BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c113545_g1_i1 len=106 path=[84:0-105]

Length=106
                                                                      Score     E

ref|XP_010795772.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  79.0    5e-16   
ref|XP_010795697.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  79.0    6e-16   
dbj|BAC33111.1|  unnamed protein product                              76.6    6e-16   Mus musculus [mouse]
gb|EHH17698.1|  hypothetical protein EGK_14157                        79.0    9e-16   
gb|AAH30651.1|  AGBL3 protein                                         79.0    9e-16   Homo sapiens [man]
gb|EFB19417.1|  hypothetical protein PANDA_017469                     78.6    1e-15   Ailuropoda melanoleuca
ref|XP_005550892.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_005550891.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_005550890.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_005550889.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_005550888.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_001104528.1|  PREDICTED: cytosolic carboxypeptidase 3-like...  79.0    1e-15   Macaca mulatta [rhesus macaque]
dbj|BAE01163.1|  unnamed protein product                              79.0    1e-15   Macaca fascicularis [crab eating macaque]
ref|XP_005550886.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_010356297.1|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   
ref|XP_005550885.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_006716026.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_007526626.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  79.0    1e-15   
ref|XP_003921027.2|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   
ref|XP_002807108.2|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   Callithrix jacchus [common marmoset]
ref|NP_848658.3|  cytosolic carboxypeptidase 3                        79.0    1e-15   Homo sapiens [man]
ref|XP_007981202.1|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   
ref|XP_004046317.1|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   
ref|XP_003813495.1|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   
ref|XP_003261418.1|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   
ref|XP_002803516.1|  PREDICTED: cytosolic carboxypeptidase 3-like...  79.0    1e-15   
sp|Q8NEM8.2|CBPC3_HUMAN  RecName: Full=Cytosolic carboxypeptidase...  79.0    1e-15   Homo sapiens [man]
ref|XP_009202184.1|  PREDICTED: cytosolic carboxypeptidase 3          79.0    1e-15   
ref|XP_008109006.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_006809993.1|  PREDICTED: cytosolic carboxypeptidase 2-like     78.6    1e-15   
ref|XP_008109005.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_006642771.1|  PREDICTED: cytosolic carboxypeptidase 2-like     79.0    1e-15   
ref|XP_008109004.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_008109003.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_008108999.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  79.0    1e-15   
ref|XP_006729240.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_008705814.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_008705813.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_005673194.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_004741780.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_002927671.1|  PREDICTED: cytosolic carboxypeptidase 3-like     78.6    2e-15   
ref|XP_008705811.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
dbj|BAK63694.1|  ATP/GTP binding protein-like 2                       75.5    2e-15   
ref|XP_004608443.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_006190346.1|  PREDICTED: cytosolic carboxypeptidase 2          78.6    2e-15   
ref|XP_010998989.1|  PREDICTED: cytosolic carboxypeptidase 2          78.6    2e-15   
ref|XP_010962832.1|  PREDICTED: cytosolic carboxypeptidase 2          78.6    2e-15   
ref|XP_006861293.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  78.6    2e-15   
ref|XP_004741779.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_005629653.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_006088388.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  78.6    2e-15   
ref|XP_004430891.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_008148766.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_004406422.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_002818522.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_007951098.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_004741778.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_003791711.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  78.6    2e-15   
ref|XP_004382766.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_003447190.2|  PREDICTED: cytosolic carboxypeptidase 2-like     78.6    2e-15   
ref|XP_006172255.1|  PREDICTED: LOW QUALITY PROTEIN: ATP/GTP bind...  78.6    2e-15   
ref|XP_005947473.1|  PREDICTED: cytosolic carboxypeptidase 2-like     78.6    2e-15   
ref|XP_004570870.1|  PREDICTED: cytosolic carboxypeptidase 2-like...  78.6    2e-15   
ref|XP_004661169.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  78.6    2e-15   
ref|XP_005331184.1|  PREDICTED: cytosolic carboxypeptidase 3          78.6    2e-15   
ref|XP_005629652.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_008705810.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_004741775.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  78.6    2e-15   
ref|XP_008285354.1|  PREDICTED: cytosolic carboxypeptidase 2-like     78.6    2e-15   
dbj|BAC37726.2|  unnamed protein product                              75.5    2e-15   Mus musculus [mouse]
ref|XP_004570869.1|  PREDICTED: cytosolic carboxypeptidase 2-like...  78.6    2e-15   
ref|XP_005734918.1|  PREDICTED: cytosolic carboxypeptidase 2-like     78.6    2e-15   
ref|XP_004570868.1|  PREDICTED: cytosolic carboxypeptidase 2-like...  78.6    2e-15   
ref|XP_004570867.1|  PREDICTED: cytosolic carboxypeptidase 2-like...  78.6    2e-15   
ref|XP_010749659.1|  PREDICTED: cytosolic carboxypeptidase 2          78.6    2e-15   
gb|EPY76996.1|  formin binding protein 4-like protein                 78.6    2e-15   
gb|ELW68796.1|  Cytosolic carboxypeptidase 3                          78.6    2e-15   
gb|EDL79478.1|  ATP/GTP binding protein-like 2 (predicted), isofo...  76.3    3e-15   
ref|XP_005860761.1|  PREDICTED: cytosolic carboxypeptidase 3          78.2    3e-15   
ref|XP_006756756.1|  PREDICTED: cytosolic carboxypeptidase 3          78.2    3e-15   
gb|EPQ04252.1|  Cytosolic carboxypeptidase 3                          78.2    3e-15   
emb|CAF98247.1|  unnamed protein product                              77.4    3e-15   Tetraodon nigroviridis
dbj|BAB15707.1|  unnamed protein product                              75.5    3e-15   Homo sapiens [man]
gb|ELK35559.1|  Cytosolic carboxypeptidase 3                          78.2    4e-15   
ref|XP_007423277.1|  PREDICTED: cytosolic carboxypeptidase 3          77.8    4e-15   
ref|XP_008572394.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    4e-15   
ref|XP_008071882.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    5e-15   
ref|XP_008071881.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    5e-15   
dbj|BAC26932.1|  unnamed protein product                              76.6    5e-15   Mus musculus [mouse]
ref|XP_006219737.1|  PREDICTED: cytosolic carboxypeptidase 3-like     76.6    5e-15   
gb|EGW11839.1|  Cytosolic carboxypeptidase 3                          76.6    5e-15   
ref|XP_004630022.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
dbj|BAH13813.1|  unnamed protein product                              77.4    5e-15   Homo sapiens [man]
ref|XP_003475404.2|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|XP_010829940.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|XP_005959029.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|XP_005679550.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|XP_004008129.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|XP_005906988.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|NP_001179571.1|  cytosolic carboxypeptidase 3                     77.4    5e-15   
ref|XP_005205825.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    5e-15   
ref|XP_007669810.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  77.0    5e-15   
ref|XP_003967431.1|  PREDICTED: cytosolic carboxypeptidase 2-like     77.4    5e-15   
ref|XP_005205824.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    5e-15   
ref|XP_008071880.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    5e-15   
ref|XP_005405553.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|NP_001072531.1|  cytosolic carboxypeptidase 2                     77.4    5e-15   Xenopus tropicalis [western clawed frog]
ref|XP_004677253.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  77.4    5e-15   
ref|XP_006079928.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    5e-15   
ref|XP_005205819.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    5e-15   
sp|E1B9D8.1|CBPC3_BOVIN  RecName: Full=Cytosolic carboxypeptidase...  77.4    5e-15   
gb|ELR48181.1|  Cytosolic carboxypeptidase 3                          77.4    5e-15   
ref|XP_008268992.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    6e-15   
ref|XP_008268987.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    6e-15   
ref|XP_008268981.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    6e-15   
ref|XP_008268973.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    6e-15   
ref|XP_008256361.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    6e-15   
ref|XP_007444892.1|  PREDICTED: cytosolic carboxypeptidase 2-like     75.5    6e-15   
ref|XP_008268966.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    6e-15   
ref|XP_008268961.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    6e-15   
ref|XP_008256360.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    6e-15   
gb|EDM15313.1|  rCG28185                                              76.6    6e-15   
gb|EDL13683.1|  ATP/GTP binding protein-like 3                        76.6    6e-15   
ref|XP_008256359.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    6e-15   
ref|XP_008256357.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    6e-15   
ref|XP_008256356.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    6e-15   
ref|XP_008536547.1|  PREDICTED: cytosolic carboxypeptidase 3          77.0    6e-15   
gb|EDL27496.1|  ATP/GTP binding protein-like 2, isoform CRA_c         76.3    6e-15   
ref|XP_008256355.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    6e-15   
ref|XP_005609555.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  77.0    6e-15   
ref|XP_008256354.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  77.4    6e-15   
ref|XP_006506797.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    7e-15   
ref|XP_005082472.1|  PREDICTED: cytosolic carboxypeptidase 3          77.4    7e-15   
ref|XP_009053852.1|  hypothetical protein LOTGIDRAFT_117158           76.3    7e-15   
ref|XP_006157898.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_006193750.1|  PREDICTED: cytosolic carboxypeptidase 3          76.6    7e-15   
ref|XP_007082232.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_006937366.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_010590366.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_007113029.1|  PREDICTED: cytosolic carboxypeptidase 2-like     77.0    7e-15   
gb|ELW48872.1|  Cytosolic carboxypeptidase 2                          77.0    7e-15   
ref|XP_010590365.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_010590364.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_008773916.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    7e-15   
ref|XP_006157897.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_008699189.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_006937365.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
dbj|BAC26802.1|  unnamed protein product                              76.3    7e-15   Mus musculus [mouse]
ref|XP_007082231.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_005110720.1|  PREDICTED: cytosolic carboxypeptidase 2-like     77.0    7e-15   
ref|XP_005631287.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_004708499.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    7e-15   
ref|XP_010590363.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_010590362.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_006157896.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_008699188.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_010973985.1|  PREDICTED: cytosolic carboxypeptidase 3          76.6    7e-15   
ref|XP_005631286.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_005631285.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_005330140.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    7e-15   
ref|XP_006937364.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_010590361.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_007082230.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_008699190.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_003432456.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    7e-15   
ref|XP_006937363.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_006865167.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    8e-15   
ref|XP_004399657.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    8e-15   
ref|XP_007884486.1|  PREDICTED: cytosolic carboxypeptidase 2-like     74.7    8e-15   
ref|XP_010590360.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_007082229.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_006748339.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    8e-15   
ref|XP_004683617.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    8e-15   
ref|XP_005631284.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_006937362.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_004585638.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    8e-15   
ref|XP_007082228.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_004485064.1|  PREDICTED: LOW QUALITY PROTEIN: ATP/GTP bind...  77.0    8e-15   
ref|XP_005631283.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_004437045.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    8e-15   
ref|NP_001276586.1|  cytosolic carboxypeptidase 3 isoform 3           76.6    8e-15   
ref|XP_006820539.1|  PREDICTED: cytosolic carboxypeptidase 2-like     77.0    8e-15   
ref|XP_005631281.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  77.0    8e-15   
ref|XP_007619636.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    8e-15   
ref|XP_010598741.1|  PREDICTED: cytosolic carboxypeptidase 3          77.0    8e-15   
ref|XP_006506795.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    8e-15   
ref|XP_007647711.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    8e-15   
ref|XP_006224923.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    8e-15   
ref|XP_002597488.1|  hypothetical protein BRAFLDRAFT_222797           76.3    8e-15   Branchiostoma floridae
ref|XP_003781607.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  77.0    8e-15   
ref|XP_007647710.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    8e-15   
gb|ABI51951.1|  cytosolic carboxypeptidase 3 isoform 2                76.6    8e-15   Mus musculus [mouse]
ref|XP_006224922.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    8e-15   
ref|XP_007647709.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
ref|XP_005987016.1|  PREDICTED: cytosolic carboxypeptidase 2          77.0    9e-15   
ref|XP_006506794.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
gb|EPY74070.1|  hypothetical protein CB1_002312012                    76.6    9e-15   
ref|NP_848745.2|  cytosolic carboxypeptidase 3 isoform 2              76.6    9e-15   Mus musculus [mouse]
ref|NP_001276585.1|  cytosolic carboxypeptidase 3 isoform 1           76.6    9e-15   
ref|XP_006990446.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  76.6    9e-15   
ref|XP_010945812.1|  PREDICTED: cytosolic carboxypeptidase 3          76.6    9e-15   
ref|XP_004471566.1|  PREDICTED: cytosolic carboxypeptidase 3          76.6    9e-15   
ref|XP_004387775.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  76.6    9e-15   
gb|ERE90330.1|  cytosolic carboxypeptidase 3                          76.6    9e-15   
gb|ERE90332.1|  cytosolic carboxypeptidase 3                          76.6    9e-15   
gb|EDL79472.1|  ATP/GTP binding protein-like 2 (predicted), isofo...  76.3    9e-15   
ref|XP_007647708.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
gb|ERE90331.1|  cytosolic carboxypeptidase 3                          76.6    9e-15   
ref|XP_003508948.2|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
ref|XP_006224921.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
ref|XP_006234602.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    9e-15   
ref|XP_005064617.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    9e-15   
ref|XP_007647707.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
ref|XP_007647706.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
ref|XP_007647704.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.6    9e-15   
gb|ERE90329.1|  cytosolic carboxypeptidase 3                          76.6    9e-15   
ref|XP_007076333.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  76.6    9e-15   
gb|EDL79475.1|  ATP/GTP binding protein-like 2 (predicted), isofo...  76.3    1e-14   
ref|XP_008760239.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
dbj|BAC30555.2|  unnamed protein product                              76.3    1e-14   Mus musculus [mouse]
ref|XP_008760238.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007181300.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004763093.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_008760237.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007181299.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_010821224.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499711.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007181298.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
gb|EDL27495.1|  ATP/GTP binding protein-like 2, isoform CRA_b         76.3    1e-14   
ref|XP_004790624.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006057460.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
gb|EGW03957.1|  Cytosolic carboxypeptidase 2                          76.3    1e-14   
ref|XP_006499710.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006057459.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007608712.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007181297.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
gb|EDL27497.1|  ATP/GTP binding protein-like 2, isoform CRA_d         76.3    1e-14   
ref|XP_004657148.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_006499709.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499708.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499707.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006057458.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
gb|ABI51949.1|  cytosolic carboxypeptidase 2 isoform 5                76.3    1e-14   Mus musculus [mouse]
ref|XP_010840727.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007608704.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006057457.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
gb|ABI51945.1|  cytosolic carboxypeptidase 2 isoform 1                76.3    1e-14   Mus musculus [mouse]
ref|XP_006499706.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499705.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499704.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
dbj|BAC26827.1|  unnamed protein product                              76.3    1e-14   Mus musculus [mouse]
gb|EDL27494.1|  ATP/GTP binding protein-like 2, isoform CRA_a         76.3    1e-14   
gb|ABI51948.1|  cytosolic carboxypeptidase 2 isoform 4                76.3    1e-14   Mus musculus [mouse]
ref|XP_007608696.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499703.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499702.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004790623.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004790625.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
gb|ABI51947.1|  cytosolic carboxypeptidase 2 isoform 3                76.3    1e-14   Mus musculus [mouse]
ref|XP_007608690.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_010840726.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_005194773.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006057456.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499700.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499698.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499701.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_010821223.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006057455.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006499697.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004763092.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006212408.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_005984648.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_005909884.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_005690232.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_005194772.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006057454.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
gb|ABI51946.1|  cytosolic carboxypeptidase 2 isoform 2                76.3    1e-14   Mus musculus [mouse]
ref|XP_005364253.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  76.3    1e-14   
ref|XP_006499692.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|NP_848870.2|  cytosolic carboxypeptidase 2                        76.3    1e-14   
ref|XP_008773752.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004763091.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007181296.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_010840725.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007519095.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_006057453.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_005194771.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004763094.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004264475.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  76.3    1e-14   
ref|XP_006057452.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_003497375.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_007181295.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_006984461.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_002124780.2|  PREDICTED: cytosolic carboxypeptidase 2-like     76.3    1e-14   
ref|XP_004790622.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004790621.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004790620.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  76.3    1e-14   
ref|XP_004016800.1|  PREDICTED: cytosolic carboxypeptidase 2          76.3    1e-14   
ref|XP_007504422.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
ref|XP_007504421.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
ref|XP_007504420.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
ref|XP_007504419.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
ref|XP_005253198.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    1e-14   
ref|XP_007504418.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
ref|XP_007504417.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
ref|XP_005365939.1|  PREDICTED: cytosolic carboxypeptidase 3          76.3    1e-14   
ref|XP_007504416.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
dbj|BAD96891.1|  hypothetical protein FLJ23598 variant                75.5    1e-14   
ref|XP_010811181.1|  PREDICTED: formin-binding protein 4 isoform X2   76.3    1e-14   
ref|XP_007504414.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  76.3    1e-14   
ref|XP_001641333.1|  predicted protein                                75.5    1e-14   
ref|XP_003771686.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  76.3    1e-14   
gb|EKC22196.1|  Cytosolic carboxypeptidase 2                          76.3    1e-14   
ref|XP_009184338.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
gb|EAW67889.1|  ATP/GTP binding protein-like 2, isoform CRA_a         75.5    2e-14   
ref|XP_009184337.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_004051122.1|  PREDICTED: cytosolic carboxypeptidase 2-like     75.5    2e-14   
ref|XP_006896824.1|  PREDICTED: cytosolic carboxypeptidase 2          75.9    2e-14   
ref|XP_009184336.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007455782.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  75.9    2e-14   
ref|XP_009184335.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_010614468.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
ref|XP_010614467.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
ref|XP_008841851.1|  PREDICTED: cytosolic carboxypeptidase 2          75.9    2e-14   
ref|XP_010614466.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
ref|XP_004707952.1|  PREDICTED: cytosolic carboxypeptidase 3          75.9    2e-14   
ref|XP_006718392.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_003278997.2|  PREDICTED: cytosolic carboxypeptidase 2          75.5    2e-14   
ref|XP_002799620.1|  PREDICTED: cytosolic carboxypeptidase 2-like     75.5    2e-14   
ref|XP_005253197.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_006718391.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007997443.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
dbj|BAG64183.1|  unnamed protein product                              75.5    2e-14   
ref|XP_009458645.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_005253196.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007997432.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
sp|Q4R632.1|CBPC2_MACFA  RecName: Full=Cytosolic carboxypeptidase...  75.5    2e-14   
ref|XP_007997426.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_009458644.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_006718390.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007997419.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_009458641.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_005253195.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_008966325.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  75.5    2e-14   
ref|XP_009006359.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  75.5    2e-14   
ref|XP_007997408.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007997400.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_005577978.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  75.5    2e-14   
ref|XP_010369439.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  75.5    2e-14   
ref|NP_079059.2|  cytosolic carboxypeptidase 2                        75.5    2e-14   
ref|XP_009244654.1|  PREDICTED: cytosolic carboxypeptidase 2          75.5    2e-14   
gb|AAH36234.1|  ATP/GTP binding protein-like 2                        75.5    2e-14   
ref|XP_008109952.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007997395.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007997390.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_005803363.1|  PREDICTED: cytosolic carboxypeptidase 2-like     75.5    2e-14   
ref|XP_008109939.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_008109930.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_007997334.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_008109924.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_008109919.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.5    2e-14   
ref|XP_010614465.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
ref|XP_010614464.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
ref|XP_010614463.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
ref|XP_010614462.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
ref|XP_010614460.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    2e-14   
gb|ELK13834.1|  Cytosolic carboxypeptidase 3                          75.5    2e-14   
ref|XP_006910563.1|  PREDICTED: cytosolic carboxypeptidase 3          75.5    2e-14   
ref|XP_007072754.1|  PREDICTED: LOW QUALITY PROTEIN: ATP/GTP bind...  75.5    2e-14   
ref|XP_004070260.1|  PREDICTED: cytosolic carboxypeptidase 2-like     75.5    2e-14   
ref|XP_006125981.1|  PREDICTED: cytosolic carboxypeptidase 3          75.5    3e-14   
ref|XP_008177003.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    3e-14   
ref|XP_008177002.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    3e-14   
ref|XP_008177001.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  75.5    3e-14   
ref|XP_008572267.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.1    3e-14   
ref|XP_008409829.1|  PREDICTED: cytosolic carboxypeptidase 2-like...  75.5    3e-14   
ref|XP_008409828.1|  PREDICTED: cytosolic carboxypeptidase 2-like...  75.5    3e-14   
ref|XP_008409827.1|  PREDICTED: cytosolic carboxypeptidase 2-like...  75.5    3e-14   
ref|XP_008572266.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.1    3e-14   
gb|KFO18369.1|  Cytosolic carboxypeptidase 3                          75.5    3e-14   
ref|XP_008572265.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.1    3e-14   
ref|XP_008572264.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  75.1    3e-14   
ref|XP_008052995.1|  PREDICTED: cytosolic carboxypeptidase 3          75.1    3e-14   
gb|ELK16107.1|  Cytosolic carboxypeptidase 2                          75.1    3e-14   
gb|EPQ10534.1|  Cytosolic carboxypeptidase 2                          75.1    4e-14   
ref|XP_006772401.1|  PREDICTED: cytosolic carboxypeptidase 2          75.1    4e-14   
ref|XP_006929456.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  75.1    4e-14   
ref|XP_008144939.1|  PREDICTED: cytosolic carboxypeptidase 2          75.1    4e-14   
ref|XP_006908189.1|  PREDICTED: cytosolic carboxypeptidase 2          75.1    4e-14   
ref|XP_006092000.1|  PREDICTED: cytosolic carboxypeptidase 2          75.1    4e-14   
ref|XP_005870906.1|  PREDICTED: cytosolic carboxypeptidase 2          75.1    4e-14   
ref|XP_006035890.1|  PREDICTED: cytosolic carboxypeptidase 2-like     74.3    4e-14   
ref|XP_002921702.1|  PREDICTED: cytosolic carboxypeptidase 2-like     74.7    4e-14   
gb|EFB16083.1|  hypothetical protein PANDA_010607                     74.7    4e-14   
gb|ELK23838.1|  Cytosolic carboxypeptidase 2                          75.1    4e-14   
emb|CDQ63226.1|  unnamed protein product                              74.7    4e-14   
ref|XP_007561491.1|  PREDICTED: cytosolic carboxypeptidase 2          74.7    4e-14   
ref|XP_010882067.1|  PREDICTED: cytosolic carboxypeptidase 2-like     74.7    4e-14   
gb|EMP27692.1|  Cytosolic carboxypeptidase 2                          74.3    5e-14   
gb|ETE72716.1|  Cytosolic carboxypeptidase 2                          74.3    5e-14   
ref|XP_006270898.1|  PREDICTED: cytosolic carboxypeptidase 2          74.3    5e-14   
ref|XP_006035891.1|  PREDICTED: cytosolic carboxypeptidase 2-like     74.3    5e-14   
ref|XP_003465202.2|  PREDICTED: cytosolic carboxypeptidase 2          74.3    5e-14   
ref|XP_006111012.1|  PREDICTED: cytosolic carboxypeptidase 2          74.3    5e-14   
ref|XP_004627336.1|  PREDICTED: cytosolic carboxypeptidase 2          74.3    5e-14   
ref|XP_008335725.1|  PREDICTED: cytosolic carboxypeptidase 2-like     74.7    5e-14   
ref|XP_005295099.2|  PREDICTED: cytosolic carboxypeptidase 2          74.3    5e-14   
ref|XP_007956701.1|  PREDICTED: cytosolic carboxypeptidase 2          74.3    6e-14   
ref|XP_007497501.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  74.3    6e-14   
gb|KFO12588.1|  Cytosolic carboxypeptidase 3                          73.2    6e-14   
ref|XP_007497500.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  74.3    6e-14   
ref|XP_007497499.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  74.3    6e-14   
ref|XP_007497498.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  74.3    6e-14   
ref|XP_007497497.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  74.3    6e-14   
ref|XP_007068530.1|  PREDICTED: cytosolic carboxypeptidase 2          74.3    6e-14   
ref|XP_007497496.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  74.3    6e-14   
ref|XP_007497494.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  74.3    6e-14   
ref|XP_003773808.1|  PREDICTED: cytosolic carboxypeptidase 2          74.3    6e-14   
ref|XP_009643911.1|  PREDICTED: cytosolic carboxypeptidase 3          73.6    8e-14   
gb|ELT89711.1|  hypothetical protein CAPTEDRAFT_104264                73.6    8e-14   
ref|XP_006633721.1|  PREDICTED: cytosolic carboxypeptidase 3-like     73.6    9e-14   
ref|XP_010332683.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  73.9    9e-14   
ref|XP_010332674.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  73.9    9e-14   
ref|NP_001092717.1|  cytosolic carboxypeptidase 2                     73.6    9e-14   
gb|EHB11141.1|  Cytosolic carboxypeptidase 2                          73.6    1e-13   
ref|XP_010304255.1|  PREDICTED: cytosolic carboxypeptidase 3          73.2    1e-13   
gb|EMC89208.1|  Cytosolic carboxypeptidase 3                          73.2    1e-13   
ref|XP_009296353.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  73.6    1e-13   
ref|XP_005163181.2|  PREDICTED: cytosolic carboxypeptidase 2 isof...  73.6    1e-13   
ref|XP_006005956.1|  PREDICTED: cytosolic carboxypeptidase 3-like     72.8    1e-13   
ref|XP_005515140.1|  PREDICTED: cytosolic carboxypeptidase 3          73.2    1e-13   
ref|XP_004600057.1|  PREDICTED: LOW QUALITY PROTEIN: ATP/GTP bind...  73.6    1e-13   
gb|KFZ54529.1|  Cytosolic carboxypeptidase 3                          72.0    1e-13   
gb|KFW12058.1|  Cytosolic carboxypeptidase 3                          72.0    1e-13   
ref|XP_004897611.1|  PREDICTED: cytosolic carboxypeptidase 2          73.2    2e-13   
ref|XP_004987694.1|  hypothetical protein PTSG_11335                  73.2    2e-13   
ref|XP_010021346.1|  PREDICTED: cytosolic carboxypeptidase 3          70.5    2e-13   
ref|XP_004852666.1|  PREDICTED: cytosolic carboxypeptidase 2          73.2    2e-13   
gb|KFU90656.1|  Cytosolic carboxypeptidase 3                          71.6    2e-13   
ref|XP_010162258.1|  PREDICTED: cytosolic carboxypeptidase 3          72.0    2e-13   
ref|XP_010157240.1|  PREDICTED: cytosolic carboxypeptidase 3          72.0    2e-13   
gb|KFW61170.1|  Cytosolic carboxypeptidase 3                          71.6    2e-13   
gb|KFR15125.1|  Cytosolic carboxypeptidase 3                          71.6    2e-13   
gb|KFQ96116.1|  Cytosolic carboxypeptidase 3                          71.6    2e-13   
gb|KFO95998.1|  Cytosolic carboxypeptidase 3                          71.6    2e-13   
gb|KFM02279.1|  Cytosolic carboxypeptidase 3                          71.6    2e-13   
gb|KFQ00190.1|  Cytosolic carboxypeptidase 3                          71.6    2e-13   
gb|KFQ49525.1|  Cytosolic carboxypeptidase 3                          71.6    3e-13   
gb|KGL87495.1|  Cytosolic carboxypeptidase 3                          71.6    3e-13   
gb|KGL76066.1|  Cytosolic carboxypeptidase 3                          71.6    3e-13   
gb|KFV65797.1|  Cytosolic carboxypeptidase 3                          71.2    3e-13   
ref|XP_009476645.1|  PREDICTED: cytosolic carboxypeptidase 3-like     71.6    3e-13   
ref|XP_008940254.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  70.1    3e-13   
ref|XP_009892710.1|  PREDICTED: cytosolic carboxypeptidase 3          71.6    4e-13   
ref|XP_009675868.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  72.0    4e-13   
ref|XP_010295691.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  71.6    4e-13   
gb|KFW91033.1|  Cytosolic carboxypeptidase 3                          70.9    4e-13   
ref|XP_009462290.1|  PREDICTED: cytosolic carboxypeptidase 3          71.6    4e-13   
ref|XP_009938482.1|  PREDICTED: cytosolic carboxypeptidase 3          71.6    4e-13   
gb|EOA97725.1|  Cytosolic carboxypeptidase 3                          71.6    4e-13   
ref|XP_008495586.1|  PREDICTED: cytosolic carboxypeptidase 3          71.6    4e-13   
ref|XP_010211202.1|  PREDICTED: cytosolic carboxypeptidase 3          71.6    4e-13   
ref|XP_009997336.1|  PREDICTED: cytosolic carboxypeptidase 3          71.6    4e-13   
ref|XP_010567494.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  71.6    5e-13   
ref|XP_008536738.1|  PREDICTED: cytosolic carboxypeptidase 2-like     71.6    5e-13   
ref|XP_007884090.1|  PREDICTED: cytosolic carboxypeptidase 3-like     70.9    5e-13   
ref|XP_007198562.1|  PREDICTED: LOW QUALITY PROTEIN: ATP/GTP bind...  71.6    5e-13   
ref|XP_010567493.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  71.6    5e-13   
ref|XP_010567492.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  71.6    5e-13   
ref|XP_010567491.1|  PREDICTED: cytosolic carboxypeptidase 3 isof...  71.6    5e-13   
ref|XP_009912264.1|  PREDICTED: cytosolic carboxypeptidase 3-like     71.6    5e-13   
ref|XP_009896840.1|  PREDICTED: cytosolic carboxypeptidase 3          71.2    5e-13   
ref|XP_009288422.1|  PREDICTED: cytosolic carboxypeptidase 3-like     71.6    5e-13   
ref|XP_009321263.1|  PREDICTED: cytosolic carboxypeptidase 3-like     71.6    5e-13   
ref|XP_005024636.1|  PREDICTED: cytosolic carboxypeptidase 3          71.6    6e-13   
ref|XP_001915585.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  71.6    6e-13   
gb|ELU09141.1|  hypothetical protein CAPTEDRAFT_228817                71.6    6e-13   
ref|XP_009570746.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  70.9    6e-13   
ref|XP_009503039.1|  PREDICTED: cytosolic carboxypeptidase 3          70.9    7e-13   
ref|XP_007246644.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  71.2    8e-13   
ref|XP_007246643.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  71.2    8e-13   
ref|XP_007246641.1|  PREDICTED: cytosolic carboxypeptidase 2 isof...  71.2    8e-13   
ref|XP_001693491.1|  flagellar/basal body protein                     70.1    8e-13   
ref|XP_009981613.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  70.1    1e-12   
ref|XP_004921504.1|  PREDICTED: LOW QUALITY PROTEIN: ATP/GTP bind...  70.5    1e-12   
gb|KFP25686.1|  Cytosolic carboxypeptidase 3                          69.3    1e-12   
gb|EJY87732.1|  Zinc carboxypeptidase family protein                  70.1    2e-12   
ref|XP_010562681.1|  PREDICTED: cytosolic carboxypeptidase 2          70.1    2e-12   
ref|XP_010199915.1|  PREDICTED: cytosolic carboxypeptidase 3          69.3    2e-12   
ref|XP_009063236.1|  hypothetical protein LOTGIDRAFT_235577           69.7    3e-12   
ref|XP_003384943.1|  PREDICTED: hypothetical protein LOC100637326     69.7    3e-12   
emb|CDW76837.1|  UNKNOWN                                              68.9    4e-12   
ref|XP_009946991.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  68.6    4e-12   
ref|XP_010707988.1|  PREDICTED: cytosolic carboxypeptidase 3          68.6    5e-12   
ref|XP_005823312.1|  hypothetical protein GUITHDRAFT_145801           67.8    5e-12   
ref|XP_002108492.1|  hypothetical protein TRIADDRAFT_19871            67.8    6e-12   
ref|XP_424259.4|  PREDICTED: LOW QUALITY PROTEIN: cytosolic carbo...  68.6    6e-12   
ref|XP_010709111.1|  PREDICTED: cytosolic carboxypeptidase 2          68.6    7e-12   
ref|XP_009968290.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic ca...  67.8    7e-12   
ref|XP_002602339.1|  hypothetical protein BRAFLDRAFT_234332           67.8    7e-12   



>ref|XP_010795772.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Notothenia 
coriiceps]
Length=406

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  348  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  382



>ref|XP_010795697.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Notothenia 
coriiceps]
Length=448

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  390  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  424



>dbj|BAC33111.1| unnamed protein product [Mus musculus]
Length=207

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  149  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  183



>gb|EHH17698.1| hypothetical protein EGK_14157 [Macaca mulatta]
 gb|EHH52526.1| hypothetical protein EGM_12980 [Macaca fascicularis]
Length=614

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>gb|AAH30651.1| AGBL3 protein [Homo sapiens]
 gb|EAW83837.1| ATP/GTP binding protein-like 3, isoform CRA_a [Homo sapiens]
 gb|AIC61724.1| AGBL3, partial [synthetic construct]
Length=621

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>gb|EFB19417.1| hypothetical protein PANDA_017469 [Ailuropoda melanoleuca]
Length=483

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  257  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  291



>ref|XP_005550892.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X8 [Macaca fascicularis]
Length=673

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005550891.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X7 [Macaca fascicularis]
Length=677

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005550890.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X6 [Macaca fascicularis]
Length=690

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005550889.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X5 [Macaca fascicularis]
Length=692

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005550888.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Macaca fascicularis]
Length=694

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_001104528.1| PREDICTED: cytosolic carboxypeptidase 3-like isoform 1 [Macaca 
mulatta]
 ref|XP_005550887.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Macaca fascicularis]
Length=705

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>dbj|BAE01163.1| unnamed protein product [Macaca fascicularis]
Length=705

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005550886.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Macaca fascicularis]
Length=709

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_010356297.1| PREDICTED: cytosolic carboxypeptidase 3, partial [Rhinopithecus 
roxellana]
Length=780

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  248  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  282



>ref|XP_005550885.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Macaca fascicularis]
Length=803

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_006716026.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Homo sapiens]
Length=859

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_007526626.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Erinaceus europaeus]
Length=874

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  381  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  415



>ref|XP_003921027.2| PREDICTED: cytosolic carboxypeptidase 3 [Saimiri boliviensis 
boliviensis]
Length=913

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_002807108.2| PREDICTED: cytosolic carboxypeptidase 3 [Callithrix jacchus]
 ref|XP_009001276.1| PREDICTED: cytosolic carboxypeptidase 3 [Callithrix jacchus]
Length=914

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|NP_848658.3| cytosolic carboxypeptidase 3 [Homo sapiens]
 ref|XP_006716024.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Homo sapiens]
 ref|XP_006716025.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Homo sapiens]
Length=920

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_007981202.1| PREDICTED: cytosolic carboxypeptidase 3 [Chlorocebus sabaeus]
Length=921

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_004046317.1| PREDICTED: cytosolic carboxypeptidase 3 [Gorilla gorilla gorilla]
Length=921

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_003813495.1| PREDICTED: cytosolic carboxypeptidase 3 [Pan paniscus]
 ref|XP_009452533.1| PREDICTED: cytosolic carboxypeptidase 3 [Pan troglodytes]
Length=921

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_003261418.1| PREDICTED: cytosolic carboxypeptidase 3 [Nomascus leucogenys]
Length=921

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_002803516.1| PREDICTED: cytosolic carboxypeptidase 3-like isoform 2 [Macaca 
mulatta]
Length=921

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>sp|Q8NEM8.2|CBPC3_HUMAN RecName: Full=Cytosolic carboxypeptidase 3; AltName: Full=ATP/GTP-binding 
protein-like 3 [Homo sapiens]
Length=1001

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_009202184.1| PREDICTED: cytosolic carboxypeptidase 3 [Papio anubis]
Length=1010

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  436  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  470



>ref|XP_008109006.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X5 [Anolis carolinensis]
Length=1036

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  390  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  424



>ref|XP_006809993.1| PREDICTED: cytosolic carboxypeptidase 2-like [Neolamprologus 
brichardi]
Length=577

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  519  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  553



>ref|XP_008109005.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Anolis carolinensis]
Length=1071

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  390  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  424



>ref|XP_006642771.1| PREDICTED: cytosolic carboxypeptidase 2-like [Lepisosteus oculatus]
Length=1087

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  475  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  509



>ref|XP_008109004.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Anolis carolinensis]
Length=1113

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  389  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  423



>ref|XP_008109003.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Anolis carolinensis]
Length=1113

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  390  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  424



>ref|XP_008108999.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Anolis carolinensis]
 ref|XP_008109000.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Anolis carolinensis]
 ref|XP_008109001.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Anolis carolinensis]
 ref|XP_008109002.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Anolis carolinensis]
Length=1114

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  390  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  424



>ref|XP_006729240.1| PREDICTED: cytosolic carboxypeptidase 3 [Leptonychotes weddellii]
Length=712

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_008705814.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Ursus maritimus]
Length=720

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_008705813.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Ursus maritimus]
Length=724

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_005673194.1| PREDICTED: cytosolic carboxypeptidase 3 [Sus scrofa]
Length=726

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_004741780.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X6 [Mustela putorius 
furo]
 ref|XP_004789652.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X7 [Mustela putorius 
furo]
Length=732

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_002927671.1| PREDICTED: cytosolic carboxypeptidase 3-like [Ailuropoda melanoleuca]
Length=792

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  258  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  292



>ref|XP_008705811.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Ursus maritimus]
Length=799

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>dbj|BAK63694.1| ATP/GTP binding protein-like 2 [Pan troglodytes]
Length=236

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  151  AQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDL  185



>ref|XP_004608443.1| PREDICTED: cytosolic carboxypeptidase 3 [Sorex araneus]
Length=826

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_006190346.1| PREDICTED: cytosolic carboxypeptidase 2 [Camelus ferus]
Length=846

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  432  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  466



>ref|XP_010998989.1| PREDICTED: cytosolic carboxypeptidase 2 [Camelus dromedarius]
Length=864

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  450  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  484



>ref|XP_010962832.1| PREDICTED: cytosolic carboxypeptidase 2 [Camelus bactrianus]
Length=864

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  450  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  484



>ref|XP_006861293.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Chrysochloris asiatica]
Length=875

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  347  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  381



>ref|XP_004741779.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X5 [Mustela putorius 
furo]
 ref|XP_004789651.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X6 [Mustela putorius 
furo]
Length=888

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  268  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  302



>ref|XP_005629653.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Canis lupus 
familiaris]
Length=905

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  383  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  417



>ref|XP_006088388.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Myotis lucifugus]
Length=906

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  385  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  419



>ref|XP_004430891.1| PREDICTED: cytosolic carboxypeptidase 3 [Ceratotherium simum 
simum]
Length=906

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  376  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  410



>ref|XP_008148766.1| PREDICTED: cytosolic carboxypeptidase 3 [Eptesicus fuscus]
Length=918

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  385  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  419



>ref|XP_004406422.1| PREDICTED: cytosolic carboxypeptidase 3 [Odobenus rosmarus divergens]
Length=919

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  386  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  420



>ref|XP_002818522.1| PREDICTED: cytosolic carboxypeptidase 3 [Pongo abelii]
 ref|XP_009241523.1| PREDICTED: cytosolic carboxypeptidase 3 [Pongo abelii]
Length=921

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_007951098.1| PREDICTED: cytosolic carboxypeptidase 3 [Orycteropus afer afer]
Length=922

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  384  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  418



>ref|XP_004741778.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Mustela putorius 
furo]
 ref|XP_004789650.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X5 [Mustela putorius 
furo]
Length=925

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_003791711.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Otolemur garnettii]
Length=925

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_004382766.1| PREDICTED: cytosolic carboxypeptidase 3 [Trichechus manatus latirostris]
Length=926

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_003447190.2| PREDICTED: cytosolic carboxypeptidase 2-like [Oreochromis niloticus]
Length=826

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  425  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  459



>ref|XP_006172255.1| PREDICTED: LOW QUALITY PROTEIN: ATP/GTP binding protein-like 
3 [Tupaia chinensis]
Length=951

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  419  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  453



>ref|XP_005947473.1| PREDICTED: cytosolic carboxypeptidase 2-like [Haplochromis burtoni]
Length=843

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  412  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  446



>ref|XP_004570870.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform X4 [Maylandia 
zebra]
Length=857

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  415  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  449



>ref|XP_004661169.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Jaculus jaculus]
Length=982

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  429  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  463



>ref|XP_005331184.1| PREDICTED: cytosolic carboxypeptidase 3 [Ictidomys tridecemlineatus]
Length=997

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005629652.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Canis lupus 
familiaris]
Length=1001

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  383  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  417



>ref|XP_008705810.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Ursus maritimus]
Length=1007

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_004741775.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Mustela putorius 
furo]
 ref|XP_004741776.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Mustela putorius 
furo]
 ref|XP_004741777.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Mustela putorius 
furo]
 ref|XP_004789646.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Mustela putorius 
furo]
 ref|XP_004789647.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Mustela putorius 
furo]
 ref|XP_004789648.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Mustela putorius 
furo]
 ref|XP_004789649.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Mustela putorius 
furo]
Length=1007

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_008285354.1| PREDICTED: cytosolic carboxypeptidase 2-like [Stegastes partitus]
Length=898

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  391  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  425



>dbj|BAC37726.2| unnamed protein product [Mus musculus]
Length=278

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  15   AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  49



>ref|XP_004570869.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform X3 [Maylandia 
zebra]
Length=1012

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  415  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  449



>ref|XP_005734918.1| PREDICTED: cytosolic carboxypeptidase 2-like [Pundamilia nyererei]
Length=1015

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  412  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  446



>ref|XP_004570868.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform X2 [Maylandia 
zebra]
Length=1023

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  415  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  449



>ref|XP_004570867.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform X1 [Maylandia 
zebra]
Length=1023

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  415  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  449



>ref|XP_010749659.1| PREDICTED: cytosolic carboxypeptidase 2 [Larimichthys crocea]
Length=1029

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  408  AQLLRDTFVFKVVPMLNPDGVVVGNYRCSLAGRDL  442



>gb|EPY76996.1| formin binding protein 4-like protein [Camelus ferus]
Length=1506

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1     AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
             AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  1196  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  1230



>gb|ELW68796.1| Cytosolic carboxypeptidase 3 [Tupaia chinensis]
Length=1506

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1     AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
             AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  1111  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  1145


 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1     AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
             AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  1156  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  1190



>gb|EDL79478.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_c [Rattus 
norvegicus]
Length=358

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  151  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  185



>ref|XP_005860761.1| PREDICTED: cytosolic carboxypeptidase 3 [Myotis brandtii]
Length=917

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  385  AQLLRDTFIFKVIPMLNPDGVIVGNYRCSLAGRDL  419



>ref|XP_006756756.1| PREDICTED: cytosolic carboxypeptidase 3 [Myotis davidii]
Length=921

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  385  AQLLRDTFIFKVIPMLNPDGVIVGNYRCSLAGRDL  419



>gb|EPQ04252.1| Cytosolic carboxypeptidase 3 [Myotis brandtii]
Length=991

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  373  AQLLRDTFIFKVIPMLNPDGVIVGNYRCSLAGRDL  407



>emb|CAF98247.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=538

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  351  ARLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  385



>dbj|BAB15707.1| unnamed protein product [Homo sapiens]
Length=325

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  15   AQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDL  49



>gb|ELK35559.1| Cytosolic carboxypeptidase 3 [Myotis davidii]
Length=1367

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  831  AQLLRDTFIFKVIPMLNPDGVIVGNYRCSLAGRDL  865



>ref|XP_007423277.1| PREDICTED: cytosolic carboxypeptidase 3 [Python bivittatus]
Length=959

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  391  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGKDL  425



>ref|XP_008572394.1| PREDICTED: cytosolic carboxypeptidase 3 [Galeopterus variegatus]
Length=634

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  408  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  442



>ref|XP_008071882.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Tarsius syrichta]
Length=522

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  409  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  443



>ref|XP_008071881.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Tarsius syrichta]
Length=544

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  465



>dbj|BAC26932.1| unnamed protein product [Mus musculus]
 gb|AAI39066.1| Agbl3 protein [Mus musculus]
Length=511

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_006219737.1| PREDICTED: cytosolic carboxypeptidase 3-like, partial [Vicugna 
pacos]
Length=496

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  248  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGQDL  282



>gb|EGW11839.1| Cytosolic carboxypeptidase 3 [Cricetulus griseus]
Length=518

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_004630022.1| PREDICTED: cytosolic carboxypeptidase 3 [Octodon degus]
Length=897

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSL GRDL
Sbjct  387  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLTGRDL  421



>dbj|BAH13813.1| unnamed protein product [Homo sapiens]
Length=920

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AQLLRDTFAFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_003475404.2| PREDICTED: cytosolic carboxypeptidase 3 [Cavia porcellus]
Length=945

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSL GRDL
Sbjct  501  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLTGRDL  535



>ref|XP_010829940.1| PREDICTED: cytosolic carboxypeptidase 3 [Bison bison bison]
Length=917

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005959029.1| PREDICTED: cytosolic carboxypeptidase 3 [Pantholops hodgsonii]
Length=918

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005679550.1| PREDICTED: cytosolic carboxypeptidase 3 [Capra hircus]
Length=918

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_004008129.1| PREDICTED: cytosolic carboxypeptidase 3 [Ovis aries]
Length=918

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005906988.1| PREDICTED: cytosolic carboxypeptidase 3 [Bos mutus]
Length=919

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|NP_001179571.1| cytosolic carboxypeptidase 3 [Bos taurus]
 tpg|DAA30362.1| TPA: ATP/GTP binding protein-like 3 [Bos taurus]
Length=919

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005205825.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Bos taurus]
Length=921

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_007669810.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3, 
partial [Ornithorhynchus anatinus]
Length=584

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKV+PMLNPDGVIVGNYRCSL GRDL
Sbjct  316  AQLLRDTFVFKVIPMLNPDGVIVGNYRCSLTGRDL  350



>ref|XP_003967431.1| PREDICTED: cytosolic carboxypeptidase 2-like [Takifugu rubripes]
Length=802

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  398  ARLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  432



>ref|XP_005205824.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Bos taurus]
Length=940

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  326  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  360



>ref|XP_008071880.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Tarsius syrichta]
Length=577

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  464  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  498



>ref|XP_005405553.1| PREDICTED: cytosolic carboxypeptidase 3 [Chinchilla lanigera]
Length=998

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSL GRDL
Sbjct  407  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLTGRDL  441



>ref|NP_001072531.1| cytosolic carboxypeptidase 2 [Xenopus (Silurana) tropicalis]
 sp|Q0P4M4.1|CBPC2_XENTR RecName: Full=Cytosolic carboxypeptidase 2; AltName: Full=ATP/GTP-binding 
protein-like 2 [Xenopus (Silurana) tropicalis]
 gb|AAI21990.1| hypothetical protein MGC146819 [Xenopus (Silurana) tropicalis]
Length=967

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSL+GRDL
Sbjct  420  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLSGRDL  454



>ref|XP_004677253.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Condylura cristata]
Length=982

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSL+GRDL
Sbjct  387  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLSGRDL  421



>ref|XP_006079928.1| PREDICTED: cytosolic carboxypeptidase 3 [Bubalus bubalis]
Length=1002

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005205819.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Bos taurus]
Length=1002

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>sp|E1B9D8.1|CBPC3_BOVIN RecName: Full=Cytosolic carboxypeptidase 3; AltName: Full=ATP/GTP-binding 
protein-like 3 [Bos taurus]
Length=1003

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>gb|ELR48181.1| Cytosolic carboxypeptidase 3 [Bos mutus]
Length=1004

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  AKLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_008268992.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X6 [Oryctolagus 
cuniculus]
Length=806

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  428  AQLLRDVFVFKVVPMLNPDGVIVGNYRCSLAGRDL  462



>ref|XP_008268987.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Oryctolagus 
cuniculus]
Length=832

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  446  AQLLRDVFVFKVVPMLNPDGVIVGNYRCSLAGRDL  480



>ref|XP_008268981.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Oryctolagus 
cuniculus]
Length=836

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  446  AQLLRDVFVFKVVPMLNPDGVIVGNYRCSLAGRDL  480



>ref|XP_008268973.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Oryctolagus 
cuniculus]
Length=849

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  428  AQLLRDVFVFKVVPMLNPDGVIVGNYRCSLAGRDL  462



>ref|XP_008256361.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X7 [Oryctolagus 
cuniculus]
Length=910

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  430  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  464



>ref|XP_007444892.1| PREDICTED: cytosolic carboxypeptidase 2-like, partial [Python 
bivittatus]
Length=357

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGV+VGNYRCSLAGRDL
Sbjct  204  AQLLRDLFIFKVVPMLNPDGVVVGNYRCSLAGRDL  238



>ref|XP_008268966.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Oryctolagus 
cuniculus]
Length=859

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  446  AQLLRDVFVFKVVPMLNPDGVIVGNYRCSLAGRDL  480



>ref|XP_008268961.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Oryctolagus 
cuniculus]
Length=867

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  446  AQLLRDVFVFKVVPMLNPDGVIVGNYRCSLAGRDL  480



>ref|XP_008256360.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X6 [Oryctolagus 
cuniculus]
Length=980

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  362  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  396



>gb|EDM15313.1| rCG28185 [Rattus norvegicus]
Length=615

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>gb|EDL13683.1| ATP/GTP binding protein-like 3 [Mus musculus]
Length=615

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_008256359.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X5 [Oryctolagus 
cuniculus]
Length=993

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  375  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  409



>ref|XP_008256357.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Oryctolagus 
cuniculus]
 ref|XP_008256358.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Oryctolagus 
cuniculus]
Length=1005

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  387  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  421



>ref|XP_008256356.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Oryctolagus 
cuniculus]
Length=1008

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  390  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  424



>ref|XP_008536547.1| PREDICTED: cytosolic carboxypeptidase 3 [Equus przewalskii]
Length=914

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  401  AELLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  435



>gb|EDL27496.1| ATP/GTP binding protein-like 2, isoform CRA_c [Mus musculus]
Length=495

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  151  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  185



>ref|XP_008256355.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Oryctolagus 
cuniculus]
Length=1042

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  424  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  458



>ref|XP_005609555.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Equus caballus]
Length=934

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  401  AELLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  435



>ref|XP_008256354.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Oryctolagus 
cuniculus]
Length=1048

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  430  AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGQDL  464



>ref|XP_006506797.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Mus musculus]
Length=642

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_005082472.1| PREDICTED: cytosolic carboxypeptidase 3 [Mesocricetus auratus]
Length=1341

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  725  ARLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  759



>ref|XP_009053852.1| hypothetical protein LOTGIDRAFT_117158, partial [Lottia gigantea]
 gb|ESO95340.1| hypothetical protein LOTGIDRAFT_117158, partial [Lottia gigantea]
Length=514

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FK+VPMLNPDGVIVGNYRCSLAGRDL
Sbjct  252  AKLLRDTFIFKIVPMLNPDGVIVGNYRCSLAGRDL  286



>ref|XP_006157898.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Tupaia chinensis]
Length=746

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  333  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  367



>ref|XP_006193750.1| PREDICTED: cytosolic carboxypeptidase 3, partial [Camelus ferus]
Length=636

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGQDL  422



>ref|XP_007082232.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Panthera 
tigris altaica]
Length=755

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_006937366.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Felis catus]
Length=755

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_010590366.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X7 [Loxodonta 
africana]
Length=758

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_007113029.1| PREDICTED: cytosolic carboxypeptidase 2-like, partial [Physeter 
catodon]
Length=762

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  290  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  324



>gb|ELW48872.1| Cytosolic carboxypeptidase 2 [Tupaia chinensis]
Length=783

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  382  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  416



>ref|XP_010590365.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X6 [Loxodonta 
africana]
Length=800

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_010590364.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Loxodonta 
africana]
Length=804

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_008773916.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Rattus norvegicus]
 ref|XP_008761067.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Rattus norvegicus]
Length=711

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_006157897.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Tupaia chinensis]
Length=808

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  395  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  429



>ref|XP_008699189.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Ursus maritimus]
Length=809

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  465



>ref|XP_006937365.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Felis catus]
Length=813

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>dbj|BAC26802.1| unnamed protein product [Mus musculus]
Length=538

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  151  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  185



>ref|XP_007082231.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Panthera 
tigris altaica]
Length=814

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_005110720.1| PREDICTED: cytosolic carboxypeptidase 2-like [Aplysia californica]
Length=814

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  414  AKLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  448



>ref|XP_005631287.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X8 [Canis lupus 
familiaris]
Length=816

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  467  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  501



>ref|XP_004708499.1| PREDICTED: cytosolic carboxypeptidase 2 [Echinops telfairi]
Length=816

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  397  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  431



>ref|XP_010590363.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Loxodonta 
africana]
Length=830

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_010590362.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Loxodonta 
africana]
Length=836

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_006157896.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Tupaia chinensis]
Length=844

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  465



>ref|XP_008699188.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Ursus maritimus]
Length=845

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  465



>ref|XP_010973985.1| PREDICTED: cytosolic carboxypeptidase 3 [Camelus dromedarius]
Length=690

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGQDL  422



>ref|XP_005631286.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X7 [Canis lupus 
familiaris]
Length=846

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  465



>ref|XP_005631285.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X6 [Canis lupus 
familiaris]
Length=846

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  467  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  501



>ref|XP_005330140.1| PREDICTED: cytosolic carboxypeptidase 2 [Ictidomys tridecemlineatus]
Length=847

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  434  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  468



>ref|XP_006937364.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Felis catus]
Length=851

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  465



>ref|XP_010590361.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Loxodonta 
africana]
Length=852

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  435  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  469



>ref|XP_007082230.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Panthera 
tigris altaica]
Length=852

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  465



>ref|XP_008699190.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Ursus maritimus]
Length=863

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_003432456.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Canis lupus 
familiaris]
Length=863

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  448  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  482



>ref|XP_006937363.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Felis catus]
Length=865

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  445  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  479



>ref|XP_006865167.1| PREDICTED: cytosolic carboxypeptidase 2 [Chrysochloris asiatica]
Length=865

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  448  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  482



>ref|XP_004399657.1| PREDICTED: cytosolic carboxypeptidase 2 [Odobenus rosmarus divergens]
Length=865

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  448  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  482



>ref|XP_007884486.1| PREDICTED: cytosolic carboxypeptidase 2-like, partial [Callorhinchus 
milii]
Length=310

 Score = 74.7 bits (182),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSL GRDL
Sbjct  238  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLTGRDL  272



>ref|XP_010590360.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Loxodonta 
africana]
Length=866

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_007082229.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Panthera 
tigris altaica]
Length=866

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  445  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  479



>ref|XP_006748339.1| PREDICTED: cytosolic carboxypeptidase 2 [Leptonychotes weddellii]
Length=866

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_004683617.1| PREDICTED: cytosolic carboxypeptidase 2 [Condylura cristata]
Length=867

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  450  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  484



>ref|XP_005631284.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Canis lupus 
familiaris]
Length=868

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  453  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  487



>ref|XP_006937362.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Felis catus]
Length=869

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_004585638.1| PREDICTED: cytosolic carboxypeptidase 2 [Ochotona princeps]
Length=869

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  453  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  487



>ref|XP_007082228.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X1 [Panthera 
tigris altaica]
Length=870

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_004485064.1| PREDICTED: LOW QUALITY PROTEIN: ATP/GTP binding protein-like 
2 [Dasypus novemcinctus]
Length=876

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  459  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  493



>ref|XP_005631283.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Canis lupus 
familiaris]
Length=879

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  467  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  501



>ref|XP_004437045.1| PREDICTED: cytosolic carboxypeptidase 2 [Ceratotherium simum 
simum]
Length=880

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  463  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  497



>ref|NP_001276586.1| cytosolic carboxypeptidase 3 isoform 3 [Mus musculus]
Length=763

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  149  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  183



>ref|XP_006820539.1| PREDICTED: cytosolic carboxypeptidase 2-like [Saccoglossus kowalevskii]
Length=881

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTFVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  433  AKLLRDTFVFKVIPMLNPDGVIVGNYRCSLAGRDL  467



>ref|XP_005631281.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Canis lupus 
familiaris]
 ref|XP_005631282.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Canis lupus 
familiaris]
Length=882

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  467  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  501



>ref|XP_007619636.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X8, partial [Cricetulus 
griseus]
Length=561

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  451  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  485



>ref|XP_010598741.1| PREDICTED: cytosolic carboxypeptidase 3 [Loxodonta africana]
Length=926

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  389  AKLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  423



>ref|XP_006506795.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Mus musculus]
Length=798

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_007647711.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Cricetulus 
griseus]
Length=809

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_006224923.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Rattus norvegicus]
 ref|XP_006236341.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Rattus norvegicus]
Length=821

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_002597488.1| hypothetical protein BRAFLDRAFT_222797 [Branchiostoma floridae]
 gb|EEN53500.1| hypothetical protein BRAFLDRAFT_222797 [Branchiostoma floridae]
Length=582

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FK+VPMLNPDGVIVGNYRCSLAGRDL
Sbjct  326  AKLLRDTFIFKIVPMLNPDGVIVGNYRCSLAGRDL  360



>ref|XP_003781607.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 2 
[Otolemur garnettii]
Length=997

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVVPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_007647710.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X8 [Cricetulus 
griseus]
 ref|XP_007616258.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X8 [Cricetulus 
griseus]
Length=848

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  150  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  184



>gb|ABI51951.1| cytosolic carboxypeptidase 3 isoform 2 [Mus musculus]
Length=861

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_006224922.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Rattus norvegicus]
 ref|XP_006236340.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Rattus norvegicus]
Length=870

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_007647709.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X7 [Cricetulus 
griseus]
 ref|XP_007616257.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X7 [Cricetulus 
griseus]
Length=945

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_005987016.1| PREDICTED: cytosolic carboxypeptidase 2 [Latimeria chalumnae]
Length=1179

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  426  AKLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  460



>ref|XP_006506794.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Mus musculus]
Length=989

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  375  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  409



>gb|EPY74070.1| hypothetical protein CB1_002312012 [Camelus ferus]
Length=891

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  833  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGQDL  867



>ref|NP_848745.2| cytosolic carboxypeptidase 3 isoform 2 [Mus musculus]
 gb|ABI51950.1| cytosolic carboxypeptidase 3 isoform 1 [Mus musculus]
Length=1001

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|NP_001276585.1| cytosolic carboxypeptidase 3 isoform 1 [Mus musculus]
 sp|Q8CDP0.1|CBPC3_MOUSE RecName: Full=Cytosolic carboxypeptidase 3; AltName: Full=ATP/GTP-binding 
protein-like 3 [Mus musculus]
 dbj|BAC26620.1| unnamed protein product [Mus musculus]
Length=1006

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  392  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  426



>ref|XP_006990446.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Peromyscus maniculatus bairdii]
Length=1007

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_010945812.1| PREDICTED: cytosolic carboxypeptidase 3 [Camelus bactrianus]
Length=919

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  388  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGQDL  422



>ref|XP_004471566.1| PREDICTED: cytosolic carboxypeptidase 3 [Dasypus novemcinctus]
Length=920

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  386  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGQDL  420



>ref|XP_004387775.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 2 
[Trichechus manatus latirostris]
Length=906

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  490  AQLLRDLFVFKVVPMLNPDGVIVGNYRCSLAGRDL  524



>gb|ERE90330.1| cytosolic carboxypeptidase 3 [Cricetulus griseus]
Length=1033

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>gb|ERE90332.1| cytosolic carboxypeptidase 3 [Cricetulus griseus]
Length=1047

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>gb|EDL79472.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_a [Rattus 
norvegicus]
 gb|EDL79473.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_a [Rattus 
norvegicus]
 gb|EDL79474.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_a [Rattus 
norvegicus]
 gb|EDL79479.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_a [Rattus 
norvegicus]
 gb|EDL79480.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_a [Rattus 
norvegicus]
 gb|EDL79481.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_a [Rattus 
norvegicus]
Length=656

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_007647708.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X6 [Cricetulus 
griseus]
 ref|XP_007616256.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X6 [Cricetulus 
griseus]
Length=1056

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  358  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  392



>gb|ERE90331.1| cytosolic carboxypeptidase 3 [Cricetulus griseus]
Length=1058

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_003508948.2| PREDICTED: cytosolic carboxypeptidase 3 isoform X5 [Cricetulus 
griseus]
 ref|XP_007616255.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X5 [Cricetulus 
griseus]
Length=1059

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_006224921.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Rattus norvegicus]
 ref|XP_006236339.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Rattus norvegicus]
 ref|XP_008773914.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Rattus norvegicus]
 ref|XP_008773915.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Rattus norvegicus]
 ref|XP_008761066.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X1 [Rattus norvegicus]
Length=1059

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_006234602.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Rattus norvegicus]
Length=660

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  361  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  395



>ref|XP_005064617.1| PREDICTED: cytosolic carboxypeptidase 2 [Mesocricetus auratus]
Length=660

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  430  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  464



>ref|XP_007647707.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Cricetulus 
griseus]
 ref|XP_007616254.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X4 [Cricetulus 
griseus]
Length=1070

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  372  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  406



>ref|XP_007647706.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Cricetulus 
griseus]
 ref|XP_007616253.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X3 [Cricetulus 
griseus]
Length=1075

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_007647704.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Cricetulus 
griseus]
 ref|XP_007647705.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Cricetulus 
griseus]
 ref|XP_007616251.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Cricetulus 
griseus]
 ref|XP_007616252.1| PREDICTED: cytosolic carboxypeptidase 3 isoform X2 [Cricetulus 
griseus]
Length=1086

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>gb|ERE90329.1| cytosolic carboxypeptidase 3 [Cricetulus griseus]
Length=1115

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            A+LLRDTF+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  388  ARLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGRDL  422



>ref|XP_007076333.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 3 
[Panthera tigris altaica]
Length=990

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRDTF+FKVVPMLNPDGVIVGNYRCSLAG+DL
Sbjct  400  AQLLRDTFIFKVVPMLNPDGVIVGNYRCSLAGQDL  434



>gb|EDL79475.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_b [Rattus 
norvegicus]
 gb|EDL79476.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_b [Rattus 
norvegicus]
 gb|EDL79477.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_b [Rattus 
norvegicus]
 gb|EDL79482.1| ATP/GTP binding protein-like 2 (predicted), isoform CRA_b [Rattus 
norvegicus]
Length=682

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  475  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  509



>ref|XP_008760239.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Rattus norvegicus]
Length=692

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  361  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  395



>dbj|BAC30555.2| unnamed protein product [Mus musculus]
Length=712

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_008760238.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Rattus norvegicus]
Length=723

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  347  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  381



>ref|XP_007181300.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X6 [Balaenoptera 
acutorostrata scammoni]
Length=725

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  310  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  344



>ref|XP_004763093.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Mustela putorius 
furo]
Length=727

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  448  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  482



>ref|XP_008760237.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X2 [Rattus norvegicus]
Length=737

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  361  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  395



>ref|XP_007181299.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Balaenoptera 
acutorostrata scammoni]
Length=739

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  324  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  358



>ref|XP_010821224.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Bos taurus]
Length=740

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  324  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  358



>ref|XP_006499711.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X20 [Mus musculus]
Length=752

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_007181298.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Balaenoptera 
acutorostrata scammoni]
Length=765

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  456  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  490



>gb|EDL27495.1| ATP/GTP binding protein-like 2, isoform CRA_b [Mus musculus]
 gb|EDL27498.1| ATP/GTP binding protein-like 2, isoform CRA_b [Mus musculus]
Length=766

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_004790624.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Mustela putorius 
furo]
Length=780

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  501  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  535



>ref|XP_006057460.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X9 [Bubalus bubalis]
Length=781

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  365  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  399



>gb|EGW03957.1| Cytosolic carboxypeptidase 2 [Cricetulus griseus]
Length=785

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  280  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  314



>ref|XP_006499710.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X19 [Mus musculus]
Length=788

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_006057459.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X8 [Bubalus bubalis]
Length=789

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  450  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  484



>ref|XP_007608712.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X5 [Cricetulus 
griseus]
Length=790

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  373  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  407



>ref|XP_007181297.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=793

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  456  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  490



>gb|EDL27497.1| ATP/GTP binding protein-like 2, isoform CRA_d [Mus musculus]
Length=793

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_004657148.1| PREDICTED: cytosolic carboxypeptidase 2 [Jaculus jaculus]
Length=795

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  430  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  464



>ref|XP_006499709.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X18 [Mus musculus]
Length=799

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  386  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  420



>ref|XP_006499708.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X17 [Mus musculus]
Length=799

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  386  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  420



>ref|XP_006499707.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X16 [Mus musculus]
Length=800

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_006057458.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X7 [Bubalus bubalis]
Length=802

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  386  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  420



>gb|ABI51949.1| cytosolic carboxypeptidase 2 isoform 5 [Mus musculus]
Length=802

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  425  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  459



>ref|XP_010840727.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X3 [Bison bison 
bison]
Length=803

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>ref|XP_007608704.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X4 [Cricetulus 
griseus]
Length=803

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  350  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  384



>ref|XP_006057457.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X6 [Bubalus bubalis]
Length=803

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD F+FKVVPMLNPDGVIVGNYRCSLAGRDL
Sbjct  387  AQLLRDIFIFKVVPMLNPDGVIVGNYRCSLAGRDL  421



>gb|ABI51945.1| cytosolic carboxypeptidase 2 isoform 1 [Mus musculus]
Length=803

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  443  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  477



>ref|XP_006499706.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X15 [Mus musculus]
Length=808

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  431  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  465



>ref|XP_006499705.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X14 [Mus musculus]
Length=809

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



>ref|XP_006499704.1| PREDICTED: cytosolic carboxypeptidase 2 isoform X13 [Mus musculus]
Length=809

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    AQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDL  105
            AQLLRD FVFKV+PMLNPDGVIVGNYRCSLAGRDL
Sbjct  449  AQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDL  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 539028242558