BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c112072_g1_i1 len=120 path=[1:0-119]

Length=120
                                                                      Score     E

emb|CDP19152.1|  unnamed protein product                              53.1    2e-06   
ref|XP_004173702.1|  PREDICTED: serine/threonine-protein phosphat...  52.0    2e-06   
ref|XP_004142332.1|  PREDICTED: serine/threonine-protein phosphat...  52.0    3e-06   
ref|XP_008460604.1|  PREDICTED: serine/threonine-protein phosphat...  52.0    4e-06   
ref|XP_010646813.1|  PREDICTED: uncharacterized protein LOC104878332  47.0    2e-04   
emb|CAN69339.1|  hypothetical protein VITISV_032633                   47.0    2e-04   Vitis vinifera
emb|CAN67486.1|  hypothetical protein VITISV_005993                   47.0    2e-04   Vitis vinifera
emb|CAN71335.1|  hypothetical protein VITISV_035759                   46.2    3e-04   Vitis vinifera
ref|XP_010695802.1|  PREDICTED: serine/threonine-protein phosphat...  45.1    3e-04   
ref|XP_010648236.1|  PREDICTED: serine/threonine-protein phosphat...  45.4    3e-04   
ref|XP_010665454.1|  PREDICTED: serine/threonine-protein phosphat...  45.8    4e-04   
ref|XP_010652564.1|  PREDICTED: serine/threonine-protein phosphat...  45.8    5e-04   
emb|CAN83818.1|  hypothetical protein VITISV_002383                   45.8    5e-04   Vitis vinifera
gb|EPS71928.1|  hypothetical protein M569_02828                       45.8    5e-04   
ref|XP_010681841.1|  PREDICTED: serine/threonine-protein phosphat...  45.1    5e-04   
emb|CAN72427.1|  hypothetical protein VITISV_008825                   45.8    5e-04   Vitis vinifera
emb|CAN78664.1|  hypothetical protein VITISV_019818                   45.8    5e-04   Vitis vinifera
emb|CAN66129.1|  hypothetical protein VITISV_003261                   45.8    5e-04   Vitis vinifera
ref|XP_006606632.1|  PREDICTED: serine/threonine-protein phosphat...  45.4    6e-04   
gb|EYU27455.1|  hypothetical protein MIMGU_mgv1a020792mg              45.4    6e-04   
ref|XP_011095576.1|  PREDICTED: serine/threonine-protein phosphat...  45.4    7e-04   
ref|XP_010655181.1|  PREDICTED: putative receptor-like protein ki...  45.4    7e-04   
ref|XP_004250585.2|  PREDICTED: serine/threonine-protein phosphat...  45.1    8e-04   
ref|XP_006582663.1|  PREDICTED: serine/threonine-protein phosphat...  44.7    8e-04   
ref|XP_011080991.1|  PREDICTED: serine/threonine-protein phosphat...  45.1    9e-04   
ref|XP_011080990.1|  PREDICTED: serine/threonine-protein phosphat...  45.1    0.001   



>emb|CDP19152.1| unnamed protein product [Coffea canephora]
Length=1182

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    KGKYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            + K KL +LP++R+L  C +  WGSAVL  LYR +CRAS
Sbjct  248  QSKVKLMYLPFLRDLEACGKLSWGSAVLACLYREMCRAS  286



>ref|XP_004173702.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog, 
partial [Cucumis sativus]
Length=403

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            +L FLP++R+L    +F WGSAVL +LYR LCRAS
Sbjct  227  QLMFLPFLRDLECVEQFSWGSAVLAHLYRELCRAS  261



>ref|XP_004142332.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis sativus]
Length=501

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            +L FLP++R+L    +F WGSAVL +LYR LCRAS
Sbjct  325  QLMFLPFLRDLECVEQFSWGSAVLAHLYRELCRAS  359



>ref|XP_008460604.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460605.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460606.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460607.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460608.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
Length=872

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            +L FLP++R+L    +F WGSAVL +LYR LCRAS
Sbjct  333  QLMFLPFLRDLECVEQFSWGSAVLAHLYRELCRAS  367



>ref|XP_010646813.1| PREDICTED: uncharacterized protein LOC104878332 [Vitis vinifera]
Length=920

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            +L +LP +R+    + + WGSAVL YLYR LCRAS
Sbjct  872  QLCYLPLLRDFTEISHYSWGSAVLAYLYRELCRAS  906



>emb|CAN69339.1| hypothetical protein VITISV_032633 [Vitis vinifera]
Length=972

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            +L +LP +R+    + + WGSAVL YLYR LCRAS
Sbjct  510  QLCYLPLLRDFTEISHYSWGSAVLAYLYRELCRAS  544



>emb|CAN67486.1| hypothetical protein VITISV_005993 [Vitis vinifera]
Length=1448

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  14    KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
             +L +LP +R+    + + WGSAVL YLYR LCRAS
Sbjct  980   QLCYLPLLRDFTEISHYSWGSAVLAYLYRELCRAS  1014



>emb|CAN71335.1| hypothetical protein VITISV_035759 [Vitis vinifera]
Length=416

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  2    KGKY-KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            KG Y +L  LP +R+    A++ WGSA L +LYR LCRAS
Sbjct  168  KGTYLQLAILPMLRDFGKTAQYSWGSATLAHLYRELCRAS  207



>ref|XP_010695802.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Beta vulgaris subsp. vulgaris]
Length=214

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            ++ +LP + +L V   + WGSA L YLYR LCRAS
Sbjct  15   QVLYLPLLADLDVVGTYSWGSATLAYLYRQLCRAS  49



>ref|XP_010648236.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=277

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L FLP + +  V   + WGSA L +LYR LCRAS
Sbjct  191  KVHLMFLPLLEDFEVAGRYSWGSACLAWLYRQLCRAS  227



>ref|XP_010665454.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=469

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L FLP + +  V   + WGSA L +LYR LCRAS
Sbjct  87   KVHLMFLPLLEDFEVAGRYSWGSACLAWLYRQLCRAS  123



>ref|XP_010652564.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=754

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L FLP + +  V   + WGSA L +LYR LCRAS
Sbjct  191  KVHLMFLPLLEDFEVAGRYSWGSACLAWLYRQLCRAS  227



>emb|CAN83818.1| hypothetical protein VITISV_002383 [Vitis vinifera]
Length=624

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +2

Query  5    GKY-KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            GK+ +L +LP +R+    + + WGSAVL YLYR LCRAS
Sbjct  337  GKHVQLCYLPLLRDFTEISHYSWGSAVLAYLYRELCRAS  375



>gb|EPS71928.1| hypothetical protein M569_02828, partial [Genlisea aurea]
Length=550

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K KL +LP +R+        WG AVL  LYRALCRAS
Sbjct  203  KVKLMYLPLLRDFEEAGRLSWGGAVLACLYRALCRAS  239



>ref|XP_010681841.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Beta vulgaris subsp. vulgaris]
Length=298

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            ++ +LP + +L V   + WGSA L YLYR LCRAS
Sbjct  204  QVLYLPLLADLDVAGTYSWGSATLAYLYRQLCRAS  238



>emb|CAN72427.1| hypothetical protein VITISV_008825 [Vitis vinifera]
Length=1436

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L FLP + +  V   + WGSA L +LYR LCRAS
Sbjct  873  KVHLMFLPLLEDFEVAGRYSWGSACLAWLYRXLCRAS  909



>emb|CAN78664.1| hypothetical protein VITISV_019818 [Vitis vinifera]
Length=1433

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L FLP + +  V   + WGSA L +LYR LCRAS
Sbjct  931  KVHLMFLPLLEDFEVAGRYSWGSACLAWLYRXLCRAS  967



>emb|CAN66129.1| hypothetical protein VITISV_003261 [Vitis vinifera]
Length=1362

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L FLP + +  V   + WGSA L +LYR LCRAS
Sbjct  874  KVHLMFLPLLEDFEVAGRYSWGSACLAWLYRQLCRAS  910



>ref|XP_006606632.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Glycine max]
Length=472

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L +L ++R+   C  + WG+AVLG+LYR +C A+
Sbjct  101  KVSLRYLQFLRDFEECGRYAWGAAVLGFLYREMCNAT  137



>gb|EYU27455.1| hypothetical protein MIMGU_mgv1a020792mg, partial [Erythranthe 
guttata]
Length=616

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K KL +LP +R+        WG AVL  LYRALCRA+
Sbjct  203  KVKLMYLPLLRDFEAAGRMSWGGAVLACLYRALCRAT  239



>ref|XP_011095576.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Sesamum indicum]
 ref|XP_011095577.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Sesamum indicum]
Length=1042

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K KL +LP +R+        WG AVL  LYRALCRA+
Sbjct  203  KVKLMYLPLLRDFEAAGRLSWGGAVLACLYRALCRAT  239



>ref|XP_010655181.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Vitis 
vinifera]
Length=1523

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            +L +LP +R+    + + WGS VL YLYR LCRAS
Sbjct  200  QLCYLPLLRDFIEISHYSWGSVVLAYLYRELCRAS  234



>ref|XP_004250585.2| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Solanum lycopersicum]
Length=522

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +2

Query  5    GKY-KLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            G Y KL +LP + +L V + + WGSA L  LYR LCRAS
Sbjct  171  GNYLKLMYLPMLEDLNVVSSYSWGSATLACLYRFLCRAS  209



>ref|XP_006582663.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Glycine max]
Length=284

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  8    KYKLYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            K  L +L ++R+   C  + WG+AVLG+LYR +C A+
Sbjct  101  KVSLRYLQFLRDFEECGRYAWGAAVLGFLYREMCNAT  137



>ref|XP_011080991.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
isoform X2 [Sesamum indicum]
Length=491

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  17   LYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            L++L Y+ N+     + WG+AVLGYLYR LC AS
Sbjct  207  LFYLRYMENICDTGSYSWGTAVLGYLYRELCVAS  240



>ref|XP_011080990.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
isoform X1 [Sesamum indicum]
Length=560

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  17   LYFLPYIRNLYVCAEFCWGSAVLGYLYRALCRAS  118
            L++L Y+ N+     + WG+AVLGYLYR LC AS
Sbjct  207  LFYLRYMENICDTGSYSWGTAVLGYLYRELCVAS  240



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518182412384