BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c113556_g1_i1 len=225 path=[1:0-224]

Length=225
                                                                      Score     E

ref|XP_010099279.1|  hypothetical protein L484_018141                   109   2e-25   
ref|XP_006603939.1|  PREDICTED: protein furry-like isoform X2           108   3e-25   
gb|KEH25185.1|  armadillo/beta-catenin-like repeat protein              108   3e-25   
ref|XP_006603938.1|  PREDICTED: protein furry-like isoform X1           108   3e-25   
gb|KHN30753.1|  Protein furry like                                      108   4e-25   
ref|XP_011085572.1|  PREDICTED: LOW QUALITY PROTEIN: protein furr...    108   4e-25   
gb|KDO72333.1|  hypothetical protein CISIN_1g0001201mg                  108   5e-25   
ref|XP_006590669.1|  PREDICTED: protein furry-like                      108   5e-25   
gb|KHN42034.1|  Protein furry like                                      108   6e-25   
ref|XP_007151424.1|  hypothetical protein PHAVU_004G045000g             108   6e-25   
ref|XP_007151423.1|  hypothetical protein PHAVU_004G045000g             108   6e-25   
ref|XP_006430990.1|  hypothetical protein CICLE_v10010888mg             108   6e-25   
ref|XP_006482460.1|  PREDICTED: protein furry-like                      108   7e-25   
emb|CAC01767.1|  hypothetical protein                                   108   7e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDP02360.1|  unnamed protein product                                108   7e-25   
ref|XP_011021123.1|  PREDICTED: uncharacterized protein LOC105123...    108   7e-25   
ref|XP_010420238.1|  PREDICTED: uncharacterized protein LOC104705...    107   8e-25   
ref|XP_011021125.1|  PREDICTED: uncharacterized protein LOC105123...    107   8e-25   
gb|KDP24317.1|  hypothetical protein JCGZ_25613                         107   8e-25   
ref|XP_010681725.1|  PREDICTED: uncharacterized protein LOC104896651    107   2e-24   
ref|XP_007044666.1|  ARM repeat superfamily protein                     107   2e-24   
ref|XP_010525127.1|  PREDICTED: uncharacterized protein LOC104802...    107   2e-24   
ref|XP_010549986.1|  PREDICTED: uncharacterized protein LOC104820987    106   2e-24   
gb|ABD96932.1|  hypothetical protein                                    106   2e-24   Tarenaya spinosa
ref|XP_010525128.1|  PREDICTED: uncharacterized protein LOC104802...    106   2e-24   
ref|XP_010525129.1|  PREDICTED: uncharacterized protein LOC104802...    106   2e-24   
ref|XP_002534056.1|  conserved hypothetical protein                     105   4e-24   Ricinus communis
ref|XP_010029436.1|  PREDICTED: uncharacterized protein LOC104419461    105   5e-24   
ref|XP_004507276.1|  PREDICTED: protein furry homolog-like              105   5e-24   
ref|XP_004156223.1|  PREDICTED: protein furry homolog-like              105   6e-24   
gb|KHG02765.1|  Protein furry -like protein                             105   7e-24   
ref|XP_008230327.1|  PREDICTED: protein furry homolog                   105   9e-24   
ref|XP_009373744.1|  PREDICTED: protein furry-like                      105   9e-24   
ref|XP_007217136.1|  hypothetical protein PRUPE_ppa000048mg             105   9e-24   
ref|XP_008342058.1|  PREDICTED: LOW QUALITY PROTEIN: protein furr...    105   9e-24   
ref|XP_004141598.1|  PREDICTED: protein furry homolog-like              104   9e-24   
gb|ADN34277.1|  hypothetical protein                                    104   9e-24   
ref|XP_008459415.1|  PREDICTED: protein furry homolog-like              104   1e-23   
ref|XP_010660549.1|  PREDICTED: cell polarity protein mor2 isofor...    104   1e-23   
emb|CBI16907.3|  unnamed protein product                                104   1e-23   
emb|CAN67023.1|  hypothetical protein VITISV_036510                     104   1e-23   Vitis vinifera
ref|XP_010492411.1|  PREDICTED: uncharacterized protein LOC104769...    104   1e-23   
ref|XP_010453707.1|  PREDICTED: uncharacterized protein LOC104735...    104   1e-23   
emb|CDX90978.1|  BnaC02g06190D                                          104   1e-23   
ref|XP_010420241.1|  PREDICTED: uncharacterized protein LOC104705...    104   1e-23   
ref|NP_197072.3|  cell morphogenesis domain-containing protein          104   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873736.1|  binding protein                                    104   1e-23   
ref|XP_010492412.1|  PREDICTED: uncharacterized protein LOC104769...    104   1e-23   
ref|XP_010492408.1|  PREDICTED: uncharacterized protein LOC104769...    104   1e-23   
ref|XP_010660548.1|  PREDICTED: protein furry homolog-like isofor...    104   1e-23   
ref|XP_006286878.1|  hypothetical protein CARUB_v10000022mg             104   1e-23   
ref|XP_010453705.1|  PREDICTED: uncharacterized protein LOC104735...    104   1e-23   
ref|XP_006400089.1|  hypothetical protein EUTSA_v10012410mg             104   1e-23   
emb|CDX85539.1|  BnaA02g02740D                                          104   1e-23   
ref|XP_009126063.1|  PREDICTED: uncharacterized protein LOC103850999    104   1e-23   
gb|EPS65124.1|  hypothetical protein M569_09652                         103   2e-23   
ref|XP_004304179.1|  PREDICTED: protein furry homolog-like              103   2e-23   
ref|XP_004234701.1|  PREDICTED: protein furry homolog-like              103   2e-23   
ref|XP_009619273.1|  PREDICTED: protein furry homolog-like              103   2e-23   
gb|EYU39352.1|  hypothetical protein MIMGU_mgv1a000045mg                103   3e-23   
ref|XP_004232124.1|  PREDICTED: protein furry homolog-like              103   3e-23   
ref|XP_009759064.1|  PREDICTED: protein furry homolog-like              103   3e-23   
ref|XP_006338316.1|  PREDICTED: protein furry homolog-like isofor...    103   4e-23   
ref|XP_010272245.1|  PREDICTED: protein furry homolog-like              103   4e-23   
ref|XP_009378302.1|  PREDICTED: cell polarity protein mor2-like         101   1e-22   
ref|XP_008379878.1|  PREDICTED: protein furry homolog-like              101   1e-22   
ref|XP_006373529.1|  hypothetical protein POPTR_0017s14560g             101   2e-22   
ref|XP_006346869.1|  PREDICTED: protein furry-like                      100   2e-22   
ref|XP_009758438.1|  PREDICTED: protein furry homolog-like isofor...  98.2    2e-21   
ref|XP_009588236.1|  PREDICTED: protein furry homolog-like isofor...  98.2    2e-21   
ref|XP_009588234.1|  PREDICTED: protein furry homolog-like isofor...  98.2    2e-21   
ref|XP_009588235.1|  PREDICTED: protein furry homolog-like isofor...  98.2    2e-21   
ref|XP_009758439.1|  PREDICTED: protein furry homolog-like isofor...  98.2    2e-21   
gb|KHG07626.1|  Cell morphogenesis PAG1                               93.6    8e-20   
ref|XP_008798720.1|  PREDICTED: uncharacterized protein LOC103713...  89.7    2e-18   
ref|XP_008798721.1|  PREDICTED: cell morphogenesis protein PAG1 i...  89.7    2e-18   
ref|XP_010923832.1|  PREDICTED: uncharacterized protein LOC105046808  87.4    1e-17   
gb|AGT16378.1|  hypothetical protein SHCRBa_008_B11_R_180             87.4    1e-17   
ref|XP_006649204.1|  PREDICTED: protein furry-like                    87.0    2e-17   
ref|XP_010251338.1|  PREDICTED: protein furry homolog-like            86.7    2e-17   
ref|XP_002453095.1|  hypothetical protein SORBIDRAFT_04g038360        84.7    1e-16   Sorghum bicolor [broomcorn]
gb|EAZ25193.1|  hypothetical protein OsJ_08992                        84.0    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88121.1|  hypothetical protein OsI_09557                        84.0    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_004954517.1|  PREDICTED: protein furry homolog isoform X1      83.6    2e-16   
ref|XP_004954518.1|  PREDICTED: protein furry homolog isoform X2      83.6    2e-16   
ref|XP_008677043.1|  PREDICTED: uncharacterized protein LOC100278...  82.0    8e-16   
ref|XP_008677044.1|  PREDICTED: uncharacterized protein LOC100278...  82.0    8e-16   
ref|XP_009420941.1|  PREDICTED: uncharacterized protein LOC104000586  82.0    8e-16   
gb|AFW63880.1|  hypothetical protein ZEAMMB73_762053                  82.0    8e-16   
ref|XP_010236926.1|  PREDICTED: uncharacterized protein LOC100845707  81.6    1e-15   
gb|EMS62874.1|  Protein furry homolog-like protein                    81.3    1e-15   
gb|EMT25637.1|  hypothetical protein F775_52514                       81.3    1e-15   
ref|XP_009394279.1|  PREDICTED: protein furry homolog-like isofor...  79.7    5e-15   
ref|XP_009394270.1|  PREDICTED: protein furry homolog-like isofor...  79.7    5e-15   
emb|CDX70630.1|  BnaC03g07140D                                        70.5    6e-12   
ref|XP_009131488.1|  PREDICTED: uncharacterized protein LOC103856154  70.5    8e-12   
emb|CDX78647.1|  BnaA03g05590D                                        70.5    8e-12   
ref|XP_006847968.1|  hypothetical protein AMTR_s00029p00151870        68.2    5e-11   
ref|XP_002965492.1|  hypothetical protein SELMODRAFT_84835            64.7    6e-10   
ref|XP_002982967.1|  hypothetical protein SELMODRAFT_117643           63.5    2e-09   
ref|XP_001751533.1|  predicted protein                                55.1    2e-06   
ref|XP_001771126.1|  predicted protein                                52.4    1e-05   
ref|XP_001784414.1|  predicted protein                                51.6    2e-05   



>ref|XP_010099279.1| hypothetical protein L484_018141 [Morus notabilis]
 gb|EXB77625.1| hypothetical protein L484_018141 [Morus notabilis]
Length=2149

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H GA +H VN KEL SALQ HQQ
Sbjct  1488  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGAAMHGVNAKELQSALQGHQQ  1547

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1548  HSLTHADIALILLA  1561



>ref|XP_006603939.1| PREDICTED: protein furry-like isoform X2 [Glycine max]
Length=2130

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G+ +H+VN KEL SALQ HQQ
Sbjct  1467  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGLHTGSAMHAVNPKELQSALQGHQQ  1526

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1527  HSLTHADIALILLA  1540



>gb|KEH25185.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula]
Length=2142

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DYL+DTP S EDG H G  +H V+ KEL SALQ HQQ
Sbjct  1482  GPLIGVRSSTGSIRSRHVSRDSGDYLVDTPNSGEDGLHAGGAVHGVSAKELQSALQGHQQ  1541

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1542  HSLTHADIALILLA  1555



>ref|XP_006603938.1| PREDICTED: protein furry-like isoform X1 [Glycine max]
Length=2140

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G+ +H+VN KEL SALQ HQQ
Sbjct  1477  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGLHTGSAMHAVNPKELQSALQGHQQ  1536

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1537  HSLTHADIALILLA  1550



>gb|KHN30753.1| Protein furry like [Glycine soja]
Length=2140

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G+ +H+VN KEL SALQ HQQ
Sbjct  1477  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGLHTGSAMHAVNPKELQSALQGHQQ  1536

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1537  HSLTHADIALILLA  1550



>ref|XP_011085572.1| PREDICTED: LOW QUALITY PROTEIN: protein furry homolog-like [Sesamum 
indicum]
Length=2143

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G G H VN KEL SALQ HQQ
Sbjct  1476  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGVGTHGVNAKELQSALQGHQQ  1535

Query  182   HSLTCADIALILLA  223
             H+LT ADIALILLA
Sbjct  1536  HTLTQADIALILLA  1549



>gb|KDO72333.1| hypothetical protein CISIN_1g0001201mg, partial [Citrus sinensis]
 gb|KDO72334.1| hypothetical protein CISIN_1g0001201mg, partial [Citrus sinensis]
Length=1278

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
            G  +GVRSSTG+LR RH SRDS DYLIDTP S E+G H G G+H +N KEL SALQ HQQ
Sbjct  617  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEGLHSGVGMHGINAKELQSALQGHQQ  676

Query  182  HSLTCADIALILLA  223
            HSLT ADIALILLA
Sbjct  677  HSLTHADIALILLA  690



>ref|XP_006590669.1| PREDICTED: protein furry-like [Glycine max]
Length=2130

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G+ +H+VN KEL SALQ HQQ
Sbjct  1467  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGVHAGSAMHAVNAKELQSALQGHQQ  1526

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1527  HSLTHADIALILLA  1540



>gb|KHN42034.1| Protein furry like [Glycine soja]
Length=2140

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G+ +H+VN KEL SALQ HQQ
Sbjct  1477  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGVHAGSAMHAVNAKELQSALQGHQQ  1536

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1537  HSLTHADIALILLA  1550



>ref|XP_007151424.1| hypothetical protein PHAVU_004G045000g [Phaseolus vulgaris]
 gb|ESW23418.1| hypothetical protein PHAVU_004G045000g [Phaseolus vulgaris]
Length=1957

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G+ +H+VN KEL SALQ HQQ
Sbjct  1294  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGLHGGSAMHAVNAKELQSALQGHQQ  1353

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1354  HSLTHADIALILLA  1367



>ref|XP_007151423.1| hypothetical protein PHAVU_004G045000g [Phaseolus vulgaris]
 gb|ESW23417.1| hypothetical protein PHAVU_004G045000g [Phaseolus vulgaris]
Length=2129

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G+ +H+VN KEL SALQ HQQ
Sbjct  1466  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGLHGGSAMHAVNAKELQSALQGHQQ  1525

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1526  HSLTHADIALILLA  1539



>ref|XP_006430990.1| hypothetical protein CICLE_v10010888mg [Citrus clementina]
 gb|ESR44230.1| hypothetical protein CICLE_v10010888mg [Citrus clementina]
Length=2150

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S E+G H G G+H +N KEL SALQ HQQ
Sbjct  1489  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEGLHSGVGMHGINAKELQSALQGHQQ  1548

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1549  HSLTHADIALILLA  1562



>ref|XP_006482460.1| PREDICTED: protein furry-like [Citrus sinensis]
Length=2151

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S E+G H G G+H +N KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEGLHSGVGMHGINAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>emb|CAC01767.1| hypothetical protein [Arabidopsis thaliana]
Length=2163

 Score =   108 bits (269),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1500  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1559

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1560  HSLTHADIALILLA  1573



>emb|CDP02360.1| unnamed protein product [Coffea canephora]
Length=2152

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G  +H VN KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGTAMHGVNAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1547  HSLTHADIALILLA  1560



>ref|XP_011021123.1| PREDICTED: uncharacterized protein LOC105123295 isoform X1 [Populus 
euphratica]
Length=2141

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G G+H V+ KEL SALQ HQQ
Sbjct  1484  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHPGVGMHGVSAKELQSALQGHQQ  1543

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1544  HSLTHADIALILLA  1557



>ref|XP_010420238.1| PREDICTED: uncharacterized protein LOC104705850 isoform X1 [Camelina 
sativa]
 ref|XP_010420239.1| PREDICTED: uncharacterized protein LOC104705850 isoform X1 [Camelina 
sativa]
 ref|XP_010420240.1| PREDICTED: uncharacterized protein LOC104705850 isoform X1 [Camelina 
sativa]
Length=1822

 Score =   107 bits (268),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_011021125.1| PREDICTED: uncharacterized protein LOC105123295 isoform X2 [Populus 
euphratica]
Length=1818

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G G+H V+ KEL SALQ HQQ
Sbjct  1161  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHPGVGMHGVSAKELQSALQGHQQ  1220

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1221  HSLTHADIALILLA  1234



>gb|KDP24317.1| hypothetical protein JCGZ_25613 [Jatropha curcas]
Length=2490

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G G+H V+ KEL SALQ HQQ
Sbjct  1446  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHPGVGMHGVSAKELQSALQGHQQ  1505

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1506  HSLTHADIALILLA  1519


 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  11    LGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQHSL  190
              GVRSSTG+LR RH SRDS DYLIDTP S EDG H G G+H V+ KEL SALQ HQQHSL
Sbjct  1836  FGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHPGVGMHGVSAKELQSALQGHQQHSL  1895

Query  191   TCADIALILLA  223
             T ADIALILLA
Sbjct  1896  THADIALILLA  1906



>ref|XP_010681725.1| PREDICTED: uncharacterized protein LOC104896651 [Beta vulgaris 
subsp. vulgaris]
Length=2144

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DY IDTP S +DG H G G+H VN KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSIRSRHVSRDSGDYFIDTPNSGDDGLHSGVGMHGVNAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1547  HSLTQADIALILLA  1560



>ref|XP_007044666.1| ARM repeat superfamily protein [Theobroma cacao]
 gb|EOY00498.1| ARM repeat superfamily protein [Theobroma cacao]
Length=2150

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G G+H VN KEL SALQ HQQ
Sbjct  1489  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDILHSGVGMHGVNAKELQSALQGHQQ  1548

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1549  HSLTHADIALILLA  1562



>ref|XP_010525127.1| PREDICTED: uncharacterized protein LOC104802983 isoform X1 [Tarenaya 
hassleriana]
Length=2151

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S E+  H G GIH VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEVLHSGVGIHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_010549986.1| PREDICTED: uncharacterized protein LOC104820987 [Tarenaya hassleriana]
 gb|ABD96836.1| hypothetical protein [Cleome spinosa]
Length=2151

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S E+  H G GIH VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEVLHSGVGIHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>gb|ABD96932.1| hypothetical protein [Cleome spinosa]
Length=1527

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S E+  H G GIH VN KEL SALQ HQQ
Sbjct  1414  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEVLHSGVGIHGVNAKELQSALQGHQQ  1473

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1474  HSLTHADIALILLA  1487



>ref|XP_010525128.1| PREDICTED: uncharacterized protein LOC104802983 isoform X2 [Tarenaya 
hassleriana]
Length=2099

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S E+  H G GIH VN KEL SALQ HQQ
Sbjct  1438  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEVLHSGVGIHGVNAKELQSALQGHQQ  1497

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1498  HSLTHADIALILLA  1511



>ref|XP_010525129.1| PREDICTED: uncharacterized protein LOC104802983 isoform X3 [Tarenaya 
hassleriana]
Length=1835

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S E+  H G GIH VN KEL SALQ HQQ
Sbjct  1174  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEEVLHSGVGIHGVNAKELQSALQGHQQ  1233

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1234  HSLTHADIALILLA  1247



>ref|XP_002534056.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28327.1| conserved hypothetical protein [Ricinus communis]
Length=1665

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G  +H V+ KEL SALQ HQQ
Sbjct  1008  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHPGVAMHGVSAKELQSALQGHQQ  1067

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1068  HSLTHADIALILLA  1081



>ref|XP_010029436.1| PREDICTED: uncharacterized protein LOC104419461 [Eucalyptus grandis]
 gb|KCW56349.1| hypothetical protein EUGRSUZ_I02084 [Eucalyptus grandis]
Length=2153

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DYLIDTP S E+G H  AG H+VN KEL SALQ HQQ
Sbjct  1486  GPLMGVRSSTGSMRSRHVSRDSGDYLIDTPNSGEEGIHAAAGGHAVNAKELRSALQGHQQ  1545

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1546  HSLTHADIALILLA  1559



>ref|XP_004507276.1| PREDICTED: protein furry homolog-like [Cicer arietinum]
Length=2094

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYL+DTP S EDG H G  +H V+ KEL SALQ HQQ
Sbjct  1433  GPLMGVRSSTGSLRSRHVSRDSGDYLVDTPNSGEDGLHAGGAVHGVSAKELQSALQGHQQ  1492

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1493  HSLTHADIALILLA  1506



>ref|XP_004156223.1| PREDICTED: protein furry homolog-like [Cucumis sativus]
Length=1397

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
            G  +GVRSSTGT+R RH SRDS DYLIDTP S EDG H G   H V+ KEL SALQ HQQ
Sbjct  732  GPLMGVRSSTGTIRSRHVSRDSGDYLIDTPNSGEDGLHSGVAAHGVSAKELQSALQGHQQ  791

Query  182  HSLTCADIALILLA  223
            HSLT ADIALILLA
Sbjct  792  HSLTHADIALILLA  805



>gb|KHG02765.1| Protein furry -like protein [Gossypium arboreum]
Length=2151

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H   G+H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDILHSAVGMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTRADIALILLA  1563



>ref|XP_008230327.1| PREDICTED: protein furry homolog [Prunus mume]
Length=2152

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G  +H ++ KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGVSMHGISAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1547  HSLTHADIALILLA  1560



>ref|XP_009373744.1| PREDICTED: protein furry-like [Pyrus x bretschneideri]
Length=2152

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G  +H ++ KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGVSMHGISAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1547  HSLTHADIALILLA  1560



>ref|XP_007217136.1| hypothetical protein PRUPE_ppa000048mg [Prunus persica]
 gb|EMJ18335.1| hypothetical protein PRUPE_ppa000048mg [Prunus persica]
Length=2152

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G  +H ++ KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGVSMHGISAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1547  HSLTHADIALILLA  1560



>ref|XP_008342058.1| PREDICTED: LOW QUALITY PROTEIN: protein furry homolog-like [Malus 
domestica]
Length=1914

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G  +H ++ KEL SALQ HQQ
Sbjct  1249  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGVSMHGISAKELQSALQGHQQ  1308

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1309  HSLTHADIALILLA  1322



>ref|XP_004141598.1| PREDICTED: protein furry homolog-like [Cucumis sativus]
 gb|KGN52538.1| hypothetical protein Csa_5G642200 [Cucumis sativus]
Length=2159

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTGT+R RH SRDS DYLIDTP S EDG H G   H V+ KEL SALQ HQQ
Sbjct  1494  GPLMGVRSSTGTIRSRHVSRDSGDYLIDTPNSGEDGLHSGVAAHGVSAKELQSALQGHQQ  1553

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1554  HSLTHADIALILLA  1567



>gb|ADN34277.1| hypothetical protein [Cucumis melo subsp. melo]
Length=2156

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTGT+R RH SRDS DYLIDTP S EDG H G   H V+ KEL SALQ HQQ
Sbjct  1491  GPLMGVRSSTGTIRSRHVSRDSGDYLIDTPNSGEDGLHSGVAAHGVSAKELQSALQGHQQ  1550

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1551  HSLTHADIALILLA  1564



>ref|XP_008459415.1| PREDICTED: protein furry homolog-like [Cucumis melo]
Length=2159

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTGT+R RH SRDS DYLIDTP S EDG H G   H V+ KEL SALQ HQQ
Sbjct  1494  GPLMGVRSSTGTIRSRHVSRDSGDYLIDTPNSGEDGLHSGVAAHGVSAKELQSALQGHQQ  1553

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1554  HSLTHADIALILLA  1567



>ref|XP_010660549.1| PREDICTED: cell polarity protein mor2 isoform X2 [Vitis vinifera]
 ref|XP_010660550.1| PREDICTED: cell polarity protein mor2 isoform X2 [Vitis vinifera]
Length=1833

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY+IDTP S E+G H G G+H VN KEL SALQ HQ 
Sbjct  1167  GPLMGVRSSTGSLRSRHVSRDSGDYVIDTPNSGEEGLHGGVGMHGVNAKELQSALQGHQL  1226

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1227  HSLTQADIALILLA  1240



>emb|CBI16907.3| unnamed protein product [Vitis vinifera]
Length=2073

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY+IDTP S E+G H G G+H VN KEL SALQ HQ 
Sbjct  1407  GPLMGVRSSTGSLRSRHVSRDSGDYVIDTPNSGEEGLHGGVGMHGVNAKELQSALQGHQL  1466

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1467  HSLTQADIALILLA  1480



>emb|CAN67023.1| hypothetical protein VITISV_036510 [Vitis vinifera]
Length=1916

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY+IDTP S E+G H G G+H VN KEL SALQ HQ 
Sbjct  1250  GPLMGVRSSTGSLRSRHVSRDSGDYVIDTPNSGEEGLHGGVGMHGVNAKELQSALQGHQL  1309

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1310  HSLTQADIALILLA  1323



>ref|XP_010492411.1| PREDICTED: uncharacterized protein LOC104769812 isoform X2 [Camelina 
sativa]
Length=1981

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1318  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1377

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1378  HSLTHADIALILLA  1391



>ref|XP_010453707.1| PREDICTED: uncharacterized protein LOC104735587 isoform X2 [Camelina 
sativa]
Length=1981

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1318  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1377

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1378  HSLTHADIALILLA  1391



>emb|CDX90978.1| BnaC02g06190D [Brassica napus]
Length=2154

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTGT+R RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1493  GPLMGVRSSTGTVRSRHMSRDSGDYLIDTPNSGEDVLHSGMAMHGVNAKELQSALQGHQQ  1552

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1553  HSLTHADIALILLA  1566



>ref|XP_010420241.1| PREDICTED: uncharacterized protein LOC104705850 isoform X2 [Camelina 
sativa]
Length=2148

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|NP_197072.3| cell morphogenesis domain-containing protein [Arabidopsis thaliana]
 gb|AED92191.1| cell morphogenesis related protein [Arabidopsis thaliana]
Length=2153

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_002873736.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49995.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=2153

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_010492412.1| PREDICTED: uncharacterized protein LOC104769812 isoform X3 [Camelina 
sativa]
Length=1914

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1251  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1310

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1311  HSLTHADIALILLA  1324



>ref|XP_010492408.1| PREDICTED: uncharacterized protein LOC104769812 isoform X1 [Camelina 
sativa]
 ref|XP_010492409.1| PREDICTED: uncharacterized protein LOC104769812 isoform X1 [Camelina 
sativa]
Length=2153

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_010660548.1| PREDICTED: protein furry homolog-like isoform X1 [Vitis vinifera]
Length=2149

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY+IDTP S E+G H G G+H VN KEL SALQ HQ 
Sbjct  1483  GPLMGVRSSTGSLRSRHVSRDSGDYVIDTPNSGEEGLHGGVGMHGVNAKELQSALQGHQL  1542

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1543  HSLTQADIALILLA  1556



>ref|XP_006286878.1| hypothetical protein CARUB_v10000022mg [Capsella rubella]
 gb|EOA19776.1| hypothetical protein CARUB_v10000022mg [Capsella rubella]
Length=2153

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_010453705.1| PREDICTED: uncharacterized protein LOC104735587 isoform X1 [Camelina 
sativa]
 ref|XP_010453706.1| PREDICTED: uncharacterized protein LOC104735587 isoform X1 [Camelina 
sativa]
Length=2153

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_006400089.1| hypothetical protein EUTSA_v10012410mg [Eutrema salsugineum]
 gb|ESQ41542.1| hypothetical protein EUTSA_v10012410mg [Eutrema salsugineum]
Length=2156

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDVLHSGIAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>emb|CDX85539.1| BnaA02g02740D [Brassica napus]
Length=2151

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTGT+R RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGTVRSRHMSRDSGDYLIDTPNSGEDLLHSGMAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>ref|XP_009126063.1| PREDICTED: uncharacterized protein LOC103850999 [Brassica rapa]
Length=2151

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTGT+R RH SRDS DYLIDTP S ED  H G  +H VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGTVRSRHMSRDSGDYLIDTPNSGEDLLHSGMAMHGVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1550  HSLTHADIALILLA  1563



>gb|EPS65124.1| hypothetical protein M569_09652, partial [Genlisea aurea]
Length=1322

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
            G  +GVRSSTG++R RH SRDS DYLIDTP S EDG   G G H +N KEL SALQ HQQ
Sbjct  653  GPLMGVRSSTGSIRSRHVSRDSGDYLIDTPNSGEDGLLSGVGTHGINAKELQSALQGHQQ  712

Query  182  HSLTCADIALILLA  223
            H+LT ADIALILLA
Sbjct  713  HTLTQADIALILLA  726



>ref|XP_004304179.1| PREDICTED: protein furry homolog-like [Fragaria vesca subsp. 
vesca]
Length=2150

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G   H ++ KEL SALQ HQQ
Sbjct  1488  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHSGVATHGISAKELQSALQGHQQ  1547

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1548  HSLTHADIALILLA  1561



>ref|XP_004234701.1| PREDICTED: protein furry homolog-like [Solanum lycopersicum]
 ref|XP_010317824.1| PREDICTED: protein furry homolog-like [Solanum lycopersicum]
 ref|XP_010317825.1| PREDICTED: protein furry homolog-like [Solanum lycopersicum]
Length=2148

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DYLIDTP S EDG H G+ +H +N KEL SALQ HQQ
Sbjct  1484  GPLMGVRSSTGSMRSRHRSRDSGDYLIDTPNSGEDGLHSGSVMHGINAKELQSALQGHQQ  1543

Query  182   HSLTCADIALILLA  223
             HSL+ ADIALILLA
Sbjct  1544  HSLSHADIALILLA  1557



>ref|XP_009619273.1| PREDICTED: protein furry homolog-like [Nicotiana tomentosiformis]
Length=2153

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY IDTP S E+G H  AG H+VN KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYHIDTPKSGEEGLHLAAGTHAVNAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             H LT ADIALILLA
Sbjct  1547  HLLTHADIALILLA  1560



>gb|EYU39352.1| hypothetical protein MIMGU_mgv1a000045mg [Erythranthe guttata]
Length=2145

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG   G G H VN KEL SALQ HQQ
Sbjct  1481  GPLMGVRSSTGSLRSRHLSRDSGDYLIDTPNSGEDGLLSGFGTHGVNAKELQSALQGHQQ  1540

Query  182   HSLTCADIALILLA  223
             H+LT ADIALILLA
Sbjct  1541  HTLTQADIALILLA  1554



>ref|XP_004232124.1| PREDICTED: protein furry homolog-like [Solanum lycopersicum]
 ref|XP_010316200.1| PREDICTED: protein furry homolog-like [Solanum lycopersicum]
Length=2152

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY IDTP S E+G H  AG H+VN KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYHIDTPNSGEEGLHLAAGTHAVNAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             H LT ADIALILLA
Sbjct  1547  HLLTHADIALILLA  1560



>ref|XP_009759064.1| PREDICTED: protein furry homolog-like [Nicotiana sylvestris]
Length=2155

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY IDTP S E+G H  AG H+VN KEL SALQ HQQ
Sbjct  1490  GPLMGVRSSTGSLRSRHVSRDSGDYHIDTPNSGEEGLHLAAGTHAVNAKELQSALQGHQQ  1549

Query  182   HSLTCADIALILLA  223
             H LT ADIALILLA
Sbjct  1550  HLLTHADIALILLA  1563



>ref|XP_006338316.1| PREDICTED: protein furry homolog-like isoform X1 [Solanum tuberosum]
 ref|XP_006338317.1| PREDICTED: protein furry homolog-like isoform X2 [Solanum tuberosum]
Length=2152

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY IDTP S E+G H  AG H+VN KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYHIDTPNSGEEGLHLAAGTHAVNAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             H LT ADIALILLA
Sbjct  1547  HLLTHADIALILLA  1560



>ref|XP_010272245.1| PREDICTED: protein furry homolog-like [Nelumbo nucifera]
 ref|XP_010272247.1| PREDICTED: protein furry homolog-like [Nelumbo nucifera]
 ref|XP_010272248.1| PREDICTED: protein furry homolog-like [Nelumbo nucifera]
Length=2154

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG   G G+H VN  EL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLLSGIGLHGVNAGELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1547  HSLTHADIALILLA  1560



>ref|XP_009378302.1| PREDICTED: cell polarity protein mor2-like [Pyrus x bretschneideri]
Length=2150

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY IDTP S EDG H G  +H ++ KEL SALQ HQQ
Sbjct  1487  GPLMGVRSSTGSLRSRHVSRDSGDYHIDTPNSGEDGLHSGVSMHGISAKELQSALQGHQQ  1546

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1547  HSLTHADIALILLA  1560



>ref|XP_008379878.1| PREDICTED: protein furry homolog-like [Malus domestica]
Length=2276

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DY IDTP S EDG H G  +H ++ KEL SALQ HQQ
Sbjct  1611  GPLMGVRSSTGSLRSRHVSRDSGDYHIDTPNSGEDGLHSGVSMHGISAKELQSALQGHQQ  1670

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1671  HSLTHADIALILLA  1684



>ref|XP_006373529.1| hypothetical protein POPTR_0017s14560g [Populus trichocarpa]
 gb|ERP51326.1| hypothetical protein POPTR_0017s14560g [Populus trichocarpa]
Length=2140

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR RH SRDS DYLIDTP S EDG H G G+H V+ KEL SALQ H Q
Sbjct  1484  GPLMGVRSSTGSLRSRHVSRDSGDYLIDTPNSGEDGLHPGVGMHGVSAKELQSALQGH-Q  1542

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1543  HSLTHADIALILLA  1556



>ref|XP_006346869.1| PREDICTED: protein furry-like [Solanum tuberosum]
Length=2148

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G   GVRSSTG++R RH SRDS DY IDTP S EDG H G+ +H +N KEL SALQ HQQ
Sbjct  1484  GPLKGVRSSTGSMRSRHRSRDSGDYFIDTPNSGEDGLHSGSVMHGINAKELQSALQGHQQ  1543

Query  182   HSLTCADIALILLA  223
             HSL+ ADIALILLA
Sbjct  1544  HSLSHADIALILLA  1557



>ref|XP_009758438.1| PREDICTED: protein furry homolog-like isoform X1 [Nicotiana sylvestris]
Length=2152

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DY IDTP S +DG H G  +H +N KEL SALQ HQQ
Sbjct  1485  GPLMGVRSSTGSMRSRHRSRDSGDYFIDTPNSGDDGLHSGTVMHGINAKELQSALQGHQQ  1544

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1545  HLLSHADIALILLA  1558



>ref|XP_009588236.1| PREDICTED: protein furry homolog-like isoform X3 [Nicotiana tomentosiformis]
Length=1884

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DY IDTP S +DG H G  +H +N KEL SALQ HQQ
Sbjct  1217  GPLMGVRSSTGSMRSRHRSRDSGDYFIDTPNSGDDGLHSGTVMHGINAKELQSALQGHQQ  1276

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1277  HLLSHADIALILLA  1290



>ref|XP_009588234.1| PREDICTED: protein furry homolog-like isoform X1 [Nicotiana tomentosiformis]
Length=2152

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DY IDTP S +DG H G  +H +N KEL SALQ HQQ
Sbjct  1485  GPLMGVRSSTGSMRSRHRSRDSGDYFIDTPNSGDDGLHSGTVMHGINAKELQSALQGHQQ  1544

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1545  HLLSHADIALILLA  1558



>ref|XP_009588235.1| PREDICTED: protein furry homolog-like isoform X2 [Nicotiana tomentosiformis]
Length=2096

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DY IDTP S +DG H G  +H +N KEL SALQ HQQ
Sbjct  1429  GPLMGVRSSTGSMRSRHRSRDSGDYFIDTPNSGDDGLHSGTVMHGINAKELQSALQGHQQ  1488

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1489  HLLSHADIALILLA  1502



>ref|XP_009758439.1| PREDICTED: protein furry homolog-like isoform X2 [Nicotiana sylvestris]
Length=2096

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG++R RH SRDS DY IDTP S +DG H G  +H +N KEL SALQ HQQ
Sbjct  1429  GPLMGVRSSTGSMRSRHRSRDSGDYFIDTPNSGDDGLHSGTVMHGINAKELQSALQGHQQ  1488

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1489  HLLSHADIALILLA  1502



>gb|KHG07626.1| Cell morphogenesis PAG1 [Gossypium arboreum]
Length=1833

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +G R+STG+LR  HASRDS DYLIDTP S ED    G G+  VN KEL SALQ +QQ
Sbjct  1170  GPLIGARNSTGSLRSHHASRDSGDYLIDTPNSVEDIMQSGVGMLGVNAKELQSALQGNQQ  1229

Query  182   HSLTCADIALILLA  223
             HSLT ADIALILLA
Sbjct  1230  HSLTRADIALILLA  1243



>ref|XP_008798720.1| PREDICTED: uncharacterized protein LOC103713534 isoform X1 [Phoenix 
dactylifera]
Length=2164

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFG-AGIHSVNTKELLSALQVHQ  178
             G  +GVRSSTG LR RH SRDS D LIDTP S ED  H G +G+H +N  EL SALQ H 
Sbjct  1492  GPLMGVRSSTGNLRSRHVSRDSGDCLIDTPNSGEDILHPGSSGLHGINASELQSALQGHH  1551

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1552  QHLLSRADIALILLA  1566



>ref|XP_008798721.1| PREDICTED: cell morphogenesis protein PAG1 isoform X2 [Phoenix 
dactylifera]
Length=2062

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFG-AGIHSVNTKELLSALQVHQ  178
             G  +GVRSSTG LR RH SRDS D LIDTP S ED  H G +G+H +N  EL SALQ H 
Sbjct  1390  GPLMGVRSSTGNLRSRHVSRDSGDCLIDTPNSGEDILHPGSSGLHGINASELQSALQGHH  1449

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1450  QHLLSRADIALILLA  1464



>ref|XP_010923832.1| PREDICTED: uncharacterized protein LOC105046808 [Elaeis guineensis]
Length=2158

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFG-AGIHSVNTKELLSALQVHQ  178
             G  +GVRSST  LR RH SRDS D LIDTP S ED  H G +G+H +N  EL SALQ H 
Sbjct  1486  GPLMGVRSSTANLRSRHVSRDSGDCLIDTPNSGEDILHPGSSGLHGINASELQSALQGHH  1545

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1546  QHLLSRADIALILLA  1560



>gb|AGT16378.1| hypothetical protein SHCRBa_008_B11_R_180 [Saccharum hybrid cultivar 
R570]
Length=2114

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFH-FGAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY  DTP S++D  H  G+GIH +N  EL SALQ H 
Sbjct  1450  GPLMGVRSSAGNLRSRHVSRDSGDYYFDTPNSTDDFLHQGGSGIHGINANELQSALQGH-  1508

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1509  QHLLSRADIALILLA  1523



>ref|XP_006649204.1| PREDICTED: protein furry-like [Oryza brachyantha]
Length=2199

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFH-FGAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY +DTP S++D  H  G+G+H +N  EL SALQ H 
Sbjct  1527  GPLMGVRSSAGNLRSRHVSRDSGDYYLDTPNSNDDILHQGGSGVHGINANELQSALQGH-  1585

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1586  QHLLSRADIALILLA  1600



>ref|XP_010251338.1| PREDICTED: protein furry homolog-like [Nelumbo nucifera]
Length=2056

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSA--DYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVH  175
             G  +G R+STGTLR RH SRDS+  D+L+DTP S EDG    +G+H +N  ++ SALQ H
Sbjct  1378  GPLMGGRNSTGTLRSRHVSRDSSSTDHLLDTPHSGEDGLLSASGLHGINVGDIQSALQGH  1437

Query  176   QQHSLTCADIALILLA  223
             QQHSLT ADIALILLA
Sbjct  1438  QQHSLTHADIALILLA  1453



>ref|XP_002453095.1| hypothetical protein SORBIDRAFT_04g038360 [Sorghum bicolor]
 gb|EES06071.1| hypothetical protein SORBIDRAFT_04g038360 [Sorghum bicolor]
Length=1801

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY  DTP S++D  H  G+GIH +N  EL SALQ H 
Sbjct  1127  GPLMGVRSSAGNLRSRHVSRDSGDYYFDTPNSTDDFLHQGGSGIHGINANELQSALQGH-  1185

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1186  QHLLSRADIALILLA  1200



>gb|EAZ25193.1| hypothetical protein OsJ_08992 [Oryza sativa Japonica Group]
Length=2142

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY +DTP S++D  H  G+G+H +N  EL SALQ H 
Sbjct  1471  GPLIGVRSSAGNLRSRHVSRDSGDYYLDTPNSNDDILHQGGSGVHGINANELQSALQGH-  1529

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1530  QHLLSRADIALILLA  1544



>gb|EAY88121.1| hypothetical protein OsI_09557 [Oryza sativa Indica Group]
Length=2142

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY +DTP S++D  H  G+G+H +N  EL SALQ H 
Sbjct  1471  GPLIGVRSSAGNLRSRHVSRDSGDYYLDTPNSNDDILHQGGSGVHGINANELQSALQGH-  1529

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1530  QHLLSRADIALILLA  1544



>ref|XP_004954517.1| PREDICTED: protein furry homolog isoform X1 [Setaria italica]
Length=2183

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY  DTP S++D  H  G+G+H +N  EL SALQ H 
Sbjct  1515  GPLMGVRSSAGNLRSRHVSRDSGDYYFDTPNSTDDILHQGGSGVHGINANELQSALQGH-  1573

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1574  QHLLSRADIALILLA  1588



>ref|XP_004954518.1| PREDICTED: protein furry homolog isoform X2 [Setaria italica]
Length=2182

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY  DTP S++D  H  G+G+H +N  EL SALQ H 
Sbjct  1514  GPLMGVRSSAGNLRSRHVSRDSGDYYFDTPNSTDDILHQGGSGVHGINANELQSALQGH-  1572

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1573  QHLLSRADIALILLA  1587



>ref|XP_008677043.1| PREDICTED: uncharacterized protein LOC100278485 isoform X1 [Zea 
mays]
Length=2156

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +2

Query  14    GVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQQHSL  190
             GVRSS G LR RH SRDS DY  DTP S++D  H  G+GIH +N  EL SALQ H QH L
Sbjct  1487  GVRSSAGNLRSRHVSRDSGDYYFDTPNSTDDILHQGGSGIHGINANELQSALQGH-QHLL  1545

Query  191   TCADIALILLA  223
             + ADIALILLA
Sbjct  1546  SRADIALILLA  1556



>ref|XP_008677044.1| PREDICTED: uncharacterized protein LOC100278485 isoform X2 [Zea 
mays]
Length=2155

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +2

Query  14    GVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQQHSL  190
             GVRSS G LR RH SRDS DY  DTP S++D  H  G+GIH +N  EL SALQ H QH L
Sbjct  1486  GVRSSAGNLRSRHVSRDSGDYYFDTPNSTDDILHQGGSGIHGINANELQSALQGH-QHLL  1544

Query  191   TCADIALILLA  223
             + ADIALILLA
Sbjct  1545  SRADIALILLA  1555



>ref|XP_009420941.1| PREDICTED: uncharacterized protein LOC104000586 [Musa acuminata 
subsp. malaccensis]
Length=1950

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGA-GIHSVNTKELLSALQVHQ  178
             G  + VR+STG LR RH SRDS D LIDTP S ED  H G   +  ++  EL SALQ HQ
Sbjct  1489  GPLMSVRNSTGNLRSRHMSRDSVDCLIDTPNSGEDILHLGGIELQGISASELQSALQGHQ  1548

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1549  QHLLSRADIALILLA  1563



>gb|AFW63880.1| hypothetical protein ZEAMMB73_762053 [Zea mays]
Length=2142

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +2

Query  14    GVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQQHSL  190
             GVRSS G LR RH SRDS DY  DTP S++D  H  G+GIH +N  EL SALQ H QH L
Sbjct  1473  GVRSSAGNLRSRHVSRDSGDYYFDTPNSTDDILHQGGSGIHGINANELQSALQGH-QHLL  1531

Query  191   TCADIALILLA  223
             + ADIALILLA
Sbjct  1532  SRADIALILLA  1542



>ref|XP_010236926.1| PREDICTED: uncharacterized protein LOC100845707 [Brachypodium 
distachyon]
Length=2220

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY  DTP S++D  H  G+G+H +N  EL SALQ H 
Sbjct  1550  GPLMGVRSSAGHLRSRHVSRDSGDYYFDTPNSNDDILHQGGSGLHGINANELQSALQGH-  1608

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1609  QHLLSRADIALILLA  1623



>gb|EMS62874.1| Protein furry homolog-like protein [Triticum urartu]
Length=2144

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY  DTP S+++  H  G+GIH +N  EL SALQ H 
Sbjct  1467  GPLMGVRSSAGHLRSRHVSRDSGDYYFDTPNSNDEFLHQGGSGIHGINANELQSALQGH-  1525

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1526  QHLLSRADIALILLA  1540



>gb|EMT25637.1| hypothetical protein F775_52514 [Aegilops tauschii]
Length=2163

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHF-GAGIHSVNTKELLSALQVHQ  178
             G  +GVRSS G LR RH SRDS DY  DTP S+++  H  G+GIH +N  EL SALQ H 
Sbjct  1503  GPLMGVRSSAGHLRSRHVSRDSGDYYFDTPNSNDEFLHQGGSGIHGINANELQSALQGH-  1561

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1562  QHLLSRADIALILLA  1576



>ref|XP_009394279.1| PREDICTED: protein furry homolog-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=2161

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAG-IHSVNTKELLSALQVHQ  178
             G  + +RSSTG LR RH SRDS D  IDTP S+ED  H  +  I  ++  EL SALQ HQ
Sbjct  1489  GPLMNIRSSTGNLRSRHVSRDSGDCPIDTPNSTEDILHPASSVIQGISASELQSALQGHQ  1548

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1549  QHLLSRADIALILLA  1563



>ref|XP_009394270.1| PREDICTED: protein furry homolog-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=2162

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAG-IHSVNTKELLSALQVHQ  178
             G  + +RSSTG LR RH SRDS D  IDTP S+ED  H  +  I  ++  EL SALQ HQ
Sbjct  1490  GPLMNIRSSTGNLRSRHVSRDSGDCPIDTPNSTEDILHPASSVIQGISASELQSALQGHQ  1549

Query  179   QHSLTCADIALILLA  223
             QH L+ ADIALILLA
Sbjct  1550  QHLLSRADIALILLA  1564



>emb|CDX70630.1| BnaC03g07140D [Brassica napus]
Length=1056

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 42/74 (57%), Gaps = 17/74 (23%)
 Frame = +2

Query  2    GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
            G  +GVRSSTG L  RH SRDS DYLIDTP S ED   F                  HQQ
Sbjct  420  GPLMGVRSSTGALSSRHVSRDSGDYLIDTPNSGEDVSQFR-----------------HQQ  462

Query  182  HSLTCADIALILLA  223
            HSL  ADIALILLA
Sbjct  463  HSLIPADIALILLA  476



>ref|XP_009131488.1| PREDICTED: uncharacterized protein LOC103856154 [Brassica rapa]
Length=2131

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 42/74 (57%), Gaps = 17/74 (23%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG L  RH SRDS DYLIDTP S ED   F                  HQQ
Sbjct  1494  GPLMGVRSSTGALSSRHVSRDSGDYLIDTPNSGEDVSQFR-----------------HQQ  1536

Query  182   HSLTCADIALILLA  223
             HSL  ADIALILLA
Sbjct  1537  HSLIPADIALILLA  1550



>emb|CDX78647.1| BnaA03g05590D [Brassica napus]
Length=2139

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 42/74 (57%), Gaps = 17/74 (23%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG L  RH SRDS DYLIDTP S ED   F                  HQQ
Sbjct  1502  GPLMGVRSSTGALSSRHVSRDSGDYLIDTPNSGEDVSQFR-----------------HQQ  1544

Query  182   HSLTCADIALILLA  223
             HSL  ADIALILLA
Sbjct  1545  HSLIPADIALILLA  1558



>ref|XP_006847968.1| hypothetical protein AMTR_s00029p00151870 [Amborella trichopoda]
 gb|ERN09549.1| hypothetical protein AMTR_s00029p00151870 [Amborella trichopoda]
Length=2127

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 49/74 (66%), Gaps = 5/74 (7%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVRSSTG+LR  H SRDS DY I+TP S ++     A    V+  EL SALQ H Q
Sbjct  1487  GPLMGVRSSTGSLRSHHVSRDSGDYFIETPNSIDE----PAAAPVVSAGELQSALQGH-Q  1541

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1542  HWLSRADIALILLA  1555



>ref|XP_002965492.1| hypothetical protein SELMODRAFT_84835 [Selaginella moellendorffii]
 gb|EFJ32912.1| hypothetical protein SELMODRAFT_84835 [Selaginella moellendorffii]
Length=2137

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 46/74 (62%), Gaps = 5/74 (7%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  LGVRSSTG+L+  H SRDS DY  DTP S ED          VN  EL SALQ H  
Sbjct  1472  GQLLGVRSSTGSLKSHHLSRDSGDYF-DTPNSVED---IRIITPPVNPSELQSALQAH-H  1526

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1527  HWLSRADIALILLA  1540



>ref|XP_002982967.1| hypothetical protein SELMODRAFT_117643 [Selaginella moellendorffii]
 gb|EFJ15776.1| hypothetical protein SELMODRAFT_117643 [Selaginella moellendorffii]
Length=2137

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 46/74 (62%), Gaps = 5/74 (7%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  LGVRSSTG+++  H SRDS DY  DTP S ED          VN  EL SALQ H  
Sbjct  1472  GQLLGVRSSTGSVKSHHLSRDSGDYF-DTPNSVED---IRIITPPVNPSELQSALQAH-H  1526

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1527  HWLSRADIALILLA  1540



>ref|XP_001751533.1| predicted protein [Physcomitrella patens]
 gb|EDQ83850.1| predicted protein [Physcomitrella patens]
Length=2125

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 9/71 (13%)
 Frame = +2

Query  11    LGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQHSL  190
             +GVR+STG+++ RH SRDS DY +DTP++ +        I S +        Q H QH L
Sbjct  1475  MGVRTSTGSMKSRHLSRDSGDYFLDTPSADD--------IRSSSQAAAGGDPQAH-QHWL  1525

Query  191   TCADIALILLA  223
             + ADIALILLA
Sbjct  1526  SRADIALILLA  1536



>ref|XP_001771126.1| predicted protein [Physcomitrella patens]
 gb|EDQ64127.1| predicted protein [Physcomitrella patens]
Length=2226

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 9/74 (12%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVR+STG++R RH SRDS DY  DTP  S D     A   +    ++       + 
Sbjct  1525  GPLMGVRTSTGSMRSRHLSRDSGDYFPDTP--SADDIRSNAQATAGGDSQI-------RH  1575

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1576  HWLSRADIALILLA  1589



>ref|XP_001784414.1| predicted protein [Physcomitrella patens]
 gb|EDQ50766.1| predicted protein [Physcomitrella patens]
Length=2132

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 9/74 (12%)
 Frame = +2

Query  2     GTHLGVRSSTGTLRGRHASRDSADYLIDTPASSEDGFHFGAGIHSVNTKELLSALQVHQQ  181
             G  +GVR+STG+++ RH SRDS DY  DTP ++ED      G    ++       Q H  
Sbjct  1479  GPLMGVRTSTGSVKSRHLSRDSGDYFFDTP-TAEDIRTNAPGAGGGDS-------QAH-H  1529

Query  182   HSLTCADIALILLA  223
             H L+ ADIALILLA
Sbjct  1530  HWLSRADIALILLA  1543



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524286916336