BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c111998_g1_i1 len=398 path=[410:0-397]

Length=398
                                                                      Score     E

gb|KDP37352.1|  hypothetical protein JCGZ_06806                       47.4    9e-05   
gb|ABK94181.1|  unknown                                               47.0    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006373773.1|  hypothetical protein POPTR_0016s05270g           46.2    2e-04   
gb|KDP37350.1|  hypothetical protein JCGZ_06804                       45.8    3e-04   
ref|XP_007203440.1|  hypothetical protein PRUPE_ppa021775mg           45.4    4e-04   
ref|XP_006381022.1|  hypothetical protein POPTR_0006s05470g           44.7    7e-04   
ref|XP_006387570.1|  hypothetical protein POPTR_0831s00200g           44.7    8e-04   



>gb|KDP37352.1| hypothetical protein JCGZ_06806 [Jatropha curcas]
Length=64

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  241  QDLAPAPSPDVGAGLSLPVSGALLGTSLIVSLFAFFR  131
            Q  APAPSPD GAG SLPVSGA++G SL+VS     +
Sbjct  27   QVAAPAPSPDAGAGFSLPVSGAVVGLSLLVSFLGLLK  63



>gb|ABK94181.1| unknown [Populus trichocarpa]
Length=67

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -2

Query  238  DLAPAPSP-DVGAGLSLPVSGALLGTSLIVSLFAFFR  131
            ++APAP+P D GAG SLPVSGA++G SL+VSL  F +
Sbjct  30   EMAPAPAPMDAGAGFSLPVSGAIVGFSLVVSLLGFLK  66



>ref|XP_006373773.1| hypothetical protein POPTR_0016s05270g [Populus trichocarpa]
 gb|ERP51570.1| hypothetical protein POPTR_0016s05270g [Populus trichocarpa]
Length=67

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = -2

Query  238  DLAPAPSP--DVGAGLSLPVSGALLGTSLIVSLFAFFR  131
            ++APAP+P  D GAG SLPVSGA++G SL+VSL  F +
Sbjct  29   EMAPAPAPGMDAGAGFSLPVSGAIVGFSLVVSLLGFLK  66



>gb|KDP37350.1| hypothetical protein JCGZ_06804 [Jatropha curcas]
Length=64

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  238  DLAPAPSPDVGAGLSLPVSGALLGTSLIVSLFAFFR  131
             LAPAPSPD GAG SLP+S A++ +SL++S  A  R
Sbjct  28   QLAPAPSPDTGAGFSLPMSSAIVASSLVLSFIALLR  63



>ref|XP_007203440.1| hypothetical protein PRUPE_ppa021775mg [Prunus persica]
 gb|EMJ04639.1| hypothetical protein PRUPE_ppa021775mg [Prunus persica]
Length=71

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 3/40 (8%)
 Frame = -2

Query  241  QDLAPAPSP---DVGAGLSLPVSGALLGTSLIVSLFAFFR  131
            Q+ APAP+P   D GA  SLPV+GA +G SL+VS+FA F+
Sbjct  28   QESAPAPAPAQMDAGAAYSLPVNGAAVGASLMVSVFALFK  67



>ref|XP_006381022.1| hypothetical protein POPTR_0006s05470g [Populus trichocarpa]
 gb|ABK92800.1| unknown [Populus trichocarpa]
 gb|ERP58819.1| hypothetical protein POPTR_0006s05470g [Populus trichocarpa]
Length=68

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = -2

Query  241  QDLAPAPSP--DVGAGLSLPVSGALLGTSLIVSLFAFFR  131
            + +APAP+P  + GAG SLPVSGA++G SL+VSL  F +
Sbjct  29   ESMAPAPAPGMEAGAGFSLPVSGAMVGFSLVVSLLGFLK  67



>ref|XP_006387570.1| hypothetical protein POPTR_0831s00200g [Populus trichocarpa]
 gb|ERP46484.1| hypothetical protein POPTR_0831s00200g [Populus trichocarpa]
Length=68

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = -2

Query  241  QDLAPAPSP--DVGAGLSLPVSGALLGTSLIVSLFAFFR  131
            + +APAP+P  + GAG SLPVSGA++G SL+VSL  F +
Sbjct  29   ESMAPAPAPGMEAGAGFSLPVSGAIVGFSLVVSLLGFLK  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512400555856