypothetical protein AALP_AA8G206800 [Arabis alpina]
Length=641

 Score =   103 bits (256),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VGLGD+  +N +DPI P VGDCKY   IP G GGFIDSDTLYG ARD
Sbjct  337  YDLLHMMGRDDILVGLGDMIALNQSDPIFPIVGDCKYITAIPQGCGGFIDSDTLYGFARD  396

Query  9    LPR  1
            LPR
Sbjct  397  LPR  399



>ref|XP_004508326.1| PREDICTED: uncharacterized protein LOC101511066 [Cicer arietinum]
Length=884

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF  N  DPI   VG+CKY K IPHGSGG++DSDTLYGLAR+
Sbjct  544  YDILHMMGRDDIPVGLGDVFATNQTDPIFGAVGNCKYVKAIPHGSGGYLDSDTLYGLARN  603

Query  9    LPR  1
            LPR
Sbjct  604  LPR  606


 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G          + P     + I +  I   GDC+Y++ IP G G
Sbjct  75   YDLLYMMGRDDIDVGVGGEGGILPNGTILPNVGGYLPIIEQSITTTGDCRYRQAIPLGLG  134

Query  51   GFIDSDTLYGLAR  13
            G +D DT YG  +
Sbjct  135  GRLDIDTNYGFRK  147



>ref|XP_004134177.1| PREDICTED: uncharacterized protein LOC101216049 [Cucumis sativus]
 ref|XP_004159833.1| PREDICTED: uncharacterized LOC101216049 [Cucumis sativus]
 gb|KGN57055.1| Inosine-uridine preferring nucleoside hydrolase [Cucumis sativus]
Length=897

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +D ++P VGDCKY K IP+G GG++DSDTLYGLAR+
Sbjct  554  YDLLHMMGRDDIPVGLGDVFAVNQSDSVLPIVGDCKYAKAIPNGCGGYLDSDTLYGLARN  613

Query  9    LPR  1
            LPR
Sbjct  614  LPR  616



>emb|CDY47186.1| BnaAnng08560D [Brassica napus]
Length=325

 Score =   100 bits (248),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARDLPR  1
            MMGRDDIPVGLGD+  +N +DP  P+VGDC Y K IP G GGF+DSDTLYGLARDLPR
Sbjct  1    MMGRDDIPVGLGDMLALNQSDPTSPSVGDCLYAKAIPQGCGGFLDSDTLYGLARDLPR  58



>ref|XP_008438766.1| PREDICTED: uncharacterized protein LOC103483780 isoform X1 [Cucumis 
melo]
Length=896

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +D ++P VGDCKY K IP+G GG++DSDTLYGLAR+
Sbjct  554  YDLLHMMGRDDIPVGLGDVFAVNQSDSVLPTVGDCKYAKAIPNGCGGYLDSDTLYGLARN  613

Query  9    LPR  1
             PR
Sbjct  614  FPR  616



>ref|XP_010420664.1| PREDICTED: uncharacterized protein LOC104706201 [Camelina sativa]
Length=893

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VG CKY K +P GSGGF+DSDTLYGLARD
Sbjct  561  YDLLHMMGRDDIPVGLGDMLALNQSDPIFPPVGGCKYVKAVPRGSGGFLDSDTLYGLARD  620

Query  9    LPR  1
            LPR
Sbjct  621  LPR  623


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G+C+Y++ IP G
Sbjct  86   YDLLHMMGRDDIPVGVGGEGGIRDDGTIHSDVGGYFP--IIEQGMTTAGECRYRQAIPKG  143

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ YG  +  
Sbjct  144  PGGLLDIDSNYGFRKQF  160



>ref|XP_008438767.1| PREDICTED: uncharacterized protein LOC103483780 isoform X2 [Cucumis 
melo]
 ref|XP_008438769.1| PREDICTED: uncharacterized protein LOC103483780 isoform X2 [Cucumis 
melo]
Length=807

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N +D ++P VGDCKY K IP+G GG++DSDTLYGLAR+
Sbjct  465  YDLLHMMGRDDIPVGLGDVFAVNQSDSVLPTVGDCKYAKAIPNGCGGYLDSDTLYGLARN  524

Query  9    LPR  1
             PR
Sbjct  525  FPR  527



>emb|CDX92576.1| BnaA10g16150D [Brassica napus]
Length=863

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVG+GD+  +N +DPI P VGDCKY K IP G GGF+DSDTLYG ARD
Sbjct  556  YDLLHMMGRDDIPVGMGDLLALNQSDPIFPPVGDCKYVKAIPQGCGGFLDSDTLYGFARD  615

Query  9    LPR  1
            LPR
Sbjct  616  LPR  618


 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 41/77 (53%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDD+ VG+G             DV   FP  I +  +   G C+Y++ +P G
Sbjct  83   YDLLHMMGRDDVAVGVGGEGAILDDGTILSDVGGYFP--IIEQGMTTTGKCRYRQAVPKG  140

Query  57   SGGFIDSDTLYGLARDL  7
            SGG +D D+ YG  +  
Sbjct  141  SGGLLDIDSNYGFRKQF  157



>ref|XP_010693771.1| PREDICTED: uncharacterized protein LOC104906683 [Beta vulgaris 
subsp. vulgaris]
Length=773

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VGLGDVF  N +D     VGDCKY K IPHGSGGF+DSDTLYGLAR+
Sbjct  443  YDLLHMMGRDDIQVGLGDVFAKNQSDSFFSAVGDCKYVKAIPHGSGGFLDSDTLYGLARE  502

Query  9    LPR  1
             PR
Sbjct  503  FPR  505


 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 45/78 (58%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+  MMGRDDIPVG+G         D+ P     + I +  +   G C+Y++ IP G G
Sbjct  86   YDMLFMMGRDDIPVGVGGEGGISRDGDISPDVGGYLPIIEQGMTTTGYCRYRQAIPLGQG  145

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D DT YGL +D LP+
Sbjct  146  GRLDIDTNYGLRKDFLPQ  163



>ref|XP_009120935.1| PREDICTED: uncharacterized protein LOC103845800 [Brassica rapa]
Length=888

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVG+GD+  +N +DPI P VGDCKY K IP G GGF+DSDTLYG ARD
Sbjct  556  YDLLHMMGRDDIPVGMGDLLALNQSDPIFPPVGDCKYVKAIPQGCGGFLDSDTLYGFARD  615

Query  9    LPR  1
            LPR
Sbjct  616  LPR  618


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 41/77 (53%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDD+ VG+G             DV   FP  I +  +   G C+Y++ +P G
Sbjct  83   YDLLHMMGRDDVAVGVGGEGAILDDGTILSDVGGYFP--IIEQGMTTTGKCRYRQAVPKG  140

Query  57   SGGFIDSDTLYGLARDL  7
            SGG +D D+ YG  +  
Sbjct  141  SGGLLDIDSNYGFRKQF  157



>gb|KEH32264.1| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=809

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF MN  DPI   VG CKY K IPHG+GG+IDSDTLYGLAR 
Sbjct  465  YDILHMMGRDDIPVGLGDVFAMNQRDPIFGAVGGCKYVKAIPHGNGGYIDSDTLYGLARY  524

Query  9    LPR  1
            LPR
Sbjct  525  LPR  527



>ref|NP_197387.1| nucleoside hydrolase 3 [Arabidopsis thaliana]
 gb|AAL84950.1| AT5g18860/F17K4_110 [Arabidopsis thaliana]
 gb|AAM91461.1| AT5g18860/F17K4_110 [Arabidopsis thaliana]
 gb|AED92622.1| nucleoside hydrolase 3 [Arabidopsis thaliana]
Length=890

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VG CKY K IP G GGF+DSDTLYGLARD
Sbjct  558  YDLLHMMGRDDIPVGLGDMLALNQSDPIFPPVGGCKYVKAIPRGCGGFLDSDTLYGLARD  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620


 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMM RDDIPVG+G             DV   FP  I +  +   G+C+Y++ IP G
Sbjct  82   YDLLHMMDRDDIPVGVGGEGGISDDGTIHSDVGGYFP--IIEQGMTTTGECRYRQAIPKG  139

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ YG  +  
Sbjct  140  LGGLLDIDSNYGFRKQF  156



>emb|CDO98943.1| unnamed protein product [Coffea canephora]
Length=881

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +N + P    VGDCKY K IPHGSGGF+DSDTLYGLARD
Sbjct  548  YDLLHMMGRDDIPVGLGDVFALNQSVPK-SAVGDCKYNKAIPHGSGGFLDSDTLYGLARD  606

Query  9    LPR  1
            LPR
Sbjct  607  LPR  609



>gb|KFK26123.1| hypothetical protein AALP_AA8G206700 [Arabis alpina]
Length=896

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+F +N +D I P VGDCKY K +P G GGF+DSDTLYG ARD
Sbjct  557  YDLLHMMGRDDIPVGLGDMFALNQSDLIFPPVGDCKYVKAVPRGCGGFLDSDTLYGFARD  616

Query  9    LPR  1
            LPR
Sbjct  617  LPR  619


 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G C+Y++ +P G
Sbjct  84   YDLLHMMGRDDIPVGVGGEGGILDDGTILPDVGGYFP--IIEQGMTTTGGCRYRQAVPKG  141

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ YG  +  
Sbjct  142  LGGLLDIDSNYGFRKQF  158



>gb|KDP23570.1| hypothetical protein JCGZ_23403 [Jatropha curcas]
Length=785

 Score =   101 bits (251),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG+VF +  A P    +GDCKY K IPHGSGGF+DSDTLYGLAR+
Sbjct  479  YDVLHMMGRDDIAVGLGNVFAVGQAYPFFKAIGDCKYSKAIPHGSGGFLDSDTLYGLARE  538

Query  9    LPR  1
            LPR
Sbjct  539  LPR  541


 Score = 49.3 bits (116),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YD+  MMGRDDIPVG+G    +     ++PNV              G+C+Y++ IP G  
Sbjct  93   YDILFMMGRDDIPVGVGGEGSILSNGTLLPNVGGYFPIIDQRMSTSGECRYRQAIPVGRT  152

Query  51   GFIDSDTLYGLAR  13
            G  D +T YGL +
Sbjct  153  GRQDINTNYGLRK  165



>ref|XP_010454139.1| PREDICTED: uncharacterized protein LOC104735943 [Camelina sativa]
Length=893

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VG CKY K +P G GGF+DSDTLYGLARD
Sbjct  561  YDLLHMMGRDDIPVGLGDMLALNQSDPIFPPVGGCKYVKAVPRGCGGFLDSDTLYGLARD  620

Query  9    LPR  1
            LPR
Sbjct  621  LPR  623


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G+C+Y++ IP G
Sbjct  86   YDLLHMMGRDDIPVGVGGEGGIRDDGTIHSDVGGYFP--IIEQGMTTTGECRYRQAIPKG  143

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ YG  +  
Sbjct  144  PGGLLDIDSNYGFRKQF  160



>ref|XP_010492928.1| PREDICTED: uncharacterized protein LOC104770230 isoform X3 [Camelina 
sativa]
Length=542

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VG CKY K +P G GGF+DSDTLYGLARD
Sbjct  210  YDLLHMMGRDDIPVGLGDMLALNQSDPIFPPVGGCKYVKAVPRGCGGFLDSDTLYGLARD  269

Query  9    LPR  1
            +PR
Sbjct  270  VPR  272



>ref|XP_006857013.1| hypothetical protein AMTR_s00197p00032700 [Amborella trichopoda]
 gb|ERN18480.1| hypothetical protein AMTR_s00197p00032700 [Amborella trichopoda]
Length=883

 Score =   100 bits (250),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGD F +  A+P +  VG+CKY + +P+GSGGF+DSDTL+GLARD
Sbjct  553  YDVLHMMGRDDIPVGLGDFFALGQANPSMSAVGECKYSQAVPYGSGGFLDSDTLFGLARD  612

Query  9    LPR  1
            LPR
Sbjct  613  LPR  615


 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MM RDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  84   YDILYMMDRDDIAVGVGGEGGILFDGTILPNVGGYASIIEQGISTVAGCRYRQAIPPGLG  143

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D DT YG+ ++ LP+
Sbjct  144  GRLDIDTNYGVRKNFLPQ  161



>ref|XP_010024478.1| PREDICTED: uncharacterized protein LOC104414950 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010024479.1| PREDICTED: uncharacterized protein LOC104414950 isoform X1 [Eucalyptus 
grandis]
 gb|KCW60925.1| hypothetical protein EUGRSUZ_H03659 [Eucalyptus grandis]
Length=887

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG VF +N +D I   VGDCKY K IPHGSGG +DSDTLYGLAR 
Sbjct  550  YDMLHMMGRDDIPVGLGKVFALNQSDAIFSAVGDCKYVKAIPHGSGGLLDSDTLYGLART  609

Query  9    LPR  1
            LPR
Sbjct  610  LPR  612



>gb|KCW61722.1| hypothetical protein EUGRSUZ_H04434 [Eucalyptus grandis]
Length=870

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGD F     DP  P +GDCKY+K IPHG GGF+DSDTLYGL+RD
Sbjct  530  YDVLHMMGRDDIPVGLGDAFAHEQTDPTFPAIGDCKYRKAIPHGGGGFLDSDTLYGLSRD  589

Query  9    LP  4
            LP
Sbjct  590  LP  591



>ref|XP_006356996.1| PREDICTED: uncharacterized protein LOC102590451 [Solanum tuberosum]
Length=887

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD F MN +D +   VGDC+Y KVIP GSGG+++SDTLYGLAR 
Sbjct  553  YDLLHMMGRDDIPVGLGDGFAMNQSDTVFSAVGDCRYSKVIPQGSGGYLNSDTLYGLARS  612

Query  9    LPR  1
            LPR
Sbjct  613  LPR  615


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  84   YDILYMMGRDDIAVGVGGEGGILPDSTILPNVGGYLPMIDQGNGTAGYCRYRQTIPVGHG  143

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YG  +  
Sbjct  144  GRLDIDSNYGFRKSF  158



>ref|XP_010025128.1| PREDICTED: uncharacterized protein LOC104415509 isoform X2 [Eucalyptus 
grandis]
Length=907

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGD F     DP  P +GDCKY+K IPHG GGF+DSDTLYGL+RD
Sbjct  540  YDVLHMMGRDDIPVGLGDAFAHEQTDPTFPAIGDCKYRKAIPHGGGGFLDSDTLYGLSRD  599

Query  9    LP  4
            LP
Sbjct  600  LP  601



>ref|XP_010687819.1| PREDICTED: uncharacterized protein LOC104901895 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VGLGDVF  N +DP +  VGDCKY K IPHGSGGF+DSDTLYGLAR 
Sbjct  532  YDLLHMMGRDDIQVGLGDVFAKNQSDPSLFAVGDCKYIKAIPHGSGGFLDSDTLYGLARG  591

Query  9    LPR  1
             PR
Sbjct  592  FPR  594


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+  MMGRDDI VG+G         D+FP     + I +  +   G C+Y++ IP G G
Sbjct  84   YDMLFMMGRDDILVGVGGEGGISRDGDIFPDVGGYLPIIEQGMTTTGYCRYRQAIPLGQG  143

Query  51   GFIDSDTLYGLARDL  7
            G +D+DT YGL +D 
Sbjct  144  GRLDTDTNYGLRKDF  158



>ref|XP_010025127.1| PREDICTED: uncharacterized protein LOC104415509 isoform X1 [Eucalyptus 
grandis]
Length=919

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGD F     DP  P +GDCKY+K IPHG GGF+DSDTLYGL+RD
Sbjct  552  YDVLHMMGRDDIPVGLGDAFAHEQTDPTFPAIGDCKYRKAIPHGGGGFLDSDTLYGLSRD  611

Query  9    LP  4
            LP
Sbjct  612  LP  613



>ref|XP_010279299.1| PREDICTED: uncharacterized protein LOC104613245 isoform X2 [Nelumbo 
nucifera]
Length=796

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +F +   +P  P+VGDCKY K IPHGSGGF+DSDTLYG AR+
Sbjct  464  YDILHMMGRDDIPVGLGSMFAIGEVNPYFPSVGDCKYVKAIPHGSGGFLDSDTLYGFARN  523

Query  9    LPR  1
            LPR
Sbjct  524  LPR  526


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 37/68 (54%), Gaps = 14/68 (21%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSGGFIDS  37
            MMGRDDI VG+G    +     I+PNVG               C+Y++ IP GSGG +D 
Sbjct  1    MMGRDDIAVGIGGEGGILPNGTILPNVGGFLPLIDQGTSTAGGCRYRQAIPLGSGGRLDI  60

Query  36   DTLYGLAR  13
            DT YGL +
Sbjct  61   DTNYGLRK  68



>ref|XP_010279283.1| PREDICTED: uncharacterized protein LOC104613245 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010279292.1| PREDICTED: uncharacterized protein LOC104613245 isoform X1 [Nelumbo 
nucifera]
Length=878

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +F +   +P  P+VGDCKY K IPHGSGGF+DSDTLYG AR+
Sbjct  546  YDILHMMGRDDIPVGLGSMFAIGEVNPYFPSVGDCKYVKAIPHGSGGFLDSDTLYGFARN  605

Query  9    LPR  1
            LPR
Sbjct  606  LPR  608


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP GSG
Sbjct  78   YDILYMMGRDDIAVGIGGEGGILPNGTILPNVGGFLPLIDQGTSTAGGCRYRQAIPLGSG  137

Query  51   GFIDSDTLYGLAR  13
            G +D DT YGL +
Sbjct  138  GRLDIDTNYGLRK  150



>ref|XP_006286427.1| hypothetical protein CARUB_v10003350mg [Capsella rubella]
 gb|EOA19325.1| hypothetical protein CARUB_v10003350mg [Capsella rubella]
Length=886

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N ++P+  +VGDC Y K +P G GGF+DSDTLYGLARD
Sbjct  546  YDLLHMMGRDDIPVGLGDMLALNQSEPVFSSVGDCMYAKAVPQGCGGFLDSDTLYGLARD  605

Query  9    LPR  1
            LPR
Sbjct  606  LPR  608



>ref|XP_010492926.1| PREDICTED: uncharacterized protein LOC104770230 isoform X2 [Camelina 
sativa]
Length=893

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VG CKY K +P G GGF+DSDTLYGLARD
Sbjct  561  YDLLHMMGRDDIPVGLGDMLALNQSDPIFPPVGGCKYVKAVPRGCGGFLDSDTLYGLARD  620

Query  9    LPR  1
            +PR
Sbjct  621  VPR  623


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G+C+Y++ IP G
Sbjct  86   YDLLHMMGRDDIPVGVGGEGGIRDDGTIHSDVGGYFP--IIEQGMTTTGECRYRQAIPKG  143

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ YG  +  
Sbjct  144  PGGLLDIDSNYGFRKQF  160



>ref|XP_010492925.1| PREDICTED: uncharacterized protein LOC104770230 isoform X1 [Camelina 
sativa]
 ref|XP_010492927.1| PREDICTED: uncharacterized protein LOC104770230 isoform X1 [Camelina 
sativa]
Length=893

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD+  +N +DPI P VG CKY K +P G GGF+DSDTLYGLARD
Sbjct  561  YDLLHMMGRDDIPVGLGDMLALNQSDPIFPPVGGCKYVKAVPRGCGGFLDSDTLYGLARD  620

Query  9    LPR  1
            +PR
Sbjct  621  VPR  623


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 18/77 (23%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG-------------DV---FPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL HMMGRDDIPVG+G             DV   FP  I +  +   G+C+Y++ IP G
Sbjct  86   YDLLHMMGRDDIPVGVGGEGGIRDDGTIHSDVGGYFP--IIEQGMTTTGECRYRQAIPKG  143

Query  57   SGGFIDSDTLYGLARDL  7
             GG +D D+ YG  +  
Sbjct  144  PGGLLDIDSNYGFRKQF  160



>emb|CDY02599.1| BnaC02g08360D [Brassica napus]
Length=891

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLG +  +N +DP  P+VGDC Y K IP G GGF+DSDTLYGLARD
Sbjct  536  YDLLHMMGRDDIPVGLGYLLALNQSDPTSPSVGDCLYAKAIPQGCGGFLDSDTLYGLARD  595

Query  9    LPR  1
            LPR
Sbjct  596  LPR  598


 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGL---------GDVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL HMMGRDDI VG+         G + P     + I D  +   G C+Y++ IP G  
Sbjct  78   YDLLHMMGRDDIAVGVGGEGVILDDGTILPDVGGYLPIIDQGMATAGGCRYRQTIPKGRK  137

Query  51   GFIDSDTLYGLAR  13
            G +D D+ YG  +
Sbjct  138  GLLDMDSNYGFRK  150



>gb|KDO48505.1| hypothetical protein CISIN_1g0037942mg [Citrus sinensis]
Length=795

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +   +P  P +G CKY K IP GSGGF+DSDTLYGLARD
Sbjct  456  YDLLHMMGRDDIPVGLGDVFAVGEVNPKFPPIGGCKYAKAIPLGSGGFLDSDTLYGLARD  515

Query  9    LPR  1
            LPR
Sbjct  516  LPR  518



>ref|XP_006433230.1| hypothetical protein CICLE_v10003811mg, partial [Citrus clementina]
 gb|ESR46470.1| hypothetical protein CICLE_v10003811mg, partial [Citrus clementina]
Length=879

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +   +P  P +G CKY K IP GSGGF+DSDTLYGLARD
Sbjct  537  YDLLHMMGRDDIPVGLGDVFAVGEVNPKFPPIGGCKYAKAIPLGSGGFLDSDTLYGLARD  596

Query  9    LPR  1
            LPR
Sbjct  597  LPR  599



>ref|XP_006480259.1| PREDICTED: uncharacterized protein LOC102619994 [Citrus sinensis]
Length=896

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGDVF +   +P  P +G CKY K IP GSGGF+DSDTLYGLARD
Sbjct  557  YDLLHMMGRDDIPVGLGDVFAVGEVNPKFPPIGGCKYAKAIPLGSGGFLDSDTLYGLARD  616

Query  9    LPR  1
            LPR
Sbjct  617  LPR  619



>ref|XP_004229495.1| PREDICTED: uncharacterized protein LOC101247856 isoform X1 [Solanum 
lycopersicum]
Length=887

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD F MN +D +   VGDC+Y K IP GSGG++DSDTLYGLAR 
Sbjct  553  YDLLHMMGRDDIPVGLGDGFAMNQSDMVSSAVGDCRYSKAIPQGSGGYLDSDTLYGLARS  612

Query  9    LPR  1
            LPR
Sbjct  613  LPR  615


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  84   YDILYMMGRDDITVGVGGEGGILPDSTILPNVGGYLPMIDQGNGTAGYCRYRQTIPVGHG  143

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YG  +  
Sbjct  144  GRLDIDSNYGFRKSF  158



>ref|XP_010323037.1| PREDICTED: uncharacterized protein LOC101247856 isoform X2 [Solanum 
lycopersicum]
Length=799

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDIPVGLGD F MN +D +   VGDC+Y K IP GSGG++DSDTLYGLAR 
Sbjct  465  YDLLHMMGRDDIPVGLGDGFAMNQSDMVSSAVGDCRYSKAIPQGSGGYLDSDTLYGLARS  524

Query  9    LPR  1
            LPR
Sbjct  525  LPR  527



>gb|KEH36722.1| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=875

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VG+GD F MN ++     VGDCKY K IPHG+GGF+DSDTL+GLARD
Sbjct  537  YDLLHMMGRDDIKVGIGDFFAMNQSN--FSPVGDCKYVKAIPHGNGGFLDSDTLFGLARD  594

Query  9    LPR  1
            LPR
Sbjct  595  LPR  597


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  81   YDILYMMGRDDIAVGVGGEGGILPNGTILPNVGGYLPIIEQGMTTAGYCRYRQAIPVGFG  140

Query  51   GFIDSDTLYGLAR  13
            G +D DT  G+ +
Sbjct  141  GRLDIDTNLGIRK  153



>gb|AES64298.2| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=885

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VG+GD F MN ++     VGDCKY K IPHG+GGF+DSDTL+GLARD
Sbjct  547  YDLLHMMGRDDIKVGIGDFFAMNQSN--FSPVGDCKYVKAIPHGNGGFLDSDTLFGLARD  604

Query  9    LPR  1
            LPR
Sbjct  605  LPR  607


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  81   YDILYMMGRDDIAVGVGGEGGILPNGTILPNVGGYLPIIEQGMTTAGYCRYRQAIPVGFG  140

Query  51   GFIDSDTLYGLAR  13
            G +D DT  G+ +
Sbjct  141  GRLDIDTNLGIRK  153



>ref|XP_003594047.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Medicago truncatula]
Length=882

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VG+GD F MN ++     VGDCKY K IPHG+GGF+DSDTL+GLARD
Sbjct  544  YDLLHMMGRDDIKVGIGDFFAMNQSN--FSPVGDCKYVKAIPHGNGGFLDSDTLFGLARD  601

Query  9    LPR  1
            LPR
Sbjct  602  LPR  604


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  78   YDILYMMGRDDIAVGVGGEGGILPNGTILPNVGGYLPIIEQGMTTAGYCRYRQAIPVGFG  137

Query  51   GFIDSDTLYGLAR  13
            G +D DT  G+ +
Sbjct  138  GRLDIDTNLGIRK  150



>gb|KEH36723.1| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=800

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VG+GD F MN ++     VGDCKY K IPHG+GGF+DSDTL+GLARD
Sbjct  462  YDLLHMMGRDDIKVGIGDFFAMNQSN--FSPVGDCKYVKAIPHGNGGFLDSDTLFGLARD  519

Query  9    LPR  1
            LPR
Sbjct  520  LPR  522



>ref|XP_010242573.1| PREDICTED: uncharacterized protein LOC104586891 [Nelumbo nucifera]
 ref|XP_010242574.1| PREDICTED: uncharacterized protein LOC104586891 [Nelumbo nucifera]
Length=883

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGD+F +  A+P  P+VG CK+ K IPHGSGGF+DSDT YG AR 
Sbjct  545  YDVLHMMGRDDIPVGLGDMFAIGEANPSFPSVGGCKHVKAIPHGSGGFLDSDTFYGFARH  604

Query  9    LPR  1
            LPR
Sbjct  605  LPR  607



>ref|XP_010102681.1| hypothetical protein L484_002096 [Morus notabilis]
 gb|EXB93889.1| hypothetical protein L484_002096 [Morus notabilis]
Length=898

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDD+PVGLGDVF M       P +GDC Y K +PHGSGGF+DSDTLYGLAR 
Sbjct  528  YDVLHMMGRDDMPVGLGDVFAMGQTHSAFPAIGDCTYIKYVPHGSGGFLDSDTLYGLARH  587

Query  9    LPR  1
            LPR
Sbjct  588  LPR  590


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 42/78 (54%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGD---VFP-----------MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+  MM RDDIPVG+G    +FP           + I D      G+C+Y++ IP G G
Sbjct  79   YDILFMMDRDDIPVGVGGEGGIFPNATILSNVGGFLPIIDQGTSTAGECRYRQAIPVGRG  138

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D +T YGL    LPR
Sbjct  139  GRLDINTNYGLRTAFLPR  156



>gb|KGN66123.1| hypothetical protein Csa_1G572440 [Cucumis sativus]
Length=880

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLGDVF +  A P+ P +GDCKY K IP GSGG +DSDTLYG ARD
Sbjct  560  YDVLHMMGRDDISVGLGDVFAIGEAHPLYPPIGDCKYTKAIPLGSGGLLDSDTLYGFARD  619

Query  9    LPR  1
            LPR
Sbjct  620  LPR  622



>ref|XP_010660036.1| PREDICTED: uncharacterized protein LOC100245166 isoform X4 [Vitis 
vinifera]
Length=696

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF +   +   P  GDCKY+K IP G GG +DSDTLYG ARD
Sbjct  365  YDVLHMMGRDDIPVGLGDVFAIGQKEQTFPLFGDCKYRKAIPLGGGGLLDSDTLYGFARD  424

Query  9    LPR  1
            LPR
Sbjct  425  LPR  427



>ref|XP_008450714.1| PREDICTED: uncharacterized protein LOC103492210 isoform X2 [Cucumis 
melo]
Length=778

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLGD+F +    P+ P +GDCKY K IP GSGGF+DSDTLYG ARD
Sbjct  458  YDVLHMMGRDDISVGLGDLFAIGEEHPLFPPIGDCKYTKAIPLGSGGFLDSDTLYGFARD  517

Query  9    LPR  1
            LPR
Sbjct  518  LPR  520



>ref|XP_008450713.1| PREDICTED: uncharacterized protein LOC103492210 isoform X1 [Cucumis 
melo]
Length=882

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLGD+F +    P+ P +GDCKY K IP GSGGF+DSDTLYG ARD
Sbjct  562  YDVLHMMGRDDISVGLGDLFAIGEEHPLFPPIGDCKYTKAIPLGSGGFLDSDTLYGFARD  621

Query  9    LPR  1
            LPR
Sbjct  622  LPR  624



>ref|XP_007030760.1| Inosine-uridine preferring nucleoside hydrolase family protein 
[Theobroma cacao]
 gb|EOY11262.1| Inosine-uridine preferring nucleoside hydrolase family protein 
[Theobroma cacao]
Length=945

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMG DDIPVGLG  F +  A+P    +GDCKY K IP+GSGG++DSDTLYG ARD
Sbjct  557  YDILHMMGHDDIPVGLGKAFAVGQANPAFSAIGDCKYSKAIPYGSGGYLDSDTLYGHARD  616

Query  9    LPR  1
            LPR
Sbjct  617  LPR  619



>ref|XP_010660033.1| PREDICTED: uncharacterized protein LOC100245166 isoform X1 [Vitis 
vinifera]
Length=935

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF +   +   P  GDCKY+K IP G GG +DSDTLYG ARD
Sbjct  604  YDVLHMMGRDDIPVGLGDVFAIGQKEQTFPLFGDCKYRKAIPLGGGGLLDSDTLYGFARD  663

Query  9    LPR  1
            LPR
Sbjct  664  LPR  666


 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL  MMGRDDIPVG+G          + P     + I D      G C+Y++ IP G+ 
Sbjct  146  YDLLFMMGRDDIPVGVGGEGGILPNGTILPDVGGYLPIIDQGTSTAGGCRYRQAIPMGAK  205

Query  51   GFIDSDTLYGLAR  13
            G +D DT+YGL +
Sbjct  206  GLLDIDTMYGLRK  218



>ref|XP_010660034.1| PREDICTED: uncharacterized protein LOC100245166 isoform X2 [Vitis 
vinifera]
Length=889

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF +   +   P  GDCKY+K IP G GG +DSDTLYG ARD
Sbjct  558  YDVLHMMGRDDIPVGLGDVFAIGQKEQTFPLFGDCKYRKAIPLGGGGLLDSDTLYGFARD  617

Query  9    LPR  1
            LPR
Sbjct  618  LPR  620


 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL  MMGRDDIPVG+G          + P     + I D      G C+Y++ IP G+ 
Sbjct  100  YDLLFMMGRDDIPVGVGGEGGILPNGTILPDVGGYLPIIDQGTSTAGGCRYRQAIPMGAK  159

Query  51   GFIDSDTLYGLAR  13
            G +D DT+YGL +
Sbjct  160  GLLDIDTMYGLRK  172



>ref|XP_010660035.1| PREDICTED: uncharacterized protein LOC100245166 isoform X3 [Vitis 
vinifera]
Length=759

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF +   +   P  GDCKY+K IP G GG +DSDTLYG ARD
Sbjct  604  YDVLHMMGRDDIPVGLGDVFAIGQKEQTFPLFGDCKYRKAIPLGGGGLLDSDTLYGFARD  663

Query  9    LPR  1
            LPR
Sbjct  664  LPR  666


 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL  MMGRDDIPVG+G          + P     + I D      G C+Y++ IP G+ 
Sbjct  146  YDLLFMMGRDDIPVGVGGEGGILPNGTILPDVGGYLPIIDQGTSTAGGCRYRQAIPMGAK  205

Query  51   GFIDSDTLYGLAR  13
            G +D DT+YGL +
Sbjct  206  GLLDIDTMYGLRK  218



>emb|CBI34322.3| unnamed protein product [Vitis vinifera]
Length=858

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLGDVF +   +   P  GDCKY+K IP G GG +DSDTLYG ARD
Sbjct  527  YDVLHMMGRDDIPVGLGDVFAIGQKEQTFPLFGDCKYRKAIPLGGGGLLDSDTLYGFARD  586

Query  9    LPR  1
            LPR
Sbjct  587  LPR  589


 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL  MMGRDDIPVG+G          + P     + I D      G C+Y++ IP G+ 
Sbjct  89   YDLLFMMGRDDIPVGVGGEGGILPNGTILPDVGGYLPIIDQGTSTAGGCRYRQAIPMGAK  148

Query  51   GFIDSDTLYGLAR  13
            G +D DT+YGL +
Sbjct  149  GLLDIDTMYGLRK  161



>ref|XP_008246540.1| PREDICTED: uncharacterized protein LOC103344698 [Prunus mume]
Length=868

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +    P++GDC Y   IP GSGG +DSDTLYG ARD
Sbjct  537  YDILHMMGRDDIPVGLGNVFAVGQSHSEFPSLGDCWYSSSIPQGSGGSLDSDTLYGFARD  596

Query  9    LPR  1
            LPR
Sbjct  597  LPR  599



>ref|XP_007208173.1| hypothetical protein PRUPE_ppa001219mg [Prunus persica]
 gb|EMJ09372.1| hypothetical protein PRUPE_ppa001219mg [Prunus persica]
Length=878

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +    P++GDC+Y   IP GSGG +DSDTLYG ARD
Sbjct  547  YDILHMMGRDDIPVGLGNVFAVGQSHSEFPSLGDCRYSSSIPQGSGGSLDSDTLYGFARD  606

Query  9    LPR  1
            LPR
Sbjct  607  LPR  609



>gb|AAT38027.1| putative inosine-uridine preferring nucleoside hydrolase [Oryza 
sativa Japonica Group]
Length=584

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   + I     P +G C     IPHGSGGFIDSDTLYGLAR 
Sbjct  259  YDILHMMGRDDIPVGLGNTTALGI-----PTLG-CNNSYAIPHGSGGFIDSDTLYGLARS  312

Query  9    LPR  1
            LPR
Sbjct  313  LPR  315



>gb|AAT85087.1| putative inosine-uridine preferring nucleoside hydrolase [Oryza 
sativa Japonica Group]
Length=599

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   + I     P +G C     IPHGSGGFIDSDTLYGLAR 
Sbjct  274  YDILHMMGRDDIPVGLGNTTALGI-----PTLG-CNNSYAIPHGSGGFIDSDTLYGLARS  327

Query  9    LPR  1
            LPR
Sbjct  328  LPR  330



>ref|XP_010904834.1| PREDICTED: uncharacterized protein LOC105032165 [Elaeis guineensis]
Length=878

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+V  +       P++G CKY K IPHGSGGF+DSDT+YGLAR 
Sbjct  549  YDVLHMMGRDDIPVGLGNVTALGT-----PSLG-CKYVKAIPHGSGGFLDSDTVYGLART  602

Query  9    LPR  1
            LPR
Sbjct  603  LPR  605


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSG  52
            YD+ +MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP GSG
Sbjct  79   YDILYMMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPIGSG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YGL R  
Sbjct  139  GRLDIDSNYGLRRSF  153



>ref|XP_009373945.1| PREDICTED: uncharacterized protein LOC103962891 isoform X2 [Pyrus 
x bretschneideri]
Length=859

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG AR 
Sbjct  538  YDILHMMGRDDIPVGLGNVFAVGQSYSSFTSLGDCTYISSIPQGSGGSLDSDTLYGFARA  597

Query  9    LPR  1
            LPR
Sbjct  598  LPR  600


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+  +M RDDIPVG+G    +   D I PNVG               C+Y++ IP G G
Sbjct  79   YDILSVMDRDDIPVGVGGEGGILPNDTIQPNVGGYLPIIDQGPSTAGGCRYRQSIPPGQG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D +T YGL + L
Sbjct  139  GRLDVNTNYGLRKAL  153



>ref|XP_009373944.1| PREDICTED: uncharacterized protein LOC103962891 isoform X1 [Pyrus 
x bretschneideri]
Length=859

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG AR 
Sbjct  538  YDILHMMGRDDIPVGLGNVFAVGQSYSSFTSLGDCTYISSIPQGSGGSLDSDTLYGFARA  597

Query  9    LPR  1
            LPR
Sbjct  598  LPR  600


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+  +M RDDIPVG+G    +   D I PNVG               C+Y++ IP G G
Sbjct  79   YDILSVMDRDDIPVGVGGEGGILPNDTIQPNVGGYLPIIDQGPSTAGGCRYRQSIPPGQG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D +T YGL + L
Sbjct  139  GRLDVNTNYGLRKAL  153



>ref|NP_001055512.1| Os05g0406100 [Oryza sativa Japonica Group]
 dbj|BAF17426.1| Os05g0406100 [Oryza sativa Japonica Group]
Length=746

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   + I     P +G C     IPHGSGGFIDSDTLYGLAR 
Sbjct  421  YDILHMMGRDDIPVGLGNTTALGI-----PTLG-CNNSYAIPHGSGGFIDSDTLYGLARS  474

Query  9    LPR  1
            LPR
Sbjct  475  LPR  477



>ref|XP_009373947.1| PREDICTED: uncharacterized protein LOC103962891 isoform X4 [Pyrus 
x bretschneideri]
Length=843

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG AR 
Sbjct  538  YDILHMMGRDDIPVGLGNVFAVGQSYSSFTSLGDCTYISSIPQGSGGSLDSDTLYGFARA  597

Query  9    LPR  1
            LPR
Sbjct  598  LPR  600


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+  +M RDDIPVG+G    +   D I PNVG               C+Y++ IP G G
Sbjct  79   YDILSVMDRDDIPVGVGGEGGILPNDTIQPNVGGYLPIIDQGPSTAGGCRYRQSIPPGQG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D +T YGL + L
Sbjct  139  GRLDVNTNYGLRKAL  153



>ref|XP_008388984.1| PREDICTED: uncharacterized protein LOC103451348 [Malus domestica]
Length=844

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG AR 
Sbjct  537  YDILHMMGRDDIPVGLGNVFAVGQSYSSFSSLGDCTYISSIPQGSGGSLDSDTLYGFARA  596

Query  9    LPR  1
            LPR
Sbjct  597  LPR  599



>ref|XP_009373946.1| PREDICTED: uncharacterized protein LOC103962891 isoform X3 [Pyrus 
x bretschneideri]
Length=859

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG AR 
Sbjct  538  YDILHMMGRDDIPVGLGNVFAVGQSYSSFTSLGDCTYISSIPQGSGGSLDSDTLYGFARA  597

Query  9    LPR  1
            LPR
Sbjct  598  LPR  600



>gb|EMS45992.1| hypothetical protein TRIUR3_02299 [Triticum urartu]
Length=1530

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +  +       P++G C+Y K IPHGSGGF+D+DTL+GLAR 
Sbjct  593  YDVLHMMGRDDIPVGLGKITAL-----CAPDLG-CEYVKAIPHGSGGFLDTDTLFGLARV  646

Query  9    LPR  1
            LPR
Sbjct  647  LPR  649


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGD---------VFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G          ++P       I D  +  +G+C+Y++ IP GSG
Sbjct  124  YDLLYMMGRDDIAVGVGGEGGISNDGRIYPHVGGYFPIIDQGMSTIGECRYRQSIPQGSG  183

Query  51   GFIDSDTLYGLARDL  7
            G +D +  YG+ R++
Sbjct  184  GRLDINANYGVRREI  198



>gb|EEE63686.1| hypothetical protein OsJ_18504 [Oryza sativa Japonica Group]
Length=828

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   + I     P +G C     IPHGSGGFIDSDTLYGLAR 
Sbjct  503  YDILHMMGRDDIPVGLGNTTALGI-----PTLG-CNNSYAIPHGSGGFIDSDTLYGLARS  556

Query  9    LPR  1
            LPR
Sbjct  557  LPR  559



>gb|EEC79209.1| hypothetical protein OsI_19926 [Oryza sativa Indica Group]
Length=870

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   + I     P +G C     IPHGSGGFIDSDTLYGLAR 
Sbjct  545  YDILHMMGRDDIPVGLGNTTALGI-----PTLG-CNNSYAIPHGSGGFIDSDTLYGLARS  598

Query  9    LPR  1
            LPR
Sbjct  599  LPR  601



>ref|XP_006655311.1| PREDICTED: uncharacterized protein LOC102712817 [Oryza brachyantha]
Length=834

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   + +     P +G C     IPHGSGGFIDSDTLYGLAR 
Sbjct  506  YDIVHMMGRDDIPVGLGNTTALGM-----PTLG-CNNSYAIPHGSGGFIDSDTLYGLARS  559

Query  9    LPR  1
            LPR
Sbjct  560  LPR  562



>ref|XP_004962124.1| PREDICTED: uncharacterized protein LOC101758353 [Setaria italica]
Length=864

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   +       P +G CK    IPHGSGGF+DSDTLYGLAR 
Sbjct  536  YDVLHMMGRDDIPVGLGNTNALGN-----PTLG-CKNSYAIPHGSGGFVDSDTLYGLARS  589

Query  9    LPR  1
            LPR
Sbjct  590  LPR  592



>gb|EMT21035.1| hypothetical protein F775_19841 [Aegilops tauschii]
Length=1449

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +  +       P++G C+Y K IPHGSGGF+D+DTL+GLA  
Sbjct  586  YDVLHMMGRDDIPVGLGKITALGA-----PDLG-CEYVKAIPHGSGGFLDTDTLFGLAWV  639

Query  9    LPR  1
            LPR
Sbjct  640  LPR  642


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGD---------VFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G          ++P       I D  +  +G+C+Y++ IP GSG
Sbjct  117  YDLLYMMGRDDIAVGVGGEGGISNDGRIYPHVGGYFPIIDQGMSTIGECRYRQSIPQGSG  176

Query  51   GFIDSDTLYGLARDL  7
            G +D +  YG+ R++
Sbjct  177  GRLDINANYGVRREI  191



>ref|XP_008359878.1| PREDICTED: uncharacterized protein LOC103423569 isoform X1 [Malus 
domestica]
Length=859

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG AR 
Sbjct  538  YDILHMMGRDDIPVGLGNVFAVGQSYXSFTSLGDCXYISSIPQGSGGSLDSDTLYGFARA  597

Query  9    LP  4
            LP
Sbjct  598  LP  599



>ref|XP_002441080.1| hypothetical protein SORBIDRAFT_09g019990 [Sorghum bicolor]
 gb|EES19510.1| hypothetical protein SORBIDRAFT_09g019990 [Sorghum bicolor]
Length=821

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 44/63 (70%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   M       P +G C     IPHGSGGF+DSDTLYGLAR 
Sbjct  494  YDVLHMMGRDDIPVGLGNTTAMGS-----PTLG-CNNSYAIPHGSGGFVDSDTLYGLARS  547

Query  9    LPR  1
            LPR
Sbjct  548  LPR  550



>ref|XP_009402039.1| PREDICTED: uncharacterized protein LOC103985909 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG V  +       P +G CKY K +PHGSGG +DSDTL+GLAR 
Sbjct  538  YDILHMMGRDDIPVGLGHVNALGT-----PTLG-CKYVKAVPHGSGGLLDSDTLFGLART  591

Query  9    LPR  1
            LPR
Sbjct  592  LPR  594



>ref|XP_008795103.1| PREDICTED: uncharacterized protein LOC103710948 isoform X1 [Phoenix 
dactylifera]
Length=879

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+V  +       P++G CKY K IP GSGG +DSDT+YGLAR 
Sbjct  549  YDVLHMMGRDDIPVGLGNVTALGT-----PSLG-CKYVKAIPQGSGGLLDSDTVYGLART  602

Query  9    LPR  1
            LPR
Sbjct  603  LPR  605


 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSG  52
            YD+ +MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+G
Sbjct  79   YDILYMMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPIGAG  138

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YGL R  
Sbjct  139  GRLDIDSNYGLRRSF  153



>ref|XP_008795104.1| PREDICTED: uncharacterized protein LOC103710948 isoform X2 [Phoenix 
dactylifera]
Length=595

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+V  +       P++G CKY K IP GSGG +DSDT+YGLAR 
Sbjct  532  YDVLHMMGRDDIPVGLGNVTALGT-----PSLG-CKYVKAIPQGSGGLLDSDTVYGLART  585

Query  9    LPR  1
            LPR
Sbjct  586  LPR  588


 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSG  52
            YD+ +MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+G
Sbjct  62   YDILYMMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPIGAG  121

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YGL R  
Sbjct  122  GRLDIDSNYGLRRSF  136



>ref|XP_008366854.1| PREDICTED: uncharacterized protein LOC103430488 isoform X2 [Malus 
domestica]
Length=747

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG A  
Sbjct  397  YDILHMMGRDDISVGLGNVFAVGQSYSSFSSLGDCTYISSIPQGSGGSLDSDTLYGFAHA  456

Query  9    LPR  1
            LPR
Sbjct  457  LPR  459



>ref|XP_008366855.1| PREDICTED: uncharacterized protein LOC103430488 isoform X3 [Malus 
domestica]
Length=733

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG A  
Sbjct  383  YDILHMMGRDDISVGLGNVFAVGQSYSSFSSLGDCTYISSIPQGSGGSLDSDTLYGFAHA  442

Query  9    LPR  1
            LPR
Sbjct  443  LPR  445



>ref|XP_008366853.1| PREDICTED: uncharacterized protein LOC103430488 isoform X1 [Malus 
domestica]
Length=888

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG+VF +  +     ++GDC Y   IP GSGG +DSDTLYG A  
Sbjct  538  YDILHMMGRDDISVGLGNVFAVGQSYSSFSSLGDCTYISSIPQGSGGSLDSDTLYGFAHA  597

Query  9    LPR  1
            LPR
Sbjct  598  LPR  600



>ref|XP_006368132.1| PREDICTED: uncharacterized protein LOC102590315 [Solanum tuberosum]
Length=143

 Score = 72.4 bits (176),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  MNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARDLPR  1
            MN +DP+   VGDCKY KVIP GSGGF+DSDTLYGL+R LPR
Sbjct  1    MNQSDPVFSAVGDCKYSKVIPQGSGGFLDSDTLYGLSRSLPR  42



>ref|XP_002441081.1| hypothetical protein SORBIDRAFT_09g020000 [Sorghum bicolor]
 gb|EES19511.1| hypothetical protein SORBIDRAFT_09g020000 [Sorghum bicolor]
Length=827

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 42/63 (67%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G+     I  PI+     C Y   IP GSGG IDSDTLYGLAR 
Sbjct  498  YDILHMMGRDDIPVGRGNT--NAIGTPIL----GCNYASFIPQGSGGLIDSDTLYGLARS  551

Query  9    LPR  1
            LPR
Sbjct  552  LPR  554



>ref|XP_008809281.1| PREDICTED: uncharacterized protein LOC103721032 [Phoenix dactylifera]
Length=875

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG+V  +       P++G CKY K IP GSGG +DSDTLYGLAR 
Sbjct  546  YDVLHMMGRDDILVGLGNVTALGT-----PSLG-CKYVKAIPQGSGGLLDSDTLYGLART  599

Query  9    LPR  1
            LPR
Sbjct  600  LPR  602



>dbj|BAJ90435.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=774

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +  +       P++G C+Y K IPHGSGGF+D+DTL+GL R 
Sbjct  453  YDVLHMMGRDDIPVGLGKITALGT-----PDLG-CEYVKAIPHGSGGFLDTDTLFGLDRV  506

Query  9    LPR  1
            LPR
Sbjct  507  LPR  509



>ref|XP_002961673.1| hypothetical protein SELMODRAFT_403751 [Selaginella moellendorffii]
 gb|EFJ36933.1| hypothetical protein SELMODRAFT_403751 [Selaginella moellendorffii]
Length=866

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+  MMGRDD+ VGLG +F    A       GDCKY++ +P G+ G +DSDTLYGLAR 
Sbjct  573  YDVLDMMGRDDVSVGLGALFARGQA--YSNATGDCKYRRAVPQGTSGLLDSDTLYGLARS  630

Query  9    LPR  1
            LPR
Sbjct  631  LPR  633


 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 37/72 (51%), Gaps = 15/72 (21%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YDL   MGRDDIP+G+G    +     I PNV              G C+Y++ IP G G
Sbjct  126  YDLLFTMGRDDIPIGVGGEGGITQDGTIQPNVGGYVPIIDQMLYTCGSCRYRQAIPPGRG  185

Query  51   -GFIDSDTLYGL  19
             G +D DT YGL
Sbjct  186  AGSLDVDTHYGL  197



>dbj|BAJ97131.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=871

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +  +       P++G C+Y K IPHGSGGF+D+DTL+GL R 
Sbjct  550  YDVLHMMGRDDIPVGLGKITALGT-----PDLG-CEYVKAIPHGSGGFLDTDTLFGLDRV  603

Query  9    LPR  1
            LPR
Sbjct  604  LPR  606


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G          ++P       I D  +  +G+C+Y++ IP GSG
Sbjct  81   YDLLYMMGRDDIAVGVGGEGGISNDGRIYPHVGGYFPIIDQGMSTIGECRYRQSIPQGSG  140

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D +  YG+ R+ LPR
Sbjct  141  GRLDINANYGVRREILPR  158



>dbj|BAJ86153.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=871

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +  +       P++G C+Y K IPHGSGGF+D+DTL+GL R 
Sbjct  550  YDVLHMMGRDDIPVGLGKITALGT-----PDLG-CEYVKAIPHGSGGFLDTDTLFGLDRV  603

Query  9    LPR  1
            LPR
Sbjct  604  LPR  606


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YDL +MMGRDDI VG+G          ++P       I D  +  +G+C+Y++ IP GSG
Sbjct  81   YDLLYMMGRDDIAVGVGGEGGISNDGRIYPHVGGYFPIIDQGMSTIGECRYRQSIPQGSG  140

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D +  YG+ R+ LPR
Sbjct  141  GRLDINANYGVRREILPR  158



>ref|XP_010938876.1| PREDICTED: uncharacterized protein LOC105057859 isoform X6 [Elaeis 
guineensis]
 ref|XP_010938878.1| PREDICTED: uncharacterized protein LOC105057859 isoform X6 [Elaeis 
guineensis]
Length=700

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG++  +       P++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  374  YDVLHMMGRDDILVGLGNINALGT-----PSLG-CKYVNAIPLGSGGLLDSDTLYGLART  427

Query  9    LPR  1
            LPR
Sbjct  428  LPR  430



>gb|EAY98014.1| hypothetical protein OsI_19927 [Oryza sativa Indica Group]
Length=819

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 42/63 (67%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G    +        ++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  491  YDILHMMGRDDIPVGRGSTSALGTE-----SLG-CKYVSAIPQGSGGLLDSDTLYGLARS  544

Query  9    LPR  1
            LPR
Sbjct  545  LPR  547



>gb|EMT33428.1| hypothetical protein F775_14363 [Aegilops tauschii]
Length=759

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   M       P +G C     IP GSGGFIDSDTLYGLAR 
Sbjct  433  YDILHMMGRDDIPVGLGNTTAMGN-----PTLG-CNNVYAIPLGSGGFIDSDTLYGLARL  486

Query  9    LPR  1
            LPR
Sbjct  487  LPR  489



>gb|EEE63687.1| hypothetical protein OsJ_18505 [Oryza sativa Japonica Group]
Length=896

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 42/63 (67%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G    +        ++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  559  YDILHMMGRDDIPVGRGSTSALGTE-----SLG-CKYVSAIPQGSGGLLDSDTLYGLARS  612

Query  9    LPR  1
            LPR
Sbjct  613  LPR  615



>gb|AAT38028.1| putative inosine-uridine preferring nucleoside hydrolase [Oryza 
sativa Japonica Group]
Length=909

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 42/63 (67%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G    +        ++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  559  YDILHMMGRDDIPVGRGSTSALGTE-----SLG-CKYVSAIPQGSGGLLDSDTLYGLARS  612

Query  9    LPR  1
            LPR
Sbjct  613  LPR  615



>ref|NP_001055513.2| Os05g0406200 [Oryza sativa Japonica Group]
 dbj|BAF17427.2| Os05g0406200 [Oryza sativa Japonica Group]
Length=887

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 42/63 (67%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G    +        ++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  559  YDILHMMGRDDIPVGRGSTSALGTE-----SLG-CKYVSAIPQGSGGLLDSDTLYGLARS  612

Query  9    LPR  1
            LPR
Sbjct  613  LPR  615



>ref|XP_004963777.1| PREDICTED: uncharacterized protein LOC101778777 [Setaria italica]
Length=883

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG +  +       P +G C+Y K IPHGSGG +D+DTL+GLAR 
Sbjct  549  YDVLHMMGRDDIPVGLGSITALGA-----PELG-CEYVKAIPHGSGGGLDADTLFGLARM  602

Query  9    LPR  1
            LPR
Sbjct  603  LPR  605



>gb|EMT26893.1| hypothetical protein F775_13652 [Aegilops tauschii]
Length=951

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G    +         +  CKY   IP GSGG +DSDTLYGLAR 
Sbjct  621  YDILHMMGRDDIPVGRGTSTALGTG------ILGCKYVSAIPQGSGGLLDSDTLYGLARS  674

Query  9    LPR  1
            LPR
Sbjct  675  LPR  677


 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGL---------GDVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+         G ++P     + + D  I  VGDC+Y+K +P   G
Sbjct  102  YDILYMMGRDDILVGIGGDGGISDAGTIYPNVGGYLPLIDQGITTVGDCRYRKAVPLEGG  161

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D DT +G+ R  LP+
Sbjct  162  GRLDIDTNWGIRRSFLPQ  179



>dbj|BAJ97741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=865

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   M       P +G C     IP GSGG+IDSDTLYGLAR 
Sbjct  539  YDILHMMGRDDIPVGLGNTTAMGN-----PTLG-CNNVYAIPQGSGGYIDSDTLYGLARL  592

Query  9    LPR  1
            LPR
Sbjct  593  LPR  595


 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 15/74 (20%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHG-S  55
            YD+ +MMGRDDI VG+G    ++ A  I P+V              G C+Y++ IP G  
Sbjct  86   YDILYMMGRDDIAVGVGGDGGISDAGEIRPDVGGYLPLIDQGMSTAGGCRYRQAIPPGRR  145

Query  54   GGFIDSDTLYGLAR  13
            GG +D+DT  GL R
Sbjct  146  GGRLDTDTNGGLRR  159



>ref|XP_003594048.1| Pyrimidine-specific ribonucleoside hydrolase rihA [Medicago truncatula]
Length=565

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 39/62 (63%), Gaps = 16/62 (26%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VG+GD                  Y K IPHG+GGF+DSDTL+G ARD
Sbjct  247  YDLLHMMGRDDIKVGIGDFL----------------YVKAIPHGNGGFLDSDTLFGFARD  290

Query  9    LP  4
            LP
Sbjct  291  LP  292


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/101 (34%), Positives = 45/101 (45%), Gaps = 38/101 (38%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGD---VFPMNI--------------------ADPIIPNVG----  91
            YD+ +MMGRDDI VG+G    + P                          I+PNVG    
Sbjct  69   YDILYMMGRDDIAVGVGGEGGILPNGTNGASLRGCKQLKRSRASEFSGTAILPNVGGYLP  128

Query  90   ----------DCKYQKVIPHGSGGFIDSDTLYGLARD-LPR  1
                      DC+Y++ IP G GG +D DT YG+ +  LPR
Sbjct  129  IIEQGMTTAGDCRYRQAIPVGFGGRLDIDTNYGIRKAFLPR  169



>gb|AFW81969.1| hypothetical protein ZEAMMB73_452326 [Zea mays]
Length=831

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   +       P +G C     IP GSGGF+DSDTLYGLAR 
Sbjct  502  YDVLHMMGRDDIPVGLGNATALGS-----PTLG-CNNSYAIPQGSGGFVDSDTLYGLARS  555

Query  9    LPR  1
            LPR
Sbjct  556  LPR  558



>ref|XP_008655288.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=873

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   +       P +G C     IP GSGGF+DSDTLYGLAR 
Sbjct  544  YDVLHMMGRDDIPVGLGNATALGS-----PTLG-CNNSYAIPQGSGGFVDSDTLYGLARS  597

Query  9    LPR  1
            LPR
Sbjct  598  LPR  600



>ref|XP_006654387.1| PREDICTED: uncharacterized protein LOC102700802 [Oryza brachyantha]
Length=819

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G+   +       P++G CKY   IP GS G +DSDTLYGLAR 
Sbjct  491  YDILHMMGRDDIPVGRGNTSALGA-----PSLG-CKYVSAIPQGSSGLLDSDTLYGLARL  544

Query  9    LPR  1
            LPR
Sbjct  545  LPR  547


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +++   I PNVG               C+Y++ IP   G
Sbjct  21   YDMLYMMGRDDILVGVGGDGGISVHGTIHPNVGGYLPLIDQGMATFGPCRYRQAIPLEGG  80

Query  51   GFIDSDTLYGLAR  13
            G +D DT +G+ +
Sbjct  81   GRLDVDTNFGIRK  93



>ref|NP_001169740.1| hypothetical protein [Zea mays]
 gb|ACN34738.1| unknown [Zea mays]
 gb|AFW81970.1| hypothetical protein ZEAMMB73_452326 [Zea mays]
Length=805

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   +       P +G C     IP GSGGF+DSDTLYGLAR 
Sbjct  476  YDVLHMMGRDDIPVGLGNATALGS-----PTLG-CNNSYAIPQGSGGFVDSDTLYGLARS  529

Query  9    LPR  1
            LPR
Sbjct  530  LPR  532



>ref|XP_004962122.1| PREDICTED: uncharacterized protein LOC101757009 isoform X3 [Setaria 
italica]
Length=820

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G+   +       P+ G C Y  +IP GSGG IDSDTLYGLAR 
Sbjct  491  YDILHMMGRDDIPVGRGNTTALGT-----PSFG-CDYVSIIPQGSGGLIDSDTLYGLARS  544

Query  9    LPR  1
            LPR
Sbjct  545  LPR  547


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YD+ +MMGRDDIPVG+G    ++ +  I PNV              G C+Y++ IP   G
Sbjct  21   YDILYMMGRDDIPVGVGGDDGISDSGTIHPNVGGYFPLIDQGMATFGGCRYRQAIPLEGG  80

Query  51   GFIDSDTLYGLAR  13
            G +D +T +G+ R
Sbjct  81   GRLDVNTNFGIRR  93



>ref|XP_004962121.1| PREDICTED: uncharacterized protein LOC101757009 isoform X2 [Setaria 
italica]
Length=841

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G+   +       P+ G C Y  +IP GSGG IDSDTLYGLAR 
Sbjct  513  YDILHMMGRDDIPVGRGNTTALGT-----PSFG-CDYVSIIPQGSGGLIDSDTLYGLARS  566

Query  9    LPR  1
            LPR
Sbjct  567  LPR  569


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YD+ +MMGRDDIPVG+G    ++ +  I PNV              G C+Y++ IP   G
Sbjct  43   YDILYMMGRDDIPVGVGGDDGISDSGTIHPNVGGYFPLIDQGMATFGGCRYRQAIPLEGG  102

Query  51   GFIDSDTLYGLAR  13
            G +D +T +G+ R
Sbjct  103  GRLDVNTNFGIRR  115



>ref|XP_004962120.1| PREDICTED: uncharacterized protein LOC101757009 isoform X1 [Setaria 
italica]
Length=842

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVG G+   +       P+ G C Y  +IP GSGG IDSDTLYGLAR 
Sbjct  513  YDILHMMGRDDIPVGRGNTTALGT-----PSFG-CDYVSIIPQGSGGLIDSDTLYGLARS  566

Query  9    LPR  1
            LPR
Sbjct  567  LPR  569


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YD+ +MMGRDDIPVG+G    ++ +  I PNV              G C+Y++ IP   G
Sbjct  43   YDILYMMGRDDIPVGVGGDDGISDSGTIHPNVGGYFPLIDQGMATFGGCRYRQAIPLEGG  102

Query  51   GFIDSDTLYGLAR  13
            G +D +T +G+ R
Sbjct  103  GRLDVNTNFGIRR  115



>gb|AES64299.2| inosine-uridine preferring nucleoside hydrolase [Medicago truncatula]
Length=543

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 39/62 (63%), Gaps = 16/62 (26%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YDL HMMGRDDI VG+GD                  Y K IPHG+GGF+DSDTL+G ARD
Sbjct  225  YDLLHMMGRDDIKVGIGDFL----------------YVKAIPHGNGGFLDSDTLFGFARD  268

Query  9    LP  4
            LP
Sbjct  269  LP  270


 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 20/81 (25%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGD---VFPMNIADPIIPNVG--------------DCKYQKVIPH  61
            YD+ +MMGRDDI VG+G    + P   A  I+PNVG              DC+Y++ IP 
Sbjct  69   YDILYMMGRDDIAVGVGGEGGILPNGTA--ILPNVGGYLPIIEQGMTTAGDCRYRQAIPV  126

Query  60   GSGGFIDSDTLYGLARD-LPR  1
            G GG +D DT YG+ +  LPR
Sbjct  127  GFGGRLDIDTNYGIRKAFLPR  147



>ref|XP_003566252.2| PREDICTED: uncharacterized protein LOC100844761 [Brachypodium 
distachyon]
Length=828

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 42/63 (67%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VG G+   M+      P +G C     IP GSGGFIDSDTLYGLAR 
Sbjct  502  YDILHMMGRDDISVGRGNTTAMDT-----PTLG-CNNSYAIPQGSGGFIDSDTLYGLARS  555

Query  9    LPR  1
            LPR
Sbjct  556  LPR  558


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 15/74 (20%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHG-S  55
            YD+ +MMGRDDI VG+G    ++ A  I PNV              G C+Y++ IP G  
Sbjct  43   YDILYMMGRDDIAVGVGGDGGISHAGHIQPNVGGYLPLIDQGASTAGGCRYRQAIPPGRR  102

Query  54   GGFIDSDTLYGLAR  13
            GG +D+DT  GL R
Sbjct  103  GGRLDADTNSGLRR  116



>dbj|BAJ84781.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=673

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   M       P +G C     IP GSGG+IDSDTLYGLAR 
Sbjct  449  YDILHMMGRDDIPVGLGNTTAMGN-----PTLG-CNNVYAIPQGSGGYIDSDTLYGLARL  502

Query  9    LPR  1
            LPR
Sbjct  503  LPR  505



>ref|XP_002439787.1| hypothetical protein SORBIDRAFT_09g020040 [Sorghum bicolor]
 gb|EES18217.1| hypothetical protein SORBIDRAFT_09g020040 [Sorghum bicolor]
Length=846

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMG DDIPVG G+   +       P++G C+Y  +IP GSGG IDSDTLYGLAR 
Sbjct  517  YDILHMMGHDDIPVGRGNTTALGT-----PSLG-CEYVSIIPQGSGGLIDSDTLYGLARS  570

Query  9    LPR  1
            LPR
Sbjct  571  LPR  573


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNV--------------GDCKYQKVIPHGSG  52
            YDL +MMGRDDIPVG+G    ++ +  I PNV              G C+Y++ IP   G
Sbjct  48   YDLLYMMGRDDIPVGVGGDGGISYSGTIYPNVGGYLPLIDQGMTTAGGCRYRQAIPLEGG  107

Query  51   GFIDSDTLYGLARDL  7
            G +D DT YG+ +D 
Sbjct  108  GRLDVDTNYGIRKDF  122



>gb|EMS48374.1| hypothetical protein TRIUR3_05635 [Triticum urartu]
Length=673

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   M       P +G C     IP GSGGFIDSDTLYGLAR 
Sbjct  347  YDILHMMGRDDIPVGLGNTTAMGN-----PTLG-CNNVYAIPLGSGGFIDSDTLYGLARL  400

Query  9    LPR  1
            LPR
Sbjct  401  LPR  403



>ref|XP_010938879.1| PREDICTED: uncharacterized protein LOC105057859 isoform X7 [Elaeis 
guineensis]
Length=693

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG++  +       P++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  367  YDVLHMMGRDDILVGLGNINALGT-----PSLG-CKYVNAIPLGSGGLLDSDTLYGLART  420

Query  9    LPR  1
            LPR
Sbjct  421  LPR  423


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 38/70 (54%), Gaps = 14/70 (20%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSGGFIDS  37
            MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+GG  D+
Sbjct  1    MMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPVGAGGRRDT  60

Query  36   DTLYGLARDL  7
            DT YGL R  
Sbjct  61   DTNYGLRRSF  70



>ref|XP_010938874.1| PREDICTED: uncharacterized protein LOC105057859 isoform X4 [Elaeis 
guineensis]
Length=723

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG++  +       P++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  397  YDVLHMMGRDDILVGLGNINALGT-----PSLG-CKYVNAIPLGSGGLLDSDTLYGLART  450

Query  9    LPR  1
            LPR
Sbjct  451  LPR  453


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 38/70 (54%), Gaps = 14/70 (20%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSGGFIDS  37
            MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+GG  D+
Sbjct  1    MMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPVGAGGRRDT  60

Query  36   DTLYGLARDL  7
            DT YGL R  
Sbjct  61   DTNYGLRRSF  70



>ref|XP_010938872.1| PREDICTED: uncharacterized protein LOC105057859 isoform X2 [Elaeis 
guineensis]
Length=748

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG++  +       P++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  422  YDVLHMMGRDDILVGLGNINALGT-----PSLG-CKYVNAIPLGSGGLLDSDTLYGLART  475

Query  9    LPR  1
            LPR
Sbjct  476  LPR  478


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 38/70 (54%), Gaps = 14/70 (20%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSGGFIDS  37
            MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+GG  D+
Sbjct  1    MMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPVGAGGRRDT  60

Query  36   DTLYGLARDL  7
            DT YGL R  
Sbjct  61   DTNYGLRRSF  70



>ref|XP_010938873.1| PREDICTED: uncharacterized protein LOC105057859 isoform X3 [Elaeis 
guineensis]
Length=728

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG++  +       P++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  463  YDVLHMMGRDDILVGLGNINALGT-----PSLG-CKYVNAIPLGSGGLLDSDTLYGLART  516

Query  9    LPR  1
            LPR
Sbjct  517  LPR  519


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 38/70 (54%), Gaps = 14/70 (20%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSGGFIDS  37
            MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+GG  D+
Sbjct  1    MMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPVGAGGRRDT  60

Query  36   DTLYGLARDL  7
            DT YGL R  
Sbjct  61   DTNYGLRRSF  70



>gb|EMT33427.1| hypothetical protein F775_22335 [Aegilops tauschii]
Length=733

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDIPVGLG+   +       P +G C     IP GSGGFIDSDTLYGLAR 
Sbjct  407  YDILHMMGRDDIPVGLGNTTALGN-----PTLG-CNNAYAIPLGSGGFIDSDTLYGLARL  460

Query  9    LP  4
            LP
Sbjct  461  LP  462



>ref|XP_010938871.1| PREDICTED: uncharacterized protein LOC105057859 isoform X1 [Elaeis 
guineensis]
Length=764

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG++  +       P++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  463  YDVLHMMGRDDILVGLGNINALGT-----PSLG-CKYVNAIPLGSGGLLDSDTLYGLART  516

Query  9    LPR  1
            LPR
Sbjct  517  LPR  519


 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 38/70 (54%), Gaps = 14/70 (20%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSGGFIDS  37
            MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+GG  D+
Sbjct  1    MMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPVGAGGRRDT  60

Query  36   DTLYGLARDL  7
            DT YGL R  
Sbjct  61   DTNYGLRRSF  70



>ref|XP_010938875.1| PREDICTED: uncharacterized protein LOC105057859 isoform X5 [Elaeis 
guineensis]
Length=703

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRDDI VGLG++  +       P++G CKY   IP GSGG +DSDTLYGLAR 
Sbjct  463  YDVLHMMGRDDILVGLGNINALGT-----PSLG-CKYVNAIPLGSGGLLDSDTLYGLART  516

Query  9    LPR  1
            LPR
Sbjct  517  LPR  519


 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 38/70 (54%), Gaps = 14/70 (20%)
 Frame = -2

Query  174  MMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSGGFIDS  37
            MM RDDIPVG+G    +     I+PNVG              DC+Y++ IP G+GG  D+
Sbjct  1    MMNRDDIPVGVGGDGGILDDGTILPNVGGYLPIIEQGMSTAGDCRYRQAIPVGAGGRRDT  60

Query  36   DTLYGLARDL  7
            DT YGL R  
Sbjct  61   DTNYGLRRSF  70



>ref|XP_010102680.1| hypothetical protein L484_002095 [Morus notabilis]
 gb|EXB93888.1| hypothetical protein L484_002095 [Morus notabilis]
Length=206

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 10/63 (16%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGDCKYQKVIPHGSGGFIDSDTLYGLARD  10
            YD+ HMMGRD+IPVGLG+VF M         +GDC ++K I H          LYGLAR 
Sbjct  92   YDVLHMMGRDEIPVGLGEVFAMGQTHSAFSAIGDCTFRKSIRH----------LYGLARG  141

Query  9    LPR  1
            LPR
Sbjct  142  LPR  144



>ref|XP_010233227.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100842948 
[Brachypodium distachyon]
Length=760

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 39/75 (52%), Gaps = 18/75 (24%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVG----------------LGDVFPMNIADPIIPNVGDCKYQKVIPHG  58
            YDL +MMGRDDI VG                +G  FP  I D  +  VG C+Y++ IP G
Sbjct  83   YDLLYMMGRDDIAVGVGGEGGISDDGRMYPDIGGYFP--IIDQEMSTVGGCRYRQSIPQG  140

Query  57   SGGFIDSDTLYGLAR  13
             GG +D +  YG+ R
Sbjct  141  GGGRLDINANYGVRR  155



>ref|XP_007147842.1| hypothetical protein PHAVU_006G1594000g, partial [Phaseolus vulgaris]
 ref|XP_007147843.1| hypothetical protein PHAVU_006G1594000g, partial [Phaseolus vulgaris]
 ref|XP_007147844.1| hypothetical protein PHAVU_006G1594000g, partial [Phaseolus vulgaris]
 gb|ESW19836.1| hypothetical protein PHAVU_006G1594000g, partial [Phaseolus vulgaris]
 gb|ESW19837.1| hypothetical protein PHAVU_006G1594000g, partial [Phaseolus vulgaris]
 gb|ESW19838.1| hypothetical protein PHAVU_006G1594000g, partial [Phaseolus vulgaris]
Length=460

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G  
Sbjct  71   YDILYMMGRDDIAVGMGGEGGILPNGTILPNVGGYLSIIEQGMTTTGGCRYRQAIPMGRR  130

Query  51   GFIDSDTLYGLAR  13
            G +D DT YG+ +
Sbjct  131  GHLDIDTNYGIRK  143



>ref|XP_009786043.1| PREDICTED: uncharacterized protein LOC104234211 [Nicotiana sylvestris]
Length=247

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 41/78 (53%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  145  YDMLYMMGRDDIVVGMGGEGGILPNGTILPNVGGYLPIIDQENGTAGYCRYRQAIPMGLG  204

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D D+  G  +  LP+
Sbjct  205  GRLDIDSSNGFRKSFLPQ  222



>ref|XP_011006094.1| PREDICTED: inosine-uridine preferring nucleoside hydrolase-like 
isoform X4 [Populus euphratica]
Length=253

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLG---------DVFP-----MNIADPIIPNVGDCKYQKVIPHGSG  52
            YD+ +MMGRDD+ VG+G          +FP     + I +      G C+Y++ IP G  
Sbjct  83   YDILYMMGRDDVSVGMGGEGGIAEDGRIFPDVGGFLPIVEQGKTTAGGCRYRQAIPAGPR  142

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ YGL R L
Sbjct  143  GRLDLDSNYGLRRAL  157



>ref|XP_009421179.1| PREDICTED: uncharacterized protein LOC104000771 [Musa acuminata 
subsp. malaccensis]
Length=681

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 15/78 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVG--------------DCKYQKVIPHGSG  52
            YD+ +MM RDDIPVG+G    +     I+P+VG              DC+Y++ IP G  
Sbjct  81   YDILYMMNRDDIPVGVGGDGGILDDGTILPHVGGYLPLIEQGMSTAGDCRYRQAIPVGGH  140

Query  51   GFIDSDTLYGLARD-LPR  1
            G +D +T YGL R  LP+
Sbjct  141  GRLDVNTNYGLRRSFLPQ  158



>ref|XP_010024481.1| PREDICTED: uncharacterized protein LOC104414950 isoform X3 [Eucalyptus 
grandis]
Length=276

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 14/73 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MM RDDIPVG+G    +     I+PNVG               C+Y++ IP G G
Sbjct  81   YDILYMMDRDDIPVGVGGEGGILENGTILPNVGGYLPMIEQGLSTAGYCRYRQAIPIGLG  140

Query  51   GFIDSDTLYGLAR  13
            G +D D+ YG+ +
Sbjct  141  GRLDIDSNYGIRK  153



>ref|XP_009774490.1| PREDICTED: uncharacterized protein C1683.06c-like isoform X3 
[Nicotiana sylvestris]
Length=341

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 14/75 (19%)
 Frame = -2

Query  189  YDL*HMMGRDDIPVGLGDVFPMNIADPIIPNVGD--------------CKYQKVIPHGSG  52
            YD+ +MMGRDDI VGLG    +     I+PNVG               C+Y++ IP G G
Sbjct  88   YDILYMMGRDDIAVGLGGEGGILPNGTILPNVGGYLPMIDQGNGTAGYCRYRQAIPVGPG  147

Query  51   GFIDSDTLYGLARDL  7
            G +D D+ +G  +  
Sbjct  148  GRLDIDSNFGFRKSF  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524026180552