BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c112783_g1_i1 len=149 path=[127:0-148]

Length=149
                                                                      Score     E

ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...  93.2    2e-20   
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...  89.7    3e-19   
emb|CDP12117.1|  unnamed protein product                              88.6    7e-19   
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...  88.6    7e-19   
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...  88.6    8e-19   
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg              88.2    1e-18   
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...  86.7    3e-18   
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...  85.9    8e-18   
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...  85.9    8e-18   
ref|XP_002509916.1|  ATP binding protein, putative                    84.7    2e-17   Ricinus communis
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...  84.7    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...  84.0    3e-17   
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...  84.0    3e-17   
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...  84.0    3e-17   
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...  84.0    3e-17   Populus trichocarpa [western balsam poplar]
gb|KDP25339.1|  hypothetical protein JCGZ_20495                       82.0    1e-16   
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...  81.6    2e-16   
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...  81.6    2e-16   
ref|XP_010053173.1|  PREDICTED: probable inactive receptor kinase...  81.6    2e-16   
ref|XP_004167870.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  81.6    2e-16   
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...  81.3    3e-16   
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g           81.3    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...  79.3    2e-15   
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...  79.0    2e-15   
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg           78.6    2e-15   
gb|EPS60741.1|  hypothetical protein M569_14060                       77.8    5e-15   
gb|KHG27491.1|  hypothetical protein F383_14041                       77.4    7e-15   
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...  77.0    1e-14   
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...  77.0    1e-14   
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...  76.6    1e-14   
gb|KEH21182.1|  LRR receptor-like kinase                              76.3    2e-14   
ref|XP_010104998.1|  putative inactive receptor kinase                76.3    2e-14   
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...  75.9    2e-14   
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g           75.9    2e-14   
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g           75.9    2e-14   
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...  75.9    3e-14   
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...  75.1    5e-14   
emb|CDP05105.1|  unnamed protein product                              74.3    8e-14   
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g           74.3    8e-14   
gb|AES72427.2|  LRR receptor-like kinase                              74.3    8e-14   
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...  74.7    9e-14   
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg              73.9    1e-13   
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg           73.9    1e-13   
gb|EEE54142.1|  hypothetical protein OsJ_00935                        73.9    1e-13   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA94519.1|  putative receptor-like kinase                        73.6    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...  73.6    1e-13   
gb|KHN23405.1|  Putative inactive receptor kinase                     73.6    1e-13   
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...  73.6    2e-13   
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...  73.6    2e-13   
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...  73.2    2e-13   
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...  73.2    2e-13   
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                 72.8    2e-13   
emb|CDY03527.1|  BnaC01g15550D                                        71.2    2e-13   
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...  72.8    3e-13   
ref|XP_009413825.1|  PREDICTED: probable inactive receptor kinase...  72.4    4e-13   
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...  72.4    4e-13   
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...  72.4    4e-13   
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...  72.4    4e-13   
gb|KDP22183.1|  hypothetical protein JCGZ_26014                       72.0    4e-13   
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...  72.0    5e-13   
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein   72.0    5e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47625.1|  BnaA01g13400D                                        72.0    5e-13   
ref|XP_006283316.1|  hypothetical protein CARUB_v10004355mg           72.0    5e-13   
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg           72.0    6e-13   
ref|XP_004253440.1|  PREDICTED: probable inactive receptor kinase...  71.2    6e-13   
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...  71.6    7e-13   
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...  71.6    7e-13   
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...  71.6    8e-13   
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...  71.2    9e-13   
ref|XP_003565740.1|  PREDICTED: probable inactive receptor kinase...  71.2    9e-13   
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  70.9    1e-12   
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg           70.9    1e-12   
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...  70.9    1e-12   
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...  70.5    2e-12   
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...  70.5    2e-12   
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...  70.5    2e-12   
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...  70.5    2e-12   
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...  70.1    2e-12   
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...  70.1    2e-12   
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...  70.1    2e-12   
gb|EYU19612.1|  hypothetical protein MIMGU_mgv1a026050mg              70.1    2e-12   
gb|EPS62971.1|  hypothetical protein M569_11816                       70.1    2e-12   
gb|KHN44239.1|  Putative inactive receptor kinase                     70.1    3e-12   
dbj|BAJ94608.1|  predicted protein                                    69.7    3e-12   
ref|XP_003522551.1|  PREDICTED: probable inactive receptor kinase...  69.7    3e-12   
gb|AAL09719.1|  AT3g08680/F17O14_15                                   68.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223           69.7    3e-12   
ref|XP_002513601.1|  ATP binding protein, putative                    69.7    3e-12   Ricinus communis
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase      69.7    3e-12   Arabidopsis halleri
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...  69.7    3e-12   
gb|EPS74415.1|  hypothetical protein M569_00340                       69.7    3e-12   
emb|CDY10963.1|  BnaA03g46220D                                        68.9    3e-12   
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...  69.7    4e-12   
ref|XP_008439323.1|  PREDICTED: probable inactive receptor kinase...  69.3    4e-12   
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...  69.3    4e-12   
emb|CDX94213.1|  BnaC07g38470D                                        69.3    5e-12   
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...  69.3    5e-12   
ref|XP_006287298.1|  hypothetical protein CARUB_v10000491mg           69.3    5e-12   
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...  69.3    5e-12   
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g           68.9    6e-12   
ref|XP_006394667.1|  hypothetical protein EUTSA_v10003837mg           68.9    6e-12   
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg           68.9    6e-12   
ref|XP_010671535.1|  PREDICTED: probable inactive receptor kinase...  68.9    6e-12   
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...  68.9    6e-12   
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...  68.9    6e-12   
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  68.9    6e-12   
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein   68.9    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...  68.9    6e-12   
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg              68.9    6e-12   
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...  68.9    6e-12   
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...  68.9    7e-12   
gb|EPS58213.1|  hypothetical protein M569_16602                       68.6    7e-12   
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...  68.9    7e-12   
ref|XP_010097875.1|  putative inactive receptor kinase                68.9    7e-12   
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170           68.9    7e-12   
gb|EYU36891.1|  hypothetical protein MIMGU_mgv1a0177022mg             67.8    7e-12   
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...  68.6    7e-12   
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...  68.9    7e-12   
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg           68.6    8e-12   
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg           68.6    8e-12   
ref|XP_004149452.1|  PREDICTED: probable inactive receptor kinase...  68.6    8e-12   
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...  68.6    8e-12   
emb|CDY35996.1|  BnaA05g29540D                                        68.6    9e-12   
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...  68.6    9e-12   
emb|CDY27986.1|  BnaC05g43880D                                        68.6    9e-12   
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...  68.6    9e-12   
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg           68.6    9e-12   
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...  68.6    9e-12   
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...  68.6    1e-11   
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...  68.2    1e-11   
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...  68.2    1e-11   
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...  68.2    1e-11   
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...  68.2    1e-11   
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...  68.2    1e-11   
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-11   
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-11   
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...  67.8    2e-11   
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                 67.8    2e-11   
ref|XP_010493544.1|  PREDICTED: inactive leucine-rich repeat rece...  67.8    2e-11   
ref|XP_008376682.1|  PREDICTED: probable inactive receptor kinase...  67.8    2e-11   
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...  67.8    2e-11   
ref|XP_010421220.1|  PREDICTED: inactive leucine-rich repeat rece...  67.8    2e-11   
ref|XP_010445167.1|  PREDICTED: probable inactive receptor kinase...  67.8    2e-11   
gb|AFW80440.1|  putative leucine-rich repeat receptor-like protei...  64.7    2e-11   
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                 67.4    2e-11   
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg           67.4    2e-11   
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...  67.4    2e-11   
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg           67.4    2e-11   
ref|XP_002872091.1|  hypothetical protein ARALYDRAFT_489266           67.4    2e-11   
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg           67.4    2e-11   
emb|CDP13882.1|  unnamed protein product                              67.4    2e-11   
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...  67.4    3e-11   
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                 67.4    3e-11   
ref|XP_010454700.1|  PREDICTED: inactive leucine-rich repeat rece...  67.0    3e-11   
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg           67.0    3e-11   
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                 67.0    3e-11   
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg           67.0    3e-11   
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                 67.0    3e-11   
emb|CBI22555.3|  unnamed protein product                              67.0    3e-11   
gb|EPS73425.1|  hypothetical protein M569_01324                       66.6    3e-11   
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...  67.0    3e-11   
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...  66.6    3e-11   
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...  66.6    4e-11   
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...  66.6    4e-11   
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...  66.6    4e-11   
ref|XP_006391655.1|  hypothetical protein EUTSA_v10024075mg           66.6    4e-11   
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...  66.6    4e-11   
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...  66.6    4e-11   
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...  66.6    4e-11   
ref|XP_009357339.1|  PREDICTED: probable inactive receptor kinase...  66.6    5e-11   
gb|KHG17391.1|  hypothetical protein F383_22576                       66.6    5e-11   
emb|CDP06375.1|  unnamed protein product                              66.6    5e-11   
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...  66.2    5e-11   
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...  66.6    5e-11   
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...  66.6    5e-11   
ref|NP_197798.1|  Leucine-rich repeat protein kinase family protein   66.2    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368693.1|  PREDICTED: probable inactive receptor kinase...  66.2    6e-11   
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...  65.9    7e-11   
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...  65.9    7e-11   
ref|NP_001055854.1|  Os05g0480400                                     65.9    7e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KCW46493.1|  hypothetical protein EUGRSUZ_K00318                   65.5    8e-11   
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...  65.9    8e-11   
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...  65.9    8e-11   
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...  65.9    8e-11   
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...  65.9    8e-11   
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg           65.9    9e-11   
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...  65.5    9e-11   
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein   65.5    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...  65.5    9e-11   
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...  65.5    1e-10   
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...  65.5    1e-10   
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...  65.1    1e-10   
dbj|BAK08005.1|  predicted protein                                    64.7    1e-10   
gb|ACN30771.1|  unknown                                               65.1    1e-10   Zea mays [maize]
emb|CDX87143.1|  BnaC09g04580D                                        65.1    1e-10   
ref|NP_001168844.1|  uncharacterized LOC100382649 precursor           65.1    1e-10   Zea mays [maize]
gb|EEE64112.1|  hypothetical protein OsJ_18944                        65.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...  65.1    1e-10   
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...  65.1    1e-10   
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...  65.1    2e-10   
emb|CDY19849.1|  BnaA09g05020D                                        65.1    2e-10   
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...  65.1    2e-10   
ref|XP_009141903.1|  PREDICTED: inactive leucine-rich repeat rece...  64.7    2e-10   
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...  64.7    2e-10   
ref|NP_001050019.1|  Os03g0332900                                     64.7    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008813231.1|  PREDICTED: probable inactive receptor kinase...  64.3    2e-10   
gb|EMT17815.1|  Putative inactive receptor kinase                     64.7    2e-10   
gb|AFK45382.1|  unknown                                               64.7    2e-10   
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase   64.7    2e-10   
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...  64.7    2e-10   
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...  64.3    2e-10   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110        64.3    2e-10   Sorghum bicolor [broomcorn]
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...  64.3    2e-10   
ref|XP_002520893.1|  Receptor protein kinase CLAVATA1 precursor, ...  64.3    2e-10   Ricinus communis
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor           64.3    2e-10   Zea mays [maize]
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...  64.3    2e-10   
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...  64.3    3e-10   
gb|ACA61611.1|  hypothetical protein AP2_E06.2                        64.3    3e-10   Arabidopsis lyrata subsp. petraea
ref|XP_002864562.1|  predicted protein                                64.3    3e-10   
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...  64.3    3e-10   
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg           63.9    3e-10   
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...  63.9    3e-10   
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg              63.9    3e-10   
dbj|BAB62593.1|  putative receptor-like protein kinase                63.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMT10528.1|  Putative inactive receptor kinase                     63.9    4e-10   
gb|KHN35064.1|  Putative inactive receptor kinase                     63.5    4e-10   
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...  63.9    4e-10   
gb|KDP45679.1|  hypothetical protein JCGZ_17286                       63.5    4e-10   
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...  63.5    4e-10   
emb|CDY58565.1|  BnaC03g12450D                                        63.5    4e-10   
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...  63.5    4e-10   
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...  63.5    4e-10   
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...  63.5    4e-10   
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg           63.5    5e-10   
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...  63.5    5e-10   
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg           63.5    5e-10   
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...  63.5    5e-10   
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g           63.5    5e-10   
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                 63.5    5e-10   
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...  63.5    5e-10   
gb|KEH34523.1|  LRR receptor-like kinase                              63.5    5e-10   
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...  63.5    5e-10   
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...  63.5    5e-10   
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                   63.2    6e-10   
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...  63.2    6e-10   
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...  63.2    6e-10   
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative   63.2    7e-10   Ricinus communis
gb|KHN25793.1|  Putative inactive receptor kinase                     63.2    7e-10   
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...  63.2    7e-10   
ref|XP_006842563.1|  hypothetical protein AMTR_s00077p00144650        62.4    7e-10   
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg           63.2    8e-10   
gb|KHG05843.1|  hypothetical protein F383_32232                       62.8    8e-10   
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...  62.8    8e-10   
ref|XP_010094441.1|  putative inactive receptor kinase                62.8    8e-10   
ref|XP_006829650.1|  hypothetical protein AMTR_s00122p00112840        62.8    9e-10   
gb|EMT12910.1|  Putative inactive receptor kinase                     62.8    9e-10   
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...  62.8    9e-10   
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...  62.8    9e-10   
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...  62.8    9e-10   
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...  62.8    9e-10   
emb|CDX88667.1|  BnaA03g09820D                                        62.8    9e-10   
gb|KHN40011.1|  Putative inactive receptor kinase                     62.4    1e-09   
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...  62.4    1e-09   
ref|NP_176603.1|  putative inactive receptor-like protein kinase      62.4    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004967473.1|  PREDICTED: probable inactive receptor kinase...  62.4    1e-09   
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...  62.4    1e-09   
emb|CAN80590.1|  hypothetical protein VITISV_040789                   62.4    1e-09   Vitis vinifera
ref|XP_010550530.1|  PREDICTED: inactive leucine-rich repeat rece...  62.4    1e-09   
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...  62.4    1e-09   
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...  62.4    1e-09   
ref|XP_004172749.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  62.4    1e-09   
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...  62.0    2e-09   
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...  62.0    2e-09   
gb|AAL76166.1|AF348333_1  candidate plant disease resistance protein  59.7    2e-09   Glycine max [soybeans]
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...  62.0    2e-09   
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570        62.0    2e-09   Sorghum bicolor [broomcorn]
gb|EYU45791.1|  hypothetical protein MIMGU_mgv1a002921mg              61.6    2e-09   
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...  61.6    2e-09   
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...  61.6    2e-09   
gb|KEH35517.1|  receptor-like kinase                                  61.6    2e-09   
ref|XP_008673506.1|  PREDICTED: probable inactive receptor kinase...  61.6    2e-09   
gb|KDP21623.1|  hypothetical protein JCGZ_03294                       61.6    3e-09   
ref|XP_008673504.1|  PREDICTED: probable inactive receptor kinase...  61.6    3e-09   
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...  61.2    3e-09   
gb|KDP21848.1|  hypothetical protein JCGZ_00635                       61.2    3e-09   
ref|XP_006579204.1|  PREDICTED: probable inactive receptor kinase...  60.8    3e-09   
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...  61.2    3e-09   
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...  61.2    3e-09   
ref|XP_006371315.1|  putative plant disease resistance family pro...  61.2    3e-09   
gb|KHF99691.1|  hypothetical protein F383_18108                       61.2    3e-09   
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...  61.2    3e-09   
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g           61.2    3e-09   
tpg|DAA52804.1|  TPA: putative leucine-rich repeat receptor-like ...  61.2    4e-09   
gb|AFG56596.1|  hypothetical protein UMN_3255_01                      57.0    4e-09   
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...  61.2    4e-09   
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...  60.8    4e-09   
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...  60.8    4e-09   
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...  60.8    4e-09   
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...  60.8    4e-09   
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...  60.8    5e-09   
ref|XP_010558411.1|  PREDICTED: probable inactive receptor kinase...  60.8    5e-09   
emb|CBI15804.3|  unnamed protein product                              60.8    5e-09   
gb|KFK36585.1|  hypothetical protein AALP_AA4G143000                  60.5    5e-09   
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g           60.5    6e-09   
gb|ACZ98536.1|  protein kinase                                        60.5    6e-09   
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...  60.5    6e-09   
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...  60.5    6e-09   
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...  60.5    6e-09   
emb|CDY32713.1|  BnaA02g07750D                                        60.5    7e-09   
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...  60.1    7e-09   
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...  60.1    7e-09   
ref|XP_002319979.1|  putative plant disease resistance family pro...  60.1    8e-09   
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...  60.1    8e-09   
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...  60.1    8e-09   
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090        60.1    8e-09   
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...  60.1    8e-09   
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...  60.1    8e-09   
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg           60.1    9e-09   
ref|XP_002887913.1|  hypothetical protein ARALYDRAFT_337960           59.7    9e-09   
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...  60.1    9e-09   
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...  59.7    9e-09   
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...  59.7    1e-08   
gb|EMT29542.1|  hypothetical protein F775_43702                       57.0    1e-08   
ref|NP_001060650.1|  Os07g0681100                                     59.7    1e-08   
gb|EAZ05160.1|  hypothetical protein OsI_27356                        59.7    1e-08   
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...  59.7    1e-08   
ref|XP_010098027.1|  putative inactive receptor kinase                59.7    1e-08   
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...  59.7    1e-08   
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...  59.7    1e-08   
ref|XP_002325632.1|  putative plant disease resistance family pro...  59.3    1e-08   
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...  59.3    1e-08   
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...  59.3    1e-08   
gb|EMT09037.1|  Putative inactive receptor kinase                     59.3    1e-08   
ref|XP_010431734.1|  PREDICTED: putative inactive receptor-like p...  59.3    1e-08   
ref|NP_001168611.1|  uncharacterized LOC100382395 precursor           59.3    2e-08   
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-08   
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-08   
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...  59.3    2e-08   
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-08   
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...  58.9    2e-08   
ref|XP_010418476.1|  PREDICTED: putative inactive receptor-like p...  58.9    2e-08   
ref|XP_010474611.1|  PREDICTED: putative inactive receptor-like p...  58.9    2e-08   
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...  58.9    2e-08   
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg           58.9    2e-08   
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...  58.9    2e-08   
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...  58.9    2e-08   
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g           58.9    2e-08   
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...  58.9    2e-08   
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...  58.5    3e-08   
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_004167125.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  58.5    3e-08   
gb|KHN18649.1|  Putative inactive receptor kinase                     58.5    3e-08   
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...  58.5    3e-08   
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g           58.2    3e-08   
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor           58.2    4e-08   
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...  58.2    4e-08   
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...  57.8    5e-08   
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g           57.8    5e-08   
ref|XP_004145918.1|  PREDICTED: probable inactive receptor kinase...  57.4    7e-08   
gb|KGN49888.1|  hypothetical protein Csa_5G139660                     57.4    7e-08   
ref|XP_010242278.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  56.6    7e-08   
dbj|BAJ90284.1|  predicted protein                                    57.4    7e-08   
ref|XP_008813619.1|  PREDICTED: probable inactive receptor kinase...  56.6    8e-08   
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative   57.0    8e-08   
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...  57.0    8e-08   
ref|XP_009770433.1|  PREDICTED: uncharacterized protein LOC104221140  57.4    9e-08   
ref|XP_009400513.1|  PREDICTED: probable inactive receptor kinase...  57.0    9e-08   
ref|XP_009782917.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-07   
ref|XP_004498388.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-07   
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...  57.0    1e-07   
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-07   
ref|XP_010916177.1|  PREDICTED: probable inactive receptor kinase...  56.6    1e-07   
ref|XP_010491047.1|  PREDICTED: probable leucine-rich repeat rece...  56.6    1e-07   
gb|EPS63924.1|  hypothetical protein M569_10855                       56.6    1e-07   
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...  56.6    1e-07   
emb|CDX71488.1|  BnaC04g17230D                                        56.6    1e-07   
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...  56.6    1e-07   
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                56.6    1e-07   
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...  56.2    2e-07   
dbj|BAJ93317.1|  predicted protein                                    56.2    2e-07   
ref|XP_010109178.1|  putative inactive receptor kinase                56.2    2e-07   
dbj|BAK07296.1|  predicted protein                                    56.2    2e-07   
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...  56.2    2e-07   
gb|EMT29923.1|  LRR receptor-like serine/threonine-protein kinase...  56.6    2e-07   
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...  56.2    2e-07   
gb|EPS69043.1|  hypothetical protein M569_05720                       56.2    2e-07   
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...  56.2    2e-07   
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...  55.8    2e-07   
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...  55.8    2e-07   
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg              55.8    2e-07   
ref|XP_006301005.1|  hypothetical protein CARUB_v10021395mg           55.8    3e-07   
ref|XP_009112815.1|  PREDICTED: putative inactive receptor-like p...  55.8    3e-07   
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...  55.5    3e-07   
ref|XP_010452417.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    3e-07   
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...  55.5    3e-07   
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...  55.5    3e-07   
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...  55.5    3e-07   
gb|AAN05336.1|  Putative leucine-rich repeat transmembrane protei...  55.5    3e-07   
ref|NP_001049422.1|  Os03g0223000                                     55.5    3e-07   
ref|XP_010423497.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    3e-07   
ref|XP_002871141.1|  hypothetical protein ARALYDRAFT_325150           55.5    3e-07   
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg           55.5    3e-07   
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...  55.1    4e-07   
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...  55.1    4e-07   
ref|XP_010098956.1|  putative inactive receptor kinase                55.1    4e-07   
ref|XP_011085845.1|  PREDICTED: probable inactive receptor kinase...  55.1    4e-07   
gb|KDP32336.1|  hypothetical protein JCGZ_13261                       55.1    4e-07   
ref|XP_003576509.1|  PREDICTED: probable inactive receptor kinase...  55.1    5e-07   
ref|XP_010513336.1|  PREDICTED: probable inactive receptor kinase...  55.1    5e-07   
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...  55.1    5e-07   
gb|KHN40609.1|  Putative inactive receptor kinase                     55.1    5e-07   
emb|CDO98323.1|  unnamed protein product                              55.1    5e-07   
ref|XP_008437572.1|  PREDICTED: probable inactive receptor kinase...  55.1    5e-07   
emb|CDY48185.1|  BnaA04g15490D                                        55.1    5e-07   
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...  54.7    5e-07   
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...  54.7    5e-07   
gb|EPS70599.1|  hypothetical protein M569_04160                       54.7    5e-07   
ref|XP_009614171.1|  PREDICTED: probable inactive receptor kinase...  54.7    5e-07   
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg           54.7    5e-07   
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...  54.7    5e-07   
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g           54.7    6e-07   
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg           54.7    6e-07   
ref|XP_004167200.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  54.7    6e-07   
ref|XP_003563067.1|  PREDICTED: LRR receptor-like serine/threonin...  54.7    7e-07   
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  54.3    7e-07   
ref|XP_010925124.1|  PREDICTED: probable inactive receptor kinase...  54.7    7e-07   
ref|XP_010555780.1|  PREDICTED: probable inactive receptor kinase...  54.3    8e-07   
ref|XP_003566864.1|  PREDICTED: probable inactive receptor kinase...  54.3    9e-07   
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                  54.3    9e-07   
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                  54.3    9e-07   
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...  53.9    1e-06   
ref|XP_006596280.1|  PREDICTED: probable inactive receptor kinase...  53.9    1e-06   
gb|KEH23299.1|  LRR receptor-like kinase                              53.9    1e-06   
gb|KHN08297.1|  Putative inactive receptor kinase                     53.9    1e-06   
emb|CDX77054.1|  BnaC04g38490D                                        53.5    1e-06   
ref|XP_001752185.1|  predicted protein                                53.5    1e-06   
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g           53.5    1e-06   
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...  53.5    1e-06   
emb|CDY04464.1|  BnaA07g12900D                                        53.5    2e-06   
ref|XP_006646083.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-06   
emb|CDP03386.1|  unnamed protein product                              53.5    2e-06   
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544           53.1    2e-06   
ref|XP_001778285.1|  predicted protein                                53.1    2e-06   
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-06   
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...  53.1    2e-06   
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein   53.1    2e-06   
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-06   
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-06   
gb|AAK92807.1|  putative receptor protein kinase                      53.1    2e-06   
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative   53.1    2e-06   
emb|CDX98821.1|  BnaC09g50140D                                        53.1    2e-06   
gb|KHG24076.1|  hypothetical protein F383_10304                       53.1    2e-06   
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  53.1    2e-06   
gb|AFD98845.1|  receptor-like protein kinase 1                        52.8    2e-06   
dbj|BAD52827.1|  receptor-like protein kinase 1-like                  52.8    2e-06   
gb|AFD98844.1|  receptor-like protein kinase 1                        52.8    2e-06   
gb|EEC71058.1|  hypothetical protein OsI_02797                        52.8    2e-06   
gb|EEE54963.1|  hypothetical protein OsJ_02553                        52.8    3e-06   
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-06   
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...  52.8    3e-06   
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-06   
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-06   
ref|XP_004969119.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-06   
ref|XP_010670123.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-06   
ref|XP_002883091.1|  hypothetical protein ARALYDRAFT_479268           52.8    3e-06   
emb|CDP00835.1|  unnamed protein product                              52.8    3e-06   
emb|CDY38186.1|  BnaA09g12030D                                        52.4    3e-06   
gb|KHG17719.1|  hypothetical protein F383_03334                       52.4    3e-06   
ref|XP_001774015.1|  predicted protein                                52.4    3e-06   
gb|KHG18372.1|  hypothetical protein F383_03411                       52.4    3e-06   
gb|KEH40435.1|  LRR receptor-like kinase                              52.4    4e-06   
gb|AAK18840.1|AC082645_10  putative receptor kinase                   52.4    4e-06   
tpg|DAA58915.1|  TPA: putative leucine-rich repeat receptor-like ...  52.0    4e-06   
gb|EEC76057.1|  hypothetical protein OsI_13260                        52.0    4e-06   
ref|XP_001774014.1|  predicted protein                                52.0    4e-06   
dbj|BAJ92367.1|  predicted protein                                    52.4    4e-06   
gb|KFK39109.1|  hypothetical protein AALP_AA3G202300                  52.0    5e-06   
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...  52.0    5e-06   
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...  52.0    5e-06   
ref|NP_566589.1|  receptor-like kinase 902                            52.0    5e-06   
emb|CDP01639.1|  unnamed protein product                              52.0    5e-06   
ref|XP_011099906.1|  PREDICTED: probable inactive receptor kinase...  52.0    5e-06   
gb|AAM64268.1|  receptor kinase, putative                             52.0    5e-06   
ref|NP_001146031.1|  uncharacterized LOC100279562 precursor           52.0    6e-06   
gb|ACL53064.1|  unknown                                               52.0    6e-06   
dbj|BAC75619.1|  putative receptor kinase                             51.6    6e-06   
gb|EAZ07055.1|  hypothetical protein OsI_29302                        51.6    6e-06   
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg           51.6    7e-06   
ref|XP_004959443.1|  PREDICTED: probable inactive receptor kinase...  49.7    7e-06   
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...  51.6    7e-06   
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...  51.6    8e-06   
gb|EEC79778.1|  hypothetical protein OsI_21189                        51.2    8e-06   



>ref|XP_011080874.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            KNW+GVTCSEDG+RV  +RLPG GFHGP+PENTLSRLSALQ+LSLRSNG
Sbjct  61   KNWTGVTCSEDGNRVISVRLPGIGFHGPIPENTLSRLSALQILSLRSNG  109



>ref|XP_009799943.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=649

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            KNW+GVTCSEDGSRV  LRLPG GF+GP+P NTLSRL+ALQ+LSLRSNG
Sbjct  70   KNWTGVTCSEDGSRVIALRLPGVGFNGPIPNNTLSRLTALQILSLRSNG  118



>emb|CDP12117.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            KNW+GV+C+EDGSRV  LRLPG GFHGP+P NTLSRLSALQ+LSLRSN
Sbjct  59   KNWTGVSCNEDGSRVISLRLPGVGFHGPIPTNTLSRLSALQILSLRSN  106



>ref|XP_011073578.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            +NW+G++CSEDGSRV  +RLPG GF GP+PENTLSRLSALQ+LSLRSNG
Sbjct  61   RNWTGISCSEDGSRVVSVRLPGVGFQGPIPENTLSRLSALQILSLRSNG  109



>ref|XP_009629119.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=648

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            KNW+GVTC+EDGSRV  LRLPG GF+GP+P NTLSRL+ALQ+LSLRSNG
Sbjct  69   KNWTGVTCNEDGSRVIALRLPGVGFNGPIPNNTLSRLTALQILSLRSNG  117



>gb|EYU23390.1| hypothetical protein MIMGU_mgv1a003016mg [Erythranthe guttata]
Length=615

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            KNW+G+TCSEDGSRVT +RLPG GF GP+P+NTL+RLSALQ+LSLRSN
Sbjct  60   KNWTGITCSEDGSRVTSVRLPGFGFQGPIPDNTLTRLSALQILSLRSN  107



>ref|XP_011022559.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=622

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            KNWSGV CS DG+RV  +RLPG GFHGP+P NTLSRLSALQVLSLRSNG
Sbjct  54   KNWSGVICSGDGTRVISVRLPGVGFHGPIPPNTLSRLSALQVLSLRSNG  102



>ref|XP_006343895.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Solanum 
tuberosum]
Length=642

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            KNW+GV C+EDGSRV  LRLPG GF+GP+P NTLSRL+ALQ+LSLRSNG
Sbjct  63   KNWTGVGCNEDGSRVIALRLPGVGFNGPIPNNTLSRLTALQILSLRSNG  111



>ref|XP_004245544.1| PREDICTED: probable inactive receptor kinase At4g23740 [Solanum 
lycopersicum]
Length=642

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            KNW+GV C+EDGSRV  LRLPG GF+GP+P NTLSRL+ALQ+LSLRSNG
Sbjct  63   KNWTGVGCNEDGSRVIALRLPGVGFNGPIPNNTLSRLTALQILSLRSNG  111



>ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51303.1| ATP binding protein, putative [Ricinus communis]
Length=536

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+GVTCS+DGSRV  LRLPG GF GP+P NT+SRLSALQVLSLRSN
Sbjct  55   NWTGVTCSKDGSRVIALRLPGVGFQGPIPSNTISRLSALQVLSLRSN  101



>ref|XP_002303623.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78602.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NWSGV CS DG+RV  +RLPG GFHGP+P NTLSRLSALQVLSLRSNG
Sbjct  55   NWSGVICSGDGTRVISVRLPGVGFHGPIPPNTLSRLSALQVLSLRSNG  102



>ref|XP_007040424.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040425.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040426.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24925.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24926.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24927.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=626

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GVTC+ DGSR+T +RLPG G HGP+P NT+SRLSALQ+LSLRSNG
Sbjct  55   NWTGVTCNADGSRITAVRLPGIGLHGPIPANTISRLSALQILSLRSNG  102



>ref|XP_011026938.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
 ref|XP_011026939.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
Length=626

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GV CS DG+RV  +RLPG GFHGP+P NTLSRLSALQ+LSLRSNG
Sbjct  55   NWTGVICSGDGTRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSNG  102



>ref|XP_011026937.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Populus euphratica]
Length=652

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GV CS DG+RV  +RLPG GFHGP+P NTLSRLSALQ+LSLRSNG
Sbjct  81   NWTGVICSGDGTRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSNG  128



>ref|XP_002299495.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84300.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GV CS DG+RV  +RLPG GFHGP+P NTLSRLSALQ+LSLRSNG
Sbjct  55   NWTGVICSGDGTRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSNG  102



>gb|KDP25339.1| hypothetical protein JCGZ_20495 [Jatropha curcas]
Length=627

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+G+TCSED SRV  +RLPG GF GP+P NTLSRLSALQ+LSLRSN
Sbjct  55   NWTGITCSEDRSRVIAVRLPGVGFQGPIPPNTLSRLSALQILSLRSN  101



>ref|XP_008437363.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437364.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437365.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437367.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=628

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TCS+D SRV  +RLPG GFHGP+P NTLSRLSALQ+LSLRSN
Sbjct  56   WTGITCSQDESRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSN  101



>ref|XP_004143879.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN50039.1| hypothetical protein Csa_5G151550 [Cucumis sativus]
Length=628

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TCS+D SRV  +RLPG GFHGP+P NTLSRLSALQ+LSLRSN
Sbjct  56   WTGITCSQDESRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSN  101



>ref|XP_010053173.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010053174.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW77437.1| hypothetical protein EUGRSUZ_D01777 [Eucalyptus grandis]
Length=634

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            +W+GVTCS DGSR+  +RLPG GF GP+P NTLSRLSALQ+LSLRSNG
Sbjct  55   HWAGVTCSGDGSRIVAVRLPGVGFQGPIPPNTLSRLSALQILSLRSNG  102



>ref|XP_004167870.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740-like [Cucumis sativus]
Length=628

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TCS+D SRV  +RLPG GFHGP+P NTLSRLSALQ+LSLRSN
Sbjct  56   WTGITCSQDESRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSN  101



>ref|XP_010055829.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055830.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055831.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055832.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW72378.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72379.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72380.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
Length=634

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW GVTC +DGSRV  LRLPG GFHGP+P NTL RLS LQ+LSLRSN 
Sbjct  59   NWVGVTCDKDGSRVIALRLPGVGFHGPIPANTLGRLSDLQILSLRSNA  106



>ref|XP_002317741.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
 gb|EEE95961.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
Length=633

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GV+CS D SRVT LRLPG GF GP+P NTLSRLSA+Q+LSLRSNG
Sbjct  60   WTGVSCSNDNSRVTALRLPGVGFRGPIPPNTLSRLSAIQILSLRSNG  106



>ref|XP_011001936.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001938.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GV+CS D SRVT LRLPG GF GP+P NTL RLSA+Q+LSLRSNG
Sbjct  60   WTGVSCSNDNSRVTALRLPGVGFRGPIPPNTLGRLSAIQILSLRSNG  106



>ref|XP_008234792.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234793.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234794.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            KNW+GV CSED SR+  L LPGA  HGP+P NTLSRLSALQVLSLR N
Sbjct  54   KNWTGVICSEDQSRIIELHLPGAALHGPIPANTLSRLSALQVLSLRLN  101



>ref|XP_007220432.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 ref|XP_007220433.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21631.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21632.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
Length=629

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            KNW+GV CSED SR+  L LPGA  HGP+P NTLSRLSALQVLSLR N
Sbjct  54   KNWTGVICSEDQSRIIELHLPGAALHGPIPPNTLSRLSALQVLSLRLN  101



>gb|EPS60741.1| hypothetical protein M569_14060 [Genlisea aurea]
Length=589

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+G++C E G+RVT +RLPG GF GP+P+NTLSRLSALQ+LSLRSN 
Sbjct  63   WTGISCDEAGTRVTSVRLPGFGFRGPIPDNTLSRLSALQILSLRSNA  109



>gb|KHG27491.1| hypothetical protein F383_14041 [Gossypium arboreum]
Length=634

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GV C+ D SRV GL LPG GFHGP+P NTLSRLSAL+VLSLRSN
Sbjct  58   WVGVACNNDHSRVIGLHLPGMGFHGPIPRNTLSRLSALEVLSLRSN  103



>ref|XP_009399834.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=666

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTCS DGSRV  +RLPG GF GP+P NTLSRLSALQ+LS+RSN
Sbjct  59   WYGVTCSADGSRVITVRLPGIGFSGPIPPNTLSRLSALQILSIRSN  104



>ref|XP_009399835.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399836.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=651

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTCS DGSRV  +RLPG GF GP+P NTLSRLSALQ+LS+RSN
Sbjct  59   WYGVTCSADGSRVITVRLPGIGFSGPIPPNTLSRLSALQILSIRSN  104



>ref|XP_009380537.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TCS DGSRV  +RLPG GF GPVP NTLSRLSAL++LSLR+N
Sbjct  59   WTGITCSADGSRVVAVRLPGIGFRGPVPPNTLSRLSALRILSLRAN  104



>gb|KEH21182.1| LRR receptor-like kinase [Medicago truncatula]
Length=639

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+GVTC+ED SRV  +RLPG GFHG +P NT+S LSAL++LSLRSN
Sbjct  51   NWTGVTCNEDRSRVIAIRLPGVGFHGNIPPNTISNLSALEILSLRSN  97



>ref|XP_010104998.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC02955.1| putative inactive receptor kinase [Morus notabilis]
Length=646

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS+D SRV  +RLPG GF GP+P NTLSRL++LQ+LSLRSN
Sbjct  55   HWTGITCSDDKSRVLAVRLPGVGFDGPIPPNTLSRLTSLQILSLRSN  101



>ref|XP_010658906.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658908.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658911.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658915.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+GVTCS+D S+V  +RLPG GF G +P NTLSRLSALQ+LSLRSN
Sbjct  55   NWTGVTCSDDKSQVISVRLPGVGFQGAIPPNTLSRLSALQILSLRSN  101



>ref|XP_007160136.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
 gb|ESW32130.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
Length=637

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ED SRV  +RLPG GFHG +P +T+SRLSALQ LSLRSN
Sbjct  56   WTGVTCNEDKSRVIAIRLPGVGFHGTIPADTISRLSALQTLSLRSN  101



>ref|XP_007137558.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137559.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137560.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09552.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09553.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09554.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
Length=626

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            ++W GVTC+ D SRV  LRLPGAG  GP+P NTLSRLSAL+++SLRSNG
Sbjct  52   QSWRGVTCNSDKSRVIALRLPGAGLSGPIPPNTLSRLSALEIVSLRSNG  100



>ref|XP_011001931.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001932.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001933.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GV+CS D SRVT LRLPG GF GP+P NTL RLSA+Q+LSL SNG
Sbjct  60   WTGVSCSNDNSRVTALRLPGVGFRGPIPPNTLGRLSAIQILSLGSNG  106



>ref|XP_009409433.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409434.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409435.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTCS D SRV  +RLPG GF GP+P NTLSRLSAL++LSLRSN
Sbjct  64   SWTGVTCSADDSRVIAVRLPGIGFSGPIPPNTLSRLSALRILSLRSN  110



>emb|CDP05105.1| unnamed protein product [Coffea canephora]
Length=630

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTC+ D SR+  +RLPG GF G VP NTL+RLSALQ+LSLRSNG
Sbjct  56   WTGVTCNHDKSRIIAVRLPGFGFRGSVPSNTLARLSALQILSLRSNG  102



>ref|XP_006374322.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
 gb|ERP52119.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
Length=634

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GV+CS D SRVT L LPG GF GP+P NTL RLSA+Q+LSL SNG
Sbjct  59   NWTGVSCSNDHSRVTALVLPGVGFRGPIPPNTLRRLSAIQILSLGSNG  106



>gb|AES72427.2| LRR receptor-like kinase [Medicago truncatula]
Length=616

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            + W GVTC+ DGSRV  +RLPGAG  GP+P NTL+RLSAL+ +SLRSNG
Sbjct  52   QTWRGVTCNTDGSRVIAIRLPGAGLSGPIPPNTLNRLSALETVSLRSNG  100



>ref|XP_003602176.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
Length=1088

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            + W GVTC+ DGSRV  +RLPGAG  GP+P NTL+RLSAL+ +SLRSNG
Sbjct  52   QTWRGVTCNTDGSRVIAIRLPGAGLSGPIPPNTLNRLSALETVSLRSNG  100



>gb|EYU25187.1| hypothetical protein MIMGU_mgv1a002923mg [Erythranthe guttata]
Length=625

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GVTC+ D SRV  +RLP  GF G +P NTLSRLS LQ+LSLRSNG
Sbjct  60   NWTGVTCNHDNSRVIAVRLPAIGFRGRIPTNTLSRLSELQILSLRSNG  107



>ref|XP_006413522.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
 gb|ESQ54975.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
Length=630

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K W+GVTC++DGSRV  +RLPG G +G +P NT+SRLSAL+VLSLRSN
Sbjct  55   KTWTGVTCNQDGSRVIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSN  102



>gb|EEE54142.1| hypothetical protein OsJ_00935 [Oryza sativa Japonica Group]
Length=580

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+GVTCS DGSRV  LRLPG G  GPVP  TL RL+ALQVLSLR+N
Sbjct  58   NWTGVTCSGDGSRVVALRLPGLGLSGPVPRGTLGRLTALQVLSLRAN  104



>dbj|BAA94519.1| putative receptor-like kinase [Oryza sativa Japonica Group]
 dbj|BAB07903.1| putative receptor-like kinase [Oryza sativa Japonica Group]
 gb|EEC70208.1| hypothetical protein OsI_00955 [Oryza sativa Indica Group]
Length=641

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+GVTCS DGSRV  LRLPG G  GPVP  TL RL+ALQVLSLR+N
Sbjct  58   NWTGVTCSGDGSRVVALRLPGLGLSGPVPRGTLGRLTALQVLSLRAN  104



>ref|XP_003526687.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            ++W GV C+ D SRV  LRLPGAG  GP+P NTLSRLSAL+V+SLRSNG
Sbjct  59   QSWRGVICNSDKSRVIELRLPGAGLSGPIPPNTLSRLSALEVVSLRSNG  107



>gb|KHN23405.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            ++W GV C+ D SRV  LRLPGAG  GP+P NTLSRLSAL+V+SLRSNG
Sbjct  59   QSWRGVICNSDKSRVIELRLPGAGLSGPIPPNTLSRLSALEVVSLRSNG  107



>ref|XP_010251541.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251542.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251543.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
Length=636

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTC+ D +R+  +RLPG GF G +P NTLSRLSALQ+LSLRSNG
Sbjct  56   WTGVTCNSDKTRIIAVRLPGVGFQGRIPPNTLSRLSALQILSLRSNG  102



>ref|XP_006645650.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Oryza 
brachyantha]
Length=655

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+GVTCS DGSRV  LRLPG G  GPVP  TL RL+ALQVLSLR+N
Sbjct  74   NWTGVTCSGDGSRVVALRLPGLGLSGPVPAGTLGRLTALQVLSLRAN  120



>ref|XP_009796898.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796899.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796900.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=625

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ D SR+  +RLPG GF G +P NTLSRLSALQ+LSLRSN
Sbjct  56   WTGVTCNHDNSRIIAVRLPGVGFRGSIPVNTLSRLSALQILSLRSN  101



>ref|XP_009628885.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
 ref|XP_009628886.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=625

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTC+ D SR+  +RLPG GF G +P NTLSRLSALQ+LSLRSN
Sbjct  55   SWTGVTCNHDNSRIIAVRLPGVGFRGSIPVNTLSRLSALQILSLRSN  101



>gb|KDO76442.1| hypothetical protein CISIN_1g006922mg [Citrus sinensis]
Length=625

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GV CSEDG RV  +RLPG GF G +P NT+SRLSAL++LSLRSN
Sbjct  55   HWTGVKCSEDGKRVVAVRLPGVGFSGLIPPNTISRLSALKILSLRSN  101



>emb|CDY03527.1| BnaC01g15550D [Brassica napus]
Length=306

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+T +RLPG G +G +P NTLSRLS+L VLSLRSN
Sbjct  54   WTGVTCNKDGSRITAVRLPGVGLNGQIPPNTLSRLSSLTVLSLRSN  99



>ref|XP_006476438.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=625

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GV CSEDG RV  +RLPG GF G +P NT+SRLSAL++LSLRSN
Sbjct  55   HWTGVKCSEDGKRVVAVRLPGVGFSGLIPPNTISRLSALKILSLRSN  101



>ref|XP_009413825.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=632

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTCS DGSRV  +RLP  GF GP+P NTLSRLSALQ+LSL SN
Sbjct  59   WTGVTCSIDGSRVVAVRLPEIGFGGPIPPNTLSRLSALQILSLNSN  104



>ref|XP_008366817.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
 ref|XP_008366818.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=636

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            K+W G+TC+ DG+RV  +RLPGAG  GP+P NTL +L AL +LSLRSNG
Sbjct  53   KSWVGITCTLDGTRVVSVRLPGAGLFGPIPANTLGKLDALMILSLRSNG  101



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTCS+DG+RV  LRLPG G  GP+P NTL RL AL+VLSLRSN
Sbjct  60   WVGVTCSQDGTRVVALRLPGIGLSGPIPTNTLGRLDALRVLSLRSN  105



>ref|XP_007038934.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY23435.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=630

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            +W+GVTC  D SRV  LRLPG G  GP+P  TLSRLSA+Q+L LRSNG
Sbjct  55   SWTGVTCDNDHSRVIALRLPGMGLRGPIPPKTLSRLSAIQILCLRSNG  102



>gb|KDP22183.1| hypothetical protein JCGZ_26014 [Jatropha curcas]
Length=632

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTC+ D SRV  LRLPG G  G +P NTLSRLSA+Q+LSLRSNG
Sbjct  58   WTGVTCNNDRSRVITLRLPGVGIQGSIPPNTLSRLSAIQILSLRSNG  104



>ref|XP_009137362.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=628

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+T +RLPG G +G +P NTLSRLS+L VLSLRSN
Sbjct  54   WTGVTCNKDGSRITAVRLPGVGLNGQIPPNTLSRLSSLTVLSLRSN  99



>ref|NP_194105.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9SUQ3.1|Y4374_ARATH RecName: Full=Probable inactive receptor kinase At4g23740; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA23040.1| putative receptor kinase [Arabidopsis thaliana]
 emb|CAB81292.1| putative receptor kinase [Arabidopsis thaliana]
 dbj|BAC42978.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAP40406.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|ACN59347.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84800.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=638

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+  +RLPG G +G +P NT+SRLSAL+VLSLRSN
Sbjct  58   WTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSN  103



>emb|CDY47625.1| BnaA01g13400D [Brassica napus]
Length=662

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+T +RLPG G +G +P NTLSRLS+L VLSLRSN
Sbjct  88   WTGVTCNKDGSRITAVRLPGVGLNGQIPPNTLSRLSSLTVLSLRSN  133



>ref|XP_006283316.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16214.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=598

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+  +RLPG G +G +P NT+SRLSAL+VLSLRSN
Sbjct  19   WTGVTCNKDGSRIIAVRLPGVGLNGQIPSNTISRLSALRVLSLRSN  64



>ref|XP_006283317.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16215.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=635

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+  +RLPG G +G +P NT+SRLSAL+VLSLRSN
Sbjct  56   WTGVTCNKDGSRIIAVRLPGVGLNGQIPSNTISRLSALRVLSLRSN  101



>ref|XP_004253440.1| PREDICTED: probable inactive receptor kinase At4g23740, partial 
[Solanum lycopersicum]
Length=435

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ + SR+  +RLPG GF G +P NTLSRLSALQ+LSLRSN
Sbjct  56   WTGVTCNHEKSRIIAIRLPGVGFRGSIPGNTLSRLSALQILSLRSN  101



>ref|XP_006580544.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006580545.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
 gb|KHM99924.1| Putative inactive receptor kinase [Glycine soja]
Length=615

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ D S+V  +RLPG GFHG +P +T+SRLSALQ LSLRSN
Sbjct  57   WTGVTCNVDKSKVIAIRLPGVGFHGTIPPDTISRLSALQTLSLRSN  102



>ref|XP_009370892.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009370912.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=639

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+G+TC+ DG+RV  +RLPGAG +GP+P NTL +L AL +LSLRSN
Sbjct  53   KSWAGITCTLDGTRVLTVRLPGAGLYGPIPANTLGKLDALMILSLRSN  100



>ref|XP_006584744.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006584745.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
 ref|XP_006584746.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Glycine max]
 ref|XP_006584747.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X4 [Glycine max]
 ref|XP_006584748.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X5 [Glycine max]
 ref|XP_006584749.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X6 [Glycine max]
 ref|XP_006584750.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X7 [Glycine max]
 ref|XP_006584751.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X8 [Glycine max]
Length=638

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ D S+V  +RLPG GFHG +P +T+SRLSALQ LSLRSN
Sbjct  57   WTGVTCNVDKSKVIAIRLPGVGFHGSIPPDTISRLSALQTLSLRSN  102



>ref|XP_011007941.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011007942.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GV+CS D SRVT L LP  GF GP+P NTL RLSA+Q+LSL SNG
Sbjct  59   NWTGVSCSNDHSRVTALVLPRVGFRGPIPPNTLGRLSAIQILSLGSNG  106



>ref|XP_003565740.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brachypodium 
distachyon]
Length=637

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTCS DGSRV  LRLPG G  GPVP  TL RL+ALQVLSLR+N
Sbjct  58   WRGVTCSADGSRVVALRLPGLGLSGPVPRGTLGRLTALQVLSLRAN  103



>ref|XP_011084477.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740 [Sesamum indicum]
Length=631

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 2/50 (4%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTL--SRLSALQVLSLRSNG  2
            NW+G+TC+ D SRV  +RLP  GF G +PEN L  SRLSALQ+LSLRSNG
Sbjct  55   NWTGITCNHDNSRVIAVRLPALGFRGSIPENFLQISRLSALQILSLRSNG  104



>ref|XP_006439412.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
 gb|ESR52652.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
Length=625

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GV CSEDG RV  +RLPG GF G +P  T+SRLSAL++LSLRSN
Sbjct  55   HWTGVKCSEDGKRVVAVRLPGVGFSGLIPPKTISRLSALKILSLRSN  101



>ref|XP_006350601.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350602.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350603.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Solanum tuberosum]
Length=629

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTC+ D SR+  +RLPG GF G +P NTLSRLS LQ+LSLRSN
Sbjct  59   SWTGVTCNHDKSRIIAIRLPGVGFRGSIPGNTLSRLSDLQILSLRSN  105



>ref|XP_004503646.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cicer 
arietinum]
Length=645

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ED SRV  +RLPG GFHG +P  T+S L ALQ+LSLRSN
Sbjct  58   WTGVTCNEDRSRVIAIRLPGVGFHGTIPPFTISNLPALQILSLRSN  103



>ref|XP_008392458.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTCSED S V  +RLPG GF G +P +TLSRLS LQ+LSLRSN
Sbjct  55   HWTGVTCSEDKSHVIAVRLPGIGFTGQIPADTLSRLSRLQILSLRSN  101



>ref|XP_010059849.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059857.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW90565.1| hypothetical protein EUGRSUZ_A02671 [Eucalyptus grandis]
Length=665

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W+GV C+ D SRV  LRLPG GF GP+P NTLSRL+A+Q++SLR N
Sbjct  54   QSWTGVGCNADSSRVISLRLPGVGFRGPIPPNTLSRLTAIQIISLRLN  101



>ref|XP_009336254.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=654

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTCSED S V  +RLPG GF G +P NTLSRLS LQ LSLRSN
Sbjct  80   HWTGVTCSEDKSYVIAVRLPGIGFTGQIPANTLSRLSRLQTLSLRSN  126



>ref|XP_009337799.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=636

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            K+W G+TC+ DG+RV  +RLPGA   GP+P NTL RL AL +LSLRSNG
Sbjct  53   KSWVGITCTLDGTRVLSVRLPGARLFGPIPANTLGRLDALMILSLRSNG  101



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+G+TC+ DG+RV  +RLPG G +GP+P NTL +L AL +LSLRSN
Sbjct  53   KSWAGITCTLDGTRVLTVRLPGVGLYGPIPANTLGKLDALMILSLRSN  100



>ref|XP_008380496.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008380504.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362797.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362798.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=624

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K W+GV CS+D S V  L LPGA  HGP+P NTLSRLSALQVL+L SN
Sbjct  54   KTWTGVVCSKDQSGVIELHLPGAALHGPIPPNTLSRLSALQVLNLSSN  101



>gb|EYU19612.1| hypothetical protein MIMGU_mgv1a026050mg, partial [Erythranthe 
guttata]
Length=560

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+G+TC  D SRV  +RLPG G  G +P N L+RLSALQ+LSLRSN 
Sbjct  57   NWTGITCDRDNSRVVAIRLPGVGLKGVLPSNILTRLSALQILSLRSNA  104



>gb|EPS62971.1| hypothetical protein M569_11816, partial [Genlisea aurea]
Length=566

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+G++C   GSRV  +RLPG GF GP+P NTL+RLSAL++LSLRSN
Sbjct  29   NWTGISCDGGGSRVVSVRLPGFGFRGPIPGNTLTRLSALRILSLRSN  75



>gb|KHN44239.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            ++W GV C+ D SRV  LRLPGAG  GP+  NTLSRLSAL+V+SLRSNG
Sbjct  59   QSWRGVICNSDESRVIELRLPGAGLSGPISPNTLSRLSALEVVSLRSNG  107



>dbj|BAJ94608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+GVTCS DGSRV  LRLPG    GP+P  TL+RL+AL+VLSLR+N
Sbjct  56   NWTGVTCSADGSRVVELRLPGLALTGPMPRRTLARLTALRVLSLRAN  102



>ref|XP_003522551.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            ++W GV C+ D SRV  LRLPGAG  GP+  NTLSRLSAL+V+SLRSNG
Sbjct  59   QSWRGVICNSDESRVIELRLPGAGLSGPISPNTLSRLSALEVVSLRSNG  107



>gb|AAL09719.1| AT3g08680/F17O14_15 [Arabidopsis thaliana]
 gb|AAN18066.1| At3g08680/F17O14_15 [Arabidopsis thaliana]
Length=382

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TCS++ +RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  57   WTGITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  102



>ref|XP_002869766.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46025.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
Length=637

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+  +RLPG G +G +P NT+SRLS L+VLSLRSN
Sbjct  56   WTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSGLRVLSLRSN  101



>ref|XP_002513601.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49004.1| ATP binding protein, putative [Ricinus communis]
Length=621

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTC+ D SR+  LRLPG G  G +P NTL RLSA+Q+LSLRSNG
Sbjct  58   WTGVTCNRDHSRIIVLRLPGVGIQGQIPPNTLGRLSAIQILSLRSNG  104



>gb|ACC91242.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
halleri]
Length=636

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++DGSR+  +RLPG G +G +P NT+SRLS L+VLSLRSN
Sbjct  56   WTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSGLRVLSLRSN  101



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTCS+DG+ V  LRLPG G  GP+P NTL RL AL+VLSLRSN
Sbjct  95   WVGVTCSQDGNHVVMLRLPGVGLSGPIPANTLGRLDALKVLSLRSN  140



>gb|EPS74415.1| hypothetical protein M569_00340 [Genlisea aurea]
Length=629

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +WSG+TCS DG+ V G+ LPG G HG VP NT+ +L ALQVLSLRSN
Sbjct  55   SWSGITCSRDGTHVIGIHLPGIGLHGSVPVNTIGKLPALQVLSLRSN  101



>emb|CDY10963.1| BnaA03g46220D [Brassica napus]
Length=424

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            KNW+GVTC+ + SR+  LRLP  G +G +P NT+SRLSAL+VLSLRSN
Sbjct  55   KNWTGVTCNHNESRIIALRLPAIGLNGQIPPNTISRLSALRVLSLRSN  102



>ref|XP_009137388.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=616

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            KNW+GVTC+ + SR+  LRLP  G +G +P NT+SRLSAL+VLSLRSN
Sbjct  55   KNWTGVTCNHNESRIIALRLPAIGLNGQIPPNTISRLSALRVLSLRSN  102



>ref|XP_008439323.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008439324.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=631

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K W+GV C+ D SRV  LRLPG G  GP+P NTLSRLSAL++LSLR N
Sbjct  56   KAWTGVFCNSDESRVVALRLPGTGLRGPIPVNTLSRLSALEILSLRLN  103



>ref|XP_010676354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
Length=617

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+G+TC+ D SRV  +RLP  GF+G +P  T+SRLSALQ+LSLRSN
Sbjct  59   NWTGITCNADLSRVIAVRLPAVGFNGEIPARTISRLSALQILSLRSN  105



>emb|CDX94213.1| BnaC07g38470D [Brassica napus]
Length=615

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            KNW+GVTC+ + SR+  LRLP  G +G +P NT+SRLSAL+VLSLRSN
Sbjct  54   KNWTGVTCNRNESRIIALRLPAIGLNGQIPPNTISRLSALRVLSLRSN  101



>ref|XP_009352353.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009352354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=629

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTCSED S V  +RLPG GF G +P  TLSRLS LQ+LSLRSN
Sbjct  55   HWTGVTCSEDKSHVIAVRLPGIGFTGQIPAYTLSRLSRLQILSLRSN  101



>ref|XP_006287298.1| hypothetical protein CARUB_v10000491mg [Capsella rubella]
 gb|EOA20196.1| hypothetical protein CARUB_v10000491mg [Capsella rubella]
Length=613

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            WSGVTC  DG+RVT L LPGA   G +P  T+SRLS LQ+LSLRSNG
Sbjct  61   WSGVTCDRDGTRVTALHLPGASLIGQIPPGTISRLSELQILSLRSNG  107



>ref|XP_010541406.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=621

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTCS+DGS++  +RLPG G +G +P NT+SRLS L+VLSLRSN
Sbjct  59   WTGVTCSQDGSQIIAVRLPGVGLNGQIPPNTISRLSGLRVLSLRSN  104



>ref|XP_007158557.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
 gb|ESW30551.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
Length=590

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ D SRV  + LPG GFHG +P NTLSR++ LQ LSLRSN
Sbjct  57   WTGVTCNSDHSRVIAIHLPGFGFHGTIPPNTLSRVTCLQTLSLRSN  102



>ref|XP_006394667.1| hypothetical protein EUTSA_v10003837mg [Eutrema salsugineum]
 gb|ESQ31953.1| hypothetical protein EUTSA_v10003837mg [Eutrema salsugineum]
Length=615

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GVTC  DG+RVTGLRLPGA   G +P  T+SRLS LQ+LSLR NG
Sbjct  61   WPGVTCDRDGTRVTGLRLPGASLLGVIPPGTISRLSELQILSLRFNG  107



>ref|XP_006297193.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 ref|XP_006297194.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30091.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30092.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
Length=633

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++ +RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  56   SWTGITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  102



>ref|XP_010671535.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010671536.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
Length=633

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW+GVTC++  +RV  LRLPG G  G +P NTLSRL+ALQ++SLR+NG
Sbjct  57   NWTGVTCNDRQTRVIALRLPGIGIRGSIPLNTLSRLTALQIISLRNNG  104



>ref|XP_008793397.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008793471.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
Length=637

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW GV CS D +RV  +RLPG GF+G +P +TL RL+ALQVLSLR NG
Sbjct  60   NWRGVACSGDRARVVAVRLPGVGFNGQIPRDTLGRLTALQVLSLRCNG  107



>ref|XP_008239079.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008239080.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTCSED S V  +RLPG GF G +P  TLSRLS LQ+LSLRSN
Sbjct  55   HWTGVTCSEDKSYVIAVRLPGIGFTGQIPPYTLSRLSRLQILSLRSN  101



>ref|XP_010463311.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Camelina sativa]
Length=637

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++ +RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  57   SWTGITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  103



>ref|NP_187480.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_974257.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9C9Y8.1|Y3868_ARATH RecName: Full=Probable inactive receptor kinase At3g08680; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51359.1|AC012562_20 putative protein kinase; 49514-51513 [Arabidopsis thaliana]
 gb|ACN59313.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE74662.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEE74663.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=640

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++ +RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  56   SWTGITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  102



>ref|XP_008793541.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Phoenix dactylifera]
Length=626

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            NW GV CS D +RV  +RLPG GF+G +P +TL RL+ALQVLSLR NG
Sbjct  60   NWRGVACSGDRARVVAVRLPGVGFNGQIPRDTLGRLTALQVLSLRCNG  107



>gb|EYU42048.1| hypothetical protein MIMGU_mgv1a003031mg [Erythranthe guttata]
Length=614

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +WSGVTC+ D +RV  LRLP  G  GP+PENTL+RL AL  LSLRSN
Sbjct  60   SWSGVTCTPDATRVMALRLPALGLIGPIPENTLTRLDALTTLSLRSN  106



>ref|XP_010464477.1| PREDICTED: probable inactive receptor kinase At3g08680 [Camelina 
sativa]
Length=638

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++ +RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  58   SWTGITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  104



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  73   KSWVGVTCTSDGTRVLALRLPGIGLLGPIPPNTLGKLESLKILSLRSN  120



>gb|EPS58213.1| hypothetical protein M569_16602, partial [Genlisea aurea]
Length=493

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW GV CS DG RV GLRLPG G  GP+P NTL R+ +L VLSLRSN
Sbjct  53   NWVGVICSSDGGRVVGLRLPGIGLAGPIPINTLGRMDSLAVLSLRSN  99



>ref|XP_010915719.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915720.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915721.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=640

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTCS D +RV  +RLPG GF+G +P NTL RL+ALQ+LSLRSN
Sbjct  63   SWRGVTCSVDRARVVAVRLPGIGFNGSIPPNTLGRLTALQILSLRSN  109



>ref|XP_010097875.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB72472.1| putative inactive receptor kinase [Morus notabilis]
Length=640

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K W+G+ C+ D +RV  L LPG GF GP+P NTLSRLSAL+ LSLR N
Sbjct  56   KTWTGIICNSDHTRVVELHLPGVGFRGPIPSNTLSRLSALEFLSLRVN  103



>ref|XP_002882579.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58838.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++ +RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  55   SWTGITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  101



>gb|EYU36891.1| hypothetical protein MIMGU_mgv1a0177022mg, partial [Erythranthe 
guttata]
Length=369

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+ CS DG+ V GLRLPG G  GP+P+NTL +L++L+VLSLRSN
Sbjct  43   SWIGINCSTDGTTVVGLRLPGVGLTGPIPQNTLGKLTSLKVLSLRSN  89



>ref|XP_009123870.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
 ref|XP_009123879.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=618

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TCS++ SRVT LRLPG+G +GP+P+ T  +L AL+++SLRSN
Sbjct  52   WTGITCSKNNSRVTALRLPGSGLYGPLPDKTFEKLDALRIISLRSN  97



>ref|XP_010443551.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443552.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443553.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=661

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  78   KSWFGVTCTSDGTRVLALRLPGIGLLGPIPPNTLGKLESLKILSLRSN  125



>ref|XP_007210296.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
 gb|EMJ11495.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
Length=656

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTCSED S V  +RLPG GF G +P  TLSRLS LQ+LSLRSN
Sbjct  82   HWTGVTCSEDKSYVIAVRLPGIGFTGQIPPYTLSRLSRLQILSLRSN  128



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  75   KSWVGVTCTSDGTRVLALRLPGIGLLGPIPPNTLGKLESLRILSLRSN  122



>ref|XP_004149452.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 ref|XP_004164694.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN57874.1| hypothetical protein Csa_3G358620 [Cucumis sativus]
Length=630

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K W+GV C+ D S+V  LRLPG G  GP+P NTLSRLSAL++LSLR N
Sbjct  56   KAWTGVFCNSDESKVVALRLPGTGLRGPIPVNTLSRLSALEILSLRLN  103



>ref|XP_010453493.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453499.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453515.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  73   KSWVGVTCTSDGTRVLALRLPGIGLLGPIPPNTLGKLESLRILSLRSN  120



>emb|CDY35996.1| BnaA05g29540D [Brassica napus]
Length=635

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++  RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  53   SWTGITCSKNNDRVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  99



>ref|XP_009146990.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=635

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++  RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  53   SWTGITCSKNNDRVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSN  99



>emb|CDY27986.1| BnaC05g43880D [Brassica napus]
Length=631

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++ +RVT LRLPG+G +GP+PE T  +L AL+++SLRSN
Sbjct  53   SWTGITCSKNNARVTALRLPGSGLYGPLPEKTFEQLDALRIISLRSN  99



>ref|XP_004502606.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=597

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            + W GVTC+ D SRV  +RLPGAG  G +P NTL+RLSAL+ +SLRSNG
Sbjct  52   QTWRGVTCNTDESRVIAIRLPGAGLSGLIPPNTLTRLSALETVSLRSNG  100



>ref|XP_006401105.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
 gb|ESQ42558.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
Length=650

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  69   KSWVGVTCTSDGTRVLALRLPGIGLVGPIPPNTLGKLESLRILSLRSN  116



>ref|XP_004502605.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Cicer arietinum]
Length=621

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            + W GVTC+ D SRV  +RLPGAG  G +P NTL+RLSAL+ +SLRSNG
Sbjct  52   QTWRGVTCNTDESRVIAIRLPGAGLSGLIPPNTLTRLSALETVSLRSNG  100



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  GP+P NTL +L +L+VLSLRSN
Sbjct  85   KSWVGVTCTPDGARVLALRLPGIGLVGPIPPNTLGKLDSLRVLSLRSN  132



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  GP+P NTL +L +L+VLSLRSN
Sbjct  61   KSWVGVTCTPDGARVLALRLPGIGLVGPIPPNTLGKLDSLRVLSLRSN  108



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GV+CS DG+RV  LRLPG G +GP+P+NT+ RL AL  LSL SN 
Sbjct  60   WHGVSCSSDGTRVVALRLPGIGLYGPIPDNTIGRLDALTTLSLHSNA  106



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GV+CS DG+RV  LRLPG G +GP+P+NT+ RL AL  LSL SN 
Sbjct  59   WHGVSCSSDGTRVVALRLPGLGLYGPIPDNTIGRLDALTTLSLHSNA  105



>ref|XP_009352112.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=623

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K W+GV CS+D S V  L LPGA  HGP+P +TLSRLSALQVL+L SN
Sbjct  54   KTWTGVVCSKDQSGVIELHLPGAALHGPIPPSTLSRLSALQVLNLSSN  101



>ref|XP_004300851.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Fragaria 
vesca subsp. vesca]
Length=635

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTCS D S V  +RLPG G  GP+P NTLSR+S L++LSLRSN
Sbjct  56   HWTGVTCSADKSHVIAVRLPGIGLSGPIPPNTLSRVSGLEILSLRSN  102



>ref|XP_009375580.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009375581.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=624

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K W+GV CS+D S V  L LPGA  HGP+P +TLSRLSALQVL+L SN
Sbjct  54   KTWTGVVCSKDQSGVIELHLPGAALHGPIPPSTLSRLSALQVLNLSSN  101



>ref|XP_010448663.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010448664.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=641

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++D SR+  +RLPG G +G +P NT+SRLS+L+VLSLRSN
Sbjct  60   WTGVTCNKDRSRIIAVRLPGVGLNGQIPSNTISRLSSLRVLSLRSN  105



>ref|XP_006490586.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=619

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+GVTCS D SRV  LRLPG    G +P NT+ RLSALQ LSLRSN
Sbjct  59   KSWTGVTCSADHSRVVALRLPGMALRGEIPPNTIGRLSALQNLSLRSN  106



>gb|KDO56147.1| hypothetical protein CISIN_1g007167mg [Citrus sinensis]
Length=615

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+GVTCS D SRV  LRLPG    G +P NT+ RLSALQ LSLRSN
Sbjct  55   KSWTGVTCSADHSRVVALRLPGMALRGEIPPNTIGRLSALQNLSLRSN  102



>ref|XP_010493544.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493545.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493546.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493547.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=613

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GVTC +DG+RVT L LPGA   G +P  T+SRLS LQ+LSLRSNG
Sbjct  61   WPGVTCDKDGTRVTALHLPGASLLGVIPPGTISRLSELQILSLRSNG  107



>ref|XP_008376682.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            + W+GV CSED SRV  L LPGA   GP+P NTLSRLSAL VLSLR N
Sbjct  54   ETWNGVICSEDQSRVIELHLPGAALLGPIPPNTLSRLSALLVLSLRLN  101



>ref|XP_010433865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010433866.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=639

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++D SR+  +RLPG G +G +P NT+SRLS+L+VLSLRSN
Sbjct  59   WTGVTCNKDRSRIIAVRLPGVGLNGQIPSNTISRLSSLRVLSLRSN  104



>ref|XP_010421220.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=614

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GVTC +DG+RVT L LPGA   G +P  T+SRLS LQ+LSLRSNG
Sbjct  61   WPGVTCDKDGTRVTALHLPGASLLGVIPPGTISRLSELQILSLRSNG  107



>ref|XP_010445167.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=739

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC++D SR+  +RLPG G +G +P NT+SRLS+L+VLSLRSN
Sbjct  59   WTGVTCNKDRSRIIAVRLPGVGLNGQIPSNTISRLSSLRVLSLRSN  104



>gb|AFW80440.1| putative leucine-rich repeat receptor-like protein kinase family 
protein, partial [Zea mays]
Length=171

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTCS DG+RV  L LPG G  G VP  TL RL+ALQ+LSLRSN
Sbjct  41   WTGVTCSADGARVVALHLPGLGLSGAVPPGTLGRLTALQLLSLRSN  86



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC+++GSRV  +RLPG G +GP+P NTL +L +L +LSLRSN
Sbjct  55   WVGITCTKNGSRVLAVRLPGVGLYGPIPANTLEKLDSLMILSLRSN  100



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC+++GSRV  +RLPG G +GP+P NTL +L +L +LSLRSN
Sbjct  55   WVGITCTKNGSRVLAVRLPGVGLYGPIPANTLEKLDSLMILSLRSN  100



>ref|XP_010662595.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662596.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662597.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662598.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTCS D SRV  L LPG GF G +P NTL +LSA+Q+LSLRSN 
Sbjct  56   WTGVTCSGDHSRVIALHLPGIGFRGEIPPNTLGQLSAVQILSLRSNA  102



>ref|XP_006422104.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
 gb|ESR35344.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
Length=626

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+GVTCS D SRV  LRLPG    G +P NT+ RLSALQ LSLRSN
Sbjct  59   KSWTGVTCSADHSRVVALRLPGMALRGEIPPNTIGRLSALQNLSLRSN  106



>ref|XP_002872091.1| hypothetical protein ARALYDRAFT_489266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48350.1| hypothetical protein ARALYDRAFT_489266 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GVTC  DG+RVT L LPGA   G +P  T+SRLS LQ+LSLRSNG
Sbjct  61   WPGVTCDRDGTRVTALHLPGASLLGVIPPRTISRLSELQILSLRSNG  107



>ref|XP_007207849.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
 gb|EMJ09048.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
Length=623

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC+ DG+RV  +RLPG G +GP+P NTL +L AL VLSLRSN
Sbjct  45   WVGITCTLDGTRVLAVRLPGVGLYGPIPANTLGKLDALIVLSLRSN  90



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W+G+TC++D +RVT + LPG G  GP+PENT+ +L  L++LSLRSN
Sbjct  57   RSWNGITCNKDRTRVTAIHLPGVGLRGPIPENTIGKLDTLRILSLRSN  104



>ref|XP_008244579.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244587.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244595.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244604.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244609.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
Length=633

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC+ DG+RV  +RLPG G +GP+P NTL +L AL VLSLRSN
Sbjct  55   WVGITCTLDGTRVLAVRLPGVGLYGPIPANTLGKLDALIVLSLRSN  100



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W G+ C++D +RV GLRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  57   QSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSN  104



>ref|XP_010454700.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=613

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GVTC  DG+RVT L LPGA   G +P  T+SRLS LQ+LSLRSNG
Sbjct  61   WPGVTCDRDGTRVTALHLPGASLLGVIPPGTISRLSELQILSLRSNG  107



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W G+ C++D +RV GLRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  57   QSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSN  104



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W G+ C++D +RV GLRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  104  QSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSN  151



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W G+ C++D +RV GLRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  94   QSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSN  141



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W G+ C++D +RV GLRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  94   QSWVGINCTQDRTRVFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSN  141



>emb|CBI22555.3| unnamed protein product [Vitis vinifera]
Length=660

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTCS D SRV  L LPG GF G +P NTL +LSA+Q+LSLRSN 
Sbjct  56   WTGVTCSGDHSRVIALHLPGIGFRGEIPPNTLGQLSAVQILSLRSNA  102



>gb|EPS73425.1| hypothetical protein M569_01324, partial [Genlisea aurea]
Length=583

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            NW+G+TC+ D SRV  +RLPG G  G  P NTL+R+S+LQ+LSLRSN
Sbjct  55   NWTGITCNHDNSRVIAVRLPGIGLVGTFPPNTLNRISSLQILSLRSN  101



>ref|XP_010925785.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010925786.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=641

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GV CS D +RV  +RLPG GF+G +P +TL RL+ALQ+LSLRSNG
Sbjct  61   WRGVACSGDRARVVAVRLPGVGFNGRIPPDTLGRLTALQILSLRSNG  107



>ref|XP_011076041.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076042.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076043.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076044.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=627

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ D S++  +RLP  GF G +P NTLSRL ALQ+LSLRSN
Sbjct  56   WTGVTCNHDRSKIIAVRLPAIGFKGRIPPNTLSRLVALQILSLRSN  101



>ref|XP_008810859.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=644

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D +RV  LRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  62   SWIGVTCTADQTRVLALRLPGVGLFGPIPANTLGKLDALRVLSLRSN  108



>ref|XP_010938046.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=641

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTC+ D +RV  LRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  63   WVGVTCTTDQTRVLALRLPGVGLSGPIPANTLGKLDALRVLSLRSN  108



>ref|XP_003516715.2| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=635

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTC+ D SRV  + LPG GFHG +P NT+SR++ LQ LSLRSN
Sbjct  99   SWTGVTCNGDRSRVIAIHLPGFGFHGTIPPNTISRVTGLQTLSLRSN  145



>ref|XP_006391655.1| hypothetical protein EUTSA_v10024075mg [Eutrema salsugineum]
 gb|ESQ28941.1| hypothetical protein EUTSA_v10024075mg [Eutrema salsugineum]
Length=595

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTCSE+  R+  LRLPG GF+G +P  T+SRLSAL++LSLR N
Sbjct  53   WTGVTCSENRDRIVSLRLPGVGFNGSIPLFTISRLSALKILSLRKN  98



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GV+C+ DG+RV  LRLP  G +GP+P+NT+ RL AL  LSL SNG
Sbjct  57   WHGVSCNSDGTRVVALRLPAIGLYGPIPDNTIGRLDALTTLSLHSNG  103



>ref|XP_010921193.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=634

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D + V  LRLPGAG  GP+P NTL +L AL+VLSLRSN
Sbjct  59   SWIGVTCTADQTHVLALRLPGAGLSGPIPANTLGKLDALEVLSLRSN  105



>ref|XP_008794990.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
 ref|XP_008794991.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
Length=642

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            +W GV CS D +RV  +RLPG GF+G +P +TL RL+AL+VLSLRSNG
Sbjct  63   SWRGVACSGDRARVVAVRLPGVGFNGSIPPDTLGRLTALEVLSLRSNG  110



>ref|XP_009357339.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=627

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            + W+GV CS+D SRV  L LPGA   GP+P NTLSRLSAL VLSLR N
Sbjct  55   ETWNGVICSKDQSRVIELHLPGAALLGPIPRNTLSRLSALLVLSLRLN  102



>gb|KHG17391.1| hypothetical protein F383_22576 [Gossypium arboreum]
Length=661

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+ C++DGSRV  L LPG G HG +P NTL +L AL +LSLRSN
Sbjct  83   SWVGINCTKDGSRVIALHLPGVGLHGQIPANTLGKLDALMILSLRSN  129



>emb|CDP06375.1| unnamed protein product [Coffea canephora]
Length=667

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W+GVTC+ + +RV  LRLPG GF GP+P NTL RL AL  LSLRSN
Sbjct  69   RSWAGVTCTANATRVLELRLPGFGFDGPIPRNTLGRLDALASLSLRSN  116



>ref|XP_003564492.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=633

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TLS+L AL+VLSLRSN
Sbjct  57   SWVGVTCTPDNSRVHTLRLPAVGLFGPIPSDTLSKLDALEVLSLRSN  103



>ref|XP_010938045.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=682

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTC+ D +RV  LRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  104  WVGVTCTTDQTRVLALRLPGVGLSGPIPANTLGKLDALRVLSLRSN  149



>ref|XP_008810858.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D +RV  LRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  103  SWIGVTCTADQTRVLALRLPGVGLFGPIPANTLGKLDALRVLSLRSN  149



>ref|NP_197798.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9FL63.1|Y5410_ARATH RecName: Full=Inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11570.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAO64924.1| At5g24100 [Arabidopsis thaliana]
 dbj|BAE99411.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|ACN59373.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED93256.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=614

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GVTC  DG+RVT L LPGA   G +P  T+SRLS LQ+LSLRSNG
Sbjct  62   WPGVTCDIDGTRVTALHLPGASLLGVIPPGTISRLSELQILSLRSNG  108



>ref|XP_009368693.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009368694.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=630

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            + W+GV CS+D SRV  L LPGA   GP+P NTLSRLSAL VLSLR N
Sbjct  55   ETWNGVICSKDQSRVIELHLPGAALLGPIPPNTLSRLSALLVLSLRLN  102



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+ C++DGSRV  + LPG G +GP+P NTL +L AL +LSLRSN
Sbjct  56   SWVGINCTKDGSRVLAVHLPGVGLYGPIPANTLGKLDALMILSLRSN  102



>ref|XP_003568238.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=634

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ DG RV  LRLP  G  GP+P N L +L ALQVLSLRSN
Sbjct  58   SWVGVTCTPDGKRVRELRLPAIGLFGPIPSNILGKLDALQVLSLRSN  104



>ref|NP_001055854.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|AAT01376.1| putative phytosulfokine receptor kinase [Oryza sativa Japonica 
Group]
 dbj|BAF17768.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|EAY98442.1| hypothetical protein OsI_20356 [Oryza sativa Indica Group]
 dbj|BAG99879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=638

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TC+ DG RV  LRLP  G  GP+P +TL +L ALQVLSLRSN
Sbjct  58   SWVGITCTPDGRRVRELRLPAVGLFGPIPSDTLGKLDALQVLSLRSN  104



>gb|KCW46493.1| hypothetical protein EUGRSUZ_K00318 [Eucalyptus grandis]
Length=451

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W+GV C+ D SRV  L+LPG G  G +P NTLSRLSALQ+LSLR N
Sbjct  55   RSWTGVKCNNDQSRVVALQLPGVGIKGRIPPNTLSRLSALQMLSLRLN  102



>ref|XP_009607078.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=625

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TCS DG+ V  +RLPG G  GP+PENTL ++ A+++LSLRSN
Sbjct  58   SWVGITCSTDGAHVVAVRLPGVGLIGPLPENTLGKIDAIRILSLRSN  104



>ref|XP_004235218.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318222.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318223.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318224.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=635

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+G+ C+EDG+RV  + LP  G  GP+P N++ +L AL+VLSLR+N
Sbjct  57   KSWAGIACNEDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRAN  104



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TCSEDG+ V  +RLPG G  GP+P+NTL +L +L+++SLR+N
Sbjct  79   SWVGITCSEDGAHVVAVRLPGVGLAGPLPQNTLGKLDSLRIISLRAN  125



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+G+TC++DG+RV  + LP  G  GP+P N++ +L AL+VLSLR+N
Sbjct  104  KSWAGITCNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRAN  151



>ref|XP_006407752.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
 gb|ESQ49205.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
Length=639

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+G+TCS++ +RV  LRLPG+G +GP+P+ T  +L AL+++SLRSN
Sbjct  55   SWTGITCSKNNARVIALRLPGSGLYGPLPDQTFEKLDALRIISLRSN  101



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+ CS DG  V GLRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  78   WIGINCSVDGRNVIGLRLPGVGLTGPIPNNTLGKLEALRVLSLRSN  123



>ref|NP_200638.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_001119458.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9LVM0.1|Y5830_ARATH RecName: Full=Probable inactive receptor kinase At5g58300; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL57654.1| unknown protein [Arabidopsis thaliana]
 gb|AAN64529.1| At5g58299/At5g58299 [Arabidopsis thaliana]
 gb|ACN59396.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97030.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED97031.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=654

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+ V  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  75   KSWVGVTCTSDGTSVHALRLPGIGLLGPIPPNTLGKLESLRILSLRSN  122



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TCS DG+ V  +RLPG G  GP+PENTL ++ A+++LSLRSN
Sbjct  58   SWVGITCSTDGAHVVAVRLPGVGLVGPLPENTLGKMDAVRILSLRSN  104



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+ CS DG  V GLRLPG G  GP+P NTL +L AL+VLSLRSN
Sbjct  59   WIGINCSVDGRNVIGLRLPGVGLTGPIPNNTLGKLEALRVLSLRSN  104



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W GV+C+ D +RV  LRLP  G +GP+PENT+ RL AL  LSL SNG
Sbjct  57   WHGVSCNSDETRVVALRLPAIGLYGPIPENTIGRLDALTTLSLHSNG  103



>ref|XP_010035197.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW46492.1| hypothetical protein EUGRSUZ_K00318 [Eucalyptus grandis]
Length=633

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            ++W+GV C+ D SRV  L+LPG G  G +P NTLSRLSALQ+LSLR N
Sbjct  55   RSWTGVKCNNDQSRVVALQLPGVGIKGRIPPNTLSRLSALQMLSLRLN  102



>dbj|BAK08005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  58   SWVGVTCTPDNSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSN  104



>gb|ACN30771.1| unknown [Zea mays]
Length=639

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTCS DG+RV  L LPG G  G VP  TL RL+ALQ+LSLRSN
Sbjct  41   WTGVTCSADGARVVALHLPGLGLSGAVPPGTLGRLTALQLLSLRSN  86



>emb|CDX87143.1| BnaC09g04580D [Brassica napus]
Length=621

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            WSGVTC+ D +RVT L LPGA   G +P  T+SRLS L++LSLRSNG
Sbjct  61   WSGVTCNRDNTRVTALHLPGASLLGTLPPGTISRLSELEILSLRSNG  107



>ref|NP_001168844.1| uncharacterized LOC100382649 precursor [Zea mays]
 gb|ACN30844.1| unknown [Zea mays]
 gb|AFW80439.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=672

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTCS DG+RV  L LPG G  G VP  TL RL+ALQ+LSLRSN
Sbjct  74   WTGVTCSADGARVVALHLPGLGLSGAVPPGTLGRLTALQLLSLRSN  119



>gb|EEE64112.1| hypothetical protein OsJ_18944 [Oryza sativa Japonica Group]
Length=638

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TC+ DG RV  LRLP  G  GP+P +TL +L ALQVLSLRSN
Sbjct  58   SWVGITCTPDGRRVRELRLPAVGLLGPIPSDTLGKLDALQVLSLRSN  104



>ref|XP_006644911.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=630

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  58   SWVGVTCTPDNSRVQTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSN  104



>ref|XP_006650037.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=635

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTCS D SR++ LR+P AG  G +P NTL RL +LQVLSLRSN
Sbjct  57   WHGVTCSPDRSRISALRVPAAGLIGAIPTNTLGRLVSLQVLSLRSN  102



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC+ +G+RVT LRLPG G  G VP NT+ RL AL++LSLRSN
Sbjct  58   WVGITCNRNGTRVTALRLPGVGLVGSVPSNTVGRLDALRILSLRSN  103



>emb|CDY19849.1| BnaA09g05020D [Brassica napus]
Length=621

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            WSGVTC+ D +RVT L LPGA   G +P  T+SRLS L++LSLRSNG
Sbjct  61   WSGVTCNRDNTRVTALHLPGASLLGTLPPGTISRLSELEILSLRSNG  107



>ref|XP_006654545.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=638

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ DG RV  LRLP  G  GP+P + L +L ALQVLSLRSN
Sbjct  58   SWVGVTCTTDGKRVRELRLPAVGLFGPIPSDILGKLDALQVLSLRSN  104



>ref|XP_009141903.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Brassica rapa]
Length=621

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            WSGVTC+ D +RVT L LPGA   G +P  T+SRLS L++LSLRSNG
Sbjct  61   WSGVTCNRDSTRVTALHLPGASLLGTLPPGTISRLSELEILSLRSNG  107



>ref|XP_010538821.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
 ref|XP_010538822.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=616

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TCS+D S+V  +RLP  G +G +P NT+SRLS L+VLSLRSN
Sbjct  56   WTGITCSQDESQVIAVRLPAVGLNGRIPSNTISRLSGLRVLSLRSN  101



>ref|NP_001050019.1| Os03g0332900 [Oryza sativa Japonica Group]
 gb|ABF95778.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95779.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11933.1| Os03g0332900 [Oryza sativa Japonica Group]
 dbj|BAG95872.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59003.1| hypothetical protein OsJ_10722 [Oryza sativa Japonica Group]
Length=634

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTCS D SR++ LR+P AG  G +P NTL RL +LQVLSLRSN
Sbjct  56   SWHGVTCSPDRSRISALRVPAAGLIGAIPPNTLGRLVSLQVLSLRSN  102



>ref|XP_008813231.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008813232.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=444

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D +RV  LRLPG G  G +P NTL +L ALQVLSLRSN
Sbjct  59   SWIGVTCTADQTRVLALRLPGVGLSGLIPANTLGKLDALQVLSLRSN  105



>gb|EMT17815.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=634

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  58   SWVGVTCTPDNSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSN  104



>gb|AFK45382.1| unknown [Medicago truncatula]
Length=610

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GV CSED S++  +RLPG GF+G +P NT+S++  LQ LSLRSN
Sbjct  59   WNGVICSEDRSQIIAIRLPGFGFNGTIPANTISKIKGLQKLSLRSN  104



>ref|XP_003611028.1| Probably inactive receptor-like protein kinase [Medicago truncatula]
 gb|AES93986.1| LRR receptor-like kinase [Medicago truncatula]
Length=610

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GV CSED S++  +RLPG GF+G +P NT+S++  LQ LSLRSN
Sbjct  59   WNGVICSEDRSQIIAIRLPGFGFNGTIPANTISKIKGLQKLSLRSN  104



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+ CSEDG+ V G+RLPG G  GP+P  TL +L +L+VLSLRSN
Sbjct  65   SWIGINCSEDGTSVIGVRLPGVGLTGPIPNGTLGKLDSLKVLSLRSN  111



>tpg|DAA57078.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=637

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  57   SWVGVTCTPDKSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSN  103



>ref|XP_002456542.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
 gb|EES01662.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
Length=635

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  58   SWVGVTCTPDKSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSN  104



>ref|XP_008813233.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=636

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D +RV  LRLPG G  G +P NTL +L ALQVLSLRSN
Sbjct  59   SWIGVTCTADQTRVLALRLPGVGLSGLIPANTLGKLDALQVLSLRSN  105



>ref|XP_002520893.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF41602.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=581

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ +G+RV  + LPG G +G +P NTL+RL AL++LSLRSN
Sbjct  58   SWFGVTCNSNGTRVMAIHLPGVGLYGRIPSNTLARLDALRILSLRSN  104



>ref|NP_001130388.1| uncharacterized LOC100191484 precursor [Zea mays]
 gb|ACF78585.1| unknown [Zea mays]
 gb|AFW84760.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=637

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  58   SWVGVTCTPDKSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSN  104



>ref|XP_004970381.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=635

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  59   WVGVTCTPDKSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSN  104



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTC++DG+RV  + LP  G  GP+P N++ +L AL+VLSLR+N
Sbjct  68   SWAGVTCNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRAN  114



>gb|ACA61611.1| hypothetical protein AP2_E06.2 [Arabidopsis lyrata subsp. petraea]
Length=658

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG  V  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  75   KSWVGVTCTSDGLSVHALRLPGIGLLGPIPPNTLGKLESLRILSLRSN  122



>ref|XP_002864562.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG  V  LRLPG G  GP+P NTL +L +L++LSLRSN
Sbjct  75   KSWVGVTCTSDGLSVHALRLPGIGLLGPIPPNTLGKLESLRILSLRSN  122



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTC++DG+RV  + LP  G  GP+P N++ +L AL+VLSLR+N
Sbjct  139  SWAGVTCNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRAN  185



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC+ +G+RVT LRLPG G  G VP NT+ RL AL++LSLRSN
Sbjct  58   WVGITCNLNGTRVTALRLPGVGLVGSVPSNTVGRLDALRILSLRSN  103



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W+G+ C++DG+RV  + LP  G  GP+P N++ +L AL+VLSLR+N
Sbjct  57   KSWAGIACNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRAN  104



>gb|EYU35188.1| hypothetical protein MIMGU_mgv1a002709mg [Erythranthe guttata]
Length=645

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC++D +RV G+ LPG G  GP+P NT+ +L AL+ LSLRSN
Sbjct  59   WIGITCTKDKTRVHGIHLPGIGLFGPIPSNTIGKLDALKTLSLRSN  104



>dbj|BAB62593.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB93368.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY76289.1| hypothetical protein OsI_04221 [Oryza sativa Indica Group]
Length=637

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D SRV  LRLP  G  GP+P +TL +L AL+VLSLRSN
Sbjct  58   SWVGVTCTPDNSRVQTLRLPAVGLFGPLPSDTLGKLDALEVLSLRSN  104



>gb|EMT10528.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=640

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ DG RV  LRLP  G  GP+P N L +L AL+VLSLRSN
Sbjct  58   SWVGVTCTPDGKRVRMLRLPAVGLFGPMPSNILGKLDALEVLSLRSN  104



>gb|KHN35064.1| Putative inactive receptor kinase [Glycine soja]
Length=540

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+GVTC+ D SRV  + LP  GFHG +P NT+SR++ L+ LSLRSN
Sbjct  41   WTGVTCNGDKSRVIAIHLPAFGFHGTIPPNTISRVTGLRTLSLRSN  86



>ref|XP_003518282.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=648

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTC+++G+ V  + LPGAGF G +PEN+L +L +L++LSL SNG
Sbjct  59   WAGVTCNQNGTSVIEIHLPGAGFKGSIPENSLGKLDSLKILSLHSNG  105



>gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTC  + +RV  LRLPG GF G +P NTLS+L AL+VLSLRSN
Sbjct  56   WVGVTCDSNHTRVIRLRLPGVGFVGHIPANTLSKLDALRVLSLRSN  101



>ref|XP_006590496.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=589

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W+GVTC+ D SRV  + LP  GFHG +P NT+SR++ L+ LSLRSN
Sbjct  53   SWTGVTCNGDKSRVIAIHLPAFGFHGTIPPNTISRVTGLRTLSLRSN  99



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+ DG+RV  LRLPG G  G +P NTL +L +L+ LSLRSN
Sbjct  75   KSWVGVTCTPDGTRVLALRLPGIGLVGQIPPNTLGKLESLKTLSLRSN  122



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTC+ D +RV  LRLPG G  GP+P NTL +L AL+VLSLR N
Sbjct  58   SWVGVTCTPDKTRVCTLRLPGVGLLGPIPPNTLGKLDALEVLSLRFN  104



>ref|XP_010043603.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW88397.1| hypothetical protein EUGRSUZ_A00785 [Eucalyptus grandis]
Length=613

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TCS++ +RV  LRLPG G  GP+P NTL +L AL  LSLRSN
Sbjct  56   SWVGITCSKNPTRVIALRLPGTGLFGPIPANTLGKLDALTALSLRSN  102



>ref|XP_003562443.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233863.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233866.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233870.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=640

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GVTCS D SR+  LR+PGAG  G +P NTL +L +LQVLSLRSN
Sbjct  61   SWHGVTCSGDQSRIFELRVPGAGLIGEIPPNTLGKLDSLQVLSLRSN  107



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTC+ + SRV G+ LPG GF GP+P N++ +L AL++LSLRSN
Sbjct  59   WIGVTCNVNRSRVIGIHLPGIGFTGPIPANSIGKLDALKILSLRSN  104



>ref|XP_006357316.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Solanum 
tuberosum]
Length=592

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TC++DG+RV  + LPG G  G +P N++ +L ALQVLSLR+N
Sbjct  58   SWIGITCNKDGTRVVAIHLPGVGLTGHIPANSIGKLDALQVLSLRAN  104



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTC+ + SRV G+ LPG GF GP+P N++ +L AL++LSLRSN
Sbjct  70   WIGVTCNVNRSRVIGIHLPGIGFTGPIPANSIGKLDALKILSLRSN  115



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TC+ +G+RV  LRLPG G  G VP NTL RL AL++LSLRSN
Sbjct  57   SWVGITCTPNGTRVISLRLPGVGLLGSVPPNTLGRLDALRILSLRSN  103



>ref|XP_007141331.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 ref|XP_007141332.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13325.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13326.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
Length=644

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            W+GVTC+++ + V  +RLPGAGF G +PEN+L +L++L++LSL SNG
Sbjct  59   WAGVTCNKNETSVISIRLPGAGFKGSIPENSLGKLNSLKILSLHSNG  105



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W GVTC+ + SRV G+ LPG GF GP+P N++ +L AL++LSLRSN
Sbjct  59   WIGVTCNVNRSRVIGIHLPGIGFTGPIPANSIGKLDALKILSLRSN  104



>ref|XP_008242698.1| PREDICTED: probable inactive receptor kinase At2g26730 [Prunus 
mume]
Length=659

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC +  S V+ LRLPG G  GPVP NTL RLS L+VLSLRSN
Sbjct  64   WVGITCDDKQSYVSALRLPGVGLVGPVPPNTLGRLSQLRVLSLRSN  109



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC++DG+RV  +RLPG G  G +P NTL +L A++++SLRSN
Sbjct  70   WVGITCNQDGTRVVNVRLPGVGLIGSIPSNTLGKLDAVKIISLRSN  115



>ref|XP_003523287.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006578848.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006578849.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
 ref|XP_006578850.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
 ref|XP_006578851.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            +W GVTC+ +G+RV GL LPG G  G +PEN++ +L AL+VLSL SNG
Sbjct  59   SWVGVTCNSNGTRVVGLHLPGMGLTGTIPENSIGKLDALRVLSLHSNG  106



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W G+TC++DG+RV  +RLPG G  G +P NTL +L A++++SLRSN
Sbjct  80   WVGITCNQDGTRVVNVRLPGVGLIGSIPSNTLGKLDAVKIISLRSN  125



>gb|KCW50324.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
 gb|KCW50325.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=630

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TC+ D +RVT +RLP  G +G +P NTL++L AL+VLSLRSN
Sbjct  59   SWVGITCNVDKTRVTKVRLPAVGLYGSLPPNTLAKLDALEVLSLRSN  105



>ref|XP_010031063.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031064.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031065.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031066.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW50323.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=633

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W G+TC+ D +RVT +RLP  G +G +P NTL++L AL+VLSLRSN
Sbjct  59   SWVGITCNVDKTRVTKVRLPAVGLYGSLPPNTLAKLDALEVLSLRSN  105



>ref|XP_011095165.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011095166.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=643

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            +W GV+C+ D +RV  LRLP  G  GP+P+NTL RL AL  LSLRSN
Sbjct  64   SWVGVSCTSDATRVMALRLPAFGLIGPIPQNTLGRLDALITLSLRSN  110



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  148  KNWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            K+W GVTC+   +RV  LRLPG GF G +P NTL +L AL+VLSLRSN
Sbjct  55   KSWVGVTCNPSQTRVLELRLPGVGFIGQIPANTLGKLDALRVLSLRSN  102



>gb|KHN25793.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            +W GVTC+ +G+RV GL LPG G  G +PEN++ +L AL+VLSL SNG
Sbjct  59   SWVGVTCNSNGTRVVGLHLPGMGLIGTIPENSIGKLDALRVLSLHSNG  106



>ref|XP_003526789.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX1 
[Glycine max]
 ref|XP_003526790.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX2 
[Glycine max]
 ref|XP_006581706.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=642

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  NWSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSNG  2
            +W GVTC+ +G+RV GL LPG G  G +PEN++ +L AL+VLSL SNG
Sbjct  59   SWVGVTCNSNGTRVVGLHLPGMGLIGTIPENSIGKLDALRVLSLHSNG  106



>ref|XP_006842563.1| hypothetical protein AMTR_s00077p00144650 [Amborella trichopoda]
 gb|ERN04238.1| hypothetical protein AMTR_s00077p00144650 [Amborella trichopoda]
Length=399

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  WSGVTCSEDGSRVTGLRLPGAGFHGPVPENTLSRLSALQVLSLRSN  5
            W+G+TC+ + + V  LRLPG G  GP+P NT+S L++LQ LSLRSN
Sbjct  62   WTGITCNPEKTHVIALRLPGVGLSGPIPPNTISNLTSLQTLSLRSN  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525616678368