BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11292_g1_i1 len=1425 path=[1403:0-1424]

Length=1425
                                                                      Score     E

ref|XP_006356679.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    441   4e-149   
ref|XP_004241056.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    436   3e-147   
ref|XP_006341895.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    433   2e-146   
gb|EYU45622.1|  hypothetical protein MIMGU_mgv1a009921mg                433   5e-146   
ref|XP_009787074.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    427   8e-144   
ref|XP_009629321.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    427   1e-143   
gb|EYU41522.1|  hypothetical protein MIMGU_mgv1a009962mg                416   2e-139   
gb|KDP40124.1|  hypothetical protein JCGZ_02122                         414   1e-138   
ref|XP_011090771.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    407   3e-136   
ref|XP_010035447.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    405   2e-135   
ref|XP_008340927.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    404   5e-135   
ref|XP_006489323.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydr...    403   3e-134   
ref|XP_009338472.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    402   3e-134   
ref|XP_006419849.1|  hypothetical protein CICLE_v10005413mg             403   3e-134   
ref|XP_004296923.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    400   2e-133   
ref|XP_010093997.1|  3-ketodihydrosphingosine reductase                 400   3e-133   
ref|XP_011035996.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    398   2e-132   
ref|XP_002517186.1|  short-chain dehydrogenase, putative                402   2e-132   Ricinus communis
ref|XP_010668480.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    396   1e-131   
ref|XP_010278135.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    393   1e-130   
ref|XP_008245913.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    393   2e-130   
ref|XP_008246093.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    392   7e-130   
ref|XP_010546852.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    391   8e-130   
ref|XP_007147752.1|  hypothetical protein PHAVU_006G152000g             389   5e-129   
ref|XP_003546136.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    388   1e-128   
ref|XP_008438707.1|  PREDICTED: 3-ketodihydrosphingosine reductase      388   2e-128   
gb|KEH36798.1|  NAD(P)-binding rossmann-fold protein                    389   2e-128   
gb|EPS65224.1|  hypothetical protein M569_09551                         387   4e-128   
ref|XP_008390843.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    386   7e-128   
ref|XP_004134147.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    385   2e-127   
ref|XP_009387639.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    384   5e-127   
ref|XP_003542879.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    384   7e-127   
ref|XP_003542878.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    384   8e-127   
ref|XP_003570174.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    382   2e-126   
ref|XP_007031800.1|  Short-chain dehydrogenase, putative                382   4e-126   
ref|XP_010035460.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    381   5e-126   
ref|XP_004164724.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    381   6e-126   
ref|XP_002280998.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    380   1e-125   Vitis vinifera
ref|XP_006407987.1|  hypothetical protein EUTSA_v10021124mg             380   2e-125   
ref|XP_007208623.1|  hypothetical protein PRUPE_ppa021089mg             384   1e-124   
ref|XP_002884556.1|  short-chain dehydrogenase/reductase family p...    377   4e-124   
ref|XP_011090801.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    377   5e-124   
ref|XP_010486091.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    377   6e-124   
gb|KHG07464.1|  3-ketodihydrosphingosine reductase                      378   7e-124   
ref|XP_008801390.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    376   9e-124   
ref|XP_010551765.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    375   1e-123   
emb|CDY05227.1|  BnaC05g45760D                                          375   2e-123   
ref|NP_001047846.1|  Os02g0701900                                       375   3e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010435576.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    373   3e-122   
ref|XP_009382630.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    374   3e-122   
ref|XP_010464172.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    372   4e-122   
ref|XP_009129637.1|  PREDICTED: 3-ketodihydrosphingosine reductase      371   7e-122   
gb|AAF66134.1|  unknown protein; 15741-13972                            370   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187257.2|  3-ketodihydrosphinganine reductase-like protein       370   2e-121   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27713.1|  BnaA05g31220D                                          369   3e-121   
gb|KFK38042.1|  hypothetical protein AALP_AA3G062700                    369   5e-121   
ref|NP_197421.1|  3-ketodihydrosphinganine reductase-like protein       369   7e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298131.1|  hypothetical protein CARUB_v10014175mg             368   9e-121   
gb|AFW63520.1|  hypothetical protein ZEAMMB73_346365                    368   1e-120   
ref|XP_004486137.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    368   1e-120   
ref|XP_002871871.1|  short-chain dehydrogenase/reductase family p...    367   2e-120   
ref|XP_009386547.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    366   2e-119   
gb|ABK22103.1|  unknown                                                 364   3e-119   Picea sitchensis
gb|AGT16735.1|  3-ketodihydrosphingosine reductase precursor            364   4e-119   
ref|XP_002454428.1|  hypothetical protein SORBIDRAFT_04g030750          362   1e-118   Sorghum bicolor [broomcorn]
ref|XP_006288201.1|  hypothetical protein CARUB_v10001439mg             362   3e-118   
ref|XP_007205452.1|  hypothetical protein PRUPE_ppa007873mg             360   2e-117   
ref|XP_008776395.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    359   4e-117   
ref|XP_010942950.1|  PREDICTED: LOW QUALITY PROTEIN: 3-dehydrosph...    358   5e-117   
ref|XP_009397556.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    358   5e-117   
ref|XP_008776394.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    359   5e-117   
gb|ACG41684.1|  3-ketodihydrosphingosine reductase precursor            357   2e-116   Zea mays [maize]
ref|NP_001131956.1|  3-ketodihydrosphingosine reductase isoform 1...    357   2e-116   Zea mays [maize]
ref|XP_010940828.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    357   3e-116   
ref|XP_007034648.1|  Short-chain dehydrogenase, putative                355   9e-116   
ref|XP_004953588.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    352   2e-114   
gb|KHG07465.1|  3-ketodihydrosphingosine reductase                      352   4e-114   
dbj|BAJ96763.1|  predicted protein                                      347   2e-112   
ref|XP_008232284.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    343   6e-112   
ref|XP_009384607.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    345   6e-112   
gb|KCW84256.1|  hypothetical protein EUGRSUZ_B01113                     340   7e-110   
gb|AES73012.2|  3-ketodihydrosphingosine reductase-like protein         343   3e-109   
gb|KHG29263.1|  3-ketodihydrosphingosine reductase                      336   3e-108   
ref|XP_006850729.1|  hypothetical protein AMTR_s00025p00047220          335   3e-107   
ref|XP_007034649.1|  Short-chain dehydrogenase, putative                333   4e-106   
ref|XP_003602761.1|  NAD(P)H-quinone oxidoreductase chain               331   2e-103   
ref|XP_006648964.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    311   8e-100   
gb|KHN37583.1|  3-ketodihydrosphingosine reductase                      296   6e-94    
ref|XP_006400478.1|  hypothetical protein EUTSA_v10014360mg             294   9e-93    
ref|XP_002453005.1|  hypothetical protein SORBIDRAFT_04g036480          278   6e-86    Sorghum bicolor [broomcorn]
emb|CDO99009.1|  unnamed protein product                                270   9e-85    
emb|CDX92547.1|  BnaA10g15860D                                          273   4e-84    
emb|CDY68210.1|  BnaC09g54290D                                          268   2e-82    
gb|KHN33052.1|  3-ketodihydrosphingosine reductase                      258   9e-80    
ref|XP_006378675.1|  hypothetical protein POPTR_0010s199202g            259   3e-79    
gb|EMT05106.1|  3-ketodihydrosphingosine reductase                      256   4e-79    
ref|XP_002315170.2|  hypothetical protein POPTR_0010s199202g            257   5e-79    Populus trichocarpa [western balsam poplar]
gb|EMS61820.1|  3-ketodihydrosphingosine reductase                      254   5e-78    
ref|XP_009120905.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydr...    251   1e-75    
emb|CBI26200.3|  unnamed protein product                                239   5e-72    
ref|XP_001764917.1|  predicted protein                                  239   5e-71    
ref|XP_009760410.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    219   7e-65    
ref|XP_009787857.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    214   2e-63    
ref|XP_002962339.1|  hypothetical protein SELMODRAFT_79314              218   7e-63    
ref|XP_002962938.1|  hypothetical protein SELMODRAFT_78109              217   2e-62    
ref|XP_009762900.1|  PREDICTED: uncharacterized protein LOC104214874    219   4e-62    
ref|XP_009787854.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    209   5e-61    
ref|XP_009787856.1|  PREDICTED: 3-dehydrosphinganine reductase TS...    207   2e-60    
ref|XP_009029905.1|  hypothetical protein HELRODRAFT_104089             207   2e-58    
gb|KDO74751.1|  hypothetical protein CISIN_1g0177572mg                  199   9e-58    
ref|XP_005103655.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    192   6e-53    
gb|KDO36513.1|  hypothetical protein CISIN_1g030328mg                   187   6e-53    
gb|KDO74752.1|  hypothetical protein CISIN_1g0177571mg                  186   9e-52    
gb|AGT16861.1|  3-ketodihydrosphingosine reductase                      185   1e-51    
gb|ELU06177.1|  hypothetical protein CAPTEDRAFT_162669                  184   7e-50    
gb|AFM78304.1|  3-ketodihydrosphingosine reductase                      183   2e-49    
gb|KDR24480.1|  3-ketodihydrosphingosine reductase                      181   7e-49    
ref|NP_001170115.1|  uncharacterized protein LOC100384036 precursor     175   5e-48    Zea mays [maize]
gb|AFW63522.1|  hypothetical protein ZEAMMB73_346365                    174   7e-48    
gb|ACN26335.1|  unknown                                                 174   1e-47    Zea mays [maize]
ref|XP_008801798.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    173   2e-47    
ref|XP_008432309.1|  PREDICTED: 3-ketodihydrosphingosine reductase      175   3e-46    
ref|XP_006634509.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    173   7e-46    
ref|XP_007559453.1|  PREDICTED: 3-ketodihydrosphingosine reductase      174   9e-46    
ref|XP_003386428.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    172   2e-45    
ref|XP_009051035.1|  hypothetical protein LOTGIDRAFT_213963             172   2e-45    
ref|XP_005796076.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    172   3e-45    
ref|XP_790962.3|  PREDICTED: 3-ketodihydrosphingosine reductase         171   5e-45    Strongylocentrotus purpuratus [purple urchin]
ref|XP_001365403.1|  PREDICTED: 3-ketodihydrosphingosine reductase      171   8e-45    Monodelphis domestica
ref|XP_009903254.1|  PREDICTED: 3-ketodihydrosphingosine reductase      170   9e-45    
ref|XP_005149993.1|  PREDICTED: 3-ketodihydrosphingosine reductase      169   2e-44    
ref|NP_001084704.1|  3-ketodihydrosphingosine reductase precursor       169   2e-44    Xenopus laevis [clawed frog]
ref|XP_007229225.1|  PREDICTED: 3-ketodihydrosphingosine reductase      170   2e-44    
ref|XP_005509791.1|  PREDICTED: 3-ketodihydrosphingosine reductase      169   2e-44    
ref|XP_003703294.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    169   4e-44    
ref|XP_010584293.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    168   4e-44    
ref|XP_004579510.1|  PREDICTED: 3-ketodihydrosphingosine reductase      168   5e-44    
ref|XP_010643178.1|  PREDICTED: 3-ketodihydrosphingosine reductase      167   7e-44    
emb|CDW54506.1|  3 ketodihydrosphingosine reductase                     167   9e-44    
ref|XP_005081509.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    167   9e-44    
ref|XP_010783607.1|  PREDICTED: 3-ketodihydrosphingosine reductase      168   9e-44    
ref|XP_005300915.1|  PREDICTED: 3-ketodihydrosphingosine reductase      167   1e-43    
ref|XP_003474120.1|  PREDICTED: 3-ketodihydrosphingosine reductase      167   2e-43    
ref|XP_006122949.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    166   2e-43    
ref|XP_005526524.1|  PREDICTED: 3-ketodihydrosphingosine reductase      166   3e-43    
ref|XP_003977645.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    166   3e-43    
gb|AEA51181.1|  ketodihydrosphingosine reductase                        166   4e-43    
ref|XP_010959583.1|  PREDICTED: 3-ketodihydrosphingosine reductase      166   4e-43    
ref|NP_001072722.1|  3-ketodihydrosphingosine reductase precursor       166   4e-43    Xenopus tropicalis [western clawed frog]
ref|XP_002713676.1|  PREDICTED: 3-ketodihydrosphingosine reductase      166   4e-43    Oryctolagus cuniculus [domestic rabbit]
tpg|DAA15784.1|  TPA: 3-ketodihydrosphingosine reductase precursor      165   5e-43    
ref|NP_957433.1|  3-ketodihydrosphingosine reductase                    166   5e-43    Danio rerio [leopard danio]
ref|NP_001039384.1|  3-ketodihydrosphingosine reductase precursor       166   6e-43    Bos taurus [bovine]
ref|XP_010728300.1|  PREDICTED: 3-ketodihydrosphingosine reductase      166   6e-43    
ref|XP_010978297.1|  PREDICTED: 3-ketodihydrosphingosine reductase      166   6e-43    
ref|NP_001101812.1|  3-ketodihydrosphingosine reductase                 165   6e-43    Rattus norvegicus [brown rat]
ref|XP_004893336.1|  PREDICTED: 3-ketodihydrosphingosine reductase      165   7e-43    
dbj|BAE41541.1|  unnamed protein product                                165   8e-43    Mus musculus [mouse]
ref|XP_008290350.1|  PREDICTED: 3-ketodihydrosphingosine reductase      166   8e-43    
ref|XP_004638316.1|  PREDICTED: 3-ketodihydrosphingosine reductase      165   9e-43    
ref|XP_002127644.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    165   9e-43    Ciona intestinalis [sea vase]
ref|XP_003490322.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    165   1e-42    
ref|XP_005323066.1|  PREDICTED: 3-ketodihydrosphingosine reductase      165   1e-42    
ref|XP_003502008.1|  PREDICTED: 3-ketodihydrosphingosine reductase      165   1e-42    
gb|KFM80538.1|  3-ketodihydrosphingosine reductase                      164   1e-42    
ref|XP_004379336.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   1e-42    
ref|XP_004079405.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    165   1e-42    
ref|XP_003788462.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   1e-42    
ref|XP_001925948.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   1e-42    Sus scrofa [pigs]
gb|ADD38841.1|  3-ketodihydrosphingosine reductase                      164   1e-42    Lepeophtheirus salmonis
ref|XP_006993749.1|  PREDICTED: 3-ketodihydrosphingosine reductase      164   1e-42    
ref|NP_081810.1|  3-ketodihydrosphingosine reductase precursor          164   2e-42    Mus musculus [mouse]
ref|XP_010883116.1|  PREDICTED: 3-ketodihydrosphingosine reductase      165   2e-42    
ref|XP_002757353.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   2e-42    Callithrix jacchus [common marmoset]
ref|XP_005348350.1|  PREDICTED: 3-ketodihydrosphingosine reductase      164   2e-42    
ref|XP_008589475.1|  PREDICTED: 3-ketodihydrosphingosine reductase      164   2e-42    
ref|XP_004398117.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   2e-42    
ref|XP_005721416.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   2e-42    
ref|XP_003438177.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   2e-42    
ref|XP_004542772.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   2e-42    
emb|CDQ69407.1|  unnamed protein product                                166   3e-42    
ref|XP_006892792.1|  PREDICTED: 3-ketodihydrosphingosine reductase      164   3e-42    
ref|XP_008838877.1|  PREDICTED: 3-ketodihydrosphingosine reductase      164   3e-42    
gb|KFQ29302.1|  3-ketodihydrosphingosine reductase                      162   3e-42    
ref|XP_006837598.1|  PREDICTED: 3-ketodihydrosphingosine reductase      163   3e-42    
ref|XP_007463758.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    163   3e-42    
ref|XP_006786523.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    164   4e-42    
ref|XP_004059550.1|  PREDICTED: 3-ketodihydrosphingosine reductase      163   4e-42    
ref|XP_004268116.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    163   4e-42    
ref|NP_001267248.1|  3-ketodihydrosphingosine reductase precursor       163   4e-42    
gb|KFO99947.1|  3-ketodihydrosphingosine reductase                      162   4e-42    
ref|XP_009967943.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   5e-42    
ref|NP_002026.1|  3-ketodihydrosphingosine reductase precursor          163   5e-42    Homo sapiens [man]
ref|XP_007105173.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    163   5e-42    
gb|AAP36892.1|  Homo sapiens follicular lymphoma variant transloc...    163   5e-42    
gb|KFP63603.1|  3-ketodihydrosphingosine reductase                      162   5e-42    
ref|XP_007898714.1|  PREDICTED: 3-ketodihydrosphingosine reductase      163   5e-42    
gb|KFP12756.1|  3-ketodihydrosphingosine reductase                      162   6e-42    
ref|XP_009695595.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   6e-42    
ref|NP_001244872.1|  3-ketodihydrosphingosine reductase precursor       162   7e-42    
ref|XP_004422659.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    162   7e-42    
ref|XP_008210657.1|  PREDICTED: 3-ketodihydrosphingosine reductase      163   7e-42    
gb|KFO12735.1|  3-ketodihydrosphingosine reductase                      161   8e-42    
gb|KFU92058.1|  3-ketodihydrosphingosine reductase                      161   8e-42    
ref|XP_005234053.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   8e-42    
ref|XP_009986955.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   8e-42    
gb|KFM07495.1|  3-ketodihydrosphingosine reductase                      161   8e-42    
ref|XP_003264348.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    162   9e-42    
ref|XP_003396184.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    162   9e-42    
ref|XP_009277515.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   9e-42    
gb|KFR09256.1|  3-ketodihydrosphingosine reductase                      161   1e-41    
ref|XP_009999261.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   1e-41    
gb|KGL74479.1|  3-ketodihydrosphingosine reductase                      161   1e-41    
ref|XP_005041668.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   1e-41    
ref|XP_009324975.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   1e-41    
ref|XP_009633299.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   1e-41    
gb|KGL93461.1|  3-ketodihydrosphingosine reductase                      161   1e-41    
ref|XP_004654848.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   1e-41    
ref|XP_008490848.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   1e-41    
gb|KFQ74065.1|  3-ketodihydrosphingosine reductase                      161   1e-41    
ref|XP_010304528.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   1e-41    
ref|XP_006823632.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    161   1e-41    
ref|XP_009501506.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   1e-41    
gb|KFW79759.1|  3-ketodihydrosphingosine reductase                      160   1e-41    
gb|KFV04326.1|  3-ketodihydrosphingosine reductase                      160   1e-41    
ref|XP_008332393.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   1e-41    
ref|XP_010194610.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   1e-41    
ref|XP_010226824.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   1e-41    
gb|KFZ54004.1|  3-ketodihydrosphingosine reductase                      160   1e-41    
ref|XP_006913819.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   2e-41    
gb|KFO87315.1|  3-ketodihydrosphingosine reductase                      160   2e-41    
gb|KFR12241.1|  3-ketodihydrosphingosine reductase                      160   2e-41    
ref|XP_010284462.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydr...    160   2e-41    
gb|KFV82759.1|  3-ketodihydrosphingosine reductase                      160   2e-41    
ref|XP_009473814.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   2e-41    
ref|XP_009475917.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   2e-41    
gb|KFO61744.1|  3-ketodihydrosphingosine reductase                      160   3e-41    
gb|ELK11102.1|  3-ketodihydrosphingosine reductase                      162   3e-41    
gb|EMC82352.1|  3-ketodihydrosphingosine reductase                      160   3e-41    
ref|XP_005586579.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    161   3e-41    
ref|XP_008920713.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   3e-41    
ref|XP_009945216.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   3e-41    
ref|XP_010192796.1|  PREDICTED: 3-ketodihydrosphingosine reductase      162   3e-41    
ref|XP_009883578.1|  PREDICTED: 3-ketodihydrosphingosine reductase      161   3e-41    
ref|XP_010706767.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   3e-41    
ref|XP_007933684.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   4e-41    
ref|XP_009676018.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   4e-41    
ref|XP_005425902.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   4e-41    
ref|XP_009087246.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   4e-41    
gb|KFO70544.1|  3-ketodihydrosphingosine reductase                      159   4e-41    
gb|KFQ06054.1|  3-ketodihydrosphingosine reductase                      159   4e-41    
ref|XP_010084663.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   5e-41    
ref|XP_009567901.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   5e-41    
gb|KFQ46616.1|  3-ketodihydrosphingosine reductase                      159   5e-41    
ref|XP_010853117.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   5e-41    
ref|XP_002197495.2|  PREDICTED: 3-ketodihydrosphingosine reductase      160   5e-41    Taeniopygia guttata
ref|XP_010130510.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydr...    161   5e-41    
ref|XP_005481863.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   6e-41    
ref|XP_010175950.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   6e-41    
ref|XP_006182871.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   8e-41    
ref|XP_003406747.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   8e-41    
ref|XP_009934811.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   8e-41    
ref|XP_006141896.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    159   9e-41    
ref|XP_010009041.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   9e-41    
gb|ELR45758.1|  3-ketodihydrosphingosine reductase                      158   1e-40    
ref|XP_010116776.1|  PREDICTED: 3-ketodihydrosphingosine reductase      158   1e-40    
ref|XP_008978176.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    159   1e-40    
ref|XP_008635324.1|  PREDICTED: 3-ketodihydrosphingosine reductase      160   1e-40    
ref|XP_005028778.1|  PREDICTED: 3-ketodihydrosphingosine reductase      158   1e-40    
ref|XP_009068738.1|  PREDICTED: 3-ketodihydrosphingosine reductase      158   1e-40    
ref|XP_006037840.1|  PREDICTED: 3-ketodihydrosphingosine reductase      159   1e-40    
gb|EOA94906.1|  3-ketodihydrosphingosine reductase                      158   1e-40    
ref|XP_009919744.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    159   2e-40    
ref|XP_005476394.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    158   2e-40    
gb|EFX89154.1|  hypothetical protein DAPPUDRAFT_310703                  158   4e-40    
ref|XP_008518051.1|  PREDICTED: 3-ketodihydrosphingosine reductase      157   4e-40    
gb|EFB24547.1|  hypothetical protein PANDA_005876                       157   4e-40    Ailuropoda melanoleuca
ref|XP_008703198.1|  PREDICTED: 3-ketodihydrosphingosine reductase      157   4e-40    
ref|XP_002917552.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    157   4e-40    
ref|XP_008159970.1|  PREDICTED: 3-ketodihydrosphingosine reductase      157   5e-40    
ref|XP_002108996.1|  hypothetical protein TRIADDRAFT_52550              157   5e-40    
ref|XP_003995315.1|  PREDICTED: 3-ketodihydrosphingosine reductase      157   5e-40    
ref|XP_005654536.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    157   6e-40    
ref|XP_005910252.1|  PREDICTED: 3-ketodihydrosphingosine reductase      157   7e-40    
gb|KFD54820.1|  hypothetical protein M513_04254                         163   7e-40    
ref|XP_005697383.1|  PREDICTED: 3-ketodihydrosphingosine reductase      156   8e-40    
gb|EMP36648.1|  3-ketodihydrosphingosine reductase                      157   8e-40    
ref|XP_006722496.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    156   9e-40    
ref|XP_004684081.1|  PREDICTED: 3-ketodihydrosphingosine reductase      157   1e-39    
gb|KHJ45939.1|  Arfaptin-like domain protein                            163   1e-39    
ref|XP_007058903.1|  PREDICTED: 3-ketodihydrosphingosine reductase      157   1e-39    
gb|EHH29339.1|  3-ketodihydrosphingosine reductase                      155   1e-39    
ref|XP_005373236.1|  PREDICTED: 3-ketodihydrosphingosine reductase      158   1e-39    
ref|XP_007105175.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    155   2e-39    
ref|XP_009809818.1|  PREDICTED: 3-ketodihydrosphingosine reductase      154   2e-39    
gb|KFV53201.1|  3-ketodihydrosphingosine reductase                      154   2e-39    
gb|EFN89795.1|  3-ketodihydrosphingosine reductase                      155   3e-39    
ref|XP_006745663.1|  PREDICTED: 3-ketodihydrosphingosine reductase      155   4e-39    
gb|EHH58944.1|  3-ketodihydrosphingosine reductase                      154   4e-39    
ref|XP_002773505.1|  short chain dehydrogenase, putative                154   6e-39    
ref|XP_007105174.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    154   8e-39    
ref|XP_392423.2|  PREDICTED: 3-ketodihydrosphingosine reductase-l...    154   8e-39    
ref|XP_004703182.1|  PREDICTED: 3-ketodihydrosphingosine reductase      155   8e-39    
ref|XP_008543999.1|  PREDICTED: 3-ketodihydrosphingosine reductase      154   1e-38    
ref|XP_009517811.1|  hypothetical protein PHYSODRAFT_553530             154   1e-38    
gb|EPQ17382.1|  3-ketodihydrosphingosine reductase                      153   1e-38    
ref|XP_004602040.1|  PREDICTED: 3-ketodihydrosphingosine reductase      155   1e-38    
ref|XP_004020737.1|  PREDICTED: 3-ketodihydrosphingosine reductase      154   1e-38    
ref|XP_010150813.1|  PREDICTED: 3-ketodihydrosphingosine reductase      150   2e-38    
ref|XP_004745748.1|  PREDICTED: 3-ketodihydrosphingosine reductase      156   2e-38    
ref|XP_005881869.1|  PREDICTED: 3-ketodihydrosphingosine reductase      152   2e-38    
ref|XP_006756884.1|  PREDICTED: 3-ketodihydrosphingosine reductase      152   2e-38    
ref|XP_007192128.1|  PREDICTED: 3-ketodihydrosphingosine reductase      154   3e-38    
ref|XP_972119.1|  PREDICTED: 3-ketodihydrosphingosine reductase         152   3e-38    
ref|XP_006608893.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    152   3e-38    
gb|ACO15176.1|  3-ketodihydrosphingosine reductase precursor            152   5e-38    
gb|KFD71692.1|  LOW QUALITY PROTEIN: hypothetical protein M514_04254    157   7e-38    
ref|XP_006087255.1|  PREDICTED: 3-ketodihydrosphingosine reductase      152   8e-38    
ref|XP_007099303.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydr...    150   8e-38    
ref|XP_006009703.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    150   9e-38    
gb|EZA60332.1|  3-ketodihydrosphingosine reductase                      151   9e-38    
ref|XP_003694042.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    152   9e-38    
ref|XP_003827374.1|  PREDICTED: 3-ketodihydrosphingosine reductase      154   1e-37    
ref|XP_007661987.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    150   1e-37    
ref|XP_010584294.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    150   1e-37    
ref|XP_002434676.1|  dehydrogenase, putative                            149   2e-37    
emb|CEF63891.1|  3-ketodihydrosphingosine reductase                     150   2e-37    
ref|XP_005981907.1|  PREDICTED: 3-ketodihydrosphingosine reductase      154   3e-37    
gb|ELW71277.1|  3-ketodihydrosphingosine reductase                      152   3e-37    
gb|EDL91748.1|  follicular lymphoma variant translocation 1 (pred...    149   3e-37    
ref|XP_001753721.1|  predicted protein                                  150   3e-37    
gb|EGI63075.1|  3-ketodihydrosphingosine reductase                      149   5e-37    
ref|XP_006269234.1|  PREDICTED: 3-ketodihydrosphingosine reductase      149   5e-37    
gb|EDL39859.1|  mCG8996, isoform CRA_a                                  148   5e-37    
ref|XP_008070318.1|  PREDICTED: 3-ketodihydrosphingosine reductase      149   6e-37    
ref|XP_011058482.1|  PREDICTED: 3-ketodihydrosphingosine reductase      149   1e-36    
ref|XP_004340338.1|  3-ketodihydrosphingosine reductase                 147   3e-36    
emb|CDJ85054.1|  Short-chain dehydrogenase reductase SDR domain c...    146   8e-36    
ref|XP_002779024.1|  liver stage antigen, putative                      153   9e-36    
ref|XP_001945578.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    145   1e-35    
ref|XP_318434.3|  AGAP003984-PA                                         145   1e-35    
gb|AEE61871.1|  unknown                                                 145   2e-35    
ref|XP_001657877.1|  short-chain dehydrogenase                          144   2e-35    
gb|ERL88531.1|  hypothetical protein D910_05917                         144   2e-35    
ref|XP_006378676.1|  hypothetical protein POPTR_0010s199201g            136   4e-35    
gb|EFZ19326.1|  hypothetical protein SINV_04443                         144   5e-35    
ref|XP_852048.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydrosp...    145   5e-35    
ref|XP_008896972.1|  hypothetical protein PPTG_05217                    143   6e-35    
ref|XP_002907407.1|  3-ketodihydrosphingosine reductase, putative       143   6e-35    
ref|XP_003381107.1|  3-ketodihydrosphingosine reductase                 144   7e-35    
gb|ETN76190.1|  oxidoreductase, short chain dehydrogenase/reducta...    148   8e-35    
gb|ENN77559.1|  hypothetical protein YQE_05855                          142   1e-34    
ref|XP_006529928.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    140   1e-34    
ref|XP_009857714.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    142   1e-34    
gb|KFK29481.1|  hypothetical protein AALP_AA7G139900                    137   2e-34    
ref|XP_004452984.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    140   3e-34    
ref|XP_009919745.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    140   4e-34    
ref|XP_008978177.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    139   6e-34    
ref|XP_001848948.1|  3-ketodihydrosphingosine reductase                 140   7e-34    
emb|CAG07618.1|  unnamed protein product                                141   8e-34    
ref|XP_003224438.1|  PREDICTED: 3-ketodihydrosphingosine reductase      140   9e-34    
ref|NP_001026173.1|  3-ketodihydrosphingosine reductase                 137   9e-34    
ref|XP_003142195.1|  hypothetical protein LOAG_06611                    141   1e-33    
gb|EFN64432.1|  3-ketodihydrosphingosine reductase                      139   1e-33    
ref|XP_001755599.1|  predicted protein                                  139   2e-33    
ref|XP_005266734.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    138   2e-33    
ref|XP_006122950.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    138   2e-33    
ref|XP_007524013.1|  PREDICTED: 3-ketodihydrosphingosine reductase      137   3e-33    
ref|XP_002170569.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    138   6e-33    
gb|KFB45404.1|  AGAP003984-PA-like protein                              136   8e-33    
ref|XP_008472439.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    138   8e-33    
gb|ABK25881.1|  unknown                                                 137   1e-32    
gb|ETN58584.1|  short-chain dehydrogenase                               136   2e-32    
ref|XP_003108706.1|  hypothetical protein CRE_11123                     136   3e-32    
ref|XP_001898988.1|  oxidoreductase, short chain dehydrogenase/re...    137   3e-32    
ref|NP_001280440.1|  3-ketodihydrosphingosine reductase                 135   4e-32    
ref|WP_018234881.1|  follicular variant translocation protein 1         134   4e-32    
emb|CDH93108.1|  Protein Y37E11AM.3, isoform b                          135   4e-32    
ref|WP_014760985.1|  RkpH                                               133   5e-32    
ref|XP_006205790.1|  PREDICTED: 3-ketodihydrosphingosine reductase      132   5e-32    
ref|WP_015195278.1|  3-dehydrosphinganine reductase                     133   7e-32    
emb|CBY10690.1|  unnamed protein product                                132   9e-32    
ref|XP_008935292.1|  PREDICTED: 3-ketodihydrosphingosine reductase      131   1e-31    
ref|XP_002634504.1|  Hypothetical protein CBG08294                      134   1e-31    
ref|XP_010335047.1|  PREDICTED: 3-ketodihydrosphingosine reductase      131   1e-31    
ref|XP_006077825.1|  PREDICTED: 3-ketodihydrosphingosine reductase      132   1e-31    
ref|WP_023065730.1|  short chain dehydrogenase family protein           132   1e-31    
emb|CDH93109.1|  Protein Y37E11AM.3, isoform c                          131   1e-31    
ref|XP_001758395.1|  predicted protein                                  133   1e-31    
gb|ETE65005.1|  3-ketodihydrosphingosine reductase                      133   1e-31    
ref|WP_016878122.1|  hypothetical protein                               132   1e-31    
gb|EGT33932.1|  hypothetical protein CAEBREN_22880                      131   2e-31    
ref|XP_001627971.1|  predicted protein                                  133   2e-31    
gb|ETO32654.1|  3-ketodihydrosphingosine reductase precursor            135   2e-31    
ref|WP_037432199.1|  follicular variant translocation protein 1         131   2e-31    
emb|CAP28146.2|  Protein CBG08294                                       134   3e-31    
ref|WP_006511408.1|  short-chain dehydrogenase of unknown substra...    131   3e-31    
ref|WP_010477137.1|  short-chain dehydrogenase                          131   3e-31    
ref|XP_005848566.1|  hypothetical protein CHLNCDRAFT_57682              133   3e-31    
gb|KFQ85005.1|  3-ketodihydrosphingosine reductase                      129   3e-31    
ref|WP_012161359.1|  short-chain dehydrogenase                          131   3e-31    
ref|WP_008185353.1|  short-chain dehydrogenase                          131   3e-31    
ref|WP_037156728.1|  follicular variant translocation protein 1         130   4e-31    
ref|XP_009530702.1|  hypothetical protein PHYSODRAFT_346972             133   6e-31    
gb|EJK53745.1|  hypothetical protein THAOC_26749                        133   6e-31    
ref|WP_026733243.1|  short-chain dehydrogenase                          130   8e-31    
ref|WP_037425941.1|  follicular variant translocation protein 1         130   8e-31    
gb|KFP80900.1|  3-ketodihydrosphingosine reductase                      127   8e-31    
ref|WP_009783486.1|  short-chain dehydrogenase                          130   9e-31    
ref|WP_027999415.1|  follicular variant translocation protein 1         129   1e-30    
ref|XP_009864212.1|  PREDICTED: 3-ketodihydrosphingosine reductase      127   1e-30    
ref|WP_037204866.1|  follicular variant translocation protein 1         129   1e-30    
ref|WP_018094162.1|  follicular variant translocation protein 1         129   2e-30    
ref|WP_014327253.1|  Short-chain dehydrogenase/reductase RkpH           129   2e-30    
ref|WP_028004088.1|  follicular variant translocation protein 1         129   2e-30    
ref|XP_008606827.1|  hypothetical protein SDRG_02991                    130   2e-30    
ref|XP_003088002.1|  hypothetical protein CRE_19612                     130   2e-30    
ref|WP_015007148.1|  ribitol type dehydrogenase                         128   2e-30    
gb|AAW78652.1|  RkpH                                                    129   2e-30    
ref|WP_010968672.1|  ribitol type dehydrogenase                         128   2e-30    
ref|WP_028009755.1|  follicular variant translocation protein 1         128   3e-30    
gb|EFO21875.2|  hypothetical protein LOAG_06611                         130   3e-30    
gb|KEI68708.1|  short chain dehydrogenase/reductase family oxidor...    129   3e-30    
ref|WP_004435869.1|  ribitol type dehydrogenase protein                 128   3e-30    
gb|EFA11415.1|  hypothetical protein TcasGA2_TC013591                   127   4e-30    
ref|WP_012706792.1|  follicular variant translocation protein 1         127   4e-30    
ref|XP_002466005.1|  hypothetical protein SORBIDRAFT_01g049920          123   5e-30    
ref|WP_014526601.1|  3-dehydrosphinganine reductase                     127   5e-30    
gb|ETM42345.1|  hypothetical protein L914_11963                         129   5e-30    
ref|XP_008908733.1|  hypothetical protein PPTG_13997                    129   5e-30    
gb|KFP47014.1|  3-ketodihydrosphingosine reductase                      124   7e-30    
ref|XP_005712149.1|  3-ketodihydrosphingosine reductase                 129   8e-30    
gb|KIG11884.1|  Short-chain dehydrogenase/reductase SDR                 127   8e-30    
ref|WP_015241027.1|  Short-chain dehydrogenase of various substra...    127   9e-30    
ref|WP_013843954.1|  3-dehydrosphinganine reductase                     127   1e-29    
ref|XP_002017082.1|  GL22109                                            128   1e-29    
ref|XP_001359295.1|  GA10311                                            128   1e-29    
ref|WP_015134286.1|  3-dehydrosphinganine reductase                     126   1e-29    
ref|WP_027992661.1|  follicular variant translocation protein 1         126   2e-29    
gb|KFV95054.1|  3-ketodihydrosphingosine reductase                      124   2e-29    
ref|WP_011974406.1|  MULTISPECIES: short-chain dehydrogenase/redu...    125   2e-29    
gb|KDO34531.1|  hypothetical protein SPRG_00594                         127   2e-29    
gb|ERE73758.1|  3-ketodihydrosphingosine reductase                      124   2e-29    
ref|WP_029959367.1|  follicular variant translocation protein 1         125   2e-29    
ref|WP_026785944.1|  MULTISPECIES: short-chain dehydrogenase            125   3e-29    
ref|WP_028314857.1|  short-chain dehydrogenase                          125   3e-29    
gb|AHK43358.1|  follicular variant translocation protein 1              125   4e-29    
ref|WP_025425865.1|  follicular variant translocation protein 1         125   4e-29    
ref|XP_009582145.1|  PREDICTED: 3-ketodihydrosphingosine reductase      123   5e-29    
ref|WP_015142812.1|  short-chain dehydrogenase                          125   5e-29    
ref|WP_026795686.1|  MULTISPECIES: short-chain dehydrogenase            124   6e-29    
ref|WP_012237308.1|  short-chain dehydrogenase/reductase                124   6e-29    
ref|XP_003618406.1|  3-beta hydroxysteroid dehydrogenase/isomeras...    123   6e-29    
gb|KHN72117.1|  3-ketodihydrosphingosine reductase                      126   7e-29    
emb|CDZ81608.1|  L-gulono-1,4-lactone dehydrogenase                     130   7e-29    
ref|WP_019507758.1|  hypothetical protein                               124   7e-29    
ref|WP_020737506.1|  hypothetical protein                               124   8e-29    
ref|WP_028737212.1|  follicular variant translocation protein 1         124   8e-29    
ref|WP_038014548.1|  hypothetical protein                               124   9e-29    
ref|XP_008605433.1|  hypothetical protein SDRG_01675                    125   1e-28    
ref|WP_034851667.1|  follicular variant translocation protein 1         123   1e-28    
ref|WP_034797597.1|  follicular variant translocation protein 1         123   2e-28    
ref|WP_036486168.1|  short-chain dehydrogenase                          123   2e-28    
gb|EPY82733.1|  hypothetical protein CB1_000632076                      127   2e-28    
gb|KDP73743.1|  follicular variant translocation protein 1              123   3e-28    
ref|WP_026622043.1|  follicular variant translocation protein 1         122   3e-28    
ref|WP_037378434.1|  follicular variant translocation protein 1         122   3e-28    
ref|WP_015117766.1|  short-chain dehydrogenase                          122   3e-28    
ref|XP_004932635.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    124   3e-28    
ref|WP_026613280.1|  follicular variant translocation protein 1         122   4e-28    
ref|WP_006529651.1|  short-chain dehydrogenase of unknown substra...    122   6e-28    
ref|XP_001981835.1|  GG12271                                            123   7e-28    
ref|WP_011612762.1|  short-chain dehydrogenase                          121   8e-28    
ref|WP_037546971.1|  hypothetical protein                               121   8e-28    
ref|WP_006617155.1|  short-chain dehydrogenase                          121   8e-28    
ref|XP_001749664.1|  hypothetical protein                               127   9e-28    
ref|WP_037119849.1|  follicular variant translocation protein 1         121   1e-27    
ref|NP_651363.1|  CG10425                                               122   1e-27    
ref|XP_005586580.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    121   1e-27    
ref|WP_024545889.1|  short-chain dehydrogenase                          120   1e-27    
ref|WP_035760168.1|  short-chain dehydrogenase                          120   1e-27    
ref|WP_026231819.1|  hypothetical protein                               120   1e-27    
ref|WP_031080468.1|  hypothetical protein                               120   2e-27    
ref|XP_002043905.1|  GM17737                                            122   2e-27    
ref|XP_003738130.1|  PREDICTED: 3-ketodihydrosphingosine reductas...    121   2e-27    
gb|KFM26283.1|  3-ketodihydrosphingosine reductase                      121   2e-27    
emb|CCA21360.1|  conserved hypothetical protein                         127   2e-27    
ref|WP_033529972.1|  hypothetical protein                               120   2e-27    
ref|XP_005613066.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydr...    120   2e-27    
ref|WP_013314816.1|  short-chain dehydrogenase                          120   2e-27    
emb|CBY32743.1|  unnamed protein product                                125   3e-27    
emb|CCI50148.1|  unnamed protein product                                120   3e-27    
ref|XP_002104881.1|  GD18220                                            121   3e-27    
ref|WP_014625658.1|  short-chain dehydrogenase                          119   4e-27    
ref|XP_001953007.1|  GF17432                                            120   5e-27    
ref|XP_002099076.1|  GE10721                                            120   6e-27    
ref|WP_012174926.1|  short-chain dehydrogenase                          118   8e-27    
ref|WP_030007852.1|  short-chain dehydrogenase                          118   1e-26    
ref|WP_003182496.1|  MULTISPECIES: 3-ketoacyl-ACP reductase             117   1e-26    
ref|WP_012611164.1|  short-chain dehydrogenase                          117   1e-26    



>ref|XP_006356679.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X1 
[Solanum tuberosum]
 ref|XP_006356680.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X2 
[Solanum tuberosum]
Length=325

 Score =   441 bits (1133),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 227/296 (77%), Positives = 254/296 (86%), Gaps = 2/296 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVKVPI NRHVFITGGSSGIGLALA QA +EGAKVSILARN G+LEDAK +I  +
Sbjct  27    IVRPRPVKVPIKNRHVFITGGSSGIGLALAQQAASEGAKVSILARNIGRLEDAKESIRLS  86

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDY+AVK+AVEEAGPIDVLVCN GV+  +ELE Q++EE+K MIDVNLT
Sbjct  87    TGRDVAIFSADVRDYEAVKKAVEEAGPIDVLVCNQGVFVPQELETQDIEEIKFMIDVNLT  146

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM +R A+RGPGSIAIMSSQAGQVGIYGYTAYSASKFGL+G+AEALQQE
Sbjct  147   GTFHLIKAALPGMKNR-ADRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLKGLAEALQQE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP  A+E KRRPQ+TS +A SSG+ MKA+EVAKK+LNG+K G+
Sbjct  206   VIGENIHVSLIFPPDTETPGFAEENKRRPQLTSILAASSGS-MKADEVAKKALNGLKSGN  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             F V CN EGFFLSIATAGLSPQ SFLMAF+E   AGI+R+  LCFQ NWY  I K+
Sbjct  265   FIVPCNFEGFFLSIATAGLSPQRSFLMAFIEVIAAGILRVVGLCFQWNWYGSIDKF  320



>ref|XP_004241056.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A [Solanum lycopersicum]
 ref|XP_010322262.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A [Solanum lycopersicum]
Length=325

 Score =   436 bits (1121),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 223/296 (75%), Positives = 254/296 (86%), Gaps = 2/296 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVKVPI NRHVFITGGSSGIGLALA QA +EGAKVSILARN G+L++AK +I  +
Sbjct  27    IVRPRPVKVPIKNRHVFITGGSSGIGLALAQQAASEGAKVSILARNTGRLKEAKESIRLS  86

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDY AVK+AVEEAGPIDVLVCN GV+  +ELE Q++EE+K MIDVNLT
Sbjct  87    TGRDVAIFSADVRDYKAVKKAVEEAGPIDVLVCNQGVFVPQELETQDIEEIKFMIDVNLT  146

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM +R +NRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  147   GTFHLIKAALPGMRNR-SNRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP  A+E KRRP++TS +A SSG+ MKA+EVAKK+LNG+K G+
Sbjct  206   VIGENIHVSLIFPPDTETPGFAEENKRRPKLTSILAASSGS-MKADEVAKKALNGLKSGN  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             F V CN EGFFLS+AT+GLSPQ SFLMAF+E   AGI+R+  LCFQ NWY  I+K+
Sbjct  265   FIVPCNFEGFFLSLATSGLSPQRSFLMAFIEVIAAGILRVVGLCFQWNWYGSIEKF  320



>ref|XP_006341895.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X1 
[Solanum tuberosum]
 ref|XP_006341896.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X2 
[Solanum tuberosum]
 ref|XP_006341897.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X3 
[Solanum tuberosum]
Length=325

 Score =   433 bits (1114),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 252/296 (85%), Gaps = 2/296 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP PVKVPI NRHVFITGGSSGIGLALA QA +EGAKVSILARN G+LEDAK +I  +
Sbjct  27    IVRPHPVKVPIKNRHVFITGGSSGIGLALAQQAASEGAKVSILARNIGRLEDAKESIRLS  86

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDY+AVK+AVEEAGPIDVLVCN GV+  +ELE Q++EE+K MIDVNL 
Sbjct  87    TGRDVAIFSADVRDYEAVKKAVEEAGPIDVLVCNQGVFVPQELETQDIEEIKFMIDVNLI  146

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM +R A+RGPGSIAI+SSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  147   GTFHLIKAALPGMKNR-ADRGPGSIAIISSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP  A+E KRRPQ+TS +A SSG+ MKA+EVAKK+LNG+K G+
Sbjct  206   VIGENIHVSLIFPPDTETPGFAEENKRRPQLTSILAASSGS-MKADEVAKKALNGLKSGN  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             F V CN EGFFLSIAT+GLSPQ SFLMAF+E   AGI+R+  LCFQ NWY  I K+
Sbjct  265   FIVPCNFEGFFLSIATSGLSPQRSFLMAFIEVIAAGILRVVGLCFQWNWYGNIDKF  320



>gb|EYU45622.1| hypothetical protein MIMGU_mgv1a009921mg [Erythranthe guttata]
Length=327

 Score =   433 bits (1113),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 221/302 (73%), Positives = 249/302 (82%), Gaps = 1/302 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+P +VPI NRHVFITGGSSGIGL+LA     +GA VS+LAR+A KLE+AK +I  A
Sbjct  26    IVRPKPARVPIKNRHVFITGGSSGIGLSLAHLCARQGASVSLLARDAAKLEEAKQSIKLA  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TGC V+ FSADVRDYDAVKRAVEEAGPIDVLVCNHGV+  +EL +QE+EE+K M+DVNL 
Sbjct  86    TGCDVSVFSADVRDYDAVKRAVEEAGPIDVLVCNHGVFVPQELAEQEIEEIKFMVDVNLM  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM    A  GPGSIAIMSSQAGQVGIYGYTAYSASKFGL+G+AEALQQE
Sbjct  146   GTFHLIKAALPGMKKNRAELGPGSIAIMSSQAGQVGIYGYTAYSASKFGLKGLAEALQQE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +I+ NIHVSLIFPP T TP L +E KRRPQ+TS IA SSGA MKA+EVAKKSLNGI+ G+
Sbjct  206   IISDNIHVSLIFPPDTDTPGLVEETKRRPQLTSIIAASSGA-MKADEVAKKSLNGIESGT  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EGF LS+ATAGLSPQ SFLMAFVE   AG+MR+A L FQ NWY  I KW   N
Sbjct  265   FIVPCNFEGFLLSVATAGLSPQRSFLMAFVEVTTAGLMRLAGLFFQWNWYGAIDKWRSTN  324

Query  389   KQ  384
              +
Sbjct  325   TR  326



>ref|XP_009787074.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Nicotiana 
sylvestris]
Length=326

 Score =   427 bits (1098),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 219/295 (74%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVKVPI NRHVFITGGSSGIGLALA QA +EG++VSILARN  KLE+A+ AI  +
Sbjct  26    IVRPRPVKVPIKNRHVFITGGSSGIGLALAQQAASEGSRVSILARNTSKLEEARDAIRLS  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSAD+R+Y+AVK+A+E+AGPIDVLVCN GV+  +ELE Q++EE+K MIDVNLT
Sbjct  86    TGRDVAIFSADIRNYEAVKKAIEDAGPIDVLVCNQGVFVPQELETQDIEEIKFMIDVNLT  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM +R + RGPGSIAIMSSQAGQVGIYGYTAYSASKFGL+G+AEALQQE
Sbjct  146   GTFHLIKAALPGMKNR-SGRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLKGLAEALQQE  204

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP  A+E KRRP++TS IA SSGA MKA+EVAK +LNGIK G+
Sbjct  205   VIGENIHVSLIFPPDTETPGFAEENKRRPRVTSIIAASSGA-MKADEVAKIALNGIKSGN  263

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             F+V CN EGF LSIATAGLSPQ SFLMAFVE   AG++R+  LCFQ NWY  I+K
Sbjct  264   FTVPCNFEGFLLSIATAGLSPQRSFLMAFVEVIAAGVLRVTGLCFQWNWYGSIEK  318



>ref|XP_009629321.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Nicotiana 
tomentosiformis]
Length=332

 Score =   427 bits (1098),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 225/303 (74%), Positives = 253/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRP KVPI NRHVFITGGSSGIGLALA +A +EGAKVSILARN  KLE+A+ AI  +
Sbjct  30    IVRPRPAKVPIKNRHVFITGGSSGIGLALAQRAASEGAKVSILARNTSKLEEARDAIRLS  89

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVR+Y+AVK A+E+AGPIDVLVCN GV+  +ELE Q++EE+K MIDVNLT
Sbjct  90    TGRDVAIFSADVRNYEAVKEAIEDAGPIDVLVCNQGVFVPEELETQKIEEIKFMIDVNLT  149

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM +R + RGPGSIAIMSSQAGQVGIYGYTAYSASKFGL+G+AEALQQE
Sbjct  150   GTFHLIKAALPGMKNR-SGRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLKGLAEALQQE  208

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP  A+E KRRP++TS IA SSGA MKA+EVAK +LNGIK G+
Sbjct  209   VIGENIHVSLIFPPDTETPGFAEENKRRPRVTSIIAASSGA-MKADEVAKIALNGIKSGN  267

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK-WHPG  393
             F+V CN EGF LSIATAGLSPQ SFLMAFVE   AGI+RIA LCFQ NWY  I+K    G
Sbjct  268   FTVPCNFEGFLLSIATAGLSPQRSFLMAFVEVIAAGILRIAGLCFQWNWYGSIEKCLEEG  327

Query  392   NKQ  384
             N +
Sbjct  328   NSE  330



>gb|EYU41522.1| hypothetical protein MIMGU_mgv1a009962mg [Erythranthe guttata]
Length=326

 Score =   416 bits (1069),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 214/301 (71%), Positives = 246/301 (82%), Gaps = 1/301 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP P++VPI NRHVFITGGSSGIGL+LA     +GA V++LAR+  KLE+AK +I  A
Sbjct  27    IVRPNPIRVPIKNRHVFITGGSSGIGLSLAHLCAQQGADVTLLARSVAKLEEAKESIKLA  86

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDY AVKRAVEEAGPIDVLVCNHGVY  +EL+DQE+EE+K MIDVNLT
Sbjct  87    TGRDVAVFSADVRDYAAVKRAVEEAGPIDVLVCNHGVYLPQELQDQELEEIKFMIDVNLT  146

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM +  A RGP SIAIMSSQAGQVGIYGY AYSASKF L+G+AEALQQE
Sbjct  147   GTFHLIKAALPGMKTNRAERGPASIAIMSSQAGQVGIYGYAAYSASKFALKGLAEALQQE  206

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +I+ NIHV+LIFPP T TP  A+E KRRPQ+TS IA SSGA MKA+EVA KSL GI+ G+
Sbjct  207   IISDNIHVTLIFPPDTETPGFAEENKRRPQLTSIIAASSGA-MKADEVAGKSLAGIQSGN  265

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V+CN EGF LS+ATAGLSPQ S+LMAFVE   AG++R+A + FQ NWY  I+KWH   
Sbjct  266   FIVSCNFEGFLLSVATAGLSPQRSYLMAFVEIMGAGVLRLAGIFFQWNWYGSIEKWHAKK  325

Query  389   K  387
             K
Sbjct  326   K  326



>gb|KDP40124.1| hypothetical protein JCGZ_02122 [Jatropha curcas]
Length=325

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 217/301 (72%), Positives = 249/301 (83%), Gaps = 2/301 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRPVK+PI NRHVFITGGSSGIGLALA++A +EGA+VSILAR+  KLE+AKH I  +T
Sbjct  26    VRPRPVKIPIKNRHVFITGGSSGIGLALAIRAASEGARVSILARSLDKLEEAKHFIRLST  85

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  F+ADVRD+D+V +AV EAGPIDVLV N GV+  +ELE QE++EV+ MIDVNL G
Sbjct  86    GVDVAIFAADVRDFDSVTKAVVEAGPIDVLVVNQGVFLPQELEKQELDEVRFMIDVNLMG  145

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALPGM  R   R P SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQEV
Sbjct  146   SFNMIKAALPGMKIRDERR-PASIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQEV  204

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA NIHVSLIFPP T TPALA+E KRRPQ+TS IA SSGA MKA+EVAKK+L+GIK GSF
Sbjct  205   IADNIHVSLIFPPDTDTPALAEENKRRPQLTSIIAASSGA-MKADEVAKKALDGIKSGSF  263

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V CN EG  LSIATAGLSPQ SFLMAF+E   A ++R+ ALCFQ NWY  I+KWH   K
Sbjct  264   VVPCNFEGALLSIATAGLSPQRSFLMAFIEVVAASMIRLLALCFQWNWYGSIEKWHAQKK  323

Query  386   Q  384
             Q
Sbjct  324   Q  324



>ref|XP_011090771.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A [Sesamum indicum]
Length=324

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 222/297 (75%), Positives = 244/297 (82%), Gaps = 1/297 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV VPI N HVFITGGSSGIGLALA     EGA VS+LARN  KLE+AK +I  A
Sbjct  26    IVRPRPVSVPIKNSHVFITGGSSGIGLALAHLCAREGANVSLLARNVTKLEEAKQSIKLA  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDYDAVKRA+EEAGPIDVLVCN GV+  +ELE QE+EE+K MIDVNLT
Sbjct  86    TGRDVNVFSADVRDYDAVKRAIEEAGPIDVLVCNQGVFVPQELEHQELEEIKFMIDVNLT  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+FHLIKAALPGM    A RGPGSIAIMSSQAGQVGIYGYTAYSASKFGL+G+AEALQ E
Sbjct  146   GSFHLIKAALPGMKKNRAERGPGSIAIMSSQAGQVGIYGYTAYSASKFGLKGLAEALQHE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +IA NIHVSLIFPP T TP   +E KRRPQ+TS IA SSGA MKA+EVAKKSL+GIK G+
Sbjct  206   IIADNIHVSLIFPPDTETPGFVEENKRRPQLTSIIAASSGA-MKADEVAKKSLDGIKSGT  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             F V CN EGF LS+ TAGLSPQ S+LMAFVE   AGI+R+AAL FQ NWY  I+KWH
Sbjct  265   FIVPCNFEGFLLSVGTAGLSPQRSYLMAFVEVMTAGIVRLAALFFQWNWYGSIEKWH  321



>ref|XP_010035447.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Eucalyptus 
grandis]
 gb|KCW84257.1| hypothetical protein EUGRSUZ_B01114 [Eucalyptus grandis]
Length=325

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 248/302 (82%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV++P+ NRHVFITGGSSGIGLALA +A AEGA+VSILAR+  KLE+AK AI  A
Sbjct  26    IVRPRPVRIPLKNRHVFITGGSSGIGLALAHRAAAEGARVSILARSQAKLEEAKQAIRLA  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRD+DAV+RA EEAGP+DVLV N GV+   EL  QE+EEV+ MIDVNL 
Sbjct  86    TGIDVATFSADVRDFDAVRRAAEEAGPVDVLVVNQGVFVPGELAKQELEEVRFMIDVNLI  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKA LP M +R  +R P SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  146   GSFNMIKAFLPAMKAR-TDRRPASIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  204

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +IA +IHVSL+FPP T TP L +E K+RP +TS IA SSGA MKA+EVA+K+LNGIK GS
Sbjct  205   IIADDIHVSLVFPPDTDTPGLVEENKKRPPLTSIIAASSGA-MKADEVAEKTLNGIKSGS  263

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG+ L++ATAGLSPQ S++MAFVE   AGI+R+A L FQ NWY+ I+KWH  +
Sbjct  264   FIVPCNFEGYLLAVATAGLSPQRSYVMAFVEVVSAGIVRLAGLFFQWNWYSSIEKWHAQS  323

Query  389   KQ  384
             KQ
Sbjct  324   KQ  325



>ref|XP_008340927.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Malus domestica]
Length=325

 Score =   404 bits (1039),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 246/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVK+PI NRHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK+ I  +
Sbjct  25    IVRPRPVKIPIKNRHVFITGGSSGIGLALAHQAATEGARVSILARSIDKLEEAKNYIQLS  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V+ F+ADVRDYDAV +AV EAGP+DVL+ N GV+  +ELE Q ++EVK M+DVNL 
Sbjct  85    TGIDVSIFAADVRDYDAVSKAVXEAGPVDVLIVNQGVFVPEELEKQGLDEVKFMVDVNLI  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  +  +RGP SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  145   GSFNMIKAALPEM-KKGEDRGPRSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI+H+IHVSL+FPP T TP  A+E KRRP +T  IA SSGA MKAE+VAK++L+GIK  S
Sbjct  204   VISHDIHVSLVFPPDTDTPGFAEETKRRPPLTGIIAESSGA-MKAEDVAKRALDGIKSAS  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  LSIATAGLSPQ SF+MAF E   AG++R+ ALCFQ NWYT IQKW   N
Sbjct  263   FIVPCNFEGLLLSIATAGLSPQRSFVMAFFEVVAAGLVRLVALCFQWNWYTSIQKWQAQN  322

Query  389   KQ  384
             K+
Sbjct  323   KR  324



>ref|XP_006489323.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydrosphingosine reductase-like 
[Citrus sinensis]
Length=330

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 210/301 (70%), Positives = 245/301 (81%), Gaps = 2/301 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+PV++PI +RHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK +I  A
Sbjct  25    IVRPKPVRIPIKDRHVFITGGSSGIGLALAHQAAKEGARVSILARSGEKLEEAKQSIQLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  +SADVRD+DAVK A++EAGP+DVLV N GV+   ELE Q ++EV++MIDVN+ 
Sbjct  85    TGIEVATYSADVRDFDAVKTALDEAGPVDVLVVNQGVFVPGELEVQSLDEVRLMIDVNII  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+FH+IKAALP +I +  N GP SIA+MSSQAGQVGIYGYT YSASKFGLRG+AEALQQE
Sbjct  145   GSFHMIKAALP-LIKKRQNGGPASIALMSSQAGQVGIYGYTGYSASKFGLRGLAEALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA +IHVSLIFPP T TP L +E KRRP++TS IA SSGA MKA+EVAKK+L+GIK GS
Sbjct  204   VIADDIHVSLIFPPDTETPGLEEENKRRPRLTSIIAASSGA-MKADEVAKKALDGIKSGS  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EGF LSIATAGLSPQ S LMAFVE   AG++R  ALCFQ NWY  I+KWH   
Sbjct  263   FIVPCNSEGFLLSIATAGLSPQRSVLMAFVEVVAAGLIRFVALCFQWNWYGSIEKWHAQG  322

Query  389   K  387
             K
Sbjct  323   K  323



>ref|XP_009338472.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Pyrus x bretschneideri]
Length=325

 Score =   402 bits (1034),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 246/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVK+PI NRHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK+ I  +
Sbjct  25    IVRPRPVKIPIKNRHVFITGGSSGIGLALAHQAAIEGARVSILARSIDKLEEAKNYIQLS  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V+ F+ADVRDY AV +AVEEAGP+DVL+ N GV+  +ELE Q ++EVK M+DVNL 
Sbjct  85    TGIDVSIFAADVRDYGAVSKAVEEAGPVDVLIVNQGVFVPEELEKQGLDEVKFMVDVNLI  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  +  +RGP SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  145   GSFNMIKAALPEM-KKGEDRGPRSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI+H+IHVSL+FPP T TP  A+E KRRP +T  IA SSGA MKAE+VAK++L+GIK  S
Sbjct  204   VISHDIHVSLVFPPDTDTPGFAEETKRRPPLTGIIAESSGA-MKAEDVAKRALDGIKSAS  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  LSIATAGLSPQ SF+MAF E   AG++R+ ALCFQ NWYT IQKW   N
Sbjct  263   FIVPCNFEGLLLSIATAGLSPQRSFVMAFFEVVAAGLVRLIALCFQWNWYTSIQKWQAQN  322

Query  389   KQ  384
             K+
Sbjct  323   KR  324



>ref|XP_006419849.1| hypothetical protein CICLE_v10005413mg [Citrus clementina]
 gb|ESR33089.1| hypothetical protein CICLE_v10005413mg [Citrus clementina]
Length=327

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 246/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+PV++PI +RHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK +I  A
Sbjct  25    IVRPKPVRIPIKDRHVFITGGSSGIGLALAHQAAKEGARVSILARSGEKLEEAKQSIQLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  +SADVRD+DAVK A++EAGP+DVLV N GV+   ELE Q ++EV++MIDVN+ 
Sbjct  85    TGIEVATYSADVRDFDAVKTALDEAGPVDVLVVNQGVFVPGELEVQSLDEVRLMIDVNII  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+FH+IKAALP +I +  N GP SIA+MSSQAGQVGIYGYT YSASKFGLRG+AEALQQE
Sbjct  145   GSFHMIKAALP-LIKKRQNGGPASIALMSSQAGQVGIYGYTGYSASKFGLRGLAEALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA +IHVSLIFPP T TP L +E KRRP++TS IA SSGA MKA+EVAKK+L+GIK GS
Sbjct  204   VIADDIHVSLIFPPDTETPGLEEENKRRPRLTSIIAASSGA-MKADEVAKKALDGIKSGS  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EGF LSIATAGLSPQ S LMAFVE   AG++R  ALCFQ NWY  I+KWH   
Sbjct  263   FIVPCNSEGFLLSIATAGLSPQRSVLMAFVEVVAAGLIRFVALCFQWNWYGSIEKWHAQG  322

Query  389   KQ  384
             K+
Sbjct  323   KR  324



>ref|XP_004296923.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Fragaria 
vesca subsp. vesca]
Length=327

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/301 (70%), Positives = 241/301 (80%), Gaps = 1/301 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRP  VPI NRHVFITGGSSGIGLALA +A +EGA+VSILAR+  KLE+AK+ I  +
Sbjct  26    IVRPRPATVPIKNRHVFITGGSSGIGLALAHRAASEGARVSILARSLNKLEEAKNLIQLS  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  F+ADVRDYDA+ +AVE AGPIDVLV N GV+   EL+ Q +++V+ M+DVNL 
Sbjct  86    TGIDVAVFAADVRDYDALSKAVEAAGPIDVLVVNQGVFVPGELDKQGLDDVRFMVDVNLM  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M      RGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  146   GSFNMIKAALPAMKKDREERGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA NIHVSLIFPP T TP L +E K+RPQ+TS IA SSGA MKAE+VAKK+L+GIK  S
Sbjct  206   VIADNIHVSLIFPPDTDTPGLTEETKKRPQLTSIIAESSGA-MKAEDVAKKALDGIKSAS  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  LSIATAGLSPQ SF+MAFVE   A ++RI AL FQ NWYT I KWH  N
Sbjct  265   FIVPCNFEGRMLSIATAGLSPQRSFIMAFVEVLAASVIRIVALGFQWNWYTSILKWHGQN  324

Query  389   K  387
             +
Sbjct  325   R  325



>ref|XP_010093997.1| 3-ketodihydrosphingosine reductase [Morus notabilis]
 gb|EXB55012.1| 3-ketodihydrosphingosine reductase [Morus notabilis]
Length=323

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 246/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV++PI NRHVFITGGSSGIGLALA +A +EGA+VSILAR+  KLEDAKHAI  A
Sbjct  24    IVRPRPVRIPIKNRHVFITGGSSGIGLALAHRAASEGARVSILARSHDKLEDAKHAIRLA  83

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  F+ADVRD DAV+RA EEAGPIDVLV N GV+  +ELE Q ++EVK M+DVNL 
Sbjct  84    TGVDVATFAADVRDADAVRRAAEEAGPIDVLVVNQGVFVPEELEKQGLDEVKFMVDVNLI  143

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M +R   RGPGSIA+MSSQAGQVGIYGYTAYSASKFGLRG+AE+LQ E
Sbjct  144   GSFNMIKAALPEMKNR-EGRGPGSIALMSSQAGQVGIYGYTAYSASKFGLRGLAESLQHE  202

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +IA +IH+SLIFPP T+TP   +E K+RP +T  I  SSG  MKAEEVAKK+L+GIKCGS
Sbjct  203   LIAEDIHISLIFPPDTNTPGFIEESKKRPPLTRIITGSSGE-MKAEEVAKKALDGIKCGS  261

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F + CN EG  LSIATAGLSPQ SF MAFVE   AG++R+AALCFQ NWY  I+K++   
Sbjct  262   FIIPCNFEGLLLSIATAGLSPQRSFPMAFVEVLTAGLIRVAALCFQWNWYGSIEKYYAQK  321

Query  389   KQ  384
             +Q
Sbjct  322   QQ  323



>ref|XP_011035996.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Populus 
euphratica]
Length=340

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 208/297 (70%), Positives = 254/297 (86%), Gaps = 1/297 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             I RPRP+++PI  RH+FITGGSSGIGLALA +A +EGA+VSIL+R+  KLE+AK+AI ++
Sbjct  25    ITRPRPIQIPIKKRHIFITGGSSGIGLALAHRAASEGARVSILSRSIDKLEEAKNAIRQS  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  F+ADVRD++AV+RAV+EAGPID LV N GV+ ++ELE+Q++EEV+ +IDVNLT
Sbjct  85    TGIDVAIFAADVRDFEAVQRAVDEAGPIDFLVVNQGVFVAQELEEQKLEEVRFIIDVNLT  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALPGM     +RGPGSIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  145   GSFNMIKAALPGMKRSRKDRGPGSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  204

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSL+FPP T TP L +E KR+PQ+TS IA SSGA MKA+EVAKK+L+GIK GS
Sbjct  205   VIGDNIHVSLVFPPDTETPGLTEENKRKPQLTSIIAASSGA-MKADEVAKKALDGIKSGS  263

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             F++ CN EGF L+IATAGLSPQ S+LMAFVE   AG++RIAALCFQ NWY  I+KWH
Sbjct  264   FTIPCNSEGFLLAIATAGLSPQRSYLMAFVEVVAAGLLRIAALCFQWNWYGSIEKWH  320



>ref|XP_002517186.1| short-chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45349.1| short-chain dehydrogenase, putative [Ricinus communis]
Length=456

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 247/301 (82%), Gaps = 2/301 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR VK+PI NRHVFITGGSSGIGLALA +AV+EGA+VSILAR+  KLE+AK+ I  +
Sbjct  28    IVRPRTVKIPIKNRHVFITGGSSGIGLALAHRAVSEGARVSILARSLDKLEEAKNYIRLS  87

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  F ADVRD++++K+AV EAGPIDVLV N GV+  +ELE QE+ EV  MIDVNL 
Sbjct  88    TGVDVAIFPADVRDFESLKKAVTEAGPIDVLVVNQGVFFPEELEKQELSEVNFMIDVNLI  147

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M +R  + GP SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  148   GSFNMIKAALPVMKNR-KDSGPASIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  206

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA+NIHVSLIFPP T TP LA+E KRRPQ+TS IA SSG  MKA+EVAKK+L+GIKCG+
Sbjct  207   VIAYNIHVSLIFPPDTETPGLAEENKRRPQLTSVIAASSGV-MKADEVAKKALDGIKCGA  265

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  L++ATAGLSPQ SF MAFVE   AG++R+ ALCFQ NWY  I+KWH   
Sbjct  266   FFVPCNFEGMLLTVATAGLSPQRSFSMAFVEVVAAGLIRLVALCFQWNWYGSIEKWHAQK  325

Query  389   K  387
             K
Sbjct  326   K  326



>ref|XP_010668480.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/301 (68%), Positives = 241/301 (80%), Gaps = 1/301 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR V +PI NRH+FITGGSSGIGLALA +  +EGA+VSILAR+  KL++AK AI R 
Sbjct  27    IVRPRSVTIPIKNRHIFITGGSSGIGLALAHRFASEGARVSILARDLRKLQNAKDAIQRN  86

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V+ FSADVRD+DAVK+AVE+AGPIDVLVCN GV+  +E+E Q ++E+K MIDVN+ 
Sbjct  87    TGIEVSIFSADVRDFDAVKKAVEDAGPIDVLVCNQGVFVPQEIESQSLDEIKFMIDVNVI  146

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALP M     +RGP SIAIMSSQAGQVGIYGYTAYSASKF LRG+AEALQ E
Sbjct  147   GTFHLIKAALPLMKKDRKSRGPASIAIMSSQAGQVGIYGYTAYSASKFALRGLAEALQHE  206

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP L +E KRRP++T+ IA SSG  MK +EVAKKS++GIK G+
Sbjct  207   VIGDNIHVSLIFPPDTDTPGLEEENKRRPELTNIIAGSSG-MMKPDEVAKKSIDGIKKGT  265

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EGF LSIATAGLSPQ S+LMA+VE   AG++R+  L FQ NWY  I+KWH   
Sbjct  266   FIVPCNFEGFLLSIATAGLSPQRSYLMAYVEVVAAGVVRLIGLIFQWNWYGCIEKWHSKK  325

Query  389   K  387
             K
Sbjct  326   K  326



>ref|XP_010278135.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A [Nelumbo nucifera]
Length=326

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 236/295 (80%), Gaps = 2/295 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPRPVK+PI  RHVFITGGSSGIGLALA QA +EGA+VSILAR A KLE+A+++I  +TG
Sbjct  28    RPRPVKIPIKGRHVFITGGSSGIGLALAHQAASEGARVSILARKADKLEEARNSIRLSTG  87

Query  1103  CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
               V  FS DVRD DAV+RA++EA PID+L+CN GV+  +ELE Q +E VK MIDVNL GT
Sbjct  88    IDVAVFSVDVRDSDAVQRAIDEADPIDILICNQGVFIPQELELQSLETVKFMIDVNLMGT  147

Query  923   FHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVI  744
             FHLIK+ALP M +R  +R P SIAIMSSQAGQVGIYGYTAYSASKFGLRG+ EALQQEVI
Sbjct  148   FHLIKSALPNMKNR-GDRRPASIAIMSSQAGQVGIYGYTAYSASKFGLRGLGEALQQEVI  206

Query  743   AHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFS  564
             A NIHVSLIFPP T TP   +E K RP +TS IA SSGA MKA+EVAKK+L+GIK G F 
Sbjct  207   ADNIHVSLIFPPDTETPGFLEETKTRPLLTSIIAASSGA-MKADEVAKKALDGIKSGRFI  265

Query  563   VACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             V CNL+GF LSIATAGLSPQ S LMAF+E   AG +RI AL FQ NWY  I +WH
Sbjct  266   VPCNLDGFLLSIATAGLSPQRSPLMAFIEVVSAGALRIGALFFQWNWYGSIARWH  320



>ref|XP_008245913.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Prunus mume]
 ref|XP_008245914.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Prunus mume]
Length=327

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 242/301 (80%), Gaps = 3/301 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRPVK+PI NRHVFITGGSSGIGLALA  A +EGA+VSILAR+  KLE+AK+ I  +T
Sbjct  29    VRPRPVKIPIKNRHVFITGGSSGIGLALAHHAASEGARVSILARSIDKLEEAKNYIQLST  88

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V+ FSADVRDYDAV +AVEEAGPIDVL+ N GV+  +ELE Q ++EVK M+DVNL G
Sbjct  89    GIDVSIFSADVRDYDAVSKAVEEAGPIDVLIVNQGVFVPEELEKQGLDEVKFMVDVNLIG  148

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M  +  +  P SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQEV
Sbjct  149   SFNMIKAALPKM--KKGDGMPRSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             I+H+IHVSLIFPP T TP L +E K+RPQ+TS IA SSG  MKAEEVAKK+  GIK  +F
Sbjct  207   ISHDIHVSLIFPPDTDTPGLTEETKKRPQLTSIIAESSGV-MKAEEVAKKAFGGIKSAAF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V CNLEG  LSIATAG+SPQ SF+MAFVE   AG++R+ AL FQ NWY  I  WH  NK
Sbjct  266   IVPCNLEGALLSIATAGMSPQRSFVMAFVEVVAAGLVRLVALFFQWNWYNGIHTWHAQNK  325

Query  386   Q  384
             +
Sbjct  326   R  326



>ref|XP_008246093.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Prunus mume]
Length=358

 Score =   392 bits (1008),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 241/300 (80%), Gaps = 3/300 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRPVK+PI NRHVFITGGSSGIGLALA  A +EGA+VSILAR+  KLE+AK+ I  +T
Sbjct  29    VRPRPVKIPIKNRHVFITGGSSGIGLALAHHAASEGARVSILARSIDKLEEAKNYIQLST  88

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V+ FSADVRDYDAV +AVEEAGPIDVL+ N GV+  +ELE Q ++EVK M+DVNL G
Sbjct  89    GIDVSIFSADVRDYDAVSKAVEEAGPIDVLIVNQGVFVPEELEKQGLDEVKFMVDVNLIG  148

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M  +  +  P SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQEV
Sbjct  149   SFNMIKAALPKM--KKGDGMPRSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             I+H+IHVSLIFPP T TP L +E K+RPQ+TS IA SSG  MKAEEVAKK+  GIK  +F
Sbjct  207   ISHDIHVSLIFPPDTDTPGLTEETKKRPQLTSIIAESSGV-MKAEEVAKKAFGGIKSAAF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V CNLEG  LSIATAG+SPQ SF+MAFVE   AG++R+ AL FQ NWY  I  WH  NK
Sbjct  266   IVPCNLEGALLSIATAGMSPQRSFVMAFVEVVAAGLVRLVALFFQWNWYNGIHTWHAQNK  325



>ref|XP_010546852.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Tarenaya 
hassleriana]
Length=328

 Score =   391 bits (1005),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 205/296 (69%), Positives = 241/296 (81%), Gaps = 2/296 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRPVK+PI +RHVFITGGSSGIGLALA++  AEGA+VSILAR+  KLE+AK +I  AT
Sbjct  28    VRPRPVKIPIKSRHVFITGGSSGIGLALAVRCAAEGARVSILARSRDKLEEAKRSIQLAT  87

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  F+ADVRDYDAV +AV E+GPIDVLV N GV+ ++ELE Q ++EVK MIDVNL G
Sbjct  88    GVEVATFAADVRDYDAVSKAVNESGPIDVLVVNQGVFVAEELEKQSLDEVKFMIDVNLLG  147

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  + GP SIAIMSSQAGQVGIYGYTAYSASKFGL+G+A+ALQQEV
Sbjct  148   SFNVIKAALPSMKARKGH-GPASIAIMSSQAGQVGIYGYTAYSASKFGLQGLAQALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA NIHVSLIFPP T TP   +E K RPQ+T+ IA SSGA MK EEVAK +L GIK G F
Sbjct  207   IADNIHVSLIFPPDTETPGFEEEQKTRPQLTNIIAASSGA-MKPEEVAKITLEGIKAGKF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             SV+CN EGF LS ATAGLSPQ SFL+A+VE   AG++R+AAL FQ +WY  I KW+
Sbjct  266   SVSCNFEGFLLSTATAGLSPQRSFLIAYVEVMTAGLIRLAALFFQWDWYRAIDKWN  321



>ref|XP_007147752.1| hypothetical protein PHAVU_006G152000g [Phaseolus vulgaris]
 gb|ESW19746.1| hypothetical protein PHAVU_006G152000g [Phaseolus vulgaris]
Length=327

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 208/300 (69%), Positives = 245/300 (82%), Gaps = 2/300 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             V+PRPVK+PI NRHVFITGGSSGIGLALA +A AEGA+VSILAR+ GKLE+A++AI  AT
Sbjct  24    VKPRPVKIPIKNRHVFITGGSSGIGLALAHRAAAEGARVSILARSLGKLEEARNAIRLAT  83

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  F+ADVRD++AVKRAV+EAGPIDVL+ NHGV+ + ELE  E+ EVK  +DVNL G
Sbjct  84    GIEVAVFAADVRDFEAVKRAVDEAGPIDVLLLNHGVFVALELEKMELSEVKFTMDVNLMG  143

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             T +LIKAALP M +R  +  P SIA++SSQAGQVGIYGY AYSASKFGLRG+AEALQQEV
Sbjct  144   TLNLIKAALPAMKNRK-DPLPASIALVSSQAGQVGIYGYVAYSASKFGLRGLAEALQQEV  202

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA NIHVSLIFPP T TP LA+E +R+P+IT  IA SSG+ MKAEEVA+K+L+GIK GSF
Sbjct  203   IADNIHVSLIFPPDTDTPGLAEENRRKPEITKIIASSSGS-MKAEEVAQKALDGIKSGSF  261

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V+CNLEG  LS+ATAGLSPQ SFLMAFVE   AGI+RI AL    +WY  I+K+H   K
Sbjct  262   IVSCNLEGIALSLATAGLSPQRSFLMAFVEVVAAGILRIVALGMHWSWYGSIEKYHSQRK  321



>ref|XP_003546136.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Glycine max]
Length=329

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 245/300 (82%), Gaps = 2/300 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRPVK+PI NRHVFITGGSSGIGLALA +A AEGA+VSILAR+  KLE+A++AI  AT
Sbjct  26    VRPRPVKIPIKNRHVFITGGSSGIGLALAHRAAAEGARVSILARSPEKLEEARNAIRLAT  85

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V AF+ADVRD+DAVKRAV++AGPIDVL+ NHGV+ + ELE  E+ +VK  +DVNL G
Sbjct  86    GIEVAAFAADVRDFDAVKRAVDDAGPIDVLLLNHGVFVALELEKMELSDVKFTMDVNLMG  145

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             T +LIKAALP M +R  +  P SIA++SSQAGQVGIYGY AYSASKFGLRG+AEALQQEV
Sbjct  146   TLNLIKAALPAMKNR-NDPLPASIALVSSQAGQVGIYGYVAYSASKFGLRGLAEALQQEV  204

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA NIHVSLIFPP T TP LA+E KR+P++T  IA SSG+ MKA+EVA+K+L+GIKCG+F
Sbjct  205   IADNIHVSLIFPPDTDTPGLAEENKRKPELTKIIAASSGS-MKADEVAQKALDGIKCGNF  263

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V+CN EG  LS+ATAGLSPQ SFLMAF+E   AGI+RI AL  Q  WY  I+K+H   K
Sbjct  264   IVSCNFEGIALSLATAGLSPQRSFLMAFLEVVAAGILRIVALGMQWTWYGSIEKYHSQRK  323



>ref|XP_008438707.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cucumis melo]
Length=324

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 240/301 (80%), Gaps = 2/301 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVK+P+ +RHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK AI  +
Sbjct  26    IVRPRPVKIPLKSRHVFITGGSSGIGLALAHQAATEGARVSILARSLKKLEEAKDAIRLS  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  ++ADVRDYDA+ +AV+EAGPIDVL+ N GV+  +EL +QE++EVK M+DVNL 
Sbjct  86    TGIDVAVYAADVRDYDAISKAVDEAGPIDVLIVNQGVFVPQELAEQELDEVKFMLDVNLL  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTF++IKAALP M +R  +R P SIA+MSSQAGQVGIYGYTAYSASKFG+RG+AEALQQE
Sbjct  146   GTFNMIKAALPAMKNR-VDRRPASIALMSSQAGQVGIYGYTAYSASKFGIRGLAEALQQE  204

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  +IH+SLIFPP T TP  A+E K+RP++T+ IA   G+ MK E VAKK+ NGIK GS
Sbjct  205   VIGDDIHISLIFPPDTDTPGFAEEQKKRPELTTIIAAGGGS-MKPELVAKKAFNGIKSGS  263

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F + CN EG  LS+ATAGLSPQ SF MAF+E   AG++RI ALCFQ  WY  I+KWH   
Sbjct  264   FIIPCNFEGALLSVATAGLSPQRSFFMAFLEVVGAGVIRIVALCFQWVWYGSIEKWHAQR  323

Query  389   K  387
             K
Sbjct  324   K  324



>gb|KEH36798.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=370

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 244/300 (81%), Gaps = 2/300 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI+NRHVFITGGSSGIGLALA +A A+GA+VSI+AR+  KLE+AK+++  +T
Sbjct  24    VRPRPIKIPITNRHVFITGGSSGIGLALAHRAAADGARVSIMARSLQKLEEAKNSVKNST  83

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  F+ADVRDYDAVK+AV+EAGPIDVL+ NHGV+ + ELE  E+ +VK  IDVNL G
Sbjct  84    GVEVAIFAADVRDYDAVKKAVDEAGPIDVLLLNHGVFYALELEKMELSDVKFTIDVNLMG  143

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
               ++IKAALP M +R  +  P SIA +SSQAGQVGIYGY AYSASKFGLRG+AEALQQEV
Sbjct  144   CLNMIKAALPQMKNRK-DTLPASIAFVSSQAGQVGIYGYVAYSASKFGLRGLAEALQQEV  202

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             I  NIHVSLIFPP T TP L +E KR+P++T  IA SSG FMKA+EVA+K+ +GI+ GSF
Sbjct  203   IGDNIHVSLIFPPDTDTPGLVEENKRKPELTKIIAASSG-FMKADEVAQKAFDGIRRGSF  261

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              ++CNLEG  LS+AT+GLSPQ SFLMAFVE   AGIMRIAALCFQ NWY  I+KWH   K
Sbjct  262   IISCNLEGIALSLATSGLSPQRSFLMAFVEVIAAGIMRIAALCFQWNWYGSIEKWHKQRK  321



>gb|EPS65224.1| hypothetical protein M569_09551 [Genlisea aurea]
Length=329

 Score =   387 bits (994),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 204/302 (68%), Positives = 235/302 (78%), Gaps = 1/302 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+PV++PI NRHVFITGGSSGIGLALA      GA V++LAR   KLE+A+ +I  A
Sbjct  25    IVRPKPVQIPIKNRHVFITGGSSGIGLALAHLCAQNGADVTLLARELKKLEEARDSIELA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG GV   SADVRDY AVKRAV+ + PIDVLVCN GV+  +ELEDQ++EE+K MIDVNLT
Sbjct  85    TGRGVRILSADVRDYAAVKRAVDASPPIDVLVCNQGVFVPQELEDQDLEEIKFMIDVNLT  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G FHLIKAALPGM    A  GP SIA+MSSQAGQVGIYGYTAYSASKFGL+G+AEALQ E
Sbjct  145   GCFHLIKAALPGMKKNRAQLGPASIALMSSQAGQVGIYGYTAYSASKFGLKGLAEALQHE  204

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIAHNIHVSLIFPP T TP   +EMKRRPQ+TS IA SSG +M A+ VAKK+L GI+ G+
Sbjct  205   VIAHNIHVSLIFPPDTETPGAVEEMKRRPQLTSIIAASSG-WMSADGVAKKALRGIQSGA  263

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  LS+ATAGLSPQ SFL AF+E    G MR+  L FQ NW+  I+KWH   
Sbjct  264   FIVPCNFEGVLLSVATAGLSPQRSFLWAFLEVIGMGFMRLVGLFFQWNWFGSIRKWHMEK  323

Query  389   KQ  384
             K+
Sbjct  324   KK  325



>ref|XP_008390843.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Malus domestica]
Length=325

 Score =   386 bits (992),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 243/302 (80%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP PV +PI NRHVFITGGSSGIGLALA QA   GA+VSILAR+  KLE+AK+ I  +
Sbjct  25    IVRPCPVNIPIKNRHVFITGGSSGIGLALAHQAATXGARVSILARSLDKLEEAKNYIQLS  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V+ F+ADVRDYDAV +AVEEAGPID+L+ N GV+ ++ELE Q ++EV+ M+DVNL 
Sbjct  85    TGIDVSIFAADVRDYDAVXKAVEEAGPIDLLIVNQGVFVAEELEKQGLDEVRFMVDVNLI  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  +  +RGP SIA+MSSQAGQVGIYGYTAYSASKFGLRG+ EALQQE
Sbjct  145   GSFNMIKAALPEM-KKGEDRGPRSIALMSSQAGQVGIYGYTAYSASKFGLRGLGEALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI+H+IHVSL+FPP T TP  A+E KRRP +T  IA SSGA MKAE+VAK++L+GIK  S
Sbjct  204   VISHDIHVSLVFPPDTDTPGFAEENKRRPPLTGIIAESSGA-MKAEDVAKRALDGIKSAS  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  LSIATAG+SPQ SF+MAF+E    G++R+ ALCFQ +WYT I KW   +
Sbjct  263   FIVRCNFEGLLLSIATAGMSPQRSFVMAFLEVVAGGLVRLVALCFQWSWYTSIHKWQAQS  322

Query  389   KQ  384
             K+
Sbjct  323   KR  324



>ref|XP_004134147.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Cucumis sativus]
 gb|KGN57010.1| hypothetical protein Csa_3G149900 [Cucumis sativus]
Length=326

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/297 (67%), Positives = 238/297 (80%), Gaps = 2/297 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV++ + +RHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK AI  +
Sbjct  26    IVRPRPVRISLKSRHVFITGGSSGIGLALAHQAATEGARVSILARSLKKLEEAKDAIRLS  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  ++ADVRDYDA+ +AV+EAGPIDVL+ N GV+  +EL +QE++EVK M+DVNL 
Sbjct  86    TGIDVAVYAADVRDYDAILKAVDEAGPIDVLIVNQGVFVPQELAEQELDEVKFMLDVNLL  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTF++IKAALP M +R  +R P SIA+MSSQAGQVGIYGYTAYSASKFG+RG+AEALQQE
Sbjct  146   GTFNMIKAALPAMKNR-VDRRPASIALMSSQAGQVGIYGYTAYSASKFGIRGLAEALQQE  204

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  +IHVSLIFPP T TP  A+E K+RP++T+ IA   G+ MK E VAKK+ NGIK GS
Sbjct  205   VIGDDIHVSLIFPPDTDTPGFAEEQKKRPELTTIIAAGGGS-MKPELVAKKAFNGIKSGS  263

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             F + CN EG  LSIATAGLSPQ SF MAF+E   AG++RI ALCFQ  WY  I+KWH
Sbjct  264   FIIPCNFEGTLLSIATAGLSPQRSFFMAFIEVVGAGVIRIVALCFQWVWYGSIEKWH  320



>ref|XP_009387639.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Musa acuminata 
subsp. malaccensis]
Length=331

 Score =   384 bits (987),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 234/303 (77%), Gaps = 2/303 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR V++PI  RHVFI+GGSSGIGLALA  A  EGA+VSILAR+A +L++A+ AI  A
Sbjct  29    IVRPRSVRIPIKGRHVFISGGSSGIGLALARLAATEGARVSILARSAVRLQEARDAIRLA  88

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRD DAV  AVEEAGP+DVLVCNHGV+  +ELE Q++EEV+ M+++NL 
Sbjct  89    TGVDVAIFSADVRDADAVANAVEEAGPVDVLVCNHGVFTPQELEKQDLEEVRFMVEINLM  148

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             G FHLIKAALP M  R    G P SIAIMSSQAGQVG+YGYTAYSASKF LRG+AEALQ 
Sbjct  149   GIFHLIKAALPAMKQRAKATGLPASIAIMSSQAGQVGVYGYTAYSASKFALRGLAEALQH  208

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIAHNIHVS+IFPP T TP  A+E KRRP +T+ IA SSG  MKA++VAKK+LNGIK  
Sbjct  209   EVIAHNIHVSMIFPPDTDTPGFAEEHKRRPDLTNIIAGSSGG-MKADDVAKKALNGIKSS  267

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
              F V CN EG  LSIATAGLSPQ+SF  A  E   AG MR   LCFQ NW+++I+KWH  
Sbjct  268   MFIVPCNFEGSMLSIATAGLSPQSSFFTALAEVLGAGFMRFMGLCFQWNWFSLIEKWHSK  327

Query  392   NKQ  384
              K 
Sbjct  328   KKN  330



>ref|XP_003542879.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform 2 
[Glycine max]
Length=329

 Score =   384 bits (986),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 202/301 (67%), Positives = 243/301 (81%), Gaps = 2/301 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRPVK+PI NRHVFITGGSSGIGLALA +A AEGA+VSILAR+  KLE+A++AI  A
Sbjct  25    LVRPRPVKIPIKNRHVFITGGSSGIGLALAHRAAAEGARVSILARSPDKLEEARNAIRLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V AF+ADVRD++AVKRAV++AGPIDVL+ NHGV+ + EL+  E+ EVK  +DVNL 
Sbjct  85    TGMEVAAFAADVRDFEAVKRAVDDAGPIDVLLLNHGVFVALELDKMELSEVKFTMDVNLM  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GT +LIKAALP M +R  +  P SIA++SSQAGQVGIYGY AYSASKFGLRG+AE+LQQE
Sbjct  145   GTLNLIKAALPAMKNR-NDPLPASIALVSSQAGQVGIYGYVAYSASKFGLRGLAESLQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVS+IFPP T TP LA+E KRRP++T  I  SSG+ MKA+EVA+K+L+GIKCG 
Sbjct  204   VIEDNIHVSMIFPPDTDTPGLAEENKRRPELTKIITASSGS-MKADEVAQKALDGIKCGD  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V+CN EG  LS+ATAGLSPQ SFLMAF+E   AGI+RI AL  Q  WY  I+K+H   
Sbjct  263   FIVSCNFEGIALSLATAGLSPQRSFLMAFLEVVAAGILRIVALGMQWTWYRSIEKYHSQR  322

Query  389   K  387
             K
Sbjct  323   K  323



>ref|XP_003542878.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform 1 
[Glycine max]
Length=326

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 202/301 (67%), Positives = 243/301 (81%), Gaps = 2/301 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRPVK+PI NRHVFITGGSSGIGLALA +A AEGA+VSILAR+  KLE+A++AI  A
Sbjct  25    LVRPRPVKIPIKNRHVFITGGSSGIGLALAHRAAAEGARVSILARSPDKLEEARNAIRLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V AF+ADVRD++AVKRAV++AGPIDVL+ NHGV+ + EL+  E+ EVK  +DVNL 
Sbjct  85    TGMEVAAFAADVRDFEAVKRAVDDAGPIDVLLLNHGVFVALELDKMELSEVKFTMDVNLM  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GT +LIKAALP M +R  +  P SIA++SSQAGQVGIYGY AYSASKFGLRG+AE+LQQE
Sbjct  145   GTLNLIKAALPAMKNR-NDPLPASIALVSSQAGQVGIYGYVAYSASKFGLRGLAESLQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVS+IFPP T TP LA+E KRRP++T  I  SSG+ MKA+EVA+K+L+GIKCG 
Sbjct  204   VIEDNIHVSMIFPPDTDTPGLAEENKRRPELTKIITASSGS-MKADEVAQKALDGIKCGD  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V+CN EG  LS+ATAGLSPQ SFLMAF+E   AGI+RI AL  Q  WY  I+K+H   
Sbjct  263   FIVSCNFEGIALSLATAGLSPQRSFLMAFLEVVAAGILRIVALGMQWTWYRSIEKYHSQR  322

Query  389   K  387
             K
Sbjct  323   K  323



>ref|XP_003570174.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A [Brachypodium 
distachyon]
Length=326

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/298 (67%), Positives = 237/298 (80%), Gaps = 2/298 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPR  ++PI  RHVFITGGSSGIGLA+A  A  EGAKVSILARNA +LEDA+ AI  A
Sbjct  25    LVRPRAARIPIKGRHVFITGGSSGIGLAMATAAAREGAKVSILARNAARLEDARAAIRAA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V    ADVRD  AV RA+EEAGP+DVLVCNHGV+ ++ELE Q++EEVK M+D+NL 
Sbjct  85    TGHDVGVHQADVRDAGAVARALEEAGPVDVLVCNHGVFVAQELEKQDMEEVKWMVDINLM  144

Query  929   GTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             GTFHLIKAALP M +R    R P SIAIMSSQAGQVG+YGYTAYSASKF L G+AE+LQ 
Sbjct  145   GTFHLIKAALPAMKARTRETRLPASIAIMSSQAGQVGVYGYTAYSASKFALTGLAESLQH  204

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVI+ NIHVSLIFPP T TP  A+E+K+RP+IT+ IA SSG  MKA+ V+KK+LNGIK G
Sbjct  205   EVISDNIHVSLIFPPDTETPGFAEELKKRPEITTIIAGSSGG-MKADAVSKKALNGIKSG  263

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
              F V CN EG  L++AT+GL+PQ+S LMAFVE   AG+MR AALCFQ NW++ I+ W+
Sbjct  264   RFIVPCNFEGAMLAVATSGLTPQSSPLMAFVEVIGAGLMRFAALCFQWNWFSTIESWY  321



>ref|XP_007031800.1| Short-chain dehydrogenase, putative [Theobroma cacao]
 gb|EOY02726.1| Short-chain dehydrogenase, putative [Theobroma cacao]
Length=319

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 241/302 (80%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV +PI NRHVFITGGSSGIGLALA QA ++GA+VS+LAR+  KLE+AK +I  +
Sbjct  19    IVRPRPVNIPIKNRHVFITGGSSGIGLALAHQAASQGARVSLLARSLSKLEEAKQSIRLS  78

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             +G  V+ F+ADVRDY AV++A+ +AGPIDVLV N GV+  +ELE Q +EEVK MIDVNL 
Sbjct  79    SGVDVSIFAADVRDYYAVQKAINDAGPIDVLVVNQGVFVPQELEKQGLEEVKFMIDVNLM  138

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKA LP M  R  +RGP SIA+MSSQAGQVG+YGYTAYSASKFGLRG+AEALQQE
Sbjct  139   GSFNVIKAVLPLMKER-KDRGPTSIALMSSQAGQVGVYGYTAYSASKFGLRGLAEALQQE  197

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA NIHV+LIFPP T TP   QE K RP++T+ +A SSG+ MKA++VAKK+L+GIK GS
Sbjct  198   VIADNIHVTLIFPPDTDTPGFEQESKVRPELTTILAGSSGS-MKADKVAKKALDGIKSGS  256

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  L+IATAGLSPQ SFLMAF E    GI R+ AL FQ NWY  I++WH   
Sbjct  257   FIVPCNFEGQMLAIATAGLSPQRSFLMAFFEVAFIGICRLVALFFQWNWYGSIEQWHAKK  316

Query  389   KQ  384
             K+
Sbjct  317   KE  318



>ref|XP_010035460.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Eucalyptus 
grandis]
 gb|KCW84258.1| hypothetical protein EUGRSUZ_B01115 [Eucalyptus grandis]
Length=324

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 244/301 (81%), Gaps = 2/301 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRPV++P+ NRHVFITGGSSGIGLALA +A AEGA+VSILAR+  KL++A+ AI  AT
Sbjct  26    VRPRPVRIPLKNRHVFITGGSSGIGLALAHRAAAEGARVSILARSQAKLKEAREAIRLAT  85

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRD+DA++R  EEA P+DV+V N GV+ ++EL  QE+E VK++IDVNL G
Sbjct  86    GIDVATFSADVRDFDALRRVAEEAEPVDVMVVNQGVFVAEELAKQELEVVKLIIDVNLIG  145

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKA LP M +R  +R P SIA+MSSQAGQVGIYGYTAYSASKFGL+G+AEALQQE+
Sbjct  146   SFNMIKAFLPAMKAR-TDRRPASIALMSSQAGQVGIYGYTAYSASKFGLQGLAEALQQEI  204

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA +IHVSL+FPP T TP L +E KRRP +TS IA SSGA MKA+EVA+K++NGIK GSF
Sbjct  205   IADDIHVSLVFPPDTDTPGLVEENKRRPPLTSIIAASSGA-MKADEVAEKTINGIKSGSF  263

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V CN EG+ L+I T G+SPQ S++MAFVE   AGI+R+A L FQ +WY+ I+ WH  +K
Sbjct  264   IVPCNFEGYLLAILTGGVSPQRSYVMAFVEMVSAGIVRLACLFFQWSWYSSIENWHSQSK  323

Query  386   Q  384
             Q
Sbjct  324   Q  324



>ref|XP_004164724.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Cucumis sativus]
Length=326

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 236/297 (79%), Gaps = 2/297 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV++ + +RHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK AI  +
Sbjct  26    IVRPRPVRISLKSRHVFITGGSSGIGLALAHQAATEGARVSILARSLKKLEEAKDAIRLS  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  ++ADVRDYDA+ +AV+EAGPIDVL+ N GV+  +EL  QE++EVK M+DVNL 
Sbjct  86    TGIDVAVYAADVRDYDAILKAVDEAGPIDVLIVNQGVFVPQELAAQELDEVKFMLDVNLL  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTF++IKAALP M +R  +R P SIA+MSSQAGQVGIYGY AYSASKFG+RG+AEALQQE
Sbjct  146   GTFNMIKAALPAMKNR-VDRRPASIALMSSQAGQVGIYGYAAYSASKFGIRGLAEALQQE  204

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  +IHVSLIFPP T TP  A+E K+RP++T+ IA   G+ MK E VAKK+ NGIK GS
Sbjct  205   VIGDDIHVSLIFPPDTDTPGFAEEQKKRPELTTIIAAGGGS-MKPELVAKKAFNGIKSGS  263

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             F + CN EG  LSIATAGLSPQ SF MAF+E   AG++RI ALCFQ  WY  I+KWH
Sbjct  264   FIIPCNFEGTLLSIATAGLSPQRSFFMAFIEVVGAGVIRIVALCFQWVWYGSIEKWH  320



>ref|XP_002280998.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A isoform X1 [Vitis 
vinifera]
 ref|XP_010649870.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A isoform X2 [Vitis 
vinifera]
Length=323

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 234/300 (78%), Gaps = 2/300 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             I++P+ +K+PI NRHVFITGGSSGIGLALA  A +EGA+VSILARN  +L++A+ +I  +
Sbjct  25    ILKPQSIKIPIRNRHVFITGGSSGIGLALAHLAASEGARVSILARNVDRLQEARDSIRLS  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  F ADVRD DAV RA+EEAGP+DVL+CN GV+  +ELE QE+EEVK MIDVNL 
Sbjct  85    TGNDVAVFPADVRDPDAVLRAIEEAGPVDVLICNQGVFVPRELEKQELEEVKFMIDVNLM  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GTFHLIKAALPGM +R  +R P SIAI+SSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  145   GTFHLIKAALPGMKNR-KSREPASIAIISSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIAHNI VSLIFPP T TP   QE K RPQ+T  IA SSG  +KA+EVAKK+LNGIK GS
Sbjct  204   VIAHNILVSLIFPPDTDTPGFEQETKMRPQLTGIIAASSGT-VKADEVAKKTLNGIKSGS  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN +G  L+IATAGLSPQ S LMA  E   AG  R   LC Q  WY  I++W+  N
Sbjct  263   FIVPCNFDGLLLAIATAGLSPQRSVLMALCEVFAAGPTRFIGLCIQWGWYRSIKRWYAQN  322



>ref|XP_006407987.1| hypothetical protein EUTSA_v10021124mg [Eutrema salsugineum]
 gb|ESQ49440.1| hypothetical protein EUTSA_v10021124mg [Eutrema salsugineum]
Length=328

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 240/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+AGKL++AK +I  AT
Sbjct  28    VRPRPIKIPIKSRHVFITGGSSGIGLALAQRAASEGARVSILARSAGKLDEAKQSIKLAT  87

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +A++E+GPIDVL+ N GV+ +KELE Q  E+VK  IDVNL G
Sbjct  88    GVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFTAKELEKQSPEDVKFTIDVNLVG  147

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  +RGP SIA++SSQAGQVGIYGY AYSASKFGL+G+A++LQQEV
Sbjct  148   SFNVIKAALPAMKAR-RDRGPASIALVSSQAGQVGIYGYAAYSASKFGLQGLAQSLQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA +IHV+LIFPP T TP   +E K RP++T+ IA SSG+ MK E+VA+K+++GIK G F
Sbjct  207   IADDIHVTLIFPPDTDTPGFEEEQKSRPEVTAIIAASSGS-MKTEDVARKAMDGIKAGKF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ SF +AF+E   AG +R+ AL FQ +WY  I KW
Sbjct  266   TVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWDWYNAIAKW  320



>ref|XP_007208623.1| hypothetical protein PRUPE_ppa021089mg [Prunus persica]
 gb|EMJ09822.1| hypothetical protein PRUPE_ppa021089mg [Prunus persica]
Length=473

 Score =   384 bits (985),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 241/301 (80%), Gaps = 3/301 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPR VK+PI NRHVFITGGSSGIGLALA  A +EGA+VSILAR+  KLE+AK+ I  +T
Sbjct  29    VRPRSVKIPIKNRHVFITGGSSGIGLALAHHAASEGARVSILARSVDKLEEAKNNIQLST  88

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V+ FSADVRDYDAV +AVEEA PIDVL+ N GV+  +ELE Q ++EVK M+DVNL G
Sbjct  89    GIDVSIFSADVRDYDAVSKAVEEADPIDVLIVNQGVFVPEELEKQGLDEVKFMVDVNLIG  148

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M  +  +  P SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQEV
Sbjct  149   SFNMIKAALPKM--KKGDSVPRSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             I+H+IHVSLIFPP T TP L +E K+RPQ+TS IA SSGA MKAE VAKK+ +GIK  +F
Sbjct  207   ISHDIHVSLIFPPDTDTPGLTEETKKRPQLTSIIAESSGA-MKAEAVAKKAFDGIKSAAF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V CNLEG  LSIATAG+SPQ SF+MAFVE   AG++R+ AL FQ NWY  I  WH  N+
Sbjct  266   IVPCNLEGALLSIATAGMSPQRSFVMAFVEVVAAGLVRLVALFFQWNWYNGIHMWHAQNE  325

Query  386   Q  384
             +
Sbjct  326   K  326



>ref|XP_002884556.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60815.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=326

 Score =   377 bits (967),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 239/296 (81%), Gaps = 2/296 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRP+K+PI +RHVFITGGSSGIGLALA +A AEGA+VSILAR+AGKLE+AK  I  A
Sbjct  27    IVRPRPIKIPIKSRHVFITGGSSGIGLALAHRAAAEGARVSILARSAGKLEEAKKEIQLA  86

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDYDAV +A++E+GPIDVL+ N GV+ +KEL     E+VK  IDVNL 
Sbjct  87    TGVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFTAKELVTHSPEDVKFTIDVNLV  146

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M +R  +RGP SI+++SSQAGQVG+YGY AYSASKFGL+G+A+ALQQE
Sbjct  147   GSFNVIKAALPAMKAR-KDRGPASISLVSSQAGQVGVYGYAAYSASKFGLQGLAQALQQE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA +IHV+LIFPP T+TP   +E K RP +T+ IA SSG+ M+ EEVA+K+++GIK G 
Sbjct  206   VIADDIHVTLIFPPDTNTPGFEEEQKSRPDVTAIIAASSGS-METEEVARKAMDGIKAGK  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             F+V+CN EGF LS+AT G+SPQ SF +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  265   FTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWDWYKAIEKW  320



>ref|XP_011090801.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Sesamum 
indicum]
Length=329

 Score =   377 bits (967),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV+VPI NRHVFITGGSSGIGLALA     EGA V+ILAR+  KLE+AK +I  A
Sbjct  23    IVRPRPVRVPIKNRHVFITGGSSGIGLALAHLCAREGANVTILARDVRKLEEAKQSIKLA  82

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDY AV+R ++EAG IDVL+CNHGV+ ++ELE QE+EE+K MIDVNL 
Sbjct  83    TGREVGVFSADVRDYGAVERVIQEAGAIDVLICNHGVFIAQELEGQELEEIKFMIDVNLM  142

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+FHLIKAALPGM    A RGPGSIAIMSSQAGQVGIYG+TAYSASKFGL+G+ EALQ E
Sbjct  143   GSFHLIKAALPGMKKSRAERGPGSIAIMSSQAGQVGIYGFTAYSASKFGLKGLGEALQHE  202

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +IA NIHVSLIFPP T TP   +E KR PQ+T  IA SS A MKA++VA KSLNGI+ G+
Sbjct  203   IIADNIHVSLIFPPETETPGFLRESKRSPQLTRTIAASSRA-MKADDVAMKSLNGIQSGA  261

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             F + CN EGF LSIATAG+SPQ S++MAFVE   AGI+R+  LCFQ NWY  I+K
Sbjct  262   FIIPCNFEGFLLSIATAGVSPQRSYMMAFVEVMTAGIIRLTTLCFQWNWYRSIEK  316



>ref|XP_010486091.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Camelina 
sativa]
Length=342

 Score =   377 bits (967),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 239/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+AGKLE+AK +I  AT
Sbjct  44    VRPRPIKIPIKSRHVFITGGSSGIGLALAQRAASEGARVSILARSAGKLEEAKKSIQLAT  103

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +A++E+GPIDVLV N GV+ + EL +   E+VK  IDVNL G
Sbjct  104   GVEVATFSADVRDYDAVSKAIDESGPIDVLVVNQGVFTATELVEHSPEDVKFTIDVNLVG  163

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  +RGP SI ++SSQAGQVGIYGYTAYSASKFGL+G+A+ALQQEV
Sbjct  164   SFNVIKAALPAMKAR-KDRGPASITLVSSQAGQVGIYGYTAYSASKFGLQGLAQALQQEV  222

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA +IHV+LIFPP T TP   +E K RP++TS IA SSG+ MK EEVA+K+++GIK G+F
Sbjct  223   IADDIHVTLIFPPDTDTPGFEEEQKSRPEVTSIIAASSGS-MKTEEVARKAMDGIKAGNF  281

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ S  +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  282   TVSCNFEGFLLSLATTGMSPQRSCWLAFLEVITAGPIRLVALFFQWDWYKAIEKW  336



>gb|KHG07464.1| 3-ketodihydrosphingosine reductase [Gossypium arboreum]
Length=370

 Score =   378 bits (970),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 240/297 (81%), Gaps = 2/297 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV +PI NRHVFITGGSSGIGLALA QA ++GA+VS+LAR+  KL++AK +I R+
Sbjct  19    IVRPRPVTIPIKNRHVFITGGSSGIGLALAQQAASQGARVSLLARSLNKLQEAKESIRRS  78

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             +G  V  FSADVRD+DAV++AV +AGPIDVLV N GV+  +ELE Q ++E+K MIDVNL 
Sbjct  79    SGLDVAIFSADVRDHDAVQKAVNDAGPIDVLVVNQGVFVPQELEKQGLDEIKFMIDVNLM  138

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  R  +R P SI+++SSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  139   GSFNVIKAALPLMKER-KDRLPASISLISSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  197

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA NIHVS+++PP T TP   +E + RP++T  +A SSG+ MKA+EVAKK+L+GIK GS
Sbjct  198   VIADNIHVSVVYPPDTDTPGFEKENEVRPELTKLLAGSSGS-MKADEVAKKALDGIKSGS  256

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             F+V CN EG  L+IATAGLSPQ SFLMAF+E    G++R+  L FQ NWY  I+ WH
Sbjct  257   FTVPCNFEGHMLAIATAGLSPQRSFLMAFIEVASVGVLRLVGLFFQWNWYQTIENWH  313



>ref|XP_008801390.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Phoenix dactylifera]
Length=327

 Score =   376 bits (965),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 238/302 (79%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRPV++P+  RHVFITGGSSGIGLA+A +A AEGA+VSILARNA +L++A+ AI  A
Sbjct  25    LVRPRPVRIPVKGRHVFITGGSSGIGLAIARRAAAEGARVSILARNAARLKEARDAIRLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRD +AV R VE AGPID+LVCNHGV+  +ELE Q++EEV+ M+DVNL 
Sbjct  85    TGVDVALFSADVRDAEAVAREVEAAGPIDLLVCNHGVFTPQELEHQDLEEVRFMVDVNLM  144

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             GTF+LIKAALP M  R    G P SI+IMSSQAGQVG+YGYTAYSASKF LRG+ EALQ 
Sbjct  145   GTFNLIKAALPAMKQRARATGLPASISIMSSQAGQVGVYGYTAYSASKFALRGLGEALQH  204

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIA NIHVSLIFPP T TP  A+E KRRP++T+ IA SSG  MKA++VA+K+L GIK G
Sbjct  205   EVIADNIHVSLIFPPDTETPGFAEEHKRRPELTNIIAGSSGG-MKADDVAQKALGGIKTG  263

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
             +F V CN EG  LSIATAGLSPQ S+LMAFVE   AG MR   LCFQ NW++ I+ WH  
Sbjct  264   TFIVPCNFEGTMLSIATAGLSPQRSYLMAFVEVFGAGFMRFMGLCFQWNWFSTIENWHAK  323

Query  392   NK  387
              K
Sbjct  324   KK  325



>ref|XP_010551765.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Tarenaya 
hassleriana]
 ref|XP_010551766.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Tarenaya 
hassleriana]
Length=324

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 236/295 (80%), Gaps = 2/295 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPRPV++PI +RHVFITGGSSGIG ALA +A AEGA+VSILAR+  KLE+AK +I  ATG
Sbjct  27    RPRPVRIPIKSRHVFITGGSSGIGRALAGRAAAEGARVSILARSPDKLEEAKRSIQLATG  86

Query  1103  CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
                  F+ADVRDYDAV +AV E+GPIDVLV N GV+ ++ELE Q ++EVK MIDVNL G+
Sbjct  87    VEAATFAADVRDYDAVSKAVRESGPIDVLVVNQGVFVAEELEKQSLDEVKFMIDVNLLGS  146

Query  923   FHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVI  744
             F++IKAALP M +R   RGP SIA+MSSQAGQVGIYGYTAYSASKFGL+G+A+ALQQEVI
Sbjct  147   FNVIKAALPSMKAR-EGRGPASIALMSSQAGQVGIYGYTAYSASKFGLQGLAQALQQEVI  205

Query  743   AHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFS  564
             A NIHVSL+FPP T TP   +E K RPQ+T+ IA SSGA M+ EEVAK +L GIK G FS
Sbjct  206   ADNIHVSLVFPPDTETPGFEEEQKTRPQLTNIIAASSGA-MRPEEVAKITLEGIKAGKFS  264

Query  563   VACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             V+CN EGF LS ATAGLSPQ SF  AF E   AG++R+AAL FQ +WY  I+KW+
Sbjct  265   VSCNFEGFLLSTATAGLSPQRSFFTAFFEVMTAGLIRLAALFFQWDWYRAIEKWN  319



>emb|CDY05227.1| BnaC05g45760D [Brassica napus]
Length=324

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 239/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRP+P+++PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+  KLE+AK +I  AT
Sbjct  26    VRPKPIRIPIKSRHVFITGGSSGIGLALAHRAASEGARVSILARSPQKLEEAKQSIKLAT  85

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV RAV+E+GPIDVL+ N GV+ ++ELE   VE+VK  I+VNL G
Sbjct  86    GVEVAIFSADVRDYDAVSRAVDESGPIDVLIVNQGVFTARELERHSVEDVKFTIEVNLVG  145

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALPGM  R   RGPGSI+++SSQAGQVG+YGY AYSASKFGL+G+A++LQQEV
Sbjct  146   SFNVIKAALPGMKGR-EGRGPGSISLVSSQAGQVGVYGYAAYSASKFGLQGLAQSLQQEV  204

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             +A +IHV+L+FPP T TP   +E K RP++T+ IA SSG+ MK EEVA++++NGIK G F
Sbjct  205   VADDIHVTLVFPPDTDTPGFEEEQKSRPEVTAIIAASSGS-MKTEEVARRAMNGIKAGKF  263

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ SF +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  264   TVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLVALFFQWDWYNAIEKW  318



>ref|NP_001047846.1| Os02g0701900 [Oryza sativa Japonica Group]
 dbj|BAD07547.1| putative short-chain dehydrogenase/reductase [Oryza sativa Japonica 
Group]
 dbj|BAF09760.1| Os02g0701900 [Oryza sativa Japonica Group]
 gb|EAY87194.1| hypothetical protein OsI_08597 [Oryza sativa Indica Group]
 gb|EAZ24308.1| hypothetical protein OsJ_08059 [Oryza sativa Japonica Group]
 dbj|BAG87519.1| unnamed protein product [Oryza sativa Japonica Group]
Length=327

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 234/301 (78%), Gaps = 2/301 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPR  ++P+  RHV ITGGSSGIGLA+A  A  EGA+VSILARNA +LE+A+ AI  ATG
Sbjct  26    RPRAARIPLKGRHVLITGGSSGIGLAMATAAAREGARVSILARNAARLEEARGAIRAATG  85

Query  1103  CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
               V   +ADVRD DAV RA+ EAGP+DVLVCNHGV+  +ELE QE+EEVK M+D+NL GT
Sbjct  86    RDVGVHAADVRDADAVARALAEAGPVDVLVCNHGVFVPQELEKQEMEEVKWMVDINLMGT  145

Query  923   FHLIKAALPGMISRPA-NRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             FHL+KAALP M  R    R P SIAIMSSQAGQVG+YGYTAYSASKF LRG+ EALQ EV
Sbjct  146   FHLVKAALPAMKERTKETRLPASIAIMSSQAGQVGVYGYTAYSASKFALRGLGEALQHEV  205

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA NIHVSLIFPP T TP  A+E KRRP++T+ IA SSG  MKA++VA+K+L+GIK G F
Sbjct  206   IADNIHVSLIFPPDTETPGFAEENKRRPELTNIIAGSSGG-MKADDVARKALDGIKSGKF  264

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
              V CN EG  L++ATAGLSPQ+S L AF+E   AG+MR AA+CFQ NW+  I+ W+  NK
Sbjct  265   IVPCNFEGAMLAVATAGLSPQSSPLTAFLEIIGAGVMRFAAICFQFNWFMTIENWYAKNK  324

Query  386   Q  384
             +
Sbjct  325   K  325



>ref|XP_010435576.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A isoform X1 [Camelina 
sativa]
 ref|XP_010435653.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A isoform X2 [Camelina 
sativa]
Length=345

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 237/295 (80%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+A KLE+AK +I  AT
Sbjct  47    VRPRPIKIPIKSRHVFITGGSSGIGLALAQRAASEGARVSILARSAVKLEEAKKSIQLAT  106

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +A++E+GPIDVLV N GV+ + EL     E+VK  IDVNL G
Sbjct  107   GVEVATFSADVRDYDAVSKAIDESGPIDVLVVNQGVFTATELVKHSPEDVKFTIDVNLVG  166

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  +RGP SI ++SSQAGQVGIYGYTAYSASKFGL+G+A+ALQQEV
Sbjct  167   SFNVIKAALPAMKAR-KDRGPASITLVSSQAGQVGIYGYTAYSASKFGLQGLAQALQQEV  225

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA +IHV+LIFPP T TP   +E K RP++TS IA SSG+ MK EEVA+K+++GIK G+F
Sbjct  226   IADDIHVTLIFPPDTDTPGFEEEQKSRPEVTSIIAASSGS-MKTEEVARKAMDGIKSGNF  284

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ S  +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  285   TVSCNFEGFLLSLATTGMSPQRSCWLAFLEVITAGPIRLVALFFQWDWYKAIEKW  339



>ref|XP_009382630.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 201/302 (67%), Positives = 233/302 (77%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRPV+VPI  RHVFITGGSSGIGLALA  A AEGA VSILAR A +L++A+ AI  A
Sbjct  78    LVRPRPVRVPIKGRHVFITGGSSGIGLALARLAAAEGAHVSILARRAAQLQEARDAIRLA  137

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRD DAV +AVE AGP+DVLVCNHGV+  +ELE Q++EEV+ M++VNL 
Sbjct  138   TGVDVAIFSADVRDADAVAKAVEAAGPVDVLVCNHGVFTPQELEKQDLEEVRFMVEVNLM  197

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             GTF+LIKAALP M  R    G P SIAIMSSQAGQVG+YGYTAYSASKF LRG+AEALQ 
Sbjct  198   GTFNLIKAALPTMKQRTKVTGLPASIAIMSSQAGQVGVYGYTAYSASKFALRGLAEALQH  257

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIA +IHVS+IFPP T TP  A+E +RRP +T+ IA SSG  MKA++VAKK+L+GIK  
Sbjct  258   EVIADDIHVSMIFPPDTETPGFAEEHRRRPDLTNIIAGSSGG-MKADDVAKKALDGIKSS  316

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
              F V CN EG  LSIATAGLSPQ+SFL A  E   AG MR   LCFQ NW++ I+ WH  
Sbjct  317   RFIVPCNFEGTMLSIATAGLSPQSSFLTALAEVLGAGFMRFMGLCFQWNWFSSIENWHSK  376

Query  392   NK  387
              K
Sbjct  377   KK  378



>ref|XP_010464172.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Camelina 
sativa]
Length=345

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 237/295 (80%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+A KLE+AK +I  AT
Sbjct  47    VRPRPIKIPIKSRHVFITGGSSGIGLALAQRAASEGARVSILARSAVKLEEAKKSIQLAT  106

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +A++E+GPIDVLV N GV+ + EL     E+VK  IDVNL G
Sbjct  107   GVEVATFSADVRDYDAVSKAIDESGPIDVLVVNQGVFTATELVKHSPEDVKFTIDVNLVG  166

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  +RGP SI ++SSQAGQVGIYGYTAYSASKFGL+G+A+ALQQEV
Sbjct  167   SFNVIKAALPAMKAR-KDRGPASITLVSSQAGQVGIYGYTAYSASKFGLQGLAQALQQEV  225

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA +IHV+LIFPP T TP   +E K RP++TS IA SSG+ MK EEVA+K+++GIK G+F
Sbjct  226   IADDIHVTLIFPPDTDTPGFEEEQKSRPEVTSIIAASSGS-MKTEEVARKAMDGIKSGNF  284

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ S  +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  285   TVSCNFEGFLLSLATTGMSPQRSCWLAFLEVITAGPIRLVALFFQWDWYKAIEKW  339



>ref|XP_009129637.1| PREDICTED: 3-ketodihydrosphingosine reductase [Brassica rapa]
Length=323

 Score =   371 bits (952),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRP+P+++PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+  KLE+AK +I  AT
Sbjct  25    VRPKPIRIPIKSRHVFITGGSSGIGLALAHRAASEGARVSILARSPQKLEEAKQSIKLAT  84

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +AVEE+GPIDVL+ N GV+ ++ELE   VE+V+  I+VNL G
Sbjct  85    GVEVAIFSADVRDYDAVSKAVEESGPIDVLIVNQGVFTARELEKHSVEDVRFTIEVNLVG  144

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M  R   RGPGSI+++SSQAGQVG+YGY AYSASKFGL+G+A++LQQEV
Sbjct  145   SFNVIKAALPRMKGR-EGRGPGSISLVSSQAGQVGVYGYAAYSASKFGLQGLAQSLQQEV  203

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             +A +IHV+L+FPP T TP   +E K RP++T+ IA SSG+ MK EEVA++++NGIK G F
Sbjct  204   VADDIHVTLVFPPDTDTPGFEEEQKSRPEVTAIIAASSGS-MKTEEVARRAMNGIKAGKF  262

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ SF +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  263   TVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLVALFFQWDWYNAIEKW  317



>gb|AAF66134.1| unknown protein; 15741-13972 [Arabidopsis thaliana]
 gb|AAO24564.1| At3g06060 [Arabidopsis thaliana]
Length=327

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI +RH FITGGSSGIGLALA +A +EGA+VSILAR+  KLE+AK +I  AT
Sbjct  28    VRPRPIKIPIKSRHAFITGGSSGIGLALAHRAASEGARVSILARSGSKLEEAKKSIQLAT  87

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +A++E+GPIDVL+ N GV+ +KEL     E+VK  IDVNL G
Sbjct  88    GVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFTAKELVKHSPEDVKFTIDVNLVG  147

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  +RGP SI+++SSQAGQVG+YGY AYSASKFGL+G+A+ALQQEV
Sbjct  148   SFNVIKAALPAMKAR-KDRGPASISLVSSQAGQVGVYGYAAYSASKFGLQGLAQALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             I+ +IHV+LIFPP T+TP   +E K RP++T+ IA SSG+ M+ EEVAKK+++GIK G+F
Sbjct  207   ISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAIIAASSGS-METEEVAKKAMDGIKAGNF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ SF +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  266   TVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWDWYKAIEKW  320



>ref|NP_187257.2| 3-ketodihydrosphinganine reductase-like protein [Arabidopsis 
thaliana]
 sp|Q0WRJ2.1|TC10A_ARATH RecName: Full=3-dehydrosphinganine reductase TSC10A; AltName: 
Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; 
AltName: Full=3-ketosphinganine reductase [Arabidopsis thaliana]
 dbj|BAF00257.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74338.1| 3-ketodihydrosphinganine reductase-like protein [Arabidopsis 
thaliana]
Length=326

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI +RH FITGGSSGIGLALA +A +EGA+VSILAR+  KLE+AK +I  AT
Sbjct  28    VRPRPIKIPIKSRHAFITGGSSGIGLALAHRAASEGARVSILARSGSKLEEAKKSIQLAT  87

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +A++E+GPIDVL+ N GV+ +KEL     E+VK  IDVNL G
Sbjct  88    GVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFTAKELVKHSPEDVKFTIDVNLVG  147

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  +RGP SI+++SSQAGQVG+YGY AYSASKFGL+G+A+ALQQEV
Sbjct  148   SFNVIKAALPAMKAR-KDRGPASISLVSSQAGQVGVYGYAAYSASKFGLQGLAQALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             I+ +IHV+LIFPP T+TP   +E K RP++T+ IA SSG+ M+ EEVAKK+++GIK G+F
Sbjct  207   ISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAIIAASSGS-METEEVAKKAMDGIKAGNF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ SF +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  266   TVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWDWYKAIEKW  320



>emb|CDY27713.1| BnaA05g31220D [Brassica napus]
Length=323

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRP+P+++PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+  KLE+AK +I  AT
Sbjct  25    VRPKPIRIPIKSRHVFITGGSSGIGLALAHRAASEGARVSILARSPQKLEEAKRSIKLAT  84

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +AVEE+GPIDVL+ N GV+ ++ELE   VE+V+  I+VNL G
Sbjct  85    GVEVAIFSADVRDYDAVSKAVEESGPIDVLIVNQGVFTARELEKHSVEDVRFTIEVNLVG  144

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M  R   RGPGSI+++SSQAGQVG+YGY AYSASKFGL+G+A++LQQEV
Sbjct  145   SFNVIKAALPRMKGR-EGRGPGSISLVSSQAGQVGVYGYAAYSASKFGLQGLAQSLQQEV  203

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             +A +IHV+L+FPP T TP   +E K RP++T+ IA SSG+ MK EEVA+++++GIK G F
Sbjct  204   VADDIHVTLVFPPDTDTPGFEEEQKSRPEVTAIIAASSGS-MKTEEVARRAMDGIKAGKF  262

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ SF +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  263   TVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLVALFFQWDWYNAIEKW  317



>gb|KFK38042.1| hypothetical protein AALP_AA3G062700 [Arabis alpina]
Length=327

 Score =   369 bits (947),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 237/296 (80%), Gaps = 2/296 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+P+K+PI +RHVFITGGSSGIGLALA +A +EGA+VSILAR+A KL++AK  I  A
Sbjct  27    IVRPKPIKIPIKSRHVFITGGSSGIGLALAQRAASEGARVSILARSATKLDEAKQTIKLA  86

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  +SADVRDY+ V +A++E+GPIDVL+ N GV+ +KEL +   E+VK  IDVNL 
Sbjct  87    TGVEVATYSADVRDYNDVSKAIDESGPIDVLIVNQGVFIAKELVNHSPEDVKFTIDVNLV  146

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M +R  +RGP SI+++SSQAGQVGIYGY AYSASKFGL+G+A++LQQE
Sbjct  147   GSFNVIKAALPAMKAR-RDRGPASISLVSSQAGQVGIYGYAAYSASKFGLQGLAQSLQQE  205

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA +IHV+L+FPP T TP   +E K RP++T+ IA SSG+ MK EEVAKK+++GIK G 
Sbjct  206   VIADDIHVTLVFPPDTDTPGFEEEQKSRPEVTAIIAASSGS-MKTEEVAKKAMDGIKAGK  264

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             F+V+CN EGF LS+AT G+SPQ SF +AFVE   AG +R  AL FQ +WY  I+KW
Sbjct  265   FTVSCNFEGFLLSLATTGMSPQRSFWLAFVEVITAGPIRFTALFFQWDWYNAIEKW  320



>ref|NP_197421.1| 3-ketodihydrosphinganine reductase-like protein [Arabidopsis 
thaliana]
 sp|F4JZN6.1|TC10B_ARATH RecName: Full=3-dehydrosphinganine reductase TSC10B; AltName: 
Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; 
AltName: Full=3-ketosphinganine reductase [Arabidopsis thaliana]
 gb|AED92669.1| 3-ketodihydrosphinganine reductase-like protein [Arabidopsis 
thaliana]
Length=331

 Score =   369 bits (946),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 233/302 (77%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR V +PI  RHVFITGGSSGIGLALA +AV+EGAKVSILAR+  KL +AK +I  A
Sbjct  25    IVRPRSVTIPIKFRHVFITGGSSGIGLALAHRAVSEGAKVSILARSTEKLAEAKRSIQLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDYDAV +A++E+GPIDVL+ N GV+  KELE Q  EEVK MIDVNLT
Sbjct  85    TGVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFIGKELEKQSPEEVKFMIDVNLT  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M +R   RGP SI+++SSQAGQ GIYGYTAYSASKFGL+G+A+ALQQE
Sbjct  145   GSFNVIKAALPAMKARE-GRGPASISLVSSQAGQAGIYGYTAYSASKFGLQGLAQALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI+  IHV+L+FPP T TP   QE+K+RP++TS IA SSG+ MK  EVAK   +GIK G 
Sbjct  204   VISDGIHVTLLFPPDTDTPGFEQELKKRPELTSIIAASSGS-MKTNEVAKICFDGIKAGK  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F+V C+  GF LSIA+ G+SPQ SF +A  E    G++R+A+L FQ  WY  I+KW   N
Sbjct  263   FTVTCHFIGFLLSIASTGMSPQGSFWLALTEVMFGGLIRLASLVFQWQWYKTIEKWSQRN  322

Query  389   KQ  384
             K+
Sbjct  323   KK  324



>ref|XP_006298131.1| hypothetical protein CARUB_v10014175mg [Capsella rubella]
 gb|EOA31029.1| hypothetical protein CARUB_v10014175mg [Capsella rubella]
Length=326

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 236/295 (80%), Gaps = 2/295 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRP+K+PI +RHVF+TGGSSGIGLALA +A +EGA+VSILAR+A KLE+AK  I  AT
Sbjct  28    VRPRPIKIPIKSRHVFVTGGSSGIGLALAQRAASEGARVSILARSAEKLEEAKKLIQLAT  87

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V  FSADVRDYDAV +A++E+GPIDVLV N GV+ +KEL +   E+VK  IDVNL G
Sbjct  88    GVEVATFSADVRDYDAVSKAIDESGPIDVLVVNQGVFVAKELVNHSPEDVKFTIDVNLVG  147

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M +R  +RGP SI+++SSQAGQVGIYGY AYSA+KFGL+G+A+ALQQEV
Sbjct  148   SFNVIKAALPAMKAR-KDRGPASISLVSSQAGQVGIYGYAAYSATKFGLQGLAQALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA ++HV+LIFPP T TP   +E K RP++T+ IA SSG+ MK EEVA+K++ GIK G F
Sbjct  207   IADDVHVTLIFPPDTDTPGFEEEQKSRPEVTAIIAASSGS-MKTEEVARKAMEGIKAGKF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             +V+CN EGF LS+AT G+SPQ S  +AF+E   AG +R+ AL FQ +WY  I+KW
Sbjct  266   TVSCNFEGFLLSLATTGMSPQRSCWLAFLEVITAGPIRLVALFFQWDWYKAIEKW  320



>gb|AFW63520.1| hypothetical protein ZEAMMB73_346365 [Zea mays]
Length=326

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 236/303 (78%), Gaps = 3/303 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
              RPR  +VP+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LEDA+ AI R +
Sbjct  23    TRPRAARVPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEDARAAIQRDS  82

Query  1106  G-CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             G   V   +ADVRD  AV RA++EAGP+DVLVCNHGV+  +ELE Q+V+E+K M+D+NL 
Sbjct  83    GRDDVGVHAADVRDAGAVARALQEAGPVDVLVCNHGVFVPQELEGQDVDEIKWMVDINLM  142

Query  929   GTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             G+FHLIKAALP M +R    R PGSIAIMSSQAGQVGIYGYTAYSASKF LRG+ EALQ 
Sbjct  143   GSFHLIKAALPAMKARTRETRLPGSIAIMSSQAGQVGIYGYTAYSASKFALRGLGEALQH  202

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIA NIHVSLIFPP T TP L +E KRRP++T+ IA SSG  MKA++VAKK+L+GIK  
Sbjct  203   EVIADNIHVSLIFPPDTETPGLEEEHKRRPELTNIIAGSSGG-MKADDVAKKALDGIKSA  261

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
              F V CN EG  L++ATAGLSPQ+S LMAF+E   AG+MR AA+CFQ NW++ I+ ++  
Sbjct  262   KFIVPCNFEGAMLAVATAGLSPQSSPLMAFLEVVGAGLMRFAAICFQWNWFSTIESYYAK  321

Query  392   NKQ  384
              K+
Sbjct  322   KKK  324



>ref|XP_004486137.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Cicer arietinum]
Length=327

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 242/301 (80%), Gaps = 2/301 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVK+PI+NRHVFITGGSSGIGLALA +A A+GA+VSI+AR+  KLE+A+ A+  A
Sbjct  23    IVRPRPVKIPITNRHVFITGGSSGIGLALAHRAAADGARVSIMARSMKKLEEARDAVKHA  82

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  ++ADVRDYDAVK+AV+EAGPIDVL+ NHGV+ + ELE  E+ EVK  +DVNL 
Sbjct  83    TGIEVAIYAADVRDYDAVKKAVDEAGPIDVLLLNHGVFYALELEKMELSEVKFTLDVNLM  142

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G  ++IKA LP M +R  +  P SIA++SSQAGQVGIYGY AYSASKFGLRG+AEALQQE
Sbjct  143   GCLNMIKAVLPDMKNR-KDPLPASIALVSSQAGQVGIYGYVAYSASKFGLRGLAEALQQE  201

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP L +E KR+P+IT  IA SSG FMK +EVA+K+L+GI+ G 
Sbjct  202   VIEDNIHVSLIFPPDTDTPGLVEENKRKPEITKIIADSSG-FMKPDEVAQKALDGIRHGR  260

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F + CNLEG  L++ATAGLSPQ SFLMAFVE   AGI+RIAALCFQ NWY  I+KWH   
Sbjct  261   FIIYCNLEGLALALATAGLSPQRSFLMAFVEVVTAGILRIAALCFQWNWYGSIEKWHKER  320

Query  389   K  387
             K
Sbjct  321   K  321



>ref|XP_002871871.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48130.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=330

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 232/302 (77%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR VK+PI +RHVFITGGSSGIGLALA  AV+EGAKVSILAR+   L +AK +I  A
Sbjct  25    IVRPRSVKIPIKSRHVFITGGSSGIGLALAHSAVSEGAKVSILARSTENLAEAKRSIQLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDYDAV +AV+E+GPIDVL+ N GV+  KELE Q  EEVK MIDVNL 
Sbjct  85    TGVEVATFSADVRDYDAVSKAVDESGPIDVLIVNQGVFIGKELEKQSPEEVKFMIDVNLV  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M +R   RGP SI+++SSQAGQ GIYGYTAYSASKFGL+G+A+ALQQE
Sbjct  145   GSFNVIKAALPAMKARE-GRGPASISLVSSQAGQAGIYGYTAYSASKFGLQGLAQALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI+ +IHV+L+FPP T TP   +E+K+RP++TS IA SSG+ MK  EVAK   +GIK G 
Sbjct  204   VISDDIHVTLLFPPDTDTPGFEEELKKRPELTSIIAASSGS-MKTNEVAKICFDGIKAGK  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F+V C+  GF LSIA+ G+SPQ SF +A +E    G++R+ +L FQ  WY  I+KW    
Sbjct  263   FTVTCHFIGFLLSIASTGMSPQGSFWLALIEVMFGGLIRLVSLVFQWQWYKTIEKWSKKK  322

Query  389   KQ  384
             KQ
Sbjct  323   KQ  324



>ref|XP_009386547.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/302 (66%), Positives = 238/302 (79%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV++P+  RHV +TGGSSGIGLALAL+A AEGA+V+ILAR+  +L+DA+ AIL A
Sbjct  57    IVRPRPVRIPLKGRHVLVTGGSSGIGLALALRAAAEGARVTILARDPSRLQDARDAILLA  116

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  VT  +ADVRD +AV RA+E A P+DVLVC+HGV+  +ELE Q +EEV+ M++VNL 
Sbjct  117   TGVDVTILAADVRDPEAVCRALEAADPVDVLVCSHGVFLPQELERQSLEEVRFMVEVNLM  176

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             GTFHLIKA+LP M  R    G P SIAI+SSQAGQVGIYGYTAYSASKFGLRG+AEALQ 
Sbjct  177   GTFHLIKASLPTMKQRAKESGLPASIAIVSSQAGQVGIYGYTAYSASKFGLRGLAEALQH  236

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIA NIH++L+FPP T TP LA+E KRRP+IT  IA S G  MKA++VAKK+LNGIK G
Sbjct  237   EVIADNIHITLVFPPDTDTPGLAEEHKRRPEITKVIAGSQGG-MKADDVAKKALNGIKSG  295

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
              F VACN EG+ L +AT GLSPQ S+ MAFVE    G MR  ALC+Q +W+T I+KWH  
Sbjct  296   QFVVACNFEGYLLHVATVGLSPQRSYFMAFVEILGVGFMRFVALCYQWSWFTSIEKWHAK  355

Query  392   NK  387
              K
Sbjct  356   MK  357



>gb|ABK22103.1| unknown [Picea sitchensis]
Length=324

 Score =   364 bits (935),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 235/302 (78%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IV+PRPVKVPI  RHVFI+GGSSGIGLALA  A  EGA+VSILARNA +LE+AK ++  +
Sbjct  25    IVQPRPVKVPIKGRHVFISGGSSGIGLALAHMAAQEGARVSILARNASRLEEAKESVESS  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  +  +SADVR+++ VK+ ++EAGP+DVL+CN GV+  +E E Q V+ ++ M+D+NL 
Sbjct  85    TGQEIKIYSADVRNFEEVKKVMDEAGPVDVLICNQGVFTPQEFELQSVDTMRSMVDINLM  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             GT HLIKAALP M  R  N  P SIA+MSSQAGQVG+YGYTAYS+SKF LRG+AEALQQE
Sbjct  145   GTIHLIKAALPYM-KRRRNGPPASIALMSSQAGQVGVYGYTAYSSSKFALRGLAEALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +I HNI VSLIFPP T+TP L +E K +P++T  IA SS + M+A EVA+K+LNGIK G 
Sbjct  204   LIVHNIRVSLIFPPDTNTPGLVEENKMKPEVTKLIAASSSS-MEATEVAEKTLNGIKSGK  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F + CN +GF LSIATAG+SPQTS +MAFVE   AGI+RI ALC   +WY+ + KWH   
Sbjct  263   FIITCNFDGFMLSIATAGMSPQTSPIMAFVEVIAAGIVRIVALCLLWSWYSTVHKWHNHQ  322

Query  389   KQ  384
             K+
Sbjct  323   KK  324



>gb|AGT16735.1| 3-ketodihydrosphingosine reductase precursor [Saccharum hybrid 
cultivar R570]
Length=326

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 234/302 (77%), Gaps = 3/302 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPR  ++P+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LE+A+ AI R +G
Sbjct  24    RPRAARIPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEEARAAIQRDSG  83

Query  1103  -CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
                V   +ADVRD DAV RA+ EAGP+DVLVCNHGV+  +ELE Q+++E+K M+D+NL G
Sbjct  84    RDDVGVHAADVRDADAVARALREAGPVDVLVCNHGVFVPQELERQDMDEIKWMVDINLMG  143

Query  926   TFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             TFHLIKAALP M +R    R PGS+AIMSSQAGQVGIYGYTAYSASKF LRG+ EALQ E
Sbjct  144   TFHLIKAALPAMKARTRETRLPGSVAIMSSQAGQVGIYGYTAYSASKFALRGLGEALQHE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             V+A NIHVSLIFPP T TP   +E KRRP++T+ +A SSG  MKA++VA K+L+GIK   
Sbjct  204   VVADNIHVSLIFPPDTETPGFEEEHKRRPELTNIMAGSSGG-MKADDVANKALDGIKSAK  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  L++ATAGLSPQ+S LMAF+E   AG+MR  ALCFQ NW++ I+ ++  N
Sbjct  263   FIVPCNFEGTMLAVATAGLSPQSSPLMAFIEVIGAGLMRFVALCFQWNWFSTIESYYAKN  322

Query  389   KQ  384
             K+
Sbjct  323   KK  324



>ref|XP_002454428.1| hypothetical protein SORBIDRAFT_04g030750 [Sorghum bicolor]
 gb|EES07404.1| hypothetical protein SORBIDRAFT_04g030750 [Sorghum bicolor]
Length=326

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 234/302 (77%), Gaps = 3/302 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPR  ++P+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LE+A+ AI R +G
Sbjct  24    RPRAARIPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEEARAAIQRDSG  83

Query  1103  -CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
                V   +ADVRD  AV RA+ EAGP+DVLVCNHGV+  +ELE Q+++E+K M+D+NL G
Sbjct  84    RDDVGVHAADVRDAGAVARALREAGPVDVLVCNHGVFVPQELERQDIDEIKWMVDINLMG  143

Query  926   TFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             TFHLIKAALP M +R    R PGS+AIMSSQAGQVGIYGYTAYSASKF LRG+ EALQ E
Sbjct  144   TFHLIKAALPAMKARTRETRLPGSVAIMSSQAGQVGIYGYTAYSASKFALRGLGEALQHE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             V+A NIHVSLIFPP T TP   +E KRRP++T+ +A SSG  MKA++VA K+L+GIK   
Sbjct  204   VVADNIHVSLIFPPDTETPGFEEEHKRRPELTNILAGSSGG-MKADDVANKALDGIKSAK  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  L++ATAGLSPQ+S L+AF+E   AG+MR AALCFQ NW++ I+ ++  N
Sbjct  263   FIVPCNFEGAMLAVATAGLSPQSSPLLAFIEVIGAGLMRFAALCFQWNWFSTIESYYAKN  322

Query  389   KQ  384
             K+
Sbjct  323   KK  324



>ref|XP_006288201.1| hypothetical protein CARUB_v10001439mg [Capsella rubella]
 gb|EOA21099.1| hypothetical protein CARUB_v10001439mg [Capsella rubella]
Length=327

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 234/301 (78%), Gaps = 2/301 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR VK+PI +RHVFITGGSSGIGLALA +AVAEGA+VSILAR+  KL++A+ +I  A
Sbjct  25    IVRPRSVKIPIKSRHVFITGGSSGIGLALAHRAVAEGARVSILARSTEKLDEARRSIQLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             T  GV  FSADVRD+DAV +AV+E+GPIDVL+ N GV+  KELE Q  EEVK MIDVNL 
Sbjct  85    TCVGVATFSADVRDFDAVSKAVDESGPIDVLIVNQGVFIGKELEKQSHEEVKFMIDVNLV  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++I AALP M +R   RGP SI+++SSQAGQ GIYGYTAYSASKFGL+G+A+ALQQE
Sbjct  145   GSFNVIMAALPAMKARE-GRGPASISLVSSQAGQAGIYGYTAYSASKFGLQGLAQALQQE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI+ +IHV+L+FPP T TP   +E K+RP++TS IA SSG+ MK +EVAK  L+GIK G 
Sbjct  204   VISDDIHVTLLFPPDTDTPGYEEEQKKRPELTSIIAASSGS-MKTKEVAKICLDGIKAGK  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F+V C+  GF LSIA+AG+SPQ SF +AF+E    G+ R+ +L  Q  WY  I+KW    
Sbjct  263   FTVTCHYIGFLLSIASAGMSPQGSFWVAFIEVMFGGLTRLVSLVVQSQWYKTIEKWSTTK  322

Query  389   K  387
             K
Sbjct  323   K  323



>ref|XP_007205452.1| hypothetical protein PRUPE_ppa007873mg [Prunus persica]
 gb|EMJ06651.1| hypothetical protein PRUPE_ppa007873mg [Prunus persica]
Length=353

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 194/276 (70%), Positives = 225/276 (82%), Gaps = 3/276 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
             VRPRPVK+PI NRHVFITGGSSGIGLALA QA +EGA+VSILAR+  KLE+AK  I  +T
Sbjct  29    VRPRPVKIPIKNRHVFITGGSSGIGLALAHQAASEGARVSILARSIDKLEEAKKYIQLST  88

Query  1106  GCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
             G  V+ FSADVRDYDAV +AVEEA PIDVL+ N GV+   ELE Q ++EVK M+DVNL G
Sbjct  89    GIDVSIFSADVRDYDAVSKAVEEADPIDVLIVNQGVFVPDELEKQGLDEVKFMVDVNLIG  148

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +F++IKAALP M  +  +  P SIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQEV
Sbjct  149   SFNMIKAALPKM--KKGDSIPRSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQEV  206

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             I+H+IHVSLIFPP T TP L +EMK+RPQ++S IA SSG  MKAEEVAKK+  GIK  +F
Sbjct  207   ISHDIHVSLIFPPDTDTPGLTEEMKKRPQLSSIIAESSG-MMKAEEVAKKAFEGIKSAAF  265

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGI  459
              V CNLEG  LSIATAG+SPQ SF+MAFVE   AG+
Sbjct  266   IVPCNLEGALLSIATAGMSPQRSFVMAFVEVVAAGL  301



>ref|XP_008776395.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X2 
[Phoenix dactylifera]
Length=328

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 235/298 (79%), Gaps = 2/298 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR V++PI  RHV ITGGSSGIGLAL  +A AEGA++SILARN  +L++A+ AI  A
Sbjct  26    IVRPRRVRIPIKGRHVLITGGSSGIGLALTRRAAAEGARISILARNPTRLQEARDAIRLA  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG      +ADVRD  AV RA+EEAGP++VLVCN GV+  +ELE QE+EEV+ M++VNL 
Sbjct  86    TGVDAAVLAADVRDPAAVARALEEAGPVEVLVCNQGVFVPQELEVQELEEVRFMVEVNLM  145

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             G+FHLIKAALPGM +R    G P SIA+MSSQAGQVG+YGYTAYSASKFGLRG+AEALQ 
Sbjct  146   GSFHLIKAALPGMKTRARETGLPVSIALMSSQAGQVGVYGYTAYSASKFGLRGLAEALQH  205

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIA NIHVSLIFPP T TP  A+E KRRP++T  IA SSG  MKA++VA+K+L GIK G
Sbjct  206   EVIADNIHVSLIFPPDTETPGFAEEHKRRPELTRIIAGSSGG-MKADDVAEKALKGIKSG  264

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             +F + CN EG  LSIATAGLSPQ S+L+AFVE   AG MR+  LCFQ NW+  I+KWH
Sbjct  265   TFIIPCNFEGTMLSIATAGLSPQRSYLIAFVEVFSAGFMRLLGLCFQWNWFNTIEKWH  322



>ref|XP_010942950.1| PREDICTED: LOW QUALITY PROTEIN: 3-dehydrosphinganine reductase 
TSC10A-like [Elaeis guineensis]
Length=327

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 238/302 (79%), Gaps = 2/302 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRPV++P+  RHVFITGGSSGIGLALA +A AEGA+VSILAR+A +L +A+ AI  A
Sbjct  25    LVRPRPVRIPVKGRHVFITGGSSGIGLALARRAAAEGARVSILARSAARLNEAREAIRLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRD +AV RAVE AGPID+LVCNHGV+  +ELE Q++E+V+ M+DVNL 
Sbjct  85    TGVXVAVFSADVRDAEAVARAVEAAGPIDLLVCNHGVFTPQELEHQDLEDVRFMVDVNLM  144

Query  929   GTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             GTFHLIKAALP M  R  A + P SI+IMSSQAGQVG+YGYTAYSASKF LRG+ EALQ 
Sbjct  145   GTFHLIKAALPAMKQRARATKLPASISIMSSQAGQVGVYGYTAYSASKFALRGLGEALQH  204

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVI  NIHVSLIFPP T TP  A+E KRRP++T+ IA SSG  MKA++VA+K+++GIK G
Sbjct  205   EVIGDNIHVSLIFPPDTETPGFAEEHKRRPELTNIIAGSSGG-MKADDVAQKAMDGIKTG  263

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
             +F V CN EG  LSIATAGLSPQ S+ MAFVE   AG MR   LCFQ NW++ I+ WH  
Sbjct  264   TFIVPCNFEGTMLSIATAGLSPQRSYRMAFVEVFGAGFMRFMGLCFQWNWFSTIENWHAK  323

Query  392   NK  387
              K
Sbjct  324   KK  325



>ref|XP_009397556.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Musa acuminata 
subsp. malaccensis]
Length=327

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 232/303 (77%), Gaps = 2/303 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV++P+  RHV ++GGSSGIG ALA +A AEGA+VSILAR+  +L DA  AI R 
Sbjct  25    IVRPRPVRIPLKGRHVLVSGGSSGIGFALARRAAAEGARVSILARDPDRLRDACDAIRRD  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG    A +ADVRD  AV RA+E  GP+DVLVCN GV+  +ELE Q +EEV+ M++VNL 
Sbjct  85    TGVDAAALAADVRDPAAVARALETVGPVDVLVCNQGVFVPQELERQSLEEVRFMVEVNLM  144

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             GTFHLIKAALP M  R    G P SIAIMSSQAGQVG+YGYTAYSA+KFGLRG+AEALQ 
Sbjct  145   GTFHLIKAALPAMKQRGKETGLPASIAIMSSQAGQVGVYGYTAYSATKFGLRGLAEALQH  204

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVI  NIHV+LIFPP T TP LA+E+KRRP+IT+ IA SSG  MKA++VA+K+LNGIK  
Sbjct  205   EVIMDNIHVTLIFPPDTDTPGLAEELKRRPEITNVIAASSGG-MKADDVAQKALNGIKSA  263

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
              F V CN EG  LSIATAGLSPQ S+LMAF E   A +MR   LCFQ NW++ I+KWH  
Sbjct  264   QFVVPCNFEGTMLSIATAGLSPQRSYLMAFNEVLGASLMRFIGLCFQWNWFSAIEKWHAK  323

Query  392   NKQ  384
              K+
Sbjct  324   KKR  326



>ref|XP_008776394.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X1 
[Phoenix dactylifera]
Length=331

 Score =   359 bits (921),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 235/298 (79%), Gaps = 2/298 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPR V++PI  RHV ITGGSSGIGLAL  +A AEGA++SILARN  +L++A+ AI  A
Sbjct  26    IVRPRRVRIPIKGRHVLITGGSSGIGLALTRRAAAEGARISILARNPTRLQEARDAIRLA  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG      +ADVRD  AV RA+EEAGP++VLVCN GV+  +ELE QE+EEV+ M++VNL 
Sbjct  86    TGVDAAVLAADVRDPAAVARALEEAGPVEVLVCNQGVFVPQELEVQELEEVRFMVEVNLM  145

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             G+FHLIKAALPGM +R    G P SIA+MSSQAGQVG+YGYTAYSASKFGLRG+AEALQ 
Sbjct  146   GSFHLIKAALPGMKTRARETGLPVSIALMSSQAGQVGVYGYTAYSASKFGLRGLAEALQH  205

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIA NIHVSLIFPP T TP  A+E KRRP++T  IA SSG  MKA++VA+K+L GIK G
Sbjct  206   EVIADNIHVSLIFPPDTETPGFAEEHKRRPELTRIIAGSSGG-MKADDVAEKALKGIKSG  264

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             +F + CN EG  LSIATAGLSPQ S+L+AFVE   AG MR+  LCFQ NW+  I+KWH
Sbjct  265   TFIIPCNFEGTMLSIATAGLSPQRSYLIAFVEVFSAGFMRLLGLCFQWNWFNTIEKWH  322



>gb|ACG41684.1| 3-ketodihydrosphingosine reductase precursor [Zea mays]
Length=325

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 235/304 (77%), Gaps = 4/304 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             + RPR  ++ + + HVFITGGSSGIGLA+A  A  EGA+VSILARN  +LE+A+ AI R 
Sbjct  22    LTRPR-ARIALKDSHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEEARAAIQRD  80

Query  1109  TG-CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNL  933
             +G   V   +ADVRD DAV RA++EAGP+DVLVCNHGV+  +ELE Q+++E+K M+D+NL
Sbjct  81    SGRDDVGVHAADVRDADAVARALQEAGPVDVLVCNHGVFVPQELERQDMDEIKWMVDINL  140

Query  932   TGTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQ  756
              GTFHLIKAALP M +R    R PGSIAIMSSQAGQVGIYGYTAYSASKF LRG+ EALQ
Sbjct  141   MGTFHLIKAALPAMKARTRETRLPGSIAIMSSQAGQVGIYGYTAYSASKFALRGLGEALQ  200

Query  755   QEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKC  576
              EV+  NI+VSLIFPP T TP L +E KRRP++T+ IA  SG  MKA++VAKK+L+GIK 
Sbjct  201   HEVVGDNINVSLIFPPDTETPGLEEEHKRRPELTNIIAGLSGG-MKADDVAKKALDGIKS  259

Query  575   GSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHP  396
               F V CN EG  L++ATAGLSPQ+S LMAF+E    G+MR AALCFQ NW++ I+ ++ 
Sbjct  260   AKFIVPCNFEGTMLAVATAGLSPQSSALMAFIEVIGTGLMRFAALCFQWNWFSTIESYYA  319

Query  395   GNKQ  384
              NK+
Sbjct  320   KNKK  323



>ref|NP_001131956.1| 3-ketodihydrosphingosine reductase isoform 1 precursor [Zea mays]
 ref|XP_008681137.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform 1 isoform 
X1 [Zea mays]
 gb|ACF80599.1| unknown [Zea mays]
 gb|AFW72977.1| 3-ketodihydrosphingosine reductase isoform 1 [Zea mays]
 gb|AFW72978.1| 3-ketodihydrosphingosine reductase isoform 2 [Zea mays]
Length=325

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 234/304 (77%), Gaps = 4/304 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             + RP   ++ + + HVFITGGSSGIGLA+A  A  EGA+VSILARN  +LE+A+ AI R 
Sbjct  22    LTRPH-ARIALKDSHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEEARAAIQRD  80

Query  1109  TG-CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNL  933
             +G   V   +ADVRD DAV RA++EAGP+DVLVCNHGV+  +ELE Q+++E+K M+D+NL
Sbjct  81    SGRDDVGVHAADVRDADAVARALQEAGPVDVLVCNHGVFVPQELERQDMDEIKWMVDINL  140

Query  932   TGTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQ  756
              GTFHLIKAALP M +R    R PGSIAIMSSQAGQVGIYGYTAYSASKF LRG+ EALQ
Sbjct  141   MGTFHLIKAALPAMKARTRETRLPGSIAIMSSQAGQVGIYGYTAYSASKFALRGLGEALQ  200

Query  755   QEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKC  576
              EV+  NIHVSLIFPP T TP L +E KRRP++T+ IA  SG  MKA++VAKK+L+GIK 
Sbjct  201   HEVVGDNIHVSLIFPPDTETPGLEEEHKRRPELTNIIAGLSGG-MKADDVAKKALDGIKS  259

Query  575   GSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHP  396
               F V CN EG  L++ATAGLSPQ+S LMAF+E    G+MR AALCFQ NW++ I+ ++ 
Sbjct  260   AKFIVPCNFEGTMLAVATAGLSPQSSALMAFIEVIGTGLMRFAALCFQWNWFSTIESYYA  319

Query  395   GNKQ  384
              NK+
Sbjct  320   KNKK  323



>ref|XP_010940828.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Elaeis 
guineensis]
Length=328

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 195/298 (65%), Positives = 231/298 (78%), Gaps = 2/298 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPR V++PI  RHV ITGGSSGIGLALA +A  EGA+VSILARN  +LE+A+  I  A
Sbjct  26    VVRPRRVRIPIKGRHVLITGGSSGIGLALARRAATEGARVSILARNPARLEEARDTIRLA  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG      +ADVRD  AV RA+EEAGP+DVLVCN GV+  +ELE QE+EEV+ M++VNL 
Sbjct  86    TGVDAAVLAADVRDPTAVARALEEAGPVDVLVCNQGVFVPQELETQELEEVRFMVEVNLM  145

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             G+FHLIKAALP M +R    G P SIA++SSQAGQVG+YGYTAYSASKFGLRG+AEALQ 
Sbjct  146   GSFHLIKAALPAMKARARETGLPASIALVSSQAGQVGVYGYTAYSASKFGLRGLAEALQH  205

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVIA NIHVSLIFPP T TP  A+E KRRP++T  IA SSG  MK ++VA+K+L GIK G
Sbjct  206   EVIADNIHVSLIFPPDTETPGFAEEHKRRPELTHMIAGSSGG-MKPDDVAEKALKGIKSG  264

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             +F + CN EG  LSIATAGLSPQ S+L AFVE   AG MR+  LCFQ NW+  I+KWH
Sbjct  265   TFIIPCNFEGIMLSIATAGLSPQRSYLTAFVEVLGAGFMRLLGLCFQWNWFNTIEKWH  322



>ref|XP_007034648.1| Short-chain dehydrogenase, putative [Theobroma cacao]
 gb|EOY05574.1| Short-chain dehydrogenase, putative [Theobroma cacao]
Length=315

 Score =   355 bits (911),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 233/302 (77%), Gaps = 5/302 (2%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRP+ +PI NRHVFITGGS GIGLA+A QA +EGA++S+LAR+  KLE+AK +I +A
Sbjct  19    IVRPRPLTIPIKNRHVFITGGSIGIGLAIAKQAASEGARISLLARSLDKLEEAKQSIRQA  78

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
                 V  F+ADVRDYDAV+ A++EAGPIDVLV NHGVY  +ELE+Q ++ VK MIDVNLT
Sbjct  79    YQVDVAIFAADVRDYDAVQSAIKEAGPIDVLVVNHGVYVIQELENQGLDVVKFMIDVNLT  138

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  R  ++ P SIA+MSS AGQVGIYGY AYSA+KFGLRG+AE+LQQE
Sbjct  139   GSFNVIKAALPLMKDR-KDKWPASIALMSSMAGQVGIYGYAAYSATKFGLRGLAESLQQE  197

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVS+IFPP T TP +A+  K  P++ SKI V SG  MKAEE+ K +++GIKCGS
Sbjct  198   VIEDNIHVSIIFPPVTETPGIAR--KNMPEL-SKIIVGSGV-MKAEEIGKITVDGIKCGS  253

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             FS+ CN  G   +IATAG+SPQ SFLMA +E   AG+ R   L FQ N Y II+KWH   
Sbjct  254   FSIPCNFLGQTFAIATAGVSPQRSFLMASLEVVFAGLFRFGGLLFQWNLYGIIEKWHAQK  313

Query  389   KQ  384
             K+
Sbjct  314   KR  315



>ref|XP_004953588.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Setaria italica]
Length=326

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/302 (65%), Positives = 236/302 (78%), Gaps = 3/302 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPR  +VP+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LE+A+ AI R +G
Sbjct  24    RPRAARVPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEEARAAIQRDSG  83

Query  1103  CG-VTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
              G V   +ADVRD  AV+RA+ EAGP+DVLVCNHGV+  +ELE Q++EE+K M+D+NL G
Sbjct  84    RGDVGVHAADVRDAAAVERALREAGPVDVLVCNHGVFVPQELERQDMEEIKWMVDINLMG  143

Query  926   TFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             TFHLIKAALP M +R    R PGSIAIMSSQAGQVGIYGYTAYSASKF LRG+ EALQ E
Sbjct  144   TFHLIKAALPAMKARTRETRLPGSIAIMSSQAGQVGIYGYTAYSASKFALRGLGEALQHE  203

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP L +E KRRP++T+ IA SSG  MKA +VAKK+L+GIK   
Sbjct  204   VITDNIHVSLIFPPDTETPGLEEEHKRRPELTNIIAGSSGG-MKANDVAKKALDGIKSAK  262

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F V CN EG  L++ATAGLSPQ+S +MAF+E   AG+MR AALCFQ NW++ I+ ++  N
Sbjct  263   FIVPCNFEGAMLAVATAGLSPQSSPVMAFLEVIGAGLMRFAALCFQWNWFSTIEGYYAKN  322

Query  389   KQ  384
             K+
Sbjct  323   KK  324



>gb|KHG07465.1| 3-ketodihydrosphingosine reductase [Gossypium arboreum]
Length=338

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 184/280 (66%), Positives = 230/280 (82%), Gaps = 2/280 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPV +PI NRHVFITGGSSGIGLALA QA ++GA+VS+LAR+  KL++AK +I R+
Sbjct  19    IVRPRPVTIPIKNRHVFITGGSSGIGLALAQQAASQGARVSLLARSLNKLQEAKESIRRS  78

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             +G  V  FSADVRD+DAV++AV +AGPIDVLV N GV+  +ELE Q ++E+K MIDVNL 
Sbjct  79    SGLDVAIFSADVRDHDAVQKAVNDAGPIDVLVVNQGVFVPQELEKQGLDEIKFMIDVNLM  138

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  R  +R P SI+++SSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  139   GSFNVIKAALPLMKER-KDRLPASISLISSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  197

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VIA NIHVS+++PP T TP   +E + RP++T  +A SSG+ MKA+EVAKK+L+GIK GS
Sbjct  198   VIADNIHVSVVYPPDTDTPGFEKENEVRPELTKLLAGSSGS-MKADEVAKKALDGIKSGS  256

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRI  450
             F+V CN EG  L+IATAGLSPQ SFLMAF+E    G++R+
Sbjct  257   FTVPCNFEGHMLAIATAGLSPQRSFLMAFIEVASVGVLRL  296



>dbj|BAJ96763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 236/303 (78%), Gaps = 2/303 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             + RPR  ++P+  RHVFITGGSSGIGLALA  A  EGA+VSILARNA +LEDA+ AI  A
Sbjct  25    LTRPRAARIPLKGRHVFITGGSSGIGLALATAAAREGARVSILARNAARLEDARAAIRLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V    ADVRD  AV RA+++AGP+DVLVCNHGV+  +ELE Q++EEVK M+D+NL 
Sbjct  85    TGLDVGVHQADVRDAAAVARALDDAGPVDVLVCNHGVFVPQELEKQDMEEVKWMVDINLM  144

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
             GTFHLIKAALP M +R      P SIAIMSSQAGQVG+YGYTAYSASKF L G+AE+LQ 
Sbjct  145   GTFHLIKAALPAMKARTRETSLPASIAIMSSQAGQVGVYGYTAYSASKFALTGLAESLQH  204

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             EVI+ +IHVSLIFPP T TP L +E K+RP++T+ IA SSG  MKA++VAKK+LNGIK G
Sbjct  205   EVISDDIHVSLIFPPDTETPGLVEEKKKRPELTTIIADSSGG-MKADDVAKKALNGIKSG  263

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPG  393
              F + CN EG  L+IAT+GL+PQ+S L+AFVE   AG+MR  ALCFQ NW++ I+ W+  
Sbjct  264   RFIIPCNFEGAMLAIATSGLTPQSSPLIAFVEVIGAGLMRFVALCFQWNWFSTIENWYAK  323

Query  392   NKQ  384
             NK+
Sbjct  324   NKK  326



>ref|XP_008232284.1| PREDICTED: 3-ketodihydrosphingosine reductase-like, partial [Prunus 
mume]
Length=261

 Score =   343 bits (880),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/254 (67%), Positives = 201/254 (79%), Gaps = 3/254 (1%)
 Frame = -2

Query  1145  KLEDAKHAILRATGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEV  966
             +LE+AK+ I  +TG  V+ FSADVRDYDAV +AVEEAGPIDVL+ N GV+  +ELE Q +
Sbjct  10    RLEEAKNYIQLSTGIDVSIFSADVRDYDAVSKAVEEAGPIDVLIVNQGVFVPEELEKQGL  69

Query  965   EEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKF  786
             +EVK M+DVNL G+F++IKAALP M  +  +  P SIA+MSSQAGQVGIYGYTAYSASKF
Sbjct  70    DEVKFMVDVNLIGSFNMIKAALPKM--KKGDGMPRSIALMSSQAGQVGIYGYTAYSASKF  127

Query  785   GLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEV  606
             GLRG+AEALQQEVI+H+IHVSLIFPP T TP L +E K+RPQ+TS IA SSG  MKAEEV
Sbjct  128   GLRGLAEALQQEVISHDIHVSLIFPPDTDTPGLTEETKKRPQLTSIIAESSGV-MKAEEV  186

Query  605   AKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCN  426
             AKK+  GIK  +F V CNLEG  LSIATAG+SPQ SF+MAFVE   AG++R+ AL FQ N
Sbjct  187   AKKAFGGIKSAAFIVPCNLEGALLSIATAGMSPQRSFVMAFVEVVAAGLVRLVALFFQWN  246

Query  425   WYTIIQKWHPGNKQ  384
             WY  I  WH  NK+
Sbjct  247   WYNGIHTWHAQNKR  260



>ref|XP_009384607.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Musa acuminata 
subsp. malaccensis]
Length=323

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 227/296 (77%), Gaps = 2/296 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPRPV++P+  RHV I+GGSSGIGLALA +A AEGA+VSILAR+  +L DA  AI  ATG
Sbjct  24    RPRPVRIPLKGRHVLISGGSSGIGLALARRAAAEGARVSILARDPDRLRDACDAIRLATG  83

Query  1103  CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
                 A +ADVRD +AV  A+E AG IDVLVCNHGV+  +EL+ Q +EEV+  ++VNL GT
Sbjct  84    VDAAALAADVRDPEAVACALEAAGHIDVLVCNHGVFLPQELDRQSLEEVRFTVEVNLMGT  143

Query  923   FHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             FHLIKAALP M  R    G P SIAIMSSQAGQVGIYGYTAYSASKFGLRG+AEALQ EV
Sbjct  144   FHLIKAALPAMKQRARESGLPASIAIMSSQAGQVGIYGYTAYSASKFGLRGLAEALQHEV  203

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
             IA +IH++LIFPP T TP LA+E KRRP +T+ IA SSG  M A++VA+K+L+G+K   F
Sbjct  204   IADSIHITLIFPPDTETPGLAEERKRRPDVTNMIAASSGG-MNADDVAQKALHGLKSAQF  262

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
              V CN EG  LSIATAGLSPQ S+LMAFVE   AG MR   LCFQ NW+ II KW+
Sbjct  263   VVPCNFEGTMLSIATAGLSPQRSYLMAFVEVLGAGFMRFLGLCFQWNWFNIIDKWY  318



>gb|KCW84256.1| hypothetical protein EUGRSUZ_B01113 [Eucalyptus grandis]
Length=315

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 224/297 (75%), Gaps = 14/297 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVK+PI NRHVFITGGSSGIGLA+A +A +EGA+VSILAR+  KLE AK  I  A
Sbjct  26    IVRPRPVKIPIKNRHVFITGGSSGIGLAIAHRAASEGARVSILARSQAKLEKAKQEIRLA  85

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FS DVRD+D V+RA+EEAGP+DVLV N GV+  +EL  Q+++EV+ MIDVNL 
Sbjct  86    TGTDVATFSTDVRDFDTVRRAMEEAGPVDVLVVNQGVFLPEELAKQDLDEVRFMIDVNLM  145

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKA LP M +R  +R P SI +MSSQAGQ            + GLRG+AEALQQE
Sbjct  146   GSFNMIKAVLPAMKAR-TDRRPASIVLMSSQAGQ------------QIGLRGLAEALQQE  192

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             +IA +IHVSL+ PP T TP L +E KRRP I+S IA +S A MKA+EVA+K++NGIK GS
Sbjct  193   IIADDIHVSLVLPPDTDTPGLVEEKKRRPPISSIIAATSAA-MKADEVAEKTINGIKSGS  251

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWH  399
             F V CN+ G+ L+IA+AGLSPQ S++MAF+E   AGI R+A L    NWY+ I+KW+
Sbjct  252   FIVPCNVVGYVLAIASAGLSPQRSYVMAFLEVVGAGISRLAGLFLLWNWYSSIEKWY  308



>gb|AES73012.2| 3-ketodihydrosphingosine reductase-like protein [Medicago truncatula]
Length=459

 Score =   343 bits (881),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 228/301 (76%), Gaps = 15/301 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRP+K+PI+NR+VFITGGSSGIGLALA +A A+GA+VSI+AR+  KLE+AK+++  A
Sbjct  144   LVRPRPIKIPITNRNVFITGGSSGIGLALAHRAAADGARVSIMARSLTKLEEAKNSVKHA  203

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG        +VR +DAVK+  +EAGPIDVL+ NHGV+ + EL D     VK  IDVNL 
Sbjct  204   TGV-------EVRIFDAVKKVADEAGPIDVLLLNHGVFYALELSD-----VKFTIDVNLM  251

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G  ++IKAALP M     +  P SIA+   +   VGIYGY AYSASKFGLRG+AEALQQE
Sbjct  252   GCLNMIKAALPHMKKNRKDTLPASIALFHHKL--VGIYGYVAYSASKFGLRGLAEALQQE  309

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI  NIHVSLIFPP T TP L +E KR+P++T  IA SSG FMKA+EVA+K+ +GI+ GS
Sbjct  310   VIGDNIHVSLIFPPDTDTPGLVEENKRKPELTKIIAASSG-FMKADEVAQKAFDGIRSGS  368

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
             F ++CNLEG  LS+AT+GLSPQ SFLMAFVE   AGIMRIAALCFQ NWY  I+KWH   
Sbjct  369   FIISCNLEGIALSLATSGLSPQRSFLMAFVEVIAAGIMRIAALCFQWNWYGSIEKWHKQR  428

Query  389   K  387
             K
Sbjct  429   K  429



>gb|KHG29263.1| 3-ketodihydrosphingosine reductase [Gossypium arboreum]
Length=322

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 220/290 (76%), Gaps = 2/290 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRP+ +PI NRHVFITGGS GIGLA+A QA +EGA++S+LAR+  +L+ AK +I +A
Sbjct  21    IVRPRPINIPIKNRHVFITGGSMGIGLAIAKQAASEGARISLLARSVDQLQKAKESICQA  80

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
                 V+ FSADVRDYDAV+RA+ EAG IDVLV NHGVY  +E E Q ++ +K MIDVNL 
Sbjct  81    YEVEVSIFSADVRDYDAVERAINEAGSIDVLVVNHGVYYVEEFETQGLDVMKTMIDVNLM  140

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  R  ++GP SIA+MSS AGQVG YG+ AYSA+KFGLRG+AEALQQE
Sbjct  141   GSFNVIKAALPLMKDR-KDKGPASIALMSSMAGQVGTYGFAAYSATKFGLRGLAEALQQE  199

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             V+ +NIH+SLIFPP T TP      K  P+IT+ I+ S+ A MKAEEV K ++ GIK GS
Sbjct  200   VLENNIHLSLIFPPVTETPGFEPARKTMPEITNIIS-STSAGMKAEEVGKITIQGIKSGS  258

Query  569   FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWY  420
             FS+ C L+G  L+IATAGLSPQ  F+MA +E   AG+ R  AL  Q NWY
Sbjct  259   FSIPCKLDGRALAIATAGLSPQRCFIMASLEVVFAGLFRFVALLLQWNWY  308



>ref|XP_006850729.1| hypothetical protein AMTR_s00025p00047220 [Amborella trichopoda]
 gb|ERN12310.1| hypothetical protein AMTR_s00025p00047220 [Amborella trichopoda]
Length=355

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 218/306 (71%), Gaps = 9/306 (3%)
 Frame = -2

Query  1280  PRPVKVPISNRHVFITggssgiglalaLQAVAEGAK-VSILARNAGKLEDAKHAILRATG  1104
             PR  KVPI  RHV I+GGSSGIGLA+A  A  EGA  VSILAR+  KLEDAK  I  +TG
Sbjct  29    PRLTKVPIKGRHVLISGGSSGIGLAMAELAAMEGASCVSILARDPRKLEDAKCQIQLSTG  88

Query  1103  CG---VTAFSADVRDYDAVKRAVEEAG----PIDVLVCNHGVYASKELEDQEVEEVKVMI  945
                  V    ADVRD++ VKR VEEA     P+DVLVCN GV+  +ELE QE++  K M+
Sbjct  89    LPDDRVRVLIADVRDFEGVKRVVEEASAGGPPVDVLVCNQGVFVPQELESQEMDTAKYMV  148

Query  944   DVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAE  765
             D+NL GT HLIKA LP M  R     P SIA+MSSQAGQVGIYGY AYSASKFGLRG+ E
Sbjct  149   DINLIGTLHLIKAVLPQMKHRDDPSTPASIALMSSQAGQVGIYGYVAYSASKFGLRGLGE  208

Query  764   ALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNG  585
             ALQQEVI  NI VSLIFPP T TP L +E K +P+IT  IA SS A M+A+EVA+K+L+G
Sbjct  209   ALQQEVIVDNIRVSLIFPPETQTPGLLEENKTKPEITKIIAASSYA-MEAKEVARKALDG  267

Query  584   IKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             IK G F V CN EGF LSIATAG+SPQTS+ MAF+E   AG +R+  LCF  NW+ I ++
Sbjct  268   IKAGRFIVTCNFEGFMLSIATAGVSPQTSYGMAFIEVVAAGFIRVVGLCFLWNWFGIAER  327

Query  404   WHPGNK  387
             WH   K
Sbjct  328   WHAERK  333



>ref|XP_007034649.1| Short-chain dehydrogenase, putative [Theobroma cacao]
 gb|EOY05575.1| Short-chain dehydrogenase, putative [Theobroma cacao]
Length=405

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/290 (62%), Positives = 222/290 (77%), Gaps = 3/290 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             I RPRPVKVPI +RHVFITGGSSGIGLA+A +A +EGA+VSI+ARN  KLE+A+ +I  A
Sbjct  111   IARPRPVKVPIKDRHVFITGGSSGIGLAIAKRAASEGARVSIMARNLEKLEEARQSIRLA  170

Query  1109  TGC-GVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNL  933
             +G   V+ FSAD RD +AV+RAV +AGPIDVLV NHGVY   +LE Q ++ V  ++DVNL
Sbjct  171   SGALDVSIFSADARDSNAVQRAVNDAGPIDVLVVNHGVYEHDKLEKQGLDVVNYILDVNL  230

Query  932   TGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQ  753
              G+F++IKAALP M  R  +RGP SIA+M+SQA QVGIYGYTAYSAS FGLRG+AEALQQ
Sbjct  231   IGSFNVIKAALPLMKDR-KDRGPASIALMASQAAQVGIYGYTAYSASNFGLRGLAEALQQ  289

Query  752   EVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCG  573
             +VI  NIHVSL+FPP T TP L +     P++T KI + S   MKA+EVAKK+L GIK G
Sbjct  290   KVIEDNIHVSLMFPPDTETPNLKKAKSTMPELT-KIIIGSPVPMKADEVAKKTLEGIKSG  348

Query  572   SFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNW  423
             SF + CNL G+ L+ AT G+SPQ SFLMAF+E  LAGI R+  L +  NW
Sbjct  349   SFIIPCNLIGYPLAFATPGVSPQRSFLMAFLEVALAGISRLVVLFYLWNW  398


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = -2

Query  674  KRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSF  495
            K  P++ SKI V SG  MKAEE+ K +++GIK GSFS  CN  G  L+I TAG+SPQ SF
Sbjct  7    KTMPEL-SKIIVGSGG-MKAEEIGKITVDGIKSGSFSNPCNFLGQTLAIVTAGVSPQRSF  64

Query  494  LMAFVEACLAGIMRIAA  444
            LMA +E   AG+ R  A
Sbjct  65   LMASLEVVFAGLFRFGA  81



>ref|XP_003602761.1| NAD(P)H-quinone oxidoreductase chain [Medicago truncatula]
Length=538

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 229/330 (69%), Gaps = 42/330 (13%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRP+K+PI+NR+VFITGGSSGIGLALA +A A+GA+VSI+AR+  KLE+AK+++  A
Sbjct  144   LVRPRPIKIPITNRNVFITGGSSGIGLALAHRAAADGARVSIMARSLTKLEEAKNSVKHA  203

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG        +VR +DAVK+  +EAGPIDVL+ NHGV+ + EL D     VK  IDVNL 
Sbjct  204   TG-------VEVRIFDAVKKVADEAGPIDVLLLNHGVFYALELSD-----VKFTIDVNLM  251

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMS-----------------------------SQ  837
             G  ++IKAALP M     +  P SIA+                                +
Sbjct  252   GCLNMIKAALPHMKKNRKDTLPASIALFHHKLVSLAEIRMLRWMCGKTRLDMIRNDTIRE  311

Query  836   AGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQI  657
               +VGIYGY AYSASKFGLRG+AEALQQEVI  NIHVSLIFPP T TP L +E KR+P++
Sbjct  312   TERVGIYGYVAYSASKFGLRGLAEALQQEVIGDNIHVSLIFPPDTDTPGLVEENKRKPEL  371

Query  656   TSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVE  477
             T  IA SSG FMKA+EVA+K+ +GI+ GSF ++CNLEG  LS+AT+GLSPQ SFLMAFVE
Sbjct  372   TKIIAASSG-FMKADEVAQKAFDGIRSGSFIISCNLEGIALSLATSGLSPQRSFLMAFVE  430

Query  476   ACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
                AGIMRIAALCFQ NWY  I+KWH   K
Sbjct  431   VIAAGIMRIAALCFQWNWYGSIEKWHKQRK  460



>ref|XP_006648964.1| PREDICTED: 3-ketodihydrosphingosine reductase-like, partial [Oryza 
brachyantha]
Length=232

 Score =   311 bits (796),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 180/231 (78%), Gaps = 2/231 (1%)
 Frame = -2

Query  1073  RDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPG  894
             RD DAV RA+ EAGP+DVLVCNHGV+  +ELE QE+EE+K M+D+NL GTFHL+KAALP 
Sbjct  1     RDADAVARALAEAGPVDVLVCNHGVFVPQELEKQEMEEIKWMVDINLMGTFHLVKAALPA  60

Query  893   MISRPA-NRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLI  717
             M  R    R P SIAIMSSQAGQVG+YGYTAYSASKF LRG+ EALQ EVIA  IHVSLI
Sbjct  61    MKERTKETRLPASIAIMSSQAGQVGVYGYTAYSASKFALRGLGEALQHEVIADGIHVSLI  120

Query  716   FPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFF  537
             FPP T TP  A+E KRRP++T+ IA SSG  MKA+ VA K+L+GIK G F V CN EG  
Sbjct  121   FPPDTETPGFAEENKRRPELTNIIAGSSGG-MKADVVATKALDGIKSGKFIVPCNFEGAM  179

Query  536   LSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNKQ  384
             L++ATAGLSPQ+S L AF+E   AG+MR AA+CFQ NW++ I+ W+  NK+
Sbjct  180   LAVATAGLSPQSSPLTAFLEVIGAGLMRFAAICFQFNWFSTIENWYAKNKK  230



>gb|KHN37583.1| 3-ketodihydrosphingosine reductase, partial [Glycine soja]
Length=243

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 176/224 (79%), Gaps = 2/224 (1%)
 Frame = -2

Query  1058  VKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRP  879
             VKRAV++AGPIDVL+ NHGV+ + EL+  E+ EVK  +DVNL GT +LIKAALP M +R 
Sbjct  1     VKRAVDDAGPIDVLLLNHGVFVALELDKMELSEVKFTMDVNLMGTLNLIKAALPAMKNR-  59

Query  878   ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTH  699
              +  P SIA++SSQAGQVGIYGY AYSASKFGLRG+AE+LQQEVI  NIHVS+IFPP T 
Sbjct  60    NDPLPASIALVSSQAGQVGIYGYVAYSASKFGLRGLAESLQQEVIEDNIHVSMIFPPDTD  119

Query  698   TPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATA  519
             TP LA+E KRRP++T  I  SSG+ MKA+EVA+K+L+GIKCG F V+CN EG  LS+ATA
Sbjct  120   TPGLAEENKRRPELTKIITASSGS-MKADEVAQKALDGIKCGDFIVSCNFEGIALSLATA  178

Query  518   GLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
             GLSPQ SFLMAF+E   AGI+RI AL  Q  WY  I+K+H   K
Sbjct  179   GLSPQRSFLMAFLEVVAAGILRIVALGMQWTWYRSIEKYHSQRK  222



>ref|XP_006400478.1| hypothetical protein EUTSA_v10014360mg [Eutrema salsugineum]
 gb|ESQ41931.1| hypothetical protein EUTSA_v10014360mg [Eutrema salsugineum]
Length=275

 Score =   294 bits (753),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 162/255 (64%), Positives = 198/255 (78%), Gaps = 9/255 (4%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+ V++PI +RHVFITGGSSGIGL LA  A AEGA+VSILAR+  KL +AK +IL A
Sbjct  23    IVRPKSVRIPIKSRHVFITGGSSGIGLGLAHLAAAEGARVSILARSPEKLAEAKRSILLA  82

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRDYDAV +AV+E+GPIDVLV N GV+  KELE Q  EEVK MIDVNL 
Sbjct  83    TGVEVDTFSADVRDYDAVSKAVDESGPIDVLVVNQGVFIGKELEKQSPEEVKFMIDVNLL  142

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++I+AALP M +R  +RGP SI        + GIYGYTAYSASKFGL+G+A+ALQQE
Sbjct  143   GSFNVIEAALPSMKAR-ESRGPASIF-------KAGIYGYTAYSASKFGLQGLAQALQQE  194

Query  749   VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
             VI+H+IHV+L+FPP T TP   +E K+RP++TS IA SSG+ MK +EVAK  L+GIK G 
Sbjct  195   VISHDIHVTLLFPPDTDTPGFEEEQKKRPELTSIIAGSSGS-MKTKEVAKICLDGIKAGK  253

Query  569   FSVACNLEGFFLSIA  525
             F+V C+  GF LS+A
Sbjct  254   FTVTCHFIGFLLSLA  268



>ref|XP_002453005.1| hypothetical protein SORBIDRAFT_04g036480 [Sorghum bicolor]
 gb|EES05981.1| hypothetical protein SORBIDRAFT_04g036480 [Sorghum bicolor]
Length=307

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 200/288 (69%), Gaps = 28/288 (10%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             + RP   ++P+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LE+A+ AI R 
Sbjct  22    LTRPHAARIPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEEARAAIHRD  81

Query  1109  TGCG--VTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVN  936
             +G    V   +ADVRD  AV RA+EEAGP+DVLVCNHGV+AS+ELE Q ++E++ M+DVN
Sbjct  82    SGRNDVVGVHAADVRDAGAVARALEEAGPVDVLVCNHGVFASRELERQGMDEIRWMVDVN  141

Query  935   LTGTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEAL  759
             L GTFHL+KA+LP M +R    R P SIAIMSSQAG                        
Sbjct  142   LMGTFHLVKASLPAMKARARETRLPASIAIMSSQAG------------------------  177

Query  758   QQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIK  579
             Q E+IAHNIHVSLIFPP T TP L +E+K R ++T+ +A SSG  MKA++VAKK+L+GIK
Sbjct  178   QHEMIAHNIHVSLIFPPDTKTPGLEEELKSRTELTNIVAGSSGR-MKADDVAKKALDGIK  236

Query  578   CGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCF  435
                F V CN EG  L+ ATAGLSPQ+S LMAF+E   AGI+R  AL F
Sbjct  237   SAKFIVPCNFEGEMLAAATAGLSPQSSPLMAFIEVIGAGILRFTALLF  284



>emb|CDO99009.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = -2

Query  929  GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
            GTFHLIKAALP M +R  +RGPGSIAIMSSQAGQVGIYGY+AYSASKFGLRGMAEALQQE
Sbjct  2    GTFHLIKAALPNMKNR-GDRGPGSIAIMSSQAGQVGIYGYSAYSASKFGLRGMAEALQQE  60

Query  749  VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
            +I  +IHVSLIFPP T TP   +E KRRPQ+TS IA SSGA MKAEEVA+K+L GI+ GS
Sbjct  61   LIGDDIHVSLIFPPDTETPGFVEENKRRPQLTSIIAASSGA-MKAEEVAEKALKGIQSGS  119

Query  569  FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
            F V CN EG  LSIATAGLSPQ SFLMAF+E   A I+RIAALCFQ NWY  I++WH   
Sbjct  120  FIVPCNFEGILLSIATAGLSPQRSFLMAFIEVVAASILRIAALCFQWNWYASIERWHAQK  179

Query  389  K  387
            K
Sbjct  180  K  180



>emb|CDX92547.1| BnaA10g15860D [Brassica napus]
Length=292

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 184/287 (64%), Gaps = 38/287 (13%)
 Frame = -2

Query  1253  NRHVFITggssgiglalaLQA---VAEGAKVSILARNAGKLEDAKHAILRATGCGVTAFS  1083
             +RHVFITGG S         A    +EGA+VSILAR+  KL DAK +I  ATG  V  FS
Sbjct  30    SRHVFITGGGSSGIGLGLAHAHLAASEGARVSILARSLSKLADAKRSIKLATGVDVATFS  89

Query  1082  ADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAA  903
             ADVRDYDAV +AV ++GPIDVL+ N GV+  KELE Q  EEVK MIDVNL G++      
Sbjct  90    ADVRDYDAVSKAVNQSGPIDVLIVNQGVFIGKELEKQSTEEVKFMIDVNLVGSWS-----  144

Query  902   LPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVS  723
                                       GIYGYTAYSASKFGL+G+A+ALQQEVI+H+IHVS
Sbjct  145   --------------------------GIYGYTAYSASKFGLQGLAQALQQEVISHDIHVS  178

Query  722   LIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEG  543
             L+FPP T TP  ++E K  P++TS IA SSG+ MK +EVAK  L+GIK G F+V C+  G
Sbjct  179   LLFPPDTDTPG-SEEGK--PELTSIIASSSGS-MKTKEVAKICLDGIKAGKFTVTCHFIG  234

Query  542   FFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKW  402
             + LSI+T+G+SPQ S   AF+E    G++R   L FQ  WY  I KW
Sbjct  235   YLLSISTSGMSPQRSVWHAFMEVMFGGLIRFIGLFFQWGWYNTIAKW  281



>emb|CDY68210.1| BnaC09g54290D, partial [Brassica napus]
Length=270

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 172/270 (64%), Gaps = 35/270 (13%)
 Frame = -2

Query  1193  AVAEGAKVSILARNAGKLEDAKHAILRATGCGVTAFSADVRDYDAVKRAVEEAGPIDVLV  1014
             + +EGA VSI AR+  KL DAK +I  ATG  V  FSADVRDYDAV ++V ++GPIDVL+
Sbjct  30    SASEGAGVSIFARSLSKLADAKRSIRLATGVEVATFSADVRDYDAVSKSVHQSGPIDVLI  89

Query  1013  CNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQA  834
              N GV+  KELE Q  EEVK MIDVNL G++                             
Sbjct  90    VNQGVFIGKELEKQSTEEVKFMIDVNLVGSWS----------------------------  121

Query  833   GQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQIT  654
                GIYGYTAYSASKFGL+G+A+ALQQEVI+H+IHVSL+FPP T TP   +E K+RP++T
Sbjct  122   ---GIYGYTAYSASKFGLQGLAQALQQEVISHDIHVSLLFPPDTDTPGFEEEQKKRPELT  178

Query  653   SKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEA  474
             S IA SSG+ MK  EVAK  L+GIK G F+  C+  G+ LSIAT+G+SPQ SF  AF+E 
Sbjct  179   SIIASSSGS-MKTREVAKICLDGIKSGKFTATCHFIGYLLSIATSGVSPQRSFWHAFMEV  237

Query  473   CLAGIMRIAALCFQCNWYTIIQKWHPGNKQ  384
                G +    L FQ  WY  I KW    K+
Sbjct  238   MFGGFV---GLFFQWGWYNTIAKWSNTKKK  264



>gb|KHN33052.1| 3-ketodihydrosphingosine reductase [Glycine soja]
Length=200

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 155/195 (79%), Gaps = 2/195 (1%)
 Frame = -2

Query  971  EVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSAS  792
            E+ +VK  +DVNL GT +LIKAALP M +R  +  P SIA++SSQAGQVGIYGY AYSAS
Sbjct  2    ELSDVKFTMDVNLMGTLNLIKAALPAMKNR-NDPLPASIALVSSQAGQVGIYGYVAYSAS  60

Query  791  KFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAE  612
            KFGLRG+AEALQQEVIA NIHVSLIFPP T TP LA+E KR+P++T  IA SSG+ MKA+
Sbjct  61   KFGLRGLAEALQQEVIADNIHVSLIFPPDTDTPGLAEENKRKPELTKIIAASSGS-MKAD  119

Query  611  EVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQ  432
            EVA+K+L+GIKCG+F V+CN EG  LS+ATAGLSPQ SFLMAF+E   AGI+RI AL  Q
Sbjct  120  EVAQKALDGIKCGNFIVSCNFEGIALSLATAGLSPQRSFLMAFLEVVAAGILRIVALGMQ  179

Query  431  CNWYTIIQKWHPGNK  387
              WY  I+K+H   K
Sbjct  180  WTWYGSIEKYHSQRK  194



>ref|XP_006378675.1| hypothetical protein POPTR_0010s199202g [Populus trichocarpa]
 gb|ERP56472.1| hypothetical protein POPTR_0010s199202g [Populus trichocarpa]
Length=249

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPRP+++PI  RH+FITGGSSGIGLALA +A +EGA+VSIL+R+  KLE+AK+AI ++TG
Sbjct  27    RPRPIQIPIKKRHIFITGGSSGIGLALAHRAASEGARVSILSRSIDKLEEAKNAIRQSTG  86

Query  1103  CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
               V  F+ADVRD++AV+RAV+EAGPIDVLV N GV+ ++ELE+Q++EEV+ +IDVNL G+
Sbjct  87    IDVAIFAADVRDFEAVQRAVDEAGPIDVLVVNQGVFVAQELEEQKLEEVRFIIDVNLMGS  146

Query  923   FHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVI  744
             F++IKAALPGM     +RGPGSIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQEVI
Sbjct  147   FNMIKAALPGMKRSRKDRGPGSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQEVI  206

Query  743   AHNIHVSLIFPPHTHTPALAQEMK  672
               NIHVSL+FPP T TP L + M+
Sbjct  207   GDNIHVSLVFPPDTETPGLTEGME  230



>gb|EMT05106.1| 3-ketodihydrosphingosine reductase [Aegilops tauschii]
Length=197

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 153/196 (78%), Gaps = 2/196 (1%)
 Frame = -2

Query  968  VEEVKVMIDVNLTGTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSAS  792
            +EEVK M+D+NL GTFHLIKAALP M +R      P SIAIMSSQAGQVG+YGYTAYSAS
Sbjct  1    MEEVKWMVDINLMGTFHLIKAALPAMKARTRETSLPASIAIMSSQAGQVGVYGYTAYSAS  60

Query  791  KFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAE  612
            KF L G+AE+LQ EV++ +IHVSLIFPP T TP L +E K+RP++T+ IA SSG  MKA+
Sbjct  61   KFALTGLAESLQHEVVSDDIHVSLIFPPDTETPGLVEEKKKRPELTTIIADSSGG-MKAD  119

Query  611  EVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQ  432
            +VA K+LNGIK G F V CN EG  L+IAT+GL+PQ+S L+AFVE   AG+MR  ALCFQ
Sbjct  120  DVAMKALNGIKSGRFIVPCNFEGAMLAIATSGLTPQSSPLIAFVEVIGAGLMRFVALCFQ  179

Query  431  CNWYTIIQKWHPGNKQ  384
             NW++ I+ W+  NK+
Sbjct  180  WNWFSTIENWYAKNKK  195



>ref|XP_002315170.2| hypothetical protein POPTR_0010s199202g, partial [Populus trichocarpa]
 gb|EEF01341.2| hypothetical protein POPTR_0010s199202g, partial [Populus trichocarpa]
Length=227

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPRP+++PI  RH+FITGGSSGIGLALA +A +EGA+VSIL+R+  KLE+AK+AI ++TG
Sbjct  27    RPRPIQIPIKKRHIFITGGSSGIGLALAHRAASEGARVSILSRSIDKLEEAKNAIRQSTG  86

Query  1103  CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
               V  F+ADVRD++AV+RAV+EAGPIDVLV N GV+ ++ELE+Q++EEV+ +IDVNL G+
Sbjct  87    IDVAIFAADVRDFEAVQRAVDEAGPIDVLVVNQGVFVAQELEEQKLEEVRFIIDVNLMGS  146

Query  923   FHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVI  744
             F++IKAALPGM     +RGPGSIA+MSSQAGQVGIYGYTAYSASKFGLRG+AEALQQEVI
Sbjct  147   FNMIKAALPGMKRSRKDRGPGSIALMSSQAGQVGIYGYTAYSASKFGLRGLAEALQQEVI  206

Query  743   AHNIHVSLIFPPHTHTPALAQ  681
               NIHVSL+FPP T TP L +
Sbjct  207   GDNIHVSLVFPPDTETPGLTE  227



>gb|EMS61820.1| 3-ketodihydrosphingosine reductase [Triticum urartu]
Length=215

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  974  QEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYS  798
            Q++EEVK M+D+NL GTFHLIKAALP M +R      P SIAIMSSQAGQVG+YGYTAYS
Sbjct  17   QDMEEVKWMVDINLMGTFHLIKAALPAMKARTRETSLPASIAIMSSQAGQVGVYGYTAYS  76

Query  797  ASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMK  618
            ASKF L G+AE+LQ EV++ +IHVSLIFPP T TP L +E K+RP++T+ IA SSG  MK
Sbjct  77   ASKFALTGLAESLQHEVVSDDIHVSLIFPPDTETPGLVEEKKKRPELTTIIADSSGG-MK  135

Query  617  AEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALC  438
            A++VA K+L GIK G F + CN EG  L+IAT+GL+PQ+S L+AFVE   AG+MR  ALC
Sbjct  136  ADDVAMKALTGIKSGRFIIPCNFEGAMLAIATSGLTPQSSPLIAFVEVIGAGLMRFVALC  195

Query  437  FQCNWYTIIQKWHPGNKQ  384
            FQ NW++ I+ W   NK+
Sbjct  196  FQWNWFSTIENWCAKNKK  213



>ref|XP_009120905.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydrosphingosine reductase 
[Brassica rapa]
Length=294

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 186/304 (61%), Gaps = 40/304 (13%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRPVK+PI +RHVFIT                  + +    R+  KL DAK ++  A
Sbjct  25    IVRPRPVKIPIKSRHVFIT---------------GGSSCIGXAKRSVSKLADAKRSVKLA  69

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  F+                 P    + N      KELE Q +E VK M+DVNL 
Sbjct  70    TGVEVATFAITT--------------PFSKPLTNQ---LGKELEKQSMEXVKFMLDVNLL  112

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
             G+F++IKAALP M  R    GP SI+++SSQAG   IYG TAYSA KFGL+G+A+ALQQE
Sbjct  113   GSFNVIKAALPSMKGR---GGPASISLVSSQAGHAEIYGDTAYSARKFGLQGLAQALQQE  169

Query  749   VIAHNIH--VSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKC  576
             VI+H++H  VSL+FPP T TP   +E K+RP++TS IA SSG+ +K +EVAK  L+GIK 
Sbjct  170   VISHDLHVSVSLLFPPDTDTPGFEEEQKKRPELTSIIA-SSGS-IKTKEVAKICLDGIKT  227

Query  575   GSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHP  396
             G F+V C+  G+ LSIAT+ +SPQ SF +AFVE    G++R+  L FQ  WY  I KW+ 
Sbjct  228   GKFTVTCHFIGYLLSIATSPMSPQRSFWLAFVEVIFGGLIRL-XLFFQWGWYNTIAKWNS  286

Query  395   GNKQ  384
               K+
Sbjct  287   TKKK  290



>emb|CBI26200.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 137/181 (76%), Gaps = 2/181 (1%)
 Frame = -2

Query  929  GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQE  750
            GTFHLIKAALPGM +R + R P SIAI+SSQAGQVGIYGYTAYSASKFGLRG+AEALQQE
Sbjct  2    GTFHLIKAALPGMKNRKS-REPASIAIISSQAGQVGIYGYTAYSASKFGLRGLAEALQQE  60

Query  749  VIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGS  570
            VIAHNI VSLIFPP T TP   QE K RPQ+T  IA SSG  +KA+EVAKK+LNGIK GS
Sbjct  61   VIAHNILVSLIFPPDTDTPGFEQETKMRPQLTGIIAASSGT-VKADEVAKKTLNGIKSGS  119

Query  569  FSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGN  390
            F V CN +G  L+IATAGLSPQ S LMA  E   AG  R   LC Q  WY  I++W+  N
Sbjct  120  FIVPCNFDGLLLAIATAGLSPQRSVLMALCEVFAAGPTRFIGLCIQWGWYRSIKRWYAQN  179

Query  389  K  387
             
Sbjct  180  N  180



>ref|XP_001764917.1| predicted protein [Physcomitrella patens]
 gb|EDQ70359.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 187/293 (64%), Gaps = 8/293 (3%)
 Frame = -2

Query  1271  VKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCGVT  1092
             V +P+  RHV ITGGSSGIGL +A  A AEGA++S++AR+  KL DAK  +    G  + 
Sbjct  25    VSIPLKGRHVVITGGSSGIGLEVAKLAAAEGARISLVARDLSKLADAKSIVTDFIGYQIN  84

Query  1091  AFSADVRDYD----AVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
              +SADV+ ++    A+  AV  +GPI+VL+ +HGV      +D  +E+   ++D NL G 
Sbjct  85    TYSADVKSFESTRLAIAAAVGHSGPIEVLLLSHGVSRVLTFDDSTIEDFDHILDTNLKGN  144

Query  923   FHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVI  744
              H IKAALP + S  A   P +I+I SSQAG VG+YGY AYSASKF LRG+AE LQQE++
Sbjct  145   IHTIKAALPHIKSSKAV--PAAISIFSSQAGLVGVYGYAAYSASKFALRGLAECLQQELV  202

Query  743   AHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFS  564
               NI +SL++PP T TP   ++ K  P+IT +I   +   M    VA+ +L G+K G F 
Sbjct  203   DRNIRLSLVYPPDTMTPGYMEDQKTMPEIT-RILSQATTPMDPVSVARSALTGLKAGHFH  261

Query  563   VACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWY-TIIQ  408
             + CN EG  LS+  AG+SPQ SFL A  E    GI+R+ AL  Q +WY TI+Q
Sbjct  262   IDCNFEGAALSLVCAGMSPQPSFLRALTEILSMGILRVVALFVQKSWYDTILQ  314



>ref|XP_009760410.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Nicotiana 
sylvestris]
Length=181

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRPRP KVPI NRHVFITGGSSGIGLALA QA +EGAKVSILARN  KLE+A+ AI  +
Sbjct  28    IVRPRPAKVPIKNRHVFITGGSSGIGLALAQQAASEGAKVSILARNTSKLEEARDAIRLS  87

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TGC V  FSADVR+Y+AVK+A E+AGPIDVLVCN GV+  +ELE Q++EE+K MIDVNLT
Sbjct  88    TGCDVAIFSADVRNYEAVKKATEDAGPIDVLVCNQGVFVPQELETQDIEEIKFMIDVNLT  147

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQV  825
             GTFHLIKAALPGM +R + RGPGSIAIMSSQAGQV
Sbjct  148   GTFHLIKAALPGMKNR-SGRGPGSIAIMSSQAGQV  181



>ref|XP_009787857.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like isoform 
X3 [Nicotiana sylvestris]
Length=154

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -2

Query  830  QVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITS  651
            +VGIYGYTAYS SKFGL+G+AEALQQEVI  NIHVSLIFP  T TP  A+E KRRP++TS
Sbjct  6    KVGIYGYTAYSTSKFGLKGLAEALQQEVIGENIHVSLIFPSDTETPGFAEENKRRPRVTS  65

Query  650  KIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEAC  471
             IA SSGA MKA+EVAK +LNGIK G+F+V CN EGF LSIATAGLSPQ SFLMAFVE  
Sbjct  66   IIASSSGA-MKADEVAKIALNGIKSGNFTVPCNFEGFLLSIATAGLSPQRSFLMAFVEVI  124

Query  470  LAGIMRIAALCFQCNWYTIIQK  405
             AGI+R+A LCFQ NWY  I+K
Sbjct  125  AAGILRVAGLCFQWNWYGSIEK  146



>ref|XP_002962339.1| hypothetical protein SELMODRAFT_79314 [Selaginella moellendorffii]
 gb|EFJ35802.1| hypothetical protein SELMODRAFT_79314 [Selaginella moellendorffii]
Length=326

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 186/299 (62%), Gaps = 7/299 (2%)
 Frame = -2

Query  1265  VPISNRHVFITggssgiglalaLQAVAEGA-KVSILARNAGKLEDAKHAILRA----TGC  1101
             V I  RH+ I+GGSSGIGL LA  A A+GA KV++LARN  +L++A+ A+  A    +  
Sbjct  28    VEIRGRHILISGGSSGIGLELAKIAAAQGARKVTLLARNVERLKEARDAVAAAVSGSSDT  87

Query  1100  GVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTF  921
              V   SADV D   ++RA+ EAG +DVLVC+HG+      ED   E++  ++ +N  GT 
Sbjct  88    EVGFVSADVLDRAGLRRAMAEAGDVDVLVCSHGISIPCAFEDARDEDLDTVVGINFMGTM  147

Query  920   HLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIA  741
             +++KAALPGM+ R     P SIAI SSQA Q GIYG+  YS +K  L   AE+L+QE+  
Sbjct  148   NVVKAALPGMV-RDGGVYPRSIAIFSSQAAQAGIYGFACYSGAKVALVKFAESLKQELFL  206

Query  740   HNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSV  561
               I +S+I+PP T TP L +E K +P+IT  ++ SS A M A +VA+K+++GI+ G F+V
Sbjct  207   RKIQISVIYPPDTDTPGLREENKFKPEITKILSESSSA-MVAIDVARKAMDGIRAGRFNV  265

Query  560   ACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNKQ  384
             +CN +G  L+I   G+SP  S   +  E     + RI +L  Q  WY  I+ W   +K+
Sbjct  266   SCNFDGHLLAILCTGMSPHMSVCYSLAEIVFLPVTRIISLFIQYGWYRTIRAWLIKHKK  324



>ref|XP_002962938.1| hypothetical protein SELMODRAFT_78109 [Selaginella moellendorffii]
 gb|EFJ36401.1| hypothetical protein SELMODRAFT_78109 [Selaginella moellendorffii]
Length=326

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 184/299 (62%), Gaps = 7/299 (2%)
 Frame = -2

Query  1265  VPISNRHVFITggssgiglalaLQAVAEGA-KVSILARNAGKLEDAKHAILRA----TGC  1101
             V I  RH+ I+GGSSGIGL LA  A A GA KV++LARN  +L++A+ A+  A    +  
Sbjct  28    VEIRGRHILISGGSSGIGLELAKIAAAHGARKVTLLARNVERLKEARDAVAAAVSGSSDT  87

Query  1100  GVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTF  921
              V   SADV D   ++RA+ EAG +DVLVC+HG+      ED   E++  ++ +N  GT 
Sbjct  88    EVGFVSADVLDRAGLRRAMVEAGDVDVLVCSHGISIPCAFEDARDEDLDTVVGINFMGTM  147

Query  920   HLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIA  741
             ++IKAALPGM+ R     P SIAI SSQA Q GIYG+  YS +K  L   AE+L+QE+  
Sbjct  148   NVIKAALPGMV-RDGGVYPRSIAIFSSQAAQAGIYGFACYSGAKVALVKFAESLKQELFL  206

Query  740   HNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSV  561
               I +S+I+PP T TP L +E K +P+IT  ++ SS A M A +VA+K+++GI+ G F+V
Sbjct  207   RKIQISVIYPPDTDTPGLREENKFKPEITKILSESSSA-MVAIDVARKAMDGIRAGRFNV  265

Query  560   ACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNKQ  384
             +CN +G  L+I   G+SP  S      E     + RI +L  Q  WY  I+ W   +K+
Sbjct  266   SCNFDGHLLAILCTGMSPHMSVCYTLAEIVFLPVTRIISLFIQYGWYRTIRAWLIKHKK  324



>ref|XP_009762900.1| PREDICTED: uncharacterized protein LOC104214874 [Nicotiana sylvestris]
Length=424

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -2

Query  830  QVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITS  651
            +VGIYGYTAYSASKFGL+G+AEALQQEVI  NIHVSLIFPP T TP  A+E KRRP++TS
Sbjct  276  KVGIYGYTAYSASKFGLKGLAEALQQEVIGENIHVSLIFPPDTETPGFAEENKRRPRVTS  335

Query  650  KIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEAC  471
             IA SSGA MKA+EVAK +LNGIK G+F+V CN EGF LSIATAGLSPQ SFLMAFVE  
Sbjct  336  IIAASSGA-MKADEVAKIALNGIKSGNFTVPCNFEGFLLSIATAGLSPQRSFLMAFVEVI  394

Query  470  LAGIMRIAALCFQCNWYTIIQK  405
             AGI+R+A LCFQ NWY  I+K
Sbjct  395  AAGILRVAGLCFQWNWYGSIEK  416



>ref|XP_009787854.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009787855.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like isoform 
X1 [Nicotiana sylvestris]
Length=178

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  830  QVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITS  651
            +VGIYGYTAYS SKFGL+G+AEALQQEVI  NIHVSLIFP  T TP  A+E KRRP++TS
Sbjct  6    KVGIYGYTAYSTSKFGLKGLAEALQQEVIGENIHVSLIFPSDTETPGFAEENKRRPRVTS  65

Query  650  KIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEAC  471
             IA SSGA MKA+EVAK +LNGIK G+F+V CN EGF LSIATAGLSPQ SFLMAFVE  
Sbjct  66   IIASSSGA-MKADEVAKIALNGIKSGNFTVPCNFEGFLLSIATAGLSPQRSFLMAFVEVI  124

Query  470  LAGIMRIAALCFQCNW  423
             AGI+R+A LCFQ NW
Sbjct  125  AAGILRVAGLCFQWNW  140



>ref|XP_009787856.1| PREDICTED: 3-dehydrosphinganine reductase TSC10A-like isoform 
X2 [Nicotiana sylvestris]
Length=176

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = -2

Query  827  VGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSK  648
            VGIYGYTAYS SKFGL+G+AEALQQEVI  NIHVSLIFP  T TP  A+E KRRP++TS 
Sbjct  5    VGIYGYTAYSTSKFGLKGLAEALQQEVIGENIHVSLIFPSDTETPGFAEENKRRPRVTSI  64

Query  647  IAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACL  468
            IA SSGA MKA+EVAK +LNGIK G+F+V CN EGF LSIATAGLSPQ SFLMAFVE   
Sbjct  65   IASSSGA-MKADEVAKIALNGIKSGNFTVPCNFEGFLLSIATAGLSPQRSFLMAFVEVIA  123

Query  467  AGIMRIAALCFQCNW  423
            AGI+R+A LCFQ NW
Sbjct  124  AGILRVAGLCFQWNW  138



>ref|XP_009029905.1| hypothetical protein HELRODRAFT_104089 [Helobdella robusta]
 gb|ESN91947.1| hypothetical protein HELRODRAFT_104089 [Helobdella robusta]
Length=329

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/298 (42%), Positives = 180/298 (60%), Gaps = 14/298 (5%)
 Frame = -2

Query  1274  PVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCG-  1098
             P K      HV ITGGSSGIG +LA QA   GA V++LAR+  KL + +  +L  +    
Sbjct  28    PKKFHFPGSHVLITGGSSGIGRSLAEQAFKLGANVTLLARDVEKLAETQKYLLEHSKTNK  87

Query  1097  ---VTAFSADV-RDYDAVKRAVEEA----GPIDVLVCNHGVYASKELEDQEVEEVKVMID  942
                V  FS D+ R+YD V   +++A    GP+DVL+ + G   +  LED  V++ K ++D
Sbjct  88    KNTVQYFSVDISRNYDEVNDIIKQAESKLGPVDVLINSAGFSVAGSLEDLHVDQFKKLMD  147

Query  941   VNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEA  762
             +N  G+ H  KA +  M +R   R    I ++SSQAGQVG+YGY+AYS SKF LRG AE+
Sbjct  148   LNYLGSVHCTKAVIGQMKARRRGR----IVLISSQAGQVGLYGYSAYSGSKFALRGFAES  203

Query  761   LQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGI  582
             LQ EV+ +N+HV L FPP T TP   +EMK +P  T  I+ SSG    + +VAKK + GI
Sbjct  204   LQMEVLPYNVHVCLAFPPDTKTPGYDEEMKNKPLETKLISESSG-LHDSSDVAKKIIQGI  262

Query  581   KCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQ  408
               G+FS+   LEGFF++  TAG SP T+    F++    G++R+ ++ +   +  I++
Sbjct  263   VDGTFSIYIGLEGFFMNHLTAGFSPTTNLTDTFIQVFSMGLLRMVSVIYLSTFNKIVR  320



>gb|KDO74751.1| hypothetical protein CISIN_1g0177572mg, partial [Citrus sinensis]
Length=139

 Score =   199 bits (505),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = -2

Query  794  SKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKA  615
            SKFGLRG+AEALQQEVIA +IHVSLIFPP T TP L +E KRRP++TS IA SSGA MKA
Sbjct  1    SKFGLRGLAEALQQEVIADDIHVSLIFPPDTETPGLEEENKRRPRLTSIIAASSGA-MKA  59

Query  614  EEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCF  435
            +EVAKK+L+GIK GSF V CN EGF LSIATAGLSPQ S LMAFVE   AG++R  ALCF
Sbjct  60   DEVAKKALDGIKSGSFIVPCNSEGFLLSIATAGLSPQRSVLMAFVEVVAAGLIRFVALCF  119

Query  434  QCNWYTIIQKWHPGNKQ  384
            Q NWY  I+KWH   K+
Sbjct  120  QWNWYGSIEKWHAQGKR  136



>ref|XP_005103655.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Aplysia californica]
Length=332

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 181/302 (60%), Gaps = 15/302 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAI-LR  1113
             ++ P+P+   + N HV ITGGSSGIG ALA QAV  GA+V+++AR+  KL+ A+  + L 
Sbjct  23    LISPKPID--LQNAHVMITGGSSGIGKALACQAVRTGARVTLVARDQVKLDQAQSEVALL  80

Query  1112  ATGCG--VTAFSADVR-DYDAVKRAVEEA----GPIDVLVCNHGVYASKELEDQEVEEVK  954
             A G    V   S D+  DYD+VK+  EE+    GP+DVL+   G  +    ++  + + K
Sbjct  81    APGEEKIVQTVSVDLSADYDSVKKKFEESQVTFGPVDVLINCAGTASPGRFDEVPLSDFK  140

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              MID+N   T H  +A LPGM      RG G I  +SSQAGQ G++G++AYSASK+ LRG
Sbjct  141   KMIDINYMSTVHATRAILPGM----KERGLGRIVFVSSQAGQTGLFGFSAYSASKYALRG  196

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ EV  +N+H++L FPP T+TP  A+E K +P+ T  I+ +SG F  A+ VA   
Sbjct  197   LAESLQMEVKPYNVHLTLAFPPDTNTPGFAEEQKSKPEETRLISETSGLF-SADNVANII  255

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             L     G F  +  L+G  LS  T G SP  S + A  +    GI RI +L +  ++  I
Sbjct  256   LADTVRGRFFSSMGLDGIMLSSLTCGFSPVVSIMEATQQVLTMGIFRIISLIYLDHFDRI  315

Query  413   IQ  408
             I+
Sbjct  316   IR  317



>gb|KDO36513.1| hypothetical protein CISIN_1g030328mg [Citrus sinensis]
Length=179

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+PV++PI +RHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK +I  A
Sbjct  25    IVRPKPVRIPIKDRHVFITGGSSGIGLALAHQAAKEGARVSILARSGEKLEEAKQSIQLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  +SADVRD+DAVK A++EAGP+DVLV N GV+   ELE Q ++EV++MIDVN+ 
Sbjct  85    TGIEVATYSADVRDFDAVKTALDEAGPVDVLVVNQGVFVPGELEVQSLDEVRLMIDVNII  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVG  822
             G+FH+IKAALP +I +  N GP SIA+MSSQAGQVG
Sbjct  145   GSFHMIKAALP-LIKKRQNGGPASIALMSSQAGQVG  179



>gb|KDO74752.1| hypothetical protein CISIN_1g0177571mg, partial [Citrus sinensis]
Length=226

 Score =   186 bits (472),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             IVRP+PV++PI +RHVFITGGSSGIGLALA QA  EGA+VSILAR+  KLE+AK +I  A
Sbjct  25    IVRPKPVRIPIKDRHVFITGGSSGIGLALAHQAAKEGARVSILARSGKKLEEAKQSIQLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  +SADVRD+DAVK A++EAGP+DVLV N GV+   ELE Q ++EV++MIDVN+T
Sbjct  85    TGIEVATYSADVRDFDAVKTALDEAGPVDVLVVNQGVFVPGELEVQSLDEVRLMIDVNIT  144

Query  929   GTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQ  828
             G+FH+IKAALP +I +  N GP SIA+MSSQAGQ
Sbjct  145   GSFHMIKAALP-LIKKRQNGGPASIALMSSQAGQ  177



>gb|AGT16861.1| 3-ketodihydrosphingosine reductase [Saccharum hybrid cultivar 
R570]
Length=206

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 136/234 (58%), Gaps = 62/234 (26%)
 Frame = -2

Query  1280  PRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG-  1104
             PR V++P+  RHVFI                                 +A+ AI R +G 
Sbjct  34    PRAVRIPLKGRHVFIG-------------------------------REARAAIQRDSGH  62

Query  1103  CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
               V   +ADVRD  AV RA+ EAGP++VLV NHG++ S+ELE Q+++E+K M+D+NL GT
Sbjct  63    DDVVVHAADVRDARAVVRALREAGPVNVLVYNHGMFISQELERQDMDEIKWMVDINLRGT  122

Query  923   FHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVI  744
             FHLIKA                          VGIYGYTAYSASKF LRG+ EALQ EV+
Sbjct  123   FHLIKA--------------------------VGIYGYTAYSASKFALRGLGEALQHEVV  156

Query  743   AHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGI  582
             A NIHVSLIFPP T T    +E KRRP++T+ +A      MKA++VAKK+L+GI
Sbjct  157   ADNIHVSLIFPPDTETLGFKEEHKRRPELTNIMA----GGMKADDVAKKALDGI  206



>gb|ELU06177.1| hypothetical protein CAPTEDRAFT_162669 [Capitella teleta]
Length=335

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 118/305 (39%), Positives = 180/305 (59%), Gaps = 17/305 (6%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P P+K  + N HV +TGGSSGIG A A +++  GA V++LARN  KL DAK  + + 
Sbjct  23    LIGPTPIK--LENAHVLVTGGSSGIGKATAAESLKRGASVTLLARNQAKLSDAKQYLEKK  80

Query  1109  -----TGCGVTAFSADV-RDYDAVKRAVEEA----GPIDVLVCNHGVYASKELEDQEVEE  960
                  T   V   S D+ R+Y AV++A+ +A    GP+DVLV + G       ED  V+E
Sbjct  81    FVKDPTKQKVQCISVDLSREYGAVEKAIRQAEENLGPVDVLVNSAGTSGCGSFEDLPVDE  140

Query  959   VKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGL  780
              K ++D+N  G  +  KA    +I +   R  G I  +SSQAGQ+G++G++AYSASKF L
Sbjct  141   FKRLMDINYLGCVYATKA----LIKQMKQRQHGRIIFVSSQAGQLGLFGFSAYSASKFAL  196

Query  779   RGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAK  600
             RG+AEALQ E+  +N++V+L FPP T TP  A E+  +P+ T  I+ ++G F +A  VAK
Sbjct  197   RGLAEALQMELKPYNVYVTLAFPPDTDTPGFATELATKPKETKLISETAGLF-QASYVAK  255

Query  599   KSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWY  420
             K +     G F     ++G+ LS  T G++P  S + A  +  L  + R  +L +  ++ 
Sbjct  256   KMMKDSIRGKFLSYMGMDGYMLSCITCGMAPVVSIMEATQQVLLMSVFRAISLFYLDSFD  315

Query  419   TIIQK  405
              I+++
Sbjct  316   RIVKQ  320



>gb|AFM78304.1| 3-ketodihydrosphingosine reductase [Crassostrea gigas]
Length=328

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 170/296 (57%), Gaps = 23/296 (8%)
 Frame = -2

Query  1268  KVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAI----------  1119
             K+ +   HV ITGGSSGIG ALA++AV  GA V+I+ARN  KLEDAK  I          
Sbjct  25    KIKLKGAHVLITGGSSGIGKALAIEAVKNGANVTIMARNEKKLEDAKEEIESHIKDKDAQ  84

Query  1118  -LRATGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMID  942
              + +T   +T  +  V++  AVK+A    GP+ +L+ N G   +   ED   E+ + M+D
Sbjct  85    KVFSTSVDITKSAEMVKE--AVKKAENNLGPVTILINNAGSAVAGNFEDTSSEQFQRMMD  142

Query  941   VNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEA  762
             +N  G  ++ KAAL GM     N G G I  +SSQAGQVG++GYTAYSASKF LRG AE+
Sbjct  143   LNFLGGVNVTKAALKGM---KDNNG-GRIVFISSQAGQVGVFGYTAYSASKFALRGFAES  198

Query  761   LQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGI  582
             LQ EV  +NI+V++ FPP T TP LA+E K +P+ T  I+ + G F    +VAK      
Sbjct  199   LQMEVKPYNIYVTMAFPPDTDTPGLAEENKSKPRETLLISDTVGLF-SPSDVAKSVFKDA  257

Query  581   KCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
               G F     ++G+ L   ++G+SP TS L    +    G+ R     F C +Y +
Sbjct  258   VNGKFLSYVGMDGWLLCNLSSGMSPATSVLDLLQQIFTMGLFR-----FVCQFYLL  308



>gb|KDR24480.1| 3-ketodihydrosphingosine reductase [Zootermopsis nevadensis]
Length=330

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 173/301 (57%), Gaps = 14/301 (5%)
 Frame = -2

Query  1259  ISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDA----KHAILRATGCGVT  1092
             + N+HV ITGGSSGIG  +A++A A GA V+++AR+  KLE A    K   L      V 
Sbjct  30    LKNKHVVITGGSSGIGKCVAIEAAASGANVTLIARDVKKLESAVSEVKKHCLNHEDQKVQ  89

Query  1091  AFSADV-RDYDAVKRAV----EEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
               S DV  +YD +++ +    +E GPI +LV   G+     LED  V ++K ++++N  G
Sbjct  90    YISLDVSENYDEIEKVLHGAEDEIGPISMLVNCAGMAICGRLEDTSVNDIKYLLNLNFLG  149

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             T   IKA    +ISR   RG G I I++SQA  +GIYGYT YS++KF LRG+AE+L  EV
Sbjct  150   TLFPIKA----VISRMKGRGEGRIVIVASQAAMLGIYGYTVYSSTKFALRGLAESLHMEV  205

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
               +NI V+L  PP T TP  A E K +P  T  I+ S+G  +  E VAK+ +     G+F
Sbjct  206   KPYNISVTLSLPPDTDTPGFANEEKSKPMETRLISQSAG-IVSPEVVAKQIMKDALTGNF  264

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQKWHPGNK  387
                   EGF L+   AG++P +S L    +  L GIMR+ ++ +  +++ II+K      
Sbjct  265   YSTVGSEGFMLTTLCAGMAPVSSVLELITQVSLMGIMRLVSVHYLMSFHRIIRKCMKTRN  324

Query  386   Q  384
             Q
Sbjct  325   Q  325



>ref|NP_001170115.1| uncharacterized protein LOC100384036 precursor [Zea mays]
 gb|ACN35871.1| unknown [Zea mays]
Length=193

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
              RPR  +VP+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LEDA+ AI R +
Sbjct  23    TRPRAARVPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEDARAAIQRDS  82

Query  1106  G-CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             G   V   +ADVRD  AV RA++EAGP+DVLVCNHGV+  +ELE Q+V+E+K M+D+NL 
Sbjct  83    GRDDVGVHAADVRDAGAVARALQEAGPVDVLVCNHGVFVPQELEGQDVDEIKWMVDINLM  142

Query  929   GTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQV  825
             G+FHLIKAALP M +R    R PGSIAIMSSQAGQV
Sbjct  143   GSFHLIKAALPAMKARTRETRLPGSIAIMSSQAGQV  178



>gb|AFW63522.1| hypothetical protein ZEAMMB73_346365 [Zea mays]
Length=193

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPR  +VP+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LEDA+ AI R +G
Sbjct  24    RPRAARVPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEDARAAIQRDSG  83

Query  1103  -CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
                V   +ADVRD  AV RA++EAGP+DVLVCNHGV+  +ELE Q+V+E+K M+D+NL G
Sbjct  84    RDDVGVHAADVRDAGAVARALQEAGPVDVLVCNHGVFVPQELEGQDVDEIKWMVDINLMG  143

Query  926   TFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQV  825
             +FHLIKAALP M +R    R PGSIAIMSSQAGQV
Sbjct  144   SFHLIKAALPAMKARTRETRLPGSIAIMSSQAGQV  178



>gb|ACN26335.1| unknown [Zea mays]
 gb|AFW63521.1| hypothetical protein ZEAMMB73_346365 [Zea mays]
Length=202

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRAT  1107
              RPR  +VP+  RHVFITGGSSGIGLA+A  A  EGA+VSILARN  +LEDA+ AI R +
Sbjct  23    TRPRAARVPLKGRHVFITGGSSGIGLAMATAAAREGARVSILARNLARLEDARAAIQRDS  82

Query  1106  G-CGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             G   V   +ADVRD  AV RA++EAGP+DVLVCNHGV+  +ELE Q+V+E+K M+D+NL 
Sbjct  83    GRDDVGVHAADVRDAGAVARALQEAGPVDVLVCNHGVFVPQELEGQDVDEIKWMVDINLM  142

Query  929   GTFHLIKAALPGMISRP-ANRGPGSIAIMSSQAGQ  828
             G+FHLIKAALP M +R    R PGSIAIMSSQAGQ
Sbjct  143   GSFHLIKAALPAMKARTRETRLPGSIAIMSSQAGQ  177



>ref|XP_008801798.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Phoenix dactylifera]
Length=191

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             +VRPRPV++P+  RHVFITGGSSGIGLA+A +A AEGA+VSILAR+A +L++A+ AI  A
Sbjct  25    LVRPRPVRIPVKGRHVFITGGSSGIGLAIARRAAAEGARVSILARSAARLKEARDAIRLA  84

Query  1109  TGCGVTAFSADVRDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLT  930
             TG  V  FSADVRD +AV R VE AGPID+LVCNHGV+  +ELE Q++EEV+ M+DVNL 
Sbjct  85    TGVDVALFSADVRDAEAVAREVEAAGPIDLLVCNHGVFTPQELEHQDLEEVRFMVDVNLM  144

Query  929   GTFHLIKAALPGMISRPANRG-PGSIAIMSSQAGQVGIYGYTAYSA  795
             GTF+LIKAALP M  R    G P SI+IMSSQAG+V I    + SA
Sbjct  145   GTFNLIKAALPAMKQRARATGLPASISIMSSQAGRVLIPSPNSPSA  190



>ref|XP_008432309.1| PREDICTED: 3-ketodihydrosphingosine reductase [Poecilia reticulata]
Length=359

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/303 (39%), Positives = 182/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG ++A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKSIAVECYRQGAFITLVARDEEKLLSAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+L+   G   S + E+ EVE  K
Sbjct  107   AINDKQVVLCVSVDVSSDYTQVENVIKQAQEKLGPVDMLINCAGTSISAKFEEMEVERFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              MID+N  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYSASKF LRG
Sbjct  167   EMIDLNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSASKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V+L FPP T TP LA+E K +P  T  I+ +SG + + ++VAK  
Sbjct  223   LAEALQMEVKPYNIYVTLAFPPDTDTPLLAEENKSKPLETKLISETSGVW-QPDQVAKIF  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDGVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRSIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_006634509.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Lepisosteus 
oculatus]
Length=332

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 114/303 (38%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  I + 
Sbjct  22    LISPKPLK--LNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDENKLVQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV RDY      +K+A E+ GP+D+LV   G+  + + E+ EV+  K
Sbjct  80    AINDKQVVLCISVDVSRDYGQVESVIKQAQEKLGPVDMLVNCAGISVAAKFEEVEVDRFK  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M  R   R    I  +SSQAGQVG++GYTAYS SKF LRG
Sbjct  140   RLMEVNYLGSVYPTRAVMNTMKERRVGR----IVFVSSQAGQVGLFGYTAYSPSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI++++++PP T TP LA+E K +P  T  I+ +SG   + E+VAK  
Sbjct  196   LAEALQMEVKPYNIYLTVVYPPDTDTPGLAEENKTKPLETKMISETSG-ICQPEQVAKIV  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_007559453.1| PREDICTED: 3-ketodihydrosphingosine reductase [Poecilia formosa]
Length=359

 Score =   174 bits (440),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 182/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG ++A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKSIAVECYRQGAFITLVARDEEKLLRAKKEVEKY  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+L+   G   S + E+ EVE  K
Sbjct  107   AINDKQVVLCVSVDVSSDYTQVENVIKQAQEKLGPVDMLINCAGTSISAKFEEMEVERFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              MI++N  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYSASKF LRG
Sbjct  167   EMIELNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSASKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V+L FPP T TP LA+E K +P  T  I+ +SG + + ++VAK  
Sbjct  223   LAEALQMEVKPYNIYVTLAFPPDTDTPLLAEENKSKPLETKLISETSGVW-QPDQVAKIF  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRSIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_003386428.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Amphimedon 
queenslandica]
Length=323

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/293 (37%), Positives = 175/293 (60%), Gaps = 10/293 (3%)
 Frame = -2

Query  1268  KVPISNRHVFITggssgiglalaLQAVAEGAK-VSILARNAGKLEDAKHAILRA-TGCGV  1095
             K  I  +H+ ITGGSSGIG ++A++++  GA  V++LARN  KL+  K  + +  T   +
Sbjct  30    KHSIKGKHLLITGGSSGIGKSIAIESLKRGADSVTLLARNKDKLKLVKEELEKQFTNKSI  89

Query  1094  TAFSADVRDYDA---VKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGT  924
                S DV   DA   +K+ +++  P+DVL+ + G+  +  L + + +  + +   N+ G+
Sbjct  90    NILSVDVGHSDAENVIKKLLKDMPPVDVLINSAGITHTASLTNTDRKMFESLYATNVLGS  149

Query  923   FHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVI  744
               + +A LP M     +R  G I  +SSQAGQ  +YGYTAYSA+KF LRG+AE L  E+ 
Sbjct  150   VAVTRAILPAM----KDRKSGHIVFISSQAGQFPVYGYTAYSATKFALRGLAEVLAMELR  205

Query  743   AHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFS  564
              H I VS+ FPP T TP L +E+K+R  +  ++A S    +K E+VA + ++GI+ G+F 
Sbjct  206   PHKIRVSISFPPDTDTPQLDEELKQRSGLVKELA-SYSQTIKPEQVASEVVSGIERGAFG  264

Query  563   VACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             +    +GF L+  T+G +P +S    FV+  L G+ R+ A+C+   +  I+++
Sbjct  265   IYHTFDGFMLNTMTSGAAPFSSLWELFVQVMLMGLFRLVAVCYLFQFNRIVKR  317



>ref|XP_009051035.1| hypothetical protein LOTGIDRAFT_213963 [Lottia gigantea]
 gb|ESO98337.1| hypothetical protein LOTGIDRAFT_213963 [Lottia gigantea]
Length=322

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 118/312 (38%), Positives = 182/312 (58%), Gaps = 19/312 (6%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAK-----H  1125
             ++ P+P+   ++  HV +TGGSSGIG ALA+    +GA V++LARN  KL++AK     H
Sbjct  13    LITPKPLN--LTGAHVLVTGGSSGIGKALAINVAKQGANVTLLARNKNKLQEAKVEVEKH  70

Query  1124  AILRATGCGVTAFSADV-RDYDAVKRAVEEA----GPIDVLVCNHGVYASKELEDQEVEE  960
              I + T   +   S D+ ++Y+ V++AV++A    G + +L+   G   +   E+  V E
Sbjct  71    FINKDTQS-IICISVDISKEYEPVEKAVKQAEEKFGAVRLLINCAGTSIAGVFEELPVTE  129

Query  959   VKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGL  780
              K M+D+N  G+ ++ +A +P M         G I  +SSQAGQ+G++GYTAYSASKF L
Sbjct  130   FKRMLDINYLGSVYVTRAVIPTM----KKEHKGRIVFVSSQAGQLGLFGYTAYSASKFAL  185

Query  779   RGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAK  600
             RG++EALQ E+  ++I V++ FPP T TP  A+E K +P+ T  I+  +G F    EVAK
Sbjct  186   RGLSEALQMELKPYDIRVTMAFPPDTDTPGYAEEQKTKPRETHLISEVAGLF-SPHEVAK  244

Query  599   KSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWY  420
               +     G F     L+G+ LS  T G+SP  S + A  +   +GI R+ +L F  +++
Sbjct  245   TIVEDSIKGKFFSYMGLDGYMLSSLTCGMSPVISMMDAAQQVVTSGIFRVISL-FYLDYF  303

Query  419   TIIQKWHPGNKQ  384
               I K    +KQ
Sbjct  304   DRIVKKCKNDKQ  315



>ref|XP_005796076.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Xiphophorus 
maculatus]
Length=359

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/303 (38%), Positives = 182/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG ++A+Q   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKSIAVQCYRQGAFITLVARDEEKLLRAKKEVEKY  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+L+   G   S + E+ EVE  K
Sbjct  107   AINDKQVVLCVSVDVSSDYTQVENVIKQAQEKLGPVDMLINCAGTSISAKFEEMEVERFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              M+++N  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYSASKF LRG
Sbjct  167   EMMELNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSASKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ FPP T TP LA+E K +P  T  I+ +SG + + ++VAK  
Sbjct  223   LAEALQMEVKPYNIYVTVAFPPDTDTPLLAEENKSKPLETKLISETSGVW-QPDQVAKIF  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRSIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_790962.3| PREDICTED: 3-ketodihydrosphingosine reductase [Strongylocentrotus 
purpuratus]
Length=339

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/303 (38%), Positives = 180/303 (59%), Gaps = 22/303 (7%)
 Frame = -2

Query  1274  PVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAK----HAILRAT  1107
             P ++ ++  HV ITGGSSGIG A+A++ + +GA V++LARN  +L+ AK      I+   
Sbjct  30    PKRMKLTKAHVVITGGSSGIGKAVAMEVLRQGASVTLLARNQERLKHAKLELEKYIIDKG  89

Query  1106  GCGVTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMID  942
                +   S D+ +DY     A++++VE  GP D+L+ + G  ++   E+ E+ E K  ++
Sbjct  90    YQKILCISVDLAKDYGSVEQAIQKSVEVIGPCDMLINSAGKSSALAFEELEISEFKKDME  149

Query  941   VNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEA  762
             VN  G+ +  +A LP M      R  G I  +SSQAGQ+G+YGY++YS SKF LRG AEA
Sbjct  150   VNYLGSVYATRAVLPYM----KKRSQGRIIFISSQAGQLGLYGYSSYSGSKFALRGFAEA  205

Query  761   LQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAK----KS  594
             LQ EV  +NI+V+L FPP T TP L  E++ +P+ T  I+ +SG +  A++VA+     S
Sbjct  206   LQMEVKPYNIYVTLNFPPDTDTPMLQAELETQPEETRLISETSGLY-AAQDVARIIVQDS  264

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             LN +    F     ++G+ LSI T G+SP TS ++   +    G+ R  +  +  ++  I
Sbjct  265   LNAV----FLSYVGMDGYMLSILTCGMSPVTSMMVGVQQVAFMGLFRFISHLYLGSFDRI  320

Query  413   IQK  405
             I++
Sbjct  321   IRR  323



>ref|XP_001365403.1| PREDICTED: 3-ketodihydrosphingosine reductase [Monodelphis domestica]
Length=332

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG ++A++   +GA ++++AR+  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKSIAIECYKQGAFITLVARDENKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G   S + ED E+   +
Sbjct  80    SINDKQVVLCISVDVSQDYGQVENVIKQAQEKLGPVDMLVNCAGSSVSGKFEDLEINYFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +  M  R   R    I  +SSQAGQ+G+YGYTAYSASKF LRG
Sbjct  140   RLMNINYLGSVYPSRAVITTMKERRMGR----IVFVSSQAGQLGLYGYTAYSASKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E K +P  T  I+ SS +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITIAYPPDTDTPGYAEENKTKPLETQLISESS-SLCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++  I
Sbjct  255   VKDATQGNFNSSIGSDGYMLSSLTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDGI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>ref|XP_009903254.1| PREDICTED: 3-ketodihydrosphingosine reductase [Picoides pubescens]
 gb|KFV70727.1| 3-ketodihydrosphingosine reductase [Picoides pubescens]
Length=332

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K+P    HV +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + 
Sbjct  22    LISPKPLKLP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   +
Sbjct  80    CVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  140   TLMAVNYLGSVYPSRAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI++++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  
Sbjct  196   LAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I
Sbjct  255   VKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIIGLFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_005149993.1| PREDICTED: 3-ketodihydrosphingosine reductase [Melopsittacus 
undulatus]
Length=332

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K+P    HV +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + 
Sbjct  22    LISPKPLKLP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   +
Sbjct  80    SVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNCFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  140   RLMAVNYLGSVYPSRAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  
Sbjct  196   LAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I
Sbjct  255   VKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIVGLFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|NP_001084704.1| 3-ketodihydrosphingosine reductase precursor [Xenopus laevis]
 gb|AAH68662.1| MGC81046 protein [Xenopus laevis]
Length=332

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 184/303 (61%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+ GKL  AK  I + 
Sbjct  22    LISPKPLK--LAGTHVVVTGGSSGIGKCVAIECFKQGAFITLVARDEGKLVQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S D+ +DY    + +K+A E+ GP+D+LV   G+  +   E+ E+++  
Sbjct  80    SVNDKQVVLCISVDISKDYRQVENVIKQAQEKLGPVDMLVNCAGMAIAGNFEEIEIDKFA  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +P M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  140   RLMEINYLGSVYPSRAVIPTMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ +PP T TP  A+E K +P + +K+   S +  +A++VA+  
Sbjct  196   LAEALQMEVKPYNIYVTVAYPPDTDTPGFAEENKTKP-LETKLISESSSLCQADQVARVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP T+      +    G+ RI AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSVGSDGYMLSSLTCGMSPVTTITEGLQQVVTMGLFRIIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_007229225.1| PREDICTED: 3-ketodihydrosphingosine reductase [Astyanax mexicanus]
Length=359

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/306 (37%), Positives = 181/306 (59%), Gaps = 21/306 (7%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG ++A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKSIAIECYKQGAFITLVARDESKLVQAKKEVEK-  105

Query  1109  TGCGVT------AFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVE  963
               C V         S DV +DY  V    K+A E+ GP+D+LV   G   S + E+ +VE
Sbjct  106   --CAVNDKQVVLCISVDVSKDYSQVESVIKQAQEKLGPVDMLVNCAGTAVSGKFEEVDVE  163

Query  962   EVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFG  783
               + +++VN  G+ +  +A +  M  R   R    +  +SSQAGQ+G++GYTAYSASKF 
Sbjct  164   RFRSLMEVNYLGSVYPTRAVITTMKERRMGR----VVFVSSQAGQIGLFGYTAYSASKFA  219

Query  782   LRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVA  603
             LRG+AEALQ EV  +NI+V++ +PP T TP L +E K +P  T  I+ +SG   + E+VA
Sbjct  220   LRGLAEALQMEVKPYNIYVTVTYPPDTDTPCLTEENKTKPLETKLISETSGV-CQPEQVA  278

Query  602   KKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNW  423
             K  +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++
Sbjct  279   KVIVKDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSF  338

Query  422   YTIIQK  405
              +I+++
Sbjct  339   DSIVRR  344



>ref|XP_005509791.1| PREDICTED: 3-ketodihydrosphingosine reductase [Columba livia]
Length=332

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K+P    HV +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + 
Sbjct  22    LISPKPLKLP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   + + E+ EV   +
Sbjct  80    SVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEEIEVNSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  140   RLMAVNYLGSVYPSRAVITTM----KERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  
Sbjct  196   LAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I
Sbjct  255   VKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIVGLFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_003703294.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Megachile 
rotundata]
Length=330

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/304 (37%), Positives = 172/304 (57%), Gaps = 17/304 (6%)
 Frame = -2

Query  1259  ISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCG----VT  1092
             ++N+HV +TGGSSGIG  +A+ A   GA V+I+AR+  KLE A++ I+RA        V 
Sbjct  30    VNNKHVVVTGGSSGIGKCVAILAAKHGAHVTIIARDTQKLEVARNEIIRACKNKNVQKVE  89

Query  1091  AFSADV-RDYDAVKRAVEE----AGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
               S D+  DYDAV++A+ +     GPI +LV   G     ++ED  V ++K MID+N  G
Sbjct  90    YLSLDIGEDYDAVEKALNDLERTMGPIYMLVNCAGTAICGKIEDTSVADLKKMIDINFLG  149

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +++  KA  P M +       G I + SSQA  +GI+GY+AY ++KF LRG+AE++  E+
Sbjct  150   SYYCTKAVTPRMKASQ----EGIIILTSSQAALLGIFGYSAYCSTKFALRGLAESISMEL  205

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
               +NI V+L  PP T TP  A E   +P + +K+   + + +  E VA K       G F
Sbjct  206   SPYNISVTLCLPPDTDTPGFAIEELSKP-LETKLISQTASLVSPEVVADKLFKDALAGKF  264

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQ---KWHP  396
                  +EGF L++  AG+SP  S +    ++ L G+ R+A+  +  N+  IIQ   K   
Sbjct  265   FSTVGIEGFMLTVLCAGMSPFNSIMELLSQSMLVGLFRLASAWYLVNFKKIIQNCMKMRD  324

Query  395   GNKQ  384
              NK+
Sbjct  325   KNKK  328



>ref|XP_010584293.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Haliaeetus 
leucocephalus]
Length=332

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 178/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K+P    HV +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + 
Sbjct  22    LISPKPLKLP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV +DY+ V    K+A E  GP+D+LV   G   + + ED EV   +
Sbjct  80    CVNDKQVVLCISVDVSKDYEQVENVLKQAQERLGPVDMLVNCAGTSVTGKFEDIEVNSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  140   RLMAVNYLGSVYPSRAVIATM----KERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  
Sbjct  196   LAEALQMEVKHYNVYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I
Sbjct  255   VKDAVQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIVGLFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_004579510.1| PREDICTED: 3-ketodihydrosphingosine reductase [Ochotona princeps]
Length=332

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  +   ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMSVAGNFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF LRG
Sbjct  140   RLMNLNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTSICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+FS +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFSSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>ref|XP_010643178.1| PREDICTED: 3-ketodihydrosphingosine reductase [Fukomys damarensis]
 gb|KFO24490.1| 3-ketodihydrosphingosine reductase [Fukomys damarensis]
Length=315

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 182/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  5     LISPKPLALP--GAHVVVTGGSSGIGKCIAIECCKQGAFITLVARNEEKLLQAKKEIEKY  62

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV  DY+ V    K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  63    SINDKQVVLCISVDVSEDYNQVENVIKQAQEKLGPVDMLVNCAGMALAGKFEDLEVSTFE  122

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +  M+ R   R    I  +SSQAGQ+G++GYTAYS+SKF +RG
Sbjct  123   KLMNINYLGSVYPSRAVITTMMERRVGR----IVFVSSQAGQLGLFGYTAYSSSKFAIRG  178

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + +  K E+VAK+ 
Sbjct  179   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAKENKTKP-LETRLISETTSICKPEQVAKQI  237

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  238   VRDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  297

Query  413   IQK  405
             +++
Sbjct  298   VRR  300



>emb|CDW54506.1| 3 ketodihydrosphingosine reductase [Trichuris trichiura]
Length=328

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 9/291 (3%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             R +P+K   S  HV ITGGS GIG A+AL+AV  GA VSI+ARNA  LE     +  A+G
Sbjct  29    RCQPIK-NFSGYHVLITGGSKGIGKAIALEAVRRGADVSIIARNADALEQTAEELRLASG  87

Query  1103  CG--VTAFSADVRD----YDAVKRAVE-EAGPIDVLVCNHGVYASKELEDQEVEEVKVMI  945
              G  +  ++AD+ +       + R +E E GP+D+L+ N G      LED + E+    +
Sbjct  88    EGQKIFWYTADLSESWQRMSELMRKIELEGGPVDILINNVGRSVQAPLEDLKEEDFFDQM  147

Query  944   DVNLTGTFHLIKAALPGMISRPANRGPGS-IAIMSSQAGQVGIYGYTAYSASKFGLRGMA  768
              +N      + K  L  M  R +++     +  +SSQAGQ+G+YGYTAYSASKF LRG A
Sbjct  148   KLNYLTAACITKHVLISMKRRASDQLKNRRVCFVSSQAGQIGLYGYTAYSASKFALRGFA  207

Query  767   EALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLN  588
             EALQ E   +N+ +++ +PPHT T   A+E    P++T  I       MK  +V +  L+
Sbjct  208   EALQMECRPYNVWITIAYPPHTDTEGFAEEWNLTPELTKAITAGDTVPMKPADVGRHILD  267

Query  587   GIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCF  435
              +  G FS    LEG+ LS   AG+SP  S+     +A   G +R+  L +
Sbjct  268   SVAKGEFSCHMGLEGWMLSTVCAGMSPANSWRDTITQALAMGPLRLVGLFY  318



>ref|XP_005081509.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Mesocricetus 
auratus]
Length=332

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECFKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEELEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS+SKF +RG
Sbjct  140   KLMSVNYLGSVYPSRAVISTMKERRVGR----IVFVSSQAGQLGLFGYTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTSICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ RI AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRIIALFYLGSFDNI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_010783607.1| PREDICTED: 3-ketodihydrosphingosine reductase [Notothenia coriiceps]
Length=359

 Score =   168 bits (426),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARNEAKLLQAKKELEKF  106

Query  1109  TGCG---VTAFSADVR-DYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY  V    K+A E+ GP+D+LV   G+  S + ED EV+  K
Sbjct  107   AINDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGLAISGKFEDIEVDRFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KLMEVNYLGSVYPTRAVITTM----KERRMGRILFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T+ I+ +SG   + ++VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKSKPLETTLISETSGV-CQPDQVAKII  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNCSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_005300915.1| PREDICTED: 3-ketodihydrosphingosine reductase [Chrysemys picta 
bellii]
Length=333

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K+P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL   K  I + 
Sbjct  23    LISPKPLKLP--GAHVVVTGGSSGIGKCVAIECYKQGAFITLIARNESKLLQTKKEIEKY  80

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+L+   G   + + ED EV   +
Sbjct  81    SVNDKQVVLCISVDVSKDYGHVENVLKQAQEKLGPVDMLINCAGTSVTGKFEDLEVSCFE  140

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +    A   +I+    R  G I  +SSQAGQVG++GYTAYS +KF LRG
Sbjct  141   RLMAVNYLGSVY----ASHAIIATMKERRMGRIVFVSSQAGQVGLFGYTAYSPTKFALRG  196

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ +PP T TP  A+E+K +P + +K+   + +  +AE+VA+  
Sbjct  197   LAEALQMEVKPYNIYVTVAYPPDTDTPGFAEEIKTKP-LETKLISEASSVCQAEQVARVI  255

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+     +G+ LSI T+G+SP T+      +    GI RI  L +  ++ +I
Sbjct  256   VKDAIQGNFNSFMGSDGYMLSILTSGMSPVTAITEGLQQVVCMGIFRIIGLFYLGSFDSI  315

Query  413   IQK  405
             +++
Sbjct  316   VRR  318



>ref|XP_003474120.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cavia porcellus]
Length=332

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEEKLLQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV  DY+ V    K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSEDYNQVENVIKQAQEKLGPVDMLVNCAGLALAGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M+ R   R    I  +SSQAGQ+G++GYTAYS+SKF +RG
Sbjct  140   KLMNVNFLGSVYPSRAVITTMMERRVGR----IVFVSSQAGQLGLFGYTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAMENKTKP-LETRLISETTSICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDGI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_006122949.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Pelodiscus 
sinensis]
Length=333

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 178/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K+P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL   K  I + 
Sbjct  23    LISPKPLKLP--GAHVVVTGGSSGIGKCVAIECYKQGAFITLIARNESKLLQTKKEIEKY  80

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+L+   G   + + ED EV   +
Sbjct  81    SVNDKQVVLCISVDVSKDYGHVENVLKQAQEKLGPVDMLINCAGTAITGKFEDLEVSCFE  140

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +   A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  141   RLMAVNYLGSVYPSYAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRG  196

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
              AEALQ EV  +NI+V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  
Sbjct  197   FAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVL  255

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+     +G+ LSI T+G+SP TS   A  +    GI RI  L +  ++ +I
Sbjct  256   VKDAIQGNFNSFMGSDGYMLSILTSGMSPVTSITEALQQVVCMGIFRIIGLFYLGSFDSI  315

Query  413   IQK  405
             +++
Sbjct  316   VRR  318



>ref|XP_005526524.1| PREDICTED: 3-ketodihydrosphingosine reductase [Pseudopodoces 
humilis]
Length=332

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+ +K+P    HV +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + 
Sbjct  22    LISPKSLKLP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   +
Sbjct  80    SVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  140   RLMAVNYLGSVYPSRAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I
Sbjct  255   VKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIIGLFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_003977645.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Takifugu 
rubripes]
Length=332

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILR-  1113
             ++ P+P+K  ++  HV +TGGSSGIG A+A++   +GA ++++AR+  KL  AK  + + 
Sbjct  22    LISPKPLK--LNGAHVVVTGGSSGIGKAIAVECYRQGAFITLVARDEAKLLQAKKEVEKF  79

Query  1112  ------ATGCGVTAFSADVRDYDAV-KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                      C     S+D  + ++V K+A E+ GP+D+LV   G   S + ED EV+  +
Sbjct  80    AINDKQVVVCTSVDVSSDYHEVESVLKQAQEKLGPVDMLVNCAGTSLSGKFEDVEVDNFR  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  140   KLMEVNYLGSVYPTRAVITTMKERRMGR----IMFVSSQAGQIGLFGYTAYSPSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E + +P  T  I+ +SG   + ++VAK  
Sbjct  196   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENRTKPLETKLISETSGV-CQPDQVAKVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ L+  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  255   VRDAVQGNFNSSVGPDGYMLAAVTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>gb|AEA51181.1| ketodihydrosphingosine reductase, partial [Oryzias melastigma]
Length=336

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGS GIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  6     LISPKPLK--LNGAHVVVTGGSGGIGKCIAIECYRQGAFITLVARDEDKLLKAKKEVEQF  63

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S D+  DY    + +K+A E+ GP+D+LV   G   + + E+ EVE  K
Sbjct  64    AVNDKQVVLCVSVDISSDYTQVENVIKQAQEKLGPVDMLVNCAGTAVAGKFEEMEVERFK  123

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  124   ELMEVNYLGSVYPTRAVITTMKERRMGR----IVFVSSQAGQIGLFGYTAYSPSKFALRG  179

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ FPP T TP LA+E K +P  T  I+ +SG + + ++VAK  
Sbjct  180   LAESLQMEMKPYNIYVTVAFPPDTDTPLLAEENKSKPLETKLISETSGVW-QPDQVAKVF  238

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  239   VKDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  298

Query  413   IQK  405
             +++
Sbjct  299   VRR  301



>ref|XP_010959583.1| PREDICTED: 3-ketodihydrosphingosine reductase [Camelus bactrianus]
Length=332

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SVNDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>ref|NP_001072722.1| 3-ketodihydrosphingosine reductase precursor [Xenopus (Silurana) 
tropicalis]
 gb|AAI25690.1| hypothetical protein MGC145456 [Xenopus (Silurana) tropicalis]
Length=332

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 184/303 (61%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+ GKL  AK  I + 
Sbjct  22    LISPKPLK--LAGAHVVVTGGSSGIGKCVAVECFKQGAFITLVARDEGKLVQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S D+ +DY    + +K+A E+ GP+D+LV   G+  +   E+ E+++  
Sbjct  80    SINDKQVVLCISVDISKDYRQVENVIKQAQEKLGPVDMLVNCAGMAIAGNFEEIEIDKFA  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A    +IS    R  G I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  140   RLMEINYLGSVYPSRA----VISTMKERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ +PP T TP  A+E K +P + +K+   S +  +A++VA+  
Sbjct  196   LAEALQMEVKPYNIYVTVAYPPDTDTPGFAEENKTKP-LETKLISESSSLCQADQVARVI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP T+      +    G+ RI AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSVGSDGYMLSSLTCGMSPVTTITEGLQQVVTMGLFRIIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_002713676.1| PREDICTED: 3-ketodihydrosphingosine reductase [Oryctolagus cuniculus]
Length=332

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMSVAGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF LRG
Sbjct  140   RLMNLNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSVGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>tpg|DAA15784.1| TPA: 3-ketodihydrosphingosine reductase precursor [Bos taurus]
Length=319

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 183/303 (60%), Gaps = 16/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    +  +SSQAGQ+G++GYTAYS+SKF LRG
Sbjct  140   RLMSINYLGSVYPSRAVIATMKERRMGR----VVFVSSQAGQLGLFGYTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAKENQTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +  ++ G+F+ +   +G+ LS  T G++P TS +    +    G+ R  AL +  ++ +I
Sbjct  255   VKDVQ-GNFNSSIGSDGYMLSSLTCGMAPVTSIMEGLQQVVTMGLFRTIALFYLGSFDSI  313

Query  413   IQK  405
             +++
Sbjct  314   VRR  316



>ref|NP_957433.1| 3-ketodihydrosphingosine reductase [Danio rerio]
 gb|AAH44552.1| 3-ketodihydrosphingosine reductase [Danio rerio]
Length=332

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 177/303 (58%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++    GA ++++AR+  KL  AK  + + 
Sbjct  22    LISPKPLK--LNGAHVVVTGGSSGIGKCIAMECYKHGAFITLVARDEHKLVQAKKEVEKF  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV +DY  V    K+A E+ GP+D+LV   G   S + E+ EV+  K
Sbjct  80    AINDKQVVLCISVDVAKDYSQVESVIKQAQEKLGPVDMLVNCAGTSLSGKFEEVEVDHFK  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              M++VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  140   KMMEVNYLGSVYPTRAVITTMKERRMGR----IMFVSSQAGQIGLFGYTAYSPSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ E+  +NI+V++ +PP T TP  A+E K +P  T  I+ +SG   + E+VAK  
Sbjct  196   LAEALQMEMKPYNIYVTVAYPPDTDTPGFAEENKTKPLETKLISETSGV-SQPEQVAKIV  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAVQGNFTSSFGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|NP_001039384.1| 3-ketodihydrosphingosine reductase precursor [Bos taurus]
 sp|Q2KIJ5.1|KDSR_BOVIN RecName: Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; 
AltName: Full=3-dehydrosphinganine reductase; AltName: 
Full=Follicular variant translocation protein 1 homolog; 
Short=FVT-1; Flags: Precursor [Bos taurus]
 gb|AAI12616.1| 3-ketodihydrosphingosine reductase [Bos taurus]
Length=331

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 183/303 (60%), Gaps = 16/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    +  +SSQAGQ+G++GYTAYS+SKF LRG
Sbjct  140   RLMSINYLGSVYPSRAVIATMKERRMGR----VVFVSSQAGQLGLFGYTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAKENQTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +  ++ G+F+ +   +G+ LS  T G++P TS +    +    G+ R  AL +  ++ +I
Sbjct  255   VKDVQ-GNFNSSIGSDGYMLSSLTCGMAPVTSIMEGLQQVVTMGLFRTIALFYLGSFDSI  313

Query  413   IQK  405
             +++
Sbjct  314   VRR  316



>ref|XP_010728300.1| PREDICTED: 3-ketodihydrosphingosine reductase [Larimichthys crocea]
Length=359

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 178/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGSHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY  V    K+A E+ GP+D+LV   G   S + ED +V+  K
Sbjct  107   AINDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEDMDVDRFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              M++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KMMEVNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T  I+ ++G   + ++VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETAGV-CQPDQVAKII  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_010978297.1| PREDICTED: 3-ketodihydrosphingosine reductase [Camelus dromedarius]
Length=332

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SVNDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSAFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>ref|NP_001101812.1| 3-ketodihydrosphingosine reductase [Rattus norvegicus]
 gb|EDL91747.1| follicular lymphoma variant translocation 1 (predicted), isoform 
CRA_a [Rattus norvegicus]
Length=332

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSKSGKFEELEVSSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   KLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + A  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTAVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>ref|XP_004893336.1| PREDICTED: 3-ketodihydrosphingosine reductase [Heterocephalus 
glaber]
 ref|XP_004858504.1| PREDICTED: 3-ketodihydrosphingosine reductase [Heterocephalus 
glaber]
 gb|EHB08560.1| 3-ketodihydrosphingosine reductase [Heterocephalus glaber]
Length=332

 Score =   165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEEKLLQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV  DY+ V    K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSEDYNQVENVIKQAQEKLGPVDMLVNCAGMALAGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +  M+ R   R    I  +SSQAGQ+G++GYTAYS+SKF +RG
Sbjct  140   KLMNINYLGSVYPSRAVITTMMERRVGR----IVFVSSQAGQLGLFGYTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAMENKTKP-LETRLISETTSICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>dbj|BAE41541.1| unnamed protein product [Mus musculus]
Length=315

 Score =   165 bits (417),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  5     LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  62

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   S + E+ EV   +
Sbjct  63    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFE  122

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  123   KLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  178

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + A  K E+VAK+ 
Sbjct  179   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTAICKPEQVAKQI  237

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++  I
Sbjct  238   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNI  297

Query  413   IQK  405
             +++
Sbjct  298   VRR  300



>ref|XP_008290350.1| PREDICTED: 3-ketodihydrosphingosine reductase [Stegastes partitus]
Length=359

 Score =   166 bits (419),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEDKLLQAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+LV   G   S + E+ EV+  K
Sbjct  107   AINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSISGKFEEVEVDRFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KLMEVNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T  IA +SG   + ++VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLIAETSGV-CQPDQVAKIV  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_004638316.1| PREDICTED: 3-ketodihydrosphingosine reductase [Octodon degus]
Length=332

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEEKLLQAKKEIEKY  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV  DY+ V    K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSEDYNQVENVIKQAQEKLGPVDMLVNCAGLALAGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +  M+ R   R    I  +SSQAGQ+G++GYTAYS SKF +RG
Sbjct  140   KLMNINYLGSVYPSRAVITTMMERRVGR----IVFVSSQAGQLGLFGYTAYSPSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP LA E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGLALENKTKP-LETRLISETTSICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_002127644.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X1 
[Ciona intestinalis]
Length=331

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 171/302 (57%), Gaps = 17/302 (6%)
 Frame = -2

Query  1277  RPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAI---LRAT  1107
             RP ++ ++  HV +TGGSSGIGL +A +   +G  VS++ARN  +L+ AK  +   L+  
Sbjct  21    RPSRLNLTGAHVMVTGGSSGIGLEVAKECARQGGFVSLVARNEQRLKQAKSEVEEHLKGG  80

Query  1106  G---CGVTAFSADVRD-----YDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKV  951
             G   C VT    DV +      + +++  E+ GP+DVLV   GV  ++  ED   E+ + 
Sbjct  81    GDRQC-VTILPLDVSESYGKVQEGIRKVEEKLGPVDVLVNCAGVSHAEVFEDTPAEKFEW  139

Query  950   MIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGM  771
             ++ +N  G+ +  KA + GM  R   R    IA +SSQAGQ G++GYT Y+A+KF LRG+
Sbjct  140   LMKINYLGSVYCTKAVVSGMKLRKKGR----IAFVSSQAGQTGVFGYTGYAATKFALRGL  195

Query  770   AEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSL  591
             AE LQ E+  +N+ V++ FPP T TP    E   +P+ T  I+ ++G F  AE VAK  +
Sbjct  196   AETLQMEIKPYNMAVTISFPPDTDTPGFHSEDDTKPEETRLISETAGLF-SAEVVAKSLV  254

Query  590   NGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTII  411
               I  G F     L+GF L   T G++P  S + A ++  L   +RI AL +  ++  I+
Sbjct  255   RDIVRGEFVNTIGLDGFILGNLTVGMAPCNSVVSATLQVILMSPLRIVALAYLKSFDVIV  314

Query  410   QK  405
              K
Sbjct  315   AK  316



>ref|XP_003490322.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Bombus impatiens]
Length=333

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/301 (37%), Positives = 172/301 (57%), Gaps = 18/301 (6%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATG  1104
             RPR V    + +HV +TGGSSGIG  +A+ A   GA V+I+AR+  KLE A++ I+ A  
Sbjct  29    RPRDV----NKKHVVVTGGSSGIGKCVAILAAKCGAHVTIIARDVHKLEVARNEIIHACK  84

Query  1103  CG----VTAFSADV-RDYDAVKRAVEE----AGPIDVLVCNHGVYASKELEDQEVEEVKV  951
                   V   S D+  DY+AV++A+ +     GPI +LV   G     ++ED  + +++ 
Sbjct  85    NKDVQKVEYLSLDIGEDYNAVEKALSDLERTMGPIYMLVNCAGTAICGKIEDTSIADLQK  144

Query  950   MIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGM  771
             MI++N  GT++ IKA    ++ R      G I + SSQA  +GI+GY+AY ++KF LRG+
Sbjct  145   MININFLGTYYCIKA----VVQRMKASQEGIIVLTSSQAALLGIFGYSAYCSTKFALRGL  200

Query  770   AEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSL  591
             AE++  E+  +NI V+L  PP T TP  A E   +P + +K+   + A +  E VA K  
Sbjct  201   AESISMELAPYNISVTLSLPPDTDTPGFAIEELSKP-LETKLISETSALVSPEVVANKLF  259

Query  590   NGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTII  411
                  G F     +EGF L++  +G+SP  S    F+++ L GI R+ + C+  ++ TII
Sbjct  260   KDALAGKFFSTVGMEGFMLTVLCSGMSPLNSIRELFLQSMLMGIFRLVSACYLVHFRTII  319

Query  410   Q  408
             Q
Sbjct  320   Q  320



>ref|XP_005323066.1| PREDICTED: 3-ketodihydrosphingosine reductase [Ictidomys tridecemlineatus]
Length=332

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  +L  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDRLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGLSLSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   KLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>ref|XP_003502008.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cricetulus griseus]
 ref|XP_007611353.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cricetulus griseus]
 gb|EGV98662.1| 3-ketodihydrosphingosine reductase [Cricetulus griseus]
Length=332

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCVAIECFKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSLSGKFEELEVSAFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   KLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAKENKTKP-LETRLISETTSICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ RI AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRIIALFYLGSFDNI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>gb|KFM80538.1| 3-ketodihydrosphingosine reductase, partial [Stegodyphus mimosarum]
Length=323

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 167/296 (56%), Gaps = 17/296 (6%)
 Frame = -2

Query  1283  RPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAI---LR  1113
             R RP+   +++ H  ITGGSSGIGLA+A +AV  GA V+I+AR+  +LE+AK  +   + 
Sbjct  20    RKRPIN--LNHDHFLITGGSSGIGLAIATEAVKLGANVTIIARSKVRLEEAKRMLCSEII  77

Query  1112  ATGCGVTAFSADV-----RDYDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVM  948
              +   + +FSADV     R  + VK A   AGPI  L+   G       ED  +E+   M
Sbjct  78    KSNQSILSFSADVCEQSNRLAEIVKEAEYNAGPITFLINCAGTSVCHRFEDTPIEDFSKM  137

Query  947   IDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMA  768
             ++VN  G+ ++  A LP M      R  G I  +SS AG +G++GYTAYSASKF L G+A
Sbjct  138   MNVNYLGSVNMTYAVLPLM----KQRKRGKIVFISSLAGLIGLFGYTAYSASKFALFGLA  193

Query  767   EALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLN  588
             +ALQ EV  +NI V++ FPP T TP  A+E+K +P  T +++ S G F  A+EVA K+L 
Sbjct  194   QALQMEVKPYNISVTVAFPPDTDTPGFAEEVKDKPDETMRMSESGGLF-SAKEVALKTLQ  252

Query  587   GIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMR--IAALCFQCN  426
                   F  +   EG+ L    +G +P  S L   ++    G +R  I    ++CN
Sbjct  253   DAFNKKFMSSIGFEGWILCTLGSGTAPVNSVLEFVMQMMTTGFLRLCIVFYLWKCN  308



>ref|XP_004379336.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform 1 [Trichechus 
manatus latirostris]
Length=332

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKQ  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  + + E+ EV   +
Sbjct  80    SVNDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMSLAGKFEELEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF LRG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ +PP T TP LA+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNIYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_004079405.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Oryzias latipes]
Length=359

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGS GIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSGGIGKCIAIECYRQGAFITLVARDEDKLLRAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+LV   G   + + E+ EVE  K
Sbjct  107   AINDKQVVLCVSVDVSSDYTQVENVIKQAQEKLGPVDMLVNCAGTAVAGKFEEMEVERFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++++N  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   ELMELNYLGSVYPTRAVITTM----KERRMGRIVFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ FPP T TP LA+E K +P  T  I+ +SG + + ++VAK  
Sbjct  223   LAESLQMEMKPYNIYVTVAFPPDTDTPLLAEENKSKPLETKLISETSGVW-QPDQVAKVF  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VKDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_003788462.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform 1 [Otolemur 
garnettii]
Length=332

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCVAIECYKQGAFITLVARNEDKLLQAKKEIGKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED +V   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLDVSSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G+YG+TAYS SKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLYGFTAYSPSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI+V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNIYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSFGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_001925948.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Sus 
scrofa]
Length=332

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>gb|ADD38841.1| 3-ketodihydrosphingosine reductase [Lepeophtheirus salmonis]
Length=335

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 163/290 (56%), Gaps = 9/290 (3%)
 Frame = -2

Query  1286  VRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAK-VSILARNAGKLEDAKHAILRA  1110
             +R + +   I   HV ITGGSSGIG A A + +  G   V++ ARN GKLEDA+  I++ 
Sbjct  25    IRRKKLTSSIPYSHVLITGGSSGIGKATAKEVLKRGTSLVTLWARNKGKLEDAREEIIKE  84

Query  1109  TGCGVTAFSADVRD-----YDAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMI  945
             TG  V  FS DV       ++  +  + + G + +++   G   +  +ED  +E+   M+
Sbjct  85    TGGRVNIFSVDVTGGLSGIHNVFEETIRDGGDLRMVIHCAGSSMAGTIEDTSIEDYNCMM  144

Query  944   DVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAE  765
             ++N  GT ++ K  LP  + +     P  I ++SS AG +G+YG+TAYSASKF LRG AE
Sbjct  145   NINYFGTVNVTKVVLP-HLKKENKEIPSRITLISSIAGVMGLYGFTAYSASKFALRGFAE  203

Query  764   ALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNG  585
             +L+ EV  H I V+L  PP T TP+ A+E K +P  T  ++ ++G F + E VAK  ++ 
Sbjct  204   SLEMEVRPHGISVTLNLPPDTDTPSFAEENKSKPLETKLLSETAGLF-QPETVAKGIVDD  262

Query  584   IKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCF  435
                G F  +  L+G+ +   T G+SP  SF   F++    G +R  + C+
Sbjct  263   TLNGVFLSSVGLDGWLIRCITCGMSP-VSFGTMFLQTFCVGPLRFVSWCY  311



>ref|XP_006993749.1| PREDICTED: 3-ketodihydrosphingosine reductase [Peromyscus maniculatus 
bairdii]
Length=332

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECFRQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEELEVSSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   KLMSINYLGSVYPSRAVIATMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + A  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTAICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|NP_081810.1| 3-ketodihydrosphingosine reductase precursor [Mus musculus]
 sp|Q6GV12.1|KDSR_MOUSE RecName: Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; 
AltName: Full=3-dehydrosphinganine reductase; AltName: 
Full=Follicular variant translocation protein 1 homolog; 
Short=FVT-1; Flags: Precursor [Mus musculus]
 gb|AAT57900.1| follicular lymphoma variant translocation 1 [Mus musculus]
 gb|AAH23820.2| 3-ketodihydrosphingosine reductase [Mus musculus]
 gb|EDL39860.1| mCG8996, isoform CRA_b [Mus musculus]
Length=332

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKDIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   KLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + A  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTAICKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_010883116.1| PREDICTED: 3-ketodihydrosphingosine reductase [Esox lucius]
Length=359

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/306 (36%), Positives = 180/306 (59%), Gaps = 21/306 (7%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG ++A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKSIAMECYRQGAFITLVARDESKLVQAKKEVEK-  105

Query  1109  TGCG------VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVE  963
               C       V   S DV +DY      +K+  E+ GP+D+LV   G   S + E+ E+E
Sbjct  106   --CAINDKQVVLCISVDVSKDYGQVESVIKQCQEKLGPVDMLVNCAGTSYSGKFEEVEME  163

Query  962   EVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFG  783
               + +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF 
Sbjct  164   RFRSLMEVNYLGSVYPTRAVITTM----KERRMGRILFVSSQAGQIGLFGYTAYSPSKFA  219

Query  782   LRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVA  603
             LRG+AEALQ E+  +NI+V++ +PP T TP LA+E + +P  T  I+ +SG   + E+VA
Sbjct  220   LRGLAEALQMEMKPYNIYVTVAYPPDTDTPGLAEENRTKPLETRLISETSGV-TQPEQVA  278

Query  602   KKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNW  423
             K  +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++
Sbjct  279   KILVKDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSF  338

Query  422   YTIIQK  405
              +I+++
Sbjct  339   DSIVRR  344



>ref|XP_002757353.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Callithrix 
jacchus]
Length=332

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLGLP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_005348350.1| PREDICTED: 3-ketodihydrosphingosine reductase [Microtus ochrogaster]
Length=332

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECFKQGAFITLVARNEDKLLQAKKEIEQH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSLSGKFEELEVSSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   KLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + A  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTAVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++  I
Sbjct  255   VKDAVQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_008589475.1| PREDICTED: 3-ketodihydrosphingosine reductase [Galeopterus variegatus]
Length=332

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S D+ +DY    + +K+A E+ GP+D+L+   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDISQDYKQVENVIKQAQEKLGPVDMLINCAGMSLSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS SKF LRG
Sbjct  140   KLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSPSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAKENETKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ RI AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRIIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_004398117.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform 1 [Odobenus 
rosmarus divergens]
Length=332

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETVSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_005721416.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Pundamilia 
nyererei]
Length=359

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+LV   G   S + E+ EV+  K
Sbjct  107   AINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KLMEVNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T  I+ +SG   + ++VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV-CQPDQVAKII  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_003438177.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X1 
[Oreochromis niloticus]
Length=359

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+LV   G   S + E+ EV+  K
Sbjct  107   AINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KLMEVNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T  I+ +SG   + ++VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV-CQPDQVAKII  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_004542772.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Maylandia 
zebra]
 ref|XP_005912786.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X1 
[Haplochromis burtoni]
Length=359

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+LV   G   S + E+ EV+  K
Sbjct  107   AINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KLMEVNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T  I+ +SG   + ++VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV-CQPDQVAKII  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>emb|CDQ69407.1| unnamed protein product [Oncorhynchus mykiss]
Length=425

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 178/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILR-  1113
             ++ P+P+K  ++  HV +TGGSSGIG ++A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKSIAMECYRQGAFITLVARDESKLVQAKKEVEKC  106

Query  1112  ------ATGCGVTAFSADVRDYDAV-KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                      C     S D R  ++V K+  E+ GP+D+LV   G   S + E+ EVE  +
Sbjct  107   AINDKQVVLCISVDVSKDYRQVESVIKQCQEKLGPVDMLVNCAGTSFSGKFEEVEVERFR  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              M++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   SMMEVNYLGSVYPTRAVITTM----KERRMGRILFISSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E + +P  T  I+ +SG   + E+VAK  
Sbjct  223   LAESLQMEMKPYNIYVTVAYPPDTDTPGLAEENRTKPLETRLISETSGV-TQPEQVAKIV  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VKDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_006892792.1| PREDICTED: 3-ketodihydrosphingosine reductase [Elephantulus edwardii]
Length=332

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECFKQGAFITLVARNEEKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G   S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGKAISGKFEELEVSSFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF LRG
Sbjct  140   RLMSVNYLGSVYASRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP L +E K +P  T  I+ ++ +  + E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLVEENKTKPLETQLISETT-SLCRPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+     +G+ LS  T G++P TS      +    G+ RI AL +  ++ +I
Sbjct  255   VRDAIQGNFNSTIGADGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRIIALFYLGSFDSI  314

Query  413   IQK  405
             I++
Sbjct  315   IRR  317



>ref|XP_008838877.1| PREDICTED: 3-ketodihydrosphingosine reductase [Nannospalax galili]
 ref|XP_008838878.1| PREDICTED: 3-ketodihydrosphingosine reductase [Nannospalax galili]
Length=332

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEELEVSAFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA+E K +P + +++   + A  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKP-LETRLISETTAVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>gb|KFQ29302.1| 3-ketodihydrosphingosine reductase, partial [Mesitornis unicolor]
Length=296

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDESKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDMEVNSFERLMAVNYLGSVYPSRAVITTMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>ref|XP_006837598.1| PREDICTED: 3-ketodihydrosphingosine reductase [Chrysochloris 
asiatica]
Length=332

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCVAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNKVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEELEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF LRG
Sbjct  140   RLMSINYLGSVYPSRAVIATMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP LA E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGLAVENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T+G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTSGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_007463758.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Lipotes 
vexillifer]
Length=332

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  80    SVNDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLAGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_006786523.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Neolamprologus 
brichardi]
Length=359

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKF  106

Query  1109  TGCG---VTAFSADVR-DY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY    + +K+A E+ GP+D+LV   G   S + E+ EV+  K
Sbjct  107   AINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSISGKFEEVEVDRFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KLMEVNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T  I+ +SG   + ++VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV-CQPDQVAKII  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_004059550.1| PREDICTED: 3-ketodihydrosphingosine reductase [Gorilla gorilla 
gorilla]
Length=332

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I   
Sbjct  22    LISPKPLTLP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_004268116.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform 1 [Orcinus 
orca]
Length=332

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLAGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|NP_001267248.1| 3-ketodihydrosphingosine reductase precursor [Pan troglodytes]
 dbj|BAK63140.1| 3-ketodihydrosphingosine reductase precursor [Pan troglodytes]
Length=332

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I   
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>gb|KFO99947.1| 3-ketodihydrosphingosine reductase, partial [Calypte anna]
Length=296

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 157/268 (59%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS + 
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDGVQGNFNSSVGSDGYMLSILTSGMSPVTSIME  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_009967943.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Tyto 
alba]
 gb|KFV54948.1| 3-ketodihydrosphingosine reductase, partial [Tyto alba]
Length=296

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 156/270 (58%), Gaps = 17/270 (6%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG-----VTAFSADV-RDYDAV----KRAVEEA  1035
             +GA ++++AR+  KL   K  I +   C      V   S DV +DY+ V    K+A E+ 
Sbjct  19    QGAFITLIARDENKLLQTKKEIEK--NCVNDKQVVLCISVDVSKDYEQVENVLKQAQEKL  76

Query  1034  GPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSI  855
             GP+D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I
Sbjct  77    GPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----I  132

Query  854   AIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEM  675
               +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E 
Sbjct  133   VFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEES  192

Query  674   KRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSF  495
             K +P + +K+   + +  +AE+VAK  +     G+F+ +   +G+ LSI T+G+SP TS 
Sbjct  193   KTKP-LETKLISETSSVCQAEQVAKVIVRDAIQGNFNSSVGSDGYMLSILTSGMSPVTSI  251

Query  494   LMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
                  +    GI RI  L +  ++ +I+++
Sbjct  252   TEGLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|NP_002026.1| 3-ketodihydrosphingosine reductase precursor [Homo sapiens]
 ref|XP_009250717.1| PREDICTED: 3-ketodihydrosphingosine reductase [Pongo abelii]
 sp|Q06136.1|KDSR_HUMAN RecName: Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; 
AltName: Full=3-dehydrosphinganine reductase; AltName: 
Full=Follicular variant translocation protein 1; Short=FVT-1; 
Flags: Precursor [Homo sapiens]
 emb|CAA45197.1| FVT1 [Homo sapiens]
 gb|AAH08797.1| KDSR protein [Homo sapiens]
 gb|AAP35428.1| follicular lymphoma variant translocation 1 [Homo sapiens]
 gb|AAX32630.1| follicular lymphoma variant translocation 1 [synthetic construct]
 gb|AAX32631.1| follicular lymphoma variant translocation 1 [synthetic construct]
 gb|EAW63140.1| follicular lymphoma variant translocation 1, isoform CRA_a [Homo 
sapiens]
 gb|EAW63141.1| follicular lymphoma variant translocation 1, isoform CRA_a [Homo 
sapiens]
 dbj|BAG35278.1| unnamed protein product [Homo sapiens]
 dbj|BAI47206.1| 3-ketodihydrosphingosine reductase [synthetic construct]
 gb|AIC54410.1| KDSR, partial [synthetic construct]
Length=332

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I   
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_007105173.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Physeter 
catodon]
Length=332

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 180/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  + + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLAGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>gb|AAP36892.1| Homo sapiens follicular lymphoma variant translocation 1 [synthetic 
construct]
 gb|AAX29236.1| follicular lymphoma variant translocation 1 [synthetic construct]
 gb|AAX29237.1| follicular lymphoma variant translocation 1 [synthetic construct]
Length=333

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I   
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>gb|KFP63603.1| 3-ketodihydrosphingosine reductase, partial [Cariama cristata]
Length=296

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_007898714.1| PREDICTED: 3-ketodihydrosphingosine reductase [Callorhinchus 
milii]
Length=355

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 178/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ PRP+K  ++  HV +TGGSSGIG  +A++    GA ++++AR+ GKL  AK  I + 
Sbjct  45    LISPRPLK--LNGAHVVVTGGSSGIGKCIAIECFKHGAFITLVARDEGKLLRAKKEIEKH  102

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S D+ +DY      +K+A E+ GP+D+L+   G   + + ED EV   +
Sbjct  103   SINDKQVVLCISVDISKDYGQVASVIKQAQEKLGPVDMLINCAGKSVAAKFEDIEVGLFR  162

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++ N  G+ +  +A +  M  R   R    I  +SSQAGQVG++GYTAYS SKF LRG
Sbjct  163   RLMETNYLGSIYPTRAVIHTMKERRLGR----IVFVSSQAGQVGLFGYTAYSPSKFALRG  218

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ EV ++NI++++ +PP T TP   +E K +P  T  I+ +SG   + ++VAK  
Sbjct  219   LAESLQMEVKSYNIYITVAYPPDTDTPGFQEENKDKPLETKLISETSG-LCQPDQVAKII  277

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +N    G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  278   VNDAVQGNFNSSIGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  337

Query  413   IQK  405
             +++
Sbjct  338   VRR  340



>gb|KFP12756.1| 3-ketodihydrosphingosine reductase, partial [Egretta garzetta]
Length=296

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_009695595.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cariama cristata]
Length=299

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  22    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  81

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  82    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  137

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  138   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  197

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  198   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  256

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  257   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  284



>ref|NP_001244872.1| 3-ketodihydrosphingosine reductase precursor [Macaca mulatta]
 ref|XP_003914502.1| PREDICTED: 3-ketodihydrosphingosine reductase [Papio anubis]
 ref|XP_008012056.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_010387105.1| PREDICTED: 3-ketodihydrosphingosine reductase [Rhinopithecus 
roxellana]
Length=332

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I   
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAMSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_004422659.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform 1 [Ceratotherium 
simum simum]
Length=332

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY    + +++A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYSQVENVIRQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS SKF +RG
Sbjct  140   RLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSPSKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_008210657.1| PREDICTED: 3-ketodihydrosphingosine reductase [Nasonia vitripennis]
Length=358

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 170/294 (58%), Gaps = 14/294 (5%)
 Frame = -2

Query  1259  ISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAIL---RATGCGVTA  1089
             + N+HV ITGGSSGIG A A+ A  EGA V+I +R   KL+ A+  I+   R+    V  
Sbjct  58    LHNKHVVITGGSSGIGKAFAILAAREGANVTIASRTREKLQLARDEIIEARRSKDQWVDH  117

Query  1088  FSADVRD--YDAVKRAVEEA----GPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
                DV    ++ ++RA ++     GP D+LV   G  A  ++ED E + +K +ID+N  G
Sbjct  118   LVLDVSSSSFERIQRAFDQLERQRGPCDLLVNCAGTAACSKIEDTEEDILKYLIDLNFIG  177

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             +++  KA +P M      R  G I ++SSQAG +GI+G++AYSA+KF LRG+AE+L  E+
Sbjct  178   SYNCTKAVVPSM----KRRKEGKIVLVSSQAGLLGIFGFSAYSATKFALRGLAESLAMEL  233

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
               +N+ V+L  PP T TP  A+E K +P + +K+   S A ++ EEVA+K L     G F
Sbjct  234   TPYNVSVTLSLPPDTDTPGFAEEEKSKP-LETKLISESAALVQPEEVAEKLLKDTLDGKF  292

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
                   E F L+   +G+SP  S     +++ L G +R+ +  +  ++  I+++
Sbjct  293   FSIIGFESFILTTLCSGMSPYGSLSELLLQSVLMGPLRMISAFYLYSFEKIVKR  346



>gb|KFO12735.1| 3-ketodihydrosphingosine reductase, partial [Balearica regulorum 
gibbericeps]
Length=296

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>gb|KFU92058.1| 3-ketodihydrosphingosine reductase, partial [Chaetura pelagica]
Length=296

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_005234053.1| PREDICTED: 3-ketodihydrosphingosine reductase [Falco peregrinus]
 ref|XP_005434991.1| PREDICTED: 3-ketodihydrosphingosine reductase [Falco cherrug]
Length=299

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  22    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  81

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  82    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  137

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  138   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  197

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  198   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  256

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  257   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  284



>ref|XP_009986955.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Tauraco 
erythrolophus]
 gb|KFV19448.1| 3-ketodihydrosphingosine reductase, partial [Tauraco erythrolophus]
Length=296

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 157/268 (59%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED E+   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEMNAFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYSA+KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSATKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>gb|KFM07495.1| 3-ketodihydrosphingosine reductase, partial [Aptenodytes forsteri]
 gb|KFW68969.1| 3-ketodihydrosphingosine reductase, partial [Pygoscelis adeliae]
Length=296

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDEKKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_003264348.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform 1 [Nomascus 
leucogenys]
Length=332

 Score =   162 bits (410),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I   
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSAFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP  A+E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_003396184.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Bombus terrestris]
Length=333

 Score =   162 bits (410),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 107/293 (37%), Positives = 168/293 (57%), Gaps = 14/293 (5%)
 Frame = -2

Query  1259  ISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCG----VT  1092
             ++ +HV +TGGSSGIG  +A+ A   GA V+I+AR+  KLE A++ I+ A        V 
Sbjct  33    VNKKHVVVTGGSSGIGKCVAILAAKCGAHVTIIARDVHKLEVARNEIIHACKNKDVQKVE  92

Query  1091  AFSADV-RDYDAVKRAVEE----AGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTG  927
               S D+  DY+AV++A+ +     GPI +LV   G     ++ED  + +++ MI +N  G
Sbjct  93    CLSLDIGEDYNAVEKALSDLERTMGPIYMLVNCAGTAICGKIEDTSIADLQKMISINFLG  152

Query  926   TFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEV  747
             T++ IKA    ++ R      G I + SSQA  +GI+GY+AY ++KF LRG+AE++  E+
Sbjct  153   TYYCIKA----VVQRMKASQEGIIVLTSSQAALLGIFGYSAYCSTKFALRGLAESISMEL  208

Query  746   IAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSF  567
               +NI V+L  PP T TP  A E   +P + +K+   + A +  E VA K       G F
Sbjct  209   APYNISVTLSLPPDTDTPGFAIEELSKP-LETKLISETSALVSPEVVANKLFKDALAGKF  267

Query  566   SVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQ  408
                  +EGF L++  +G+SP  S    F+++ L GI R+ + C+  ++ TIIQ
Sbjct  268   FSTVGMEGFMLTVLCSGMSPLNSIRELFLQSMLMGIFRLVSACYLVHFRTIIQ  320



>ref|XP_009277515.1| PREDICTED: 3-ketodihydrosphingosine reductase [Aptenodytes forsteri]
Length=313

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/292 (37%), Positives = 172/292 (59%), Gaps = 13/292 (4%)
 Frame = -2

Query  1256  SNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCG---VTAF  1086
             S R V +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + +      V   
Sbjct  12    SERGVKVTGGSSGIGKCIAIECYKQGAFITLIARDEKKLLQTKKEIEKYSVNDKQVVLCI  71

Query  1085  SADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTF  921
             S DV +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   + ++ VN  G+ 
Sbjct  72    SVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSV  131

Query  920   HLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIA  741
             +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  
Sbjct  132   YPSRAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKP  187

Query  740   HNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSV  561
             +NI+V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  +     G+F+ 
Sbjct  188   YNIYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNS  246

Query  560   ACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I+++
Sbjct  247   SVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIVGLFYLGSFDSIVRR  298



>gb|KFR09256.1| 3-ketodihydrosphingosine reductase, partial [Nipponia nippon]
Length=296

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKFSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_009999261.1| PREDICTED: 3-ketodihydrosphingosine reductase [Chaetura pelagica]
Length=341

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 177/303 (58%), Gaps = 17/303 (6%)
 Frame = -2

Query  1277  RPVKVPISNRHVFI----TggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             R V  P+S + VF+    TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + 
Sbjct  29    RSVLSPLSPQPVFVVGIVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKY  88

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   +
Sbjct  89    SVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFE  148

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG
Sbjct  149   RLMAVNYLGSVYPSRAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRG  204

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +NI++++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  
Sbjct  205   LAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVI  263

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I
Sbjct  264   VKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIVGLFYLGSFDSI  323

Query  413   IQK  405
             +++
Sbjct  324   VRR  326



>gb|KGL74479.1| 3-ketodihydrosphingosine reductase, partial [Tinamus guttatus]
Length=296

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYELVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDLLVNCAGTSVTGKFEDIEVNSFERLMGVNYLGSVYPSRAVISTMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIFGLFYLGSFDSIVRR  281



>ref|XP_005041668.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Ficedula 
albicollis]
Length=307

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 171/289 (59%), Gaps = 13/289 (4%)
 Frame = -2

Query  1247  HVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSAD  1077
             HV +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + +      V   S D
Sbjct  9     HVVVTGGSSGIGKCIAIECYKQGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVD  68

Query  1076  V-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLI  912
             V +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   + ++ VN  G+ +  
Sbjct  69    VSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPS  128

Query  911   KAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNI  732
             +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N+
Sbjct  129   RAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNV  184

Query  731   HVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACN  552
             ++++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  +     G+F+ +  
Sbjct  185   YITVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVG  243

Query  551   LEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
              +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I+++
Sbjct  244   SDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIIGLFYLGSFDSIVRR  292



>ref|XP_009324975.1| PREDICTED: 3-ketodihydrosphingosine reductase [Pygoscelis adeliae]
Length=313

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/292 (37%), Positives = 172/292 (59%), Gaps = 13/292 (4%)
 Frame = -2

Query  1256  SNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCG---VTAF  1086
             S R V +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + +      V   
Sbjct  12    SERGVKVTGGSSGIGKCIAIECYKQGAFITLIARDEKKLLQTKKEIEKYSVNDKQVVLCI  71

Query  1085  SADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTF  921
             S DV +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   + ++ VN  G+ 
Sbjct  72    SVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSV  131

Query  920   HLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIA  741
             +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  
Sbjct  132   YPSRAVIATMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKP  187

Query  740   HNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSV  561
             +NI+V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  +     G+F+ 
Sbjct  188   YNIYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNS  246

Query  560   ACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I+++
Sbjct  247   SVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIVGLFYLGSFDSIVRR  298



>ref|XP_009633299.1| PREDICTED: 3-ketodihydrosphingosine reductase [Egretta garzetta]
Length=341

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  64    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  123

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M      R  G I  
Sbjct  124   VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM----KERRMGRIVF  179

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  180   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  239

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  240   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  298

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  299   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  326



>gb|KGL93461.1| 3-ketodihydrosphingosine reductase, partial [Charadrius vociferus]
Length=296

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>ref|XP_004654848.1| PREDICTED: 3-ketodihydrosphingosine reductase [Jaculus jaculus]
Length=332

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++AR+  KL  AK  I + 
Sbjct  22    LMSPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEDKLLQAKKEIEKC  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G   + + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSLAGKFEELEVSVFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYS+SKF L+G
Sbjct  140   KLMSVNYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSSSKFALKG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP LA E K +P  T  I+ ++G   K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGLAAENKSKPLETRLISETTGV-CKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ RI AL +  ++  I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSCLTCGMTPVTSITEGLQQVVTMGLFRIIALFYLGSFDNI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_008490848.1| PREDICTED: 3-ketodihydrosphingosine reductase [Calypte anna]
Length=334

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 157/268 (59%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  57    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  116

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  117   VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  172

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  173   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  232

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS + 
Sbjct  233   KP-LETKLISETSSVCQAEQVARVIVKDGVQGNFNSSVGSDGYMLSILTSGMSPVTSIME  291

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  292   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  319



>gb|KFQ74065.1| 3-ketodihydrosphingosine reductase, partial [Phaethon lepturus]
Length=296

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>ref|XP_010304528.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Balearica 
regulorum gibbericeps]
Length=308

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  31    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  90

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  91    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  146

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  147   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  206

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  207   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  265

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  266   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  293



>ref|XP_006823632.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Saccoglossus 
kowalevskii]
Length=306

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 151/289 (52%), Gaps = 46/289 (16%)
 Frame = -2

Query  1196  QAVAEGAKVSILARNAGKLEDAKHAILRATGCGVTAFSADV-RDYDAVK-----------  1053
             +AV EGA V+I+ARN                  V +FS D+ +DY AV+           
Sbjct  28    EAVKEGANVTIIARNQK----------------VLSFSLDICKDYKAVEEVMKQERLRQS  71

Query  1052  -------------RAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLI  912
                          +A+++ GP  +L+   G+  +K   D +V E K ++DVN+ G+ +  
Sbjct  72    KEEICEHLRYPDEQAIDDGGPCGMLINCAGMAVAKSFADIDVAEFKNIMDVNVLGSVYAT  131

Query  911   KAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNI  732
             +A LP M      R  G I  +SSQAGQ+G+YGYTAY ASKF LRG AEALQ EV  ++I
Sbjct  132   RAVLPFM----KQRKQGRIVFISSQAGQIGLYGYTAYCASKFALRGFAEALQMEVKPYDI  187

Query  731   HVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACN  552
             ++++ FPP T TP    E   +P+ T+ I+ ++G F + E+VAK  +N    G F     
Sbjct  188   YITVSFPPDTDTPGFQAENISKPKETTLISETAGLF-QPEDVAKVIINDASLGRFLSYIG  246

Query  551   LEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             ++G+ LS  T G SP TS +    +    G  RI +  +  ++  II+K
Sbjct  247   VDGYMLSNVTCGFSPVTSMMEGVQQVATMGFFRIISFFYIGHFDKIIKK  295



>ref|XP_009501506.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Phalacrocorax 
carbo]
 gb|KFW90212.1| 3-ketodihydrosphingosine reductase, partial [Phalacrocorax carbo]
Length=296

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 155/267 (58%), Gaps = 13/267 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQ  408
                +    GI RI  L +  ++ +I++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVR  280



>gb|KFW79759.1| 3-ketodihydrosphingosine reductase, partial [Manacus vitellinus]
Length=296

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>gb|KFV04326.1| 3-ketodihydrosphingosine reductase, partial [Pterocles gutturalis]
Length=296

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSFTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAVQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_008332393.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cynoglossus semilaevis]
Length=359

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+K  ++  HV +TGGSSGIG ++A++   +GA ++++AR+  KL  AK  + + 
Sbjct  49    LISPKPLK--LNGAHVVVTGGSSGIGKSIAVECYRQGAFITLVARDEAKLLQAKKEVEKF  106

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
                    V   S DV  DY  V    K+A E+ GP+D+LV   G+  S + E+  V+  K
Sbjct  107   AINDKQVVLCISVDVASDYSQVESVIKQAQEKLGPVDMLVNCAGMSISGKFEEVPVDHFK  166

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              +++VN  G+ +  +A +  M      R  G I  +SSQAGQ+G++GYTAYS SKF LRG
Sbjct  167   KIMEVNYLGSVYPTRAVITTM----KERRMGRIMFVSSQAGQLGLFGYTAYSPSKFALRG  222

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AE+LQ E+  +NI+V++ +PP T TP LA+E K +P  T  I+ +SG   + E+VAK  
Sbjct  223   LAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV-CQPEQVAKIV  281

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G+SP TS      +    G+ R  AL +  ++ +I
Sbjct  282   VRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSI  341

Query  413   IQK  405
             +++
Sbjct  342   VRR  344



>ref|XP_010194610.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Colius 
striatus]
 gb|KFP24432.1| 3-ketodihydrosphingosine reductase, partial [Colius striatus]
Length=296

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 155/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I +        V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYCVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_010226824.1| PREDICTED: 3-ketodihydrosphingosine reductase [Tinamus guttatus]
Length=315

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 157/268 (59%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  38    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYELVENVLKQAQEKLGP  97

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A    +IS    R  G I  
Sbjct  98    VDLLVNCAGTSVTGKFEDIEVNSFERLMGVNYLGSVYPSRA----VISTMKERRMGRIVF  153

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  154   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  213

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  214   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  272

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  273   GLQQVVCMGIFRIFGLFYLGSFDSIVRR  300



>gb|KFZ54004.1| 3-ketodihydrosphingosine reductase, partial [Podiceps cristatus]
Length=296

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>ref|XP_006913819.1| PREDICTED: 3-ketodihydrosphingosine reductase [Pteropus alecto]
Length=301

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 157/268 (59%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDY----DAVKRAVEEAGP  1029
             +GA ++++ARN  +L  AK  I + +      V   S DV +DY    + +K+A E+ GP
Sbjct  24    QGAFITLVARNEDRLLQAKKEIEKHSINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGP  83

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G+  S + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  84    VDMLVNCAGMSLSGKFEDLEVSTFERLMSVNYLGSVYPSRAVITTMKERRVGR----IVF  139

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQVG+YG+TAYS+SKF +RG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  140   LSSQAGQVGLYGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKT  199

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +++   + +    E+VAK+ +     G+F+ +   +G+ LS  T G++P TS   
Sbjct  200   KP-LETRLISETTSICTPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITE  258

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    G+ R+ +L +  ++ TII++
Sbjct  259   GLQQVATMGLFRVLSLLYLGSFDTIIRR  286



>gb|KFO87315.1| 3-ketodihydrosphingosine reductase, partial [Buceros rhinoceros 
silvestris]
Length=296

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 155/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILR---ATGCGVTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I +        V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKHYVTDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N+++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSIVTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>gb|KFR12241.1| 3-ketodihydrosphingosine reductase, partial [Opisthocomus hoazin]
Length=296

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNAFERLMGVNYLGSVYPSRAVIGTMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGVFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSIVTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQIVGMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_010284462.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketodihydrosphingosine reductase 
[Phaethon lepturus]
Length=311

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  34    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  93

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M      R  G I  
Sbjct  94    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM----KERRMGRIVF  149

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  150   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  209

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  210   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  268

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  269   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  296



>gb|KFV82759.1| 3-ketodihydrosphingosine reductase, partial [Struthio camelus 
australis]
Length=296

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYELVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDLLVNCAGTSVTGKFEDIEVNSFERLMGVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LS+ T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSLLTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>ref|XP_009473814.1| PREDICTED: 3-ketodihydrosphingosine reductase [Nipponia nippon]
Length=319

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  42    QGAFITLIARDENKLLQTKKEIEKFSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  101

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  102   VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  157

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  158   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  217

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  218   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  276

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  277   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  304



>ref|XP_009475917.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Pelecanus 
crispus]
 gb|KFQ56571.1| 3-ketodihydrosphingosine reductase, partial [Pelecanus crispus]
Length=296

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED +V   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIQVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>gb|KFO61744.1| 3-ketodihydrosphingosine reductase, partial [Corvus brachyrhynchos]
Length=296

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    G+ RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGVFRIIGLFYLGSFDSIVRR  281



>gb|ELK11102.1| 3-ketodihydrosphingosine reductase [Pteropus alecto]
Length=370

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/312 (35%), Positives = 180/312 (58%), Gaps = 22/312 (7%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVF---------ITggssgiglalaLQAVAEGAKVSILARNAGKLE  1137
             I +P+P    + +RH+          +TGGSSGIG  +A++   +GA ++++ARN  +L 
Sbjct  49    INKPKPAMKYLDSRHLLRGNHLPRRQVTGGSSGIGKCIAIECYKQGAFITLVARNEDRLL  108

Query  1136  DAKHAILRATGCG---VTAFSADV-RDY----DAVKRAVEEAGPIDVLVCNHGVYASKEL  981
              AK  I + +      V   S DV +DY    + +K+A E+ GP+D+LV   G+  S + 
Sbjct  109   QAKKEIEKHSINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKF  168

Query  980   EDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAY  801
             ED EV   + ++ VN  G+ +  +A +  M  R   R    I  +SSQAGQVG+YG+TAY
Sbjct  169   EDLEVSTFERLMSVNYLGSVYPSRAVITTMKERRVGR----IVFLSSQAGQVGLYGFTAY  224

Query  800   SASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFM  621
             S+SKF +RG+AEALQ EV  +N++V++ +PP T TP  A+E K +P + +++   + +  
Sbjct  225   SSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKP-LETRLISETTSIC  283

Query  620   KAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAAL  441
               E+VAK+ +     G+F+ +   +G+ LS  T G++P TS      +    G+ R+ +L
Sbjct  284   TPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVATMGLFRVLSL  343

Query  440   CFQCNWYTIIQK  405
              +  ++ TII++
Sbjct  344   LYLGSFDTIIRR  355



>gb|EMC82352.1| 3-ketodihydrosphingosine reductase, partial [Columba livia]
Length=296

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + E+ EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEEIEVNSFERLMAVNYLGSVYPSRAVITTMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



>ref|XP_005586579.1| PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Macaca 
fascicularis]
Length=332

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/303 (35%), Positives = 178/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  AK  I   
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G+  S + ED EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAMSGKFEDLEVSTFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ +N  G+ +  +A +  M  R   R    I  +SSQAGQ+G++G+TAYSASKF +RG
Sbjct  140   RLMSINYLGSVYPSRAVITTMKERRVGR----IVFVSSQAGQLGLFGFTAYSASKFAIRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP   +E + +P + +++   + +  K E+VAK+ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFVEENRTKP-LETRLISETTSVCKPEQVAKQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_008920713.1| PREDICTED: 3-ketodihydrosphingosine reductase [Manacus vitellinus]
Length=339

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  62    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  121

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M      R  G I  
Sbjct  122   VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM----KERRMGRIVF  177

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  178   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  237

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  238   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  296

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  297   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  324



>ref|XP_009945216.1| PREDICTED: 3-ketodihydrosphingosine reductase, partial [Leptosomus 
discolor]
 gb|KFQ06979.1| 3-ketodihydrosphingosine reductase, partial [Leptosomus discolor]
Length=296

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 155/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I +        V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYYVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  281



>ref|XP_010192796.1| PREDICTED: 3-ketodihydrosphingosine reductase [Mesitornis unicolor]
Length=400

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/292 (37%), Positives = 172/292 (59%), Gaps = 13/292 (4%)
 Frame = -2

Query  1256  SNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRATGCG---VTAF  1086
             S R V +TGGSSGIG  +A++   +GA ++++AR+  KL   K  I + +      V   
Sbjct  99    SERGVKVTGGSSGIGKCIAIECYKQGAFITLIARDESKLLQTKKEIEKYSVNDKQVVLCI  158

Query  1085  SADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTF  921
             S DV +DY+ V    K+A E+ GP+D+LV   G   + + ED EV   + ++ VN  G+ 
Sbjct  159   SVDVSKDYEQVENVLKQAQEKLGPVDMLVNCAGTSVTGKFEDMEVNSFERLMAVNYLGSV  218

Query  920   HLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIA  741
             +  +A +  M  R   R    I  +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  
Sbjct  219   YPSRAVITTMKERRMGR----IVFVSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKP  274

Query  740   HNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSV  561
             +NI+V++ +PP T TP  A+E K +P + +K+   + +  +AE+VA+  +     G+F+ 
Sbjct  275   YNIYVTVAYPPDTDTPGFAEESKTKP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNS  333

Query  560   ACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTIIQK  405
             +   +G+ LSI T+G+SP TS      +    GI RI  L +  ++ +I+++
Sbjct  334   SVGSDGYMLSILTSGMSPVTSITEGLQQVVCMGIFRIIGLFYLGSFDSIVRR  385



>ref|XP_009883578.1| PREDICTED: 3-ketodihydrosphingosine reductase [Charadrius vociferus]
Length=343

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  66    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  125

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M      R  G I  
Sbjct  126   VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATM----KERRMGRIVF  181

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  182   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  241

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  242   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  300

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  301   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  328



>ref|XP_010706767.1| PREDICTED: 3-ketodihydrosphingosine reductase [Meleagris gallopavo]
Length=325

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  48    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  107

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A    +IS    R  G I  
Sbjct  108   VDLLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRA----VISTMKERRMGRIVF  163

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP  A+E K 
Sbjct  164   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFAEESKT  223

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+     +G+ LSI T+G+SP TS   
Sbjct  224   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSFVGSDGYMLSILTSGMSPVTSITE  282

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  283   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  310



>ref|XP_007933684.1| PREDICTED: 3-ketodihydrosphingosine reductase [Orycteropus afer 
afer]
Length=332

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 179/303 (59%), Gaps = 15/303 (5%)
 Frame = -2

Query  1289  IVRPRPVKVPISNRHVFITggssgiglalaLQAVAEGAKVSILARNAGKLEDAKHAILRA  1110
             ++ P+P+ +P    HV +TGGSSGIG  +A++   +GA ++++ARN  KL  A+  I + 
Sbjct  22    LISPKPLALP--GAHVVVTGGSSGIGKCVAIECYKQGAFITLVARNEDKLLQARKEIEKH  79

Query  1109  TGCG---VTAFSADV-RDYDAV----KRAVEEAGPIDVLVCNHGVYASKELEDQEVEEVK  954
             +      V   S DV +DY+ V    K+A E+ GP+D+LV   G     + E+ EV   +
Sbjct  80    SINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSLPGKFEELEVSAFE  139

Query  953   VMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAIMSSQAGQVGIYGYTAYSASKFGLRG  774
              ++ VN  G+ +  +A +  M  R   RG G I  +SSQAGQ+G++GYTAYS+SKF LRG
Sbjct  140   KLMSVNYLGSVYPSRAVIATMKER---RG-GRIVFVSSQAGQLGLFGYTAYSSSKFALRG  195

Query  773   MAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKRRPQITSKIAVSSGAFMKAEEVAKKS  594
             +AEALQ EV  +N+++++ +PP T TP   QE K +P + +++   + +  + E+VA++ 
Sbjct  196   LAEALQMEVKPYNVYITVAYPPDTDTPGFVQENKTKP-LETRLISETTSVCRPEQVARQI  254

Query  593   LNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLMAFVEACLAGIMRIAALCFQCNWYTI  414
             +     G+F+ +   +G+ LS  T G++P TS      +    G+ R  AL +  ++ +I
Sbjct  255   VKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSI  314

Query  413   IQK  405
             +++
Sbjct  315   VRR  317



>ref|XP_009676018.1| PREDICTED: 3-ketodihydrosphingosine reductase [Struthio camelus 
australis]
Length=317

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  40    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYELVENVLKQAQEKLGP  99

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  100   VDLLVNCAGTSVTGKFEDIEVNSFERLMGVNYLGSVYPSRAVIATMKERRMGR----IVF  155

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI++++ +PP T TP  A+E K 
Sbjct  156   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYITVAYPPDTDTPGFAEESKT  215

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LS+ T+G+SP TS   
Sbjct  216   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSLLTSGMSPVTSITE  274

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  275   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  302



>ref|XP_005425902.1| PREDICTED: 3-ketodihydrosphingosine reductase [Geospiza fortis]
Length=344

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  67    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  126

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  127   VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  182

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  183   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  242

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  243   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  301

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  302   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  329



>ref|XP_009087246.1| PREDICTED: 3-ketodihydrosphingosine reductase [Serinus canaria]
Length=333

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 156/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  56    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  115

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    I  
Sbjct  116   VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----IVF  171

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +N++V++ +PP T TP  A+E K 
Sbjct  172   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEESKT  231

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  232   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  290

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  291   GLQQVVCMGIFRIIGLFYLGSFDSIVRR  318



>gb|KFO70544.1| 3-ketodihydrosphingosine reductase, partial [Cuculus canorus]
Length=296

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 155/268 (58%), Gaps = 13/268 (5%)
 Frame = -2

Query  1184  EGAKVSILARNAGKLEDAKHAILRATGCG---VTAFSADV-RDYDAV----KRAVEEAGP  1029
             +GA ++++AR+  KL   K  I + +      V   S DV +DY+ V    K+A E+ GP
Sbjct  19    QGAFITLIARDENKLLQTKKEIEKYSVNDKQVVLCISVDVSKDYEQVENVLKQAQEKLGP  78

Query  1028  IDVLVCNHGVYASKELEDQEVEEVKVMIDVNLTGTFHLIKAALPGMISRPANRGPGSIAI  849
             +D+LV   G   + + ED EV   + ++ VN  G+ +  +A +  M  R   R    +  
Sbjct  79    VDMLVNCAGTSVTGKFEDIEVNSFERLMAVNYLGSVYPSRAVIATMKERRMGR----LVF  134

Query  848   MSSQAGQVGIYGYTAYSASKFGLRGMAEALQQEVIAHNIHVSLIFPPHTHTPALAQEMKR  669
             +SSQAGQ+G++GYTAYS +KF LRG+AEALQ EV  +NI+V++ +PP T TP   +E K 
Sbjct  135   VSSQAGQLGLFGYTAYSPTKFALRGLAEALQMEVKPYNIYVTVAYPPDTDTPGFVEESKT  194

Query  668   RPQITSKIAVSSGAFMKAEEVAKKSLNGIKCGSFSVACNLEGFFLSIATAGLSPQTSFLM  489
             +P + +K+   + +  +AE+VA+  +     G+F+ +   +G+ LSI T+G+SP TS   
Sbjct  195   KP-LETKLISETSSVCQAEQVARVIVKDAIQGNFNSSVGSDGYMLSILTSGMSPVTSITE  253

Query  488   AFVEACLAGIMRIAALCFQCNWYTIIQK  405
                +    GI RI  L +  ++ +I+++
Sbjct  254   GLQQVVCMGIFRIVGLFYLGSFDSIVRR  281



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3828192580548