BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c112235_g1_i1 len=223 path=[201:0-222]

Length=223
                                                                      Score     E

ref|NP_001236017.1|  uncharacterized protein LOC100526921             49.7    3e-05   
ref|XP_008229469.1|  PREDICTED: putative ribonuclease H protein A...  48.5    1e-04   
ref|NP_680384.1|  RNase H domain-containing protein                   45.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623307.1|  PREDICTED: uncharacterized protein LOC104114541  44.7    4e-04   
ref|XP_004293128.1|  PREDICTED: uncharacterized protein LOC101304545  46.2    5e-04   
ref|WP_007223039.1|  ribonuclease H                                   45.4    6e-04   
ref|XP_009113118.1|  PREDICTED: uncharacterized protein LOC103838431  45.8    6e-04   
ref|XP_009625948.1|  PREDICTED: uncharacterized protein LOC104116734  46.2    9e-04   



>ref|NP_001236017.1| uncharacterized protein LOC100526921 [Glycine max]
 ref|XP_006574355.1| PREDICTED: uncharacterized protein LOC100526921 isoform X1 [Glycine 
max]
 gb|ACU15942.1| unknown [Glycine max]
Length=247

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/76 (33%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = +2

Query  2    GIQIAVKMGFKKVIFENDSSMIVKFVNGDLYPSIATYNILEACKKELHRFELWQV--VEI  175
            G+++A +M  KK+I E+DS  +V  V   + P+   Y ++E  + +  RF+ W+V  V +
Sbjct  141  GLKVASEMNVKKLIVESDSDSVVSMVENGVKPNHPDYGVVELIRTKRRRFD-WEVRFVSV  199

Query  176  AREQNSVADAIAKQAK  223
            + + N VAD +A  A+
Sbjct  200  SNKANRVADRLANDAR  215



>ref|XP_008229469.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=333

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 7/75 (9%)
 Frame = +2

Query  2    GIQIAVKMGFKKVIFENDSSMIVK-FVNGD---LYPSIATYNILEACKKELHRFELWQVV  169
            G+++AV  GF K++ E DS + V  F   D    +P  A   +L  C K L  FE W + 
Sbjct  223  GLRLAVAKGFTKILIEMDSQIAVNLFQQRDSLCFHPLTA---LLSNCGKILRHFESWDIQ  279

Query  170  EIAREQNSVADAIAK  214
             I RE+N +AD +AK
Sbjct  280  HIFREKNGLADCLAK  294



>ref|NP_680384.1| RNase H domain-containing protein [Arabidopsis thaliana]
 gb|AED94895.1| RNase H domain-containing protein [Arabidopsis thaliana]
Length=129

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = +2

Query  20   KMGFKKVIFENDSSMIVKFVNGDL-YPSIATYNILEACKKELHRFELWQVVEIAREQNSV  196
            +  +KKVIFE+DS  +V  +  D  YP++A    ++  +    +FE  +V+ I RE NSV
Sbjct  32   RFNYKKVIFESDSQHLVSLLGDDTDYPNLAPR--IQDIRHIFQQFEEVKVMHIKREGNSV  89

Query  197  ADAIAKQA  220
            AD IA+++
Sbjct  90   ADRIARES  97



>ref|XP_009623307.1| PREDICTED: uncharacterized protein LOC104114541 [Nicotiana tomentosiformis]
Length=84

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 40/72 (56%), Gaps = 3/72 (4%)
 Frame = +2

Query  2    GIQIAVKMGFKKVIFENDSSMIVKFVNGDLYPSIATYNILEACKKELHRFELWQVVEIAR  181
            G+Q+A+K     +    D+S ++ F+  +   ++   NI+  C+  L +F    ++ + R
Sbjct  11   GLQLAIKFNLVPLEVNIDASEVITFLRNE---NLLYTNIIYDCRHLLQQFHDPHIIHVYR  67

Query  182  EQNSVADAIAKQ  217
            EQN VAD +AKQ
Sbjct  68   EQNEVADRLAKQ  79



>ref|XP_004293128.1| PREDICTED: uncharacterized protein LOC101304545 [Fragaria vesca 
subsp. vesca]
Length=260

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  2    GIQIAVKMGFKKVIFENDSSMIVKFVNGDLYPSIATYNILEA-CKKELHRFELWQVVEIA  178
            G+Q+A ++G K V   +DS ++V  V+G         N  +A  K  LHRFE   V +I 
Sbjct  183  GLQLAQEIGVKSVQVFSDSQLVVNQVSGTFEAKEPHLNFYQAPAKALLHRFESATVTQIP  242

Query  179  REQNSVADAIAKQA  220
            R++NS AD +A+ A
Sbjct  243  RKENSNADVLARLA  256



>ref|WP_007223039.1| ribonuclease H [planctomycete KSU-1]
 dbj|GAB63956.1| ribonuclease H [planctomycete KSU-1]
Length=203

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +2

Query  8    QIAVKMGFKKVIFENDSSMIVKFVNGDLYPSIAT----YNILEACKKELHRFELWQVVEI  175
            Q A+    K+VIF+ DS ++V+ +NG      A+    YN L A    LH+  +W++  +
Sbjct  125  QKAIHHNAKRVIFKTDSELLVRQLNGIYRVKSASILPLYNELMAL---LHKISVWKIQHV  181

Query  176  AREQNSVADAIAKQA  220
             RE+N  ADA+A Q 
Sbjct  182  RREENIHADALANQG  196



>ref|XP_009113118.1| PREDICTED: uncharacterized protein LOC103838431 [Brassica rapa]
Length=262

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    GIQIAVKMGFKKVIFENDSSMIVKFVNG--DLYPSIATYNILEACKKELHRFELWQVVEI  175
             +Q  V +G+K VIFE+DS  +V+ ++G  +++P +    I+E  ++ L + + +QV   
Sbjct  155  AVQNIVSLGYKYVIFESDSQTLVRMISGQEEVWPILQP--IVEETRRLLSQVQFFQVCFY  212

Query  176  AREQNSVADAIAKQ  217
             R  N VAD IAK+
Sbjct  213  PRGGNKVADRIAKE  226



>ref|XP_009625948.1| PREDICTED: uncharacterized protein LOC104116734 [Nicotiana tomentosiformis]
Length=403

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  35   KVIFENDSSMIVKFVNGDLYPSIATYNILEACKKELHRFELWQVVEIAREQNSVADAIAK  214
            K+  E DSS++V +VNG + P     + +E  +K +  FE + V    RE N VADA+AK
Sbjct  294  KICVELDSSLVVNWVNGKIKPPWNLRHNIEEIQKIMITFEAFHVTHCYREANRVADALAK  353

Query  215  QA  220
            + 
Sbjct  354  EG  355



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506208057152