BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11195_g1_i1 len=1620 path=[1598:0-1619]

Length=1620
                                                                      Score     E

ref|XP_009599369.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    665   0.0      
ref|XP_004245060.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       647   0.0      
ref|XP_006351615.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       646   0.0      
ref|XP_007033645.1|  UDP-glucosyltransferase 74F2, putative             616   0.0      
ref|XP_010069229.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    612   0.0      
ref|XP_006442123.1|  hypothetical protein CICLE_v10020092mg             610   0.0      
ref|XP_006478555.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    606   0.0      
ref|XP_006478556.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    605   0.0      
emb|CAN68287.1|  hypothetical protein VITISV_017016                     602   0.0      Vitis vinifera
ref|XP_011085046.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       601   0.0      
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       598   0.0      
ref|XP_002278455.1|  PREDICTED: UDP-glycosyltransferase 74F2            588   0.0      Vitis vinifera
gb|EYU17631.1|  hypothetical protein MIMGU_mgv1a006064mg                570   0.0      
gb|EYU17634.1|  hypothetical protein MIMGU_mgv1a006216mg                568   0.0      
gb|EYU17628.1|  hypothetical protein MIMGU_mgv1a020645mg                566   0.0      
ref|XP_010101355.1|  UDP-glycosyltransferase 74F2                       560   0.0      
ref|XP_010101353.1|  UDP-glycosyltransferase 74F2                       551   0.0      
gb|AFJ52958.1|  UDP-glycosyltransferase 1                               548   0.0      
gb|KDP35132.1|  hypothetical protein JCGZ_10666                         541   0.0      
ref|XP_007033647.1|  UDP-glycosyltransferase 74 F1, putative            541   0.0      
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       540   0.0      
ref|XP_002309737.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    539   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006442124.1|  hypothetical protein CICLE_v10023826mg             537   0.0      
ref|XP_008384038.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       538   0.0      
ref|XP_008243112.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       538   0.0      
gb|ABK96547.1|  unknown                                                 537   0.0      Populus trichocarpa x Populus deltoides
ref|XP_011047643.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       535   0.0      
ref|XP_007203876.1|  hypothetical protein PRUPE_ppa005294mg             535   0.0      
ref|XP_003531287.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       533   0.0      
ref|XP_009366234.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       532   0.0      
ref|XP_010672475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    531   0.0      
ref|XP_008243111.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       531   0.0      
ref|XP_010242476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       529   0.0      
ref|XP_010672476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    528   1e-180   
ref|XP_002273866.1|  PREDICTED: UDP-glycosyltransferase 74E2            522   3e-178   Vitis vinifera
ref|XP_003632443.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       521   9e-178   
ref|XP_010242475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       521   1e-177   
ref|XP_007159561.1|  hypothetical protein PHAVU_002G247700g             519   6e-177   
ref|XP_010522253.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       514   3e-175   
ref|XP_010037081.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       514   5e-175   
ref|XP_002529826.1|  UDP-glucosyltransferase, putative                  514   5e-175   Ricinus communis
gb|KDP45202.1|  hypothetical protein JCGZ_15067                         514   7e-175   
ref|XP_003629941.1|  UDP-glucose glucosyltransferase                    513   1e-174   
gb|AFK43317.1|  unknown                                                 512   3e-174   
ref|XP_002880070.1|  UDP-glucosyltransferase 74F2                       511   5e-174   
ref|XP_010101354.1|  UDP-glycosyltransferase 74F2                       511   9e-174   
emb|CDY17908.1|  BnaC04g03110D                                          510   2e-173   
ref|NP_181910.1|  UDP-glucosyltransferase 74F2                          509   5e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002269003.2|  PREDICTED: UDP-glycosyltransferase 74E2            507   2e-172   Vitis vinifera
ref|XP_007201501.1|  hypothetical protein PRUPE_ppa016883mg             507   3e-172   
ref|XP_006294206.1|  hypothetical protein CARUB_v10023202mg             506   6e-172   
gb|KDP45201.1|  hypothetical protein JCGZ_15066                         506   7e-172   
ref|XP_004504205.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       506   8e-172   
ref|XP_009142974.1|  PREDICTED: UDP-glycosyltransferase 74F2            501   3e-170   
gb|KFK37204.1|  hypothetical protein AALP_AA4G227700                    501   5e-170   
ref|XP_002310479.2|  putative glucosyltransferase family protein        501   1e-169   Populus trichocarpa [western balsam poplar]
ref|XP_011047632.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       500   2e-169   
ref|XP_002532442.1|  UDP-glucosyltransferase, putative                  499   6e-169   Ricinus communis
ref|XP_006478567.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       496   2e-168   
gb|AFJ52957.1|  UDP-glycosyltransferase 1                               498   3e-168   
ref|XP_006397555.1|  hypothetical protein EUTSA_v10001440mg             496   7e-168   
emb|CDX83455.1|  BnaA03g20510D                                          495   1e-167   
ref|XP_006296149.1|  hypothetical protein CARUB_v10025301mg             494   3e-167   
ref|XP_010506284.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       494   4e-167   
ref|XP_010508370.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       493   5e-167   
ref|XP_006295749.1|  hypothetical protein CARUB_v10024869mg             493   9e-167   
ref|XP_010506287.1|  PREDICTED: UDP-glycosyltransferase 74F1 isof...    492   3e-166   
ref|XP_010508369.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       491   6e-166   
ref|XP_010517962.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       491   7e-166   
emb|CDY64614.1|  BnaAnng19440D                                          491   7e-166   
ref|NP_973682.1|  UDP-glycosyltransferase 74 F1                         490   8e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133637.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       490   1e-165   
gb|KFK37203.1|  hypothetical protein AALP_AA4G227600                    490   1e-165   
ref|XP_008455265.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    490   1e-165   
emb|CDY65158.1|  BnaC03g72710D                                          489   2e-165   
ref|XP_007049534.1|  UDP-xylose phenolic glycosyltransferase, put...    489   2e-165   
ref|XP_006397556.1|  hypothetical protein EUTSA_v10001441mg             489   2e-165   
ref|XP_010506285.1|  PREDICTED: UDP-glycosyltransferase 74F2            489   3e-165   
ref|NP_181912.1|  UDP-glycosyltransferase 74 F1                         488   8e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469356.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       488   9e-165   
ref|XP_006447932.1|  hypothetical protein CICLE_v10015140mg             488   1e-164   
ref|XP_007049526.1|  UDP-xylose phenolic glycosyltransferase, put...    487   2e-164   
emb|CAN70002.1|  hypothetical protein VITISV_033171                     487   2e-164   Vitis vinifera
gb|KDO43525.1|  hypothetical protein CISIN_1g012194mg                   487   3e-164   
ref|XP_004290110.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       486   1e-163   
ref|XP_006469358.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    486   1e-163   
ref|XP_007049529.1|  UDP-xylose phenolic glycosyltransferase, put...    485   1e-163   
ref|XP_006447926.1|  hypothetical protein CICLE_v10015147mg             485   2e-163   
ref|XP_011082054.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       485   2e-163   
ref|XP_006469357.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       485   2e-163   
ref|XP_010095580.1|  UDP-glycosyltransferase 74F2                       484   2e-163   
ref|XP_009783231.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       483   6e-163   
ref|XP_004289758.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       483   7e-163   
ref|XP_003548080.2|  PREDICTED: UDP-glycosyltransferase 74E2-like       484   7e-163   
ref|XP_007151915.1|  hypothetical protein PHAVU_004G086500g             483   1e-162   
ref|XP_010517963.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       480   5e-162   
gb|KGN43661.1|  hypothetical protein Csa_7G051410                       481   5e-162   
ref|XP_002880071.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    480   7e-162   
ref|XP_002320558.1|  putative glucosyltransferase family protein        480   9e-162   Populus trichocarpa [western balsam poplar]
ref|XP_009625439.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       480   9e-162   
gb|KFK37205.1|  hypothetical protein AALP_AA4G227800                    480   1e-161   
gb|KEH25943.1|  UDP-glucosyltransferase family protein                  480   1e-161   
ref|XP_007045533.1|  UDP-xylose phenolic glycosyltransferase, put...    479   2e-161   
ref|XP_004244485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       479   3e-161   
ref|XP_010524193.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       478   4e-161   
ref|XP_009335348.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       478   7e-161   
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                        478   1e-160   Lycium barbarum [goji berry]
ref|XP_002532451.1|  UDP-glucosyltransferase, putative                  478   1e-160   Ricinus communis
emb|CDY64613.1|  BnaAnng19430D                                          476   3e-160   
emb|CDX83456.1|  BnaA03g20500D                                          476   3e-160   
emb|CDP03995.1|  unnamed protein product                                476   4e-160   
gb|KDP45199.1|  hypothetical protein JCGZ_15064                         477   4e-160   
ref|XP_011079130.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       475   9e-160   
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       475   1e-159   
ref|XP_006447928.1|  hypothetical protein CICLE_v10017682mg             475   2e-159   
ref|XP_009783230.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       474   3e-159   
ref|XP_003632087.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       473   4e-159   
emb|CDP06918.1|  unnamed protein product                                473   5e-159   
gb|KEH25944.1|  UDP-glucosyltransferase family protein                  473   8e-159   
gb|ACM09899.2|  glycosyltransferase                                     473   1e-158   Withania somnifera [ashwagandha]
ref|XP_004292062.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       473   1e-158   
ref|NP_001234680.1|  UDP-xylose phenolic glycosyltransferase            471   2e-158   
ref|XP_009133642.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       471   2e-158   
ref|XP_004289756.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       472   3e-158   
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       471   3e-158   
dbj|BAG80538.1|  UDP-glucose:glucosyltransferase                        470   1e-157   Lycium barbarum [goji berry]
ref|XP_006447240.1|  hypothetical protein CICLE_v10015138mg             469   2e-157   
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       469   2e-157   
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       469   3e-157   
ref|XP_009133641.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       468   3e-157   
emb|CDP03926.1|  unnamed protein product                                467   1e-156   
gb|KEH25945.1|  UDP-glucosyltransferase family protein                  466   3e-156   
dbj|BAD95102.1|  putative glucosyltransferase                           465   4e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011037065.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       466   5e-156   
ref|XP_004489724.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       466   5e-156   
ref|XP_008236255.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       466   6e-156   
ref|XP_010037076.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       465   9e-156   
ref|XP_006357048.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       465   9e-156   
ref|NP_001274852.1|  UDP-glycosyltransferase 74E2-like                  465   1e-155   
ref|XP_004244487.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    464   1e-155   
ref|XP_009142972.1|  PREDICTED: UDP-glycosyltransferase 74F1            464   1e-155   
emb|CDX79797.1|  BnaA05g03590D                                          464   1e-155   
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       464   2e-155   
ref|XP_007199115.1|  hypothetical protein PRUPE_ppa020804mg             464   2e-155   
ref|XP_009590532.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       464   3e-155   
ref|XP_006447931.1|  hypothetical protein CICLE_v10015145mg             464   3e-155   
ref|XP_009133636.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       463   3e-155   
gb|KEH25946.1|  UDP-glucosyltransferase family protein                  464   3e-155   
ref|XP_010679006.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       463   6e-155   
ref|XP_004244486.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       463   6e-155   
emb|CDY17907.1|  BnaC04g03120D                                          462   1e-154   
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...    462   1e-154   
gb|AFJ52952.1|  UDP-glycosyltransferase 1                               461   2e-154   
ref|XP_010037078.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       461   2e-154   
ref|XP_006357047.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       461   4e-154   
ref|XP_011037069.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       461   4e-154   
ref|XP_008236256.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       461   5e-154   
ref|XP_004137037.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       461   7e-154   
ref|XP_008455273.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       461   7e-154   
ref|XP_008338819.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       459   1e-153   
ref|XP_009776061.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       459   2e-153   
ref|XP_009410732.1|  PREDICTED: crocetin glucosyltransferase 2-like     460   2e-153   
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...    459   2e-153   
ref|XP_006357098.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       458   6e-153   
ref|XP_009366994.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       458   6e-153   
ref|XP_002529825.1|  UDP-glucosyltransferase, putative                  458   6e-153   Ricinus communis
emb|CDP13110.1|  unnamed protein product                                457   8e-153   
ref|XP_007044514.1|  UDP-glucosyl transferase 74B1                      457   8e-153   
emb|CDP05435.1|  unnamed protein product                                462   9e-153   
gb|KDP35129.1|  hypothetical protein JCGZ_10663                         456   2e-152   
ref|XP_010037079.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       457   2e-152   
ref|XP_007201011.1|  hypothetical protein PRUPE_ppa005386mg             457   2e-152   
ref|XP_006357100.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       456   2e-152   
ref|XP_006388126.1|  hypothetical protein POPTR_0322s00200g             455   7e-152   
ref|XP_002275387.2|  PREDICTED: UDP-glycosyltransferase 74E1-like       455   8e-152   Vitis vinifera
ref|XP_010091337.1|  UDP-glycosyltransferase 74E2                       454   1e-151   
ref|XP_008235864.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       454   2e-151   
emb|CDP03994.1|  unnamed protein product                                454   3e-151   
ref|XP_002529823.1|  UDP-glucosyltransferase, putative                  454   3e-151   Ricinus communis
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    454   3e-151   
gb|KCW48703.1|  hypothetical protein EUGRSUZ_K02355                     453   5e-151   
ref|XP_011086491.1|  PREDICTED: UDP-glycosyltransferase 74B1            453   5e-151   
gb|AIT15666.1|  UDP-glycosyltransferase                                 450   1e-150   
gb|KDP21298.1|  hypothetical protein JCGZ_21769                         452   1e-150   
ref|XP_010043823.1|  PREDICTED: UDP-glycosyltransferase 74B1            452   1e-150   
ref|XP_008236257.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       452   1e-150   
emb|CAN69453.1|  hypothetical protein VITISV_002845                     451   2e-150   Vitis vinifera
ref|XP_006478564.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       450   2e-150   
emb|CDY44260.1|  BnaC03g24520D                                          449   6e-150   
ref|XP_006447930.1|  hypothetical protein CICLE_v10015149mg             450   7e-150   
ref|XP_006372897.1|  putative glucosyltransferase family protein        449   1e-149   
ref|XP_006370131.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    450   1e-149   
ref|XP_008235866.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       449   2e-149   
ref|XP_011002911.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    449   2e-149   
ref|XP_002532443.1|  UDP-glucosyltransferase, putative                  446   3e-149   Ricinus communis
ref|XP_003613351.1|  N-hydroxythioamide S-beta-glucosyltransferase      449   3e-149   
ref|XP_011002910.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    448   4e-149   
ref|XP_002280305.1|  PREDICTED: UDP-glycosyltransferase 74B1            448   4e-149   Vitis vinifera
ref|XP_010037080.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       448   5e-149   
ref|XP_008460408.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       447   8e-149   
ref|XP_006447933.1|  hypothetical protein CICLE_v10015155mg             447   9e-149   
gb|KDO43523.1|  hypothetical protein CISIN_1g012277mg                   446   2e-148   
ref|XP_010095579.1|  UDP-glycosyltransferase 74E2                       445   4e-148   
emb|CAN67249.1|  hypothetical protein VITISV_008684                     444   4e-148   Vitis vinifera
ref|XP_010069571.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       446   4e-148   
ref|XP_007224980.1|  hypothetical protein PRUPE_ppa020679mg             445   9e-148   
ref|XP_008237299.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       445   9e-148   
gb|KDP35128.1|  hypothetical protein JCGZ_10662                         443   2e-147   
gb|KHG30812.1|  hypothetical protein F383_15387                         444   3e-147   
emb|CDP08071.1|  unnamed protein product                                443   4e-147   
emb|CBI24722.3|  unnamed protein product                                441   6e-147   
ref|XP_002520220.1|  UDP-glucosyltransferase, putative                  443   6e-147   Ricinus communis
ref|XP_006469355.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       443   6e-147   
emb|CBI24715.3|  unnamed protein product                                440   6e-147   
gb|AFK36738.1|  unknown                                                 442   9e-147   
gb|KDO43524.1|  hypothetical protein CISIN_1g012277mg                   442   1e-146   
ref|XP_011082055.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       442   1e-146   
gb|EYU20869.1|  hypothetical protein MIMGU_mgv1a005301mg                442   2e-146   
ref|XP_010672479.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       440   7e-146   
ref|XP_010321783.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       440   7e-146   
gb|KDP45197.1|  hypothetical protein JCGZ_15062                         440   8e-146   
ref|XP_007033641.1|  Uridine diphosphate glycosyltransferase 74E2...    439   9e-146   
emb|CBI24719.3|  unnamed protein product                                439   1e-145   
gb|AES96307.2|  UDP-glucosyltransferase family protein                  440   3e-145   
ref|XP_010679007.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       438   3e-145   
ref|XP_002267665.1|  PREDICTED: UDP-glycosyltransferase 74B1            438   3e-145   Vitis vinifera
ref|XP_006484310.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       440   4e-145   
ref|XP_002529824.1|  UDP-glucosyltransferase, putative                  438   4e-145   Ricinus communis
ref|XP_002309739.1|  putative glucosyltransferase family protein        437   7e-145   Populus trichocarpa [western balsam poplar]
ref|XP_009776895.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       437   7e-145   
ref|XP_011002951.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    438   8e-145   
ref|XP_003517852.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       437   9e-145   
ref|XP_007199830.1|  hypothetical protein PRUPE_ppa005475mg             437   1e-144   
ref|XP_006438479.1|  hypothetical protein CICLE_v10031201mg             439   2e-144   
ref|XP_007208259.1|  hypothetical protein PRUPE_ppa016486mg             436   2e-144   
ref|XP_006344123.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       436   2e-144   
ref|XP_007133505.1|  hypothetical protein PHAVU_011G184600g             436   2e-144   
emb|CBI33059.3|  unnamed protein product                                434   2e-144   
ref|XP_003624250.1|  UDP-glucose glucosyltransferase                    436   3e-144   
ref|XP_010908641.1|  PREDICTED: crocetin glucosyltransferase 2-like     435   4e-144   
ref|XP_003613349.1|  UDP-glucose glucosyltransferase                    439   2e-143   
ref|XP_007222137.1|  hypothetical protein PRUPE_ppa005722mg             432   3e-143   
gb|KEH25950.1|  UDP-glucosyltransferase family protein                  432   4e-143   
ref|XP_006355936.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       432   6e-143   
ref|XP_003543857.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       432   6e-143   
ref|XP_010069572.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       432   6e-143   
ref|XP_010695870.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       433   8e-143   
ref|XP_007157504.1|  hypothetical protein PHAVU_002G075200g             432   8e-143   
ref|XP_004162644.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       432   9e-143   
gb|KHN13207.1|  UDP-glycosyltransferase 74E1                            431   1e-142   
ref|XP_006355935.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       432   1e-142   
dbj|BAO51836.1|  UDP-glycosyltransferase 74Y1                           432   1e-142   
ref|XP_010692817.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       432   1e-142   
ref|XP_010552631.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       431   2e-142   
ref|XP_010679009.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    431   2e-142   
ref|XP_004144461.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       431   3e-142   
ref|XP_007201692.1|  hypothetical protein PRUPE_ppa016444mg             431   4e-142   
gb|KDP35131.1|  hypothetical protein JCGZ_10665                         430   4e-142   
ref|XP_008233915.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       429   8e-142   
emb|CAN74227.1|  hypothetical protein VITISV_041748                     429   9e-142   Vitis vinifera
ref|XP_009613938.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       428   2e-141   
gb|AFJ52950.1|  UDP-glycosyltransferase 1                               429   2e-141   
gb|AEM42999.1|  UDP-glucosyltransferase                                 428   2e-141   
ref|XP_010672480.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       428   2e-141   
ref|XP_007036115.1|  UDP-glucosyl transferase 74B1, putative            428   2e-141   
ref|XP_003624251.1|  UDP-glucose glucosyltransferase                    427   4e-141   
gb|AFJ52953.1|  UDP-glycosyltransferase 1                               428   5e-141   
ref|XP_011082053.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       427   5e-141   
dbj|BAG80546.1|  UDP-glucose:glucosyltransferase                        428   6e-141   Lycium barbarum [goji berry]
ref|XP_002306205.2|  putative glucosyltransferase family protein        427   9e-141   Populus trichocarpa [western balsam poplar]
ref|XP_008235865.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       427   9e-141   
emb|CDP13108.1|  unnamed protein product                                425   9e-141   
ref|XP_002321569.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    426   1e-140   Populus trichocarpa [western balsam poplar]
ref|XP_007151237.1|  hypothetical protein PHAVU_004G029500g             426   1e-140   
ref|XP_007033644.1|  Uridine diphosphate glycosyltransferase 74E2       429   1e-140   
gb|ABB88578.1|  UDP-glucosyltransferase                                 426   1e-140   Ixeris dentata var. albiflora
ref|XP_009797699.1|  PREDICTED: UDP-glycosyltransferase 74B1            426   2e-140   
ref|XP_009383146.1|  PREDICTED: crocetin glucosyltransferase 2-like     425   2e-140   
gb|KHN09954.1|  UDP-glycosyltransferase 74E1                            425   3e-140   
gb|AGZ84547.1|  glycosyltransferase KGT18                               425   4e-140   
ref|XP_004144399.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       425   5e-140   
ref|XP_003541519.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       424   7e-140   
ref|XP_011028616.1|  PREDICTED: UDP-glycosyltransferase 74B1            424   8e-140   
ref|XP_008245156.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       424   1e-139   
gb|KCW48704.1|  hypothetical protein EUGRSUZ_K02355                     423   1e-139   
ref|XP_010908661.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       424   1e-139   
ref|XP_006342416.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       423   2e-139   
ref|XP_011047628.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    423   2e-139   
ref|XP_003554595.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       423   2e-139   
gb|AIE12489.1|  UGT9                                                    422   4e-139   
ref|XP_010069225.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       422   5e-139   
ref|XP_010069226.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       423   5e-139   
dbj|BAG80543.1|  UDP-glucose:glucosyltransferase                        422   5e-139   
ref|XP_006447238.1|  hypothetical protein CICLE_v10018164mg             421   7e-139   
gb|KCW57503.1|  hypothetical protein EUGRSUZ_H00275                     422   8e-139   
gb|KDP31143.1|  hypothetical protein JCGZ_11519                         422   8e-139   
ref|XP_010069224.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       422   1e-138   
gb|EYU17621.1|  hypothetical protein MIMGU_mgv1a006158mg                421   2e-138   
emb|CAN80193.1|  hypothetical protein VITISV_017236                     441   2e-138   
gb|KCW57502.1|  hypothetical protein EUGRSUZ_H00273                     422   2e-138   
gb|ACU19612.1|  unknown                                                 421   2e-138   
gb|AFJ52954.1|  UDP-glycosyltransferase 1                               420   3e-138   
ref|XP_004298592.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       420   4e-138   
ref|XP_002275194.2|  PREDICTED: UDP-glycosyltransferase 74E2            426   5e-138   
ref|XP_007151254.1|  hypothetical protein PHAVU_004G031100g             420   5e-138   
ref|XP_004493041.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       419   6e-138   
emb|CDX95572.1|  BnaC03g24530D                                          417   6e-138   
ref|XP_007210590.1|  hypothetical protein PRUPE_ppa016463mg             419   8e-138   
ref|XP_006476729.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       419   8e-138   
gb|EYU29695.1|  hypothetical protein MIMGU_mgv1a006214mg                419   9e-138   
gb|KDO69768.1|  hypothetical protein CISIN_1g012645mg                   419   1e-137   
emb|CDP08069.1|  unnamed protein product                                417   2e-137   
ref|XP_010069575.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       418   2e-137   
ref|XP_010091051.1|  UDP-glycosyltransferase                            418   2e-137   
ref|XP_006439748.1|  hypothetical protein CICLE_v10020081mg             418   3e-137   
ref|XP_007033374.1|  Uridine diphosphate glycosyltransferase 74E2...    424   4e-137   
ref|XP_008460407.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       417   4e-137   
ref|XP_009590752.1|  PREDICTED: UDP-glycosyltransferase 74B1            417   5e-137   
ref|XP_010672483.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       416   1e-136   
ref|XP_004493042.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       416   2e-136   
ref|XP_008233916.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       415   3e-136   
ref|XP_004287162.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       415   5e-136   
ref|XP_008239719.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       414   7e-136   
emb|CAN67246.1|  hypothetical protein VITISV_008681                     413   7e-136   
gb|KDP35130.1|  hypothetical protein JCGZ_10664                         414   7e-136   
ref|XP_007033375.1|  Uridine diphosphate glycosyltransferase 74E2...    412   2e-135   
ref|NP_001063685.1|  Os09g0518200                                       413   2e-135   
gb|KFK42906.1|  hypothetical protein AALP_AA1G053600                    413   2e-135   
ref|XP_002529822.1|  UDP-glucosyltransferase, putative                  412   3e-135   
gb|AGD95005.1|  lignan glucosyltransferase                              412   4e-135   
emb|CAN67248.1|  hypothetical protein VITISV_008683                     411   4e-135   
ref|XP_004253028.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       411   6e-135   
ref|XP_004299583.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       411   8e-135   
ref|XP_003554601.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       411   9e-135   
emb|CDP21774.1|  unnamed protein product                                408   1e-134   
ref|XP_010552632.1|  PREDICTED: UDP-glycosyltransferase 74B1            411   1e-134   
dbj|BAG80534.1|  putative glycosyltransferase                           410   2e-134   
ref|XP_007137294.1|  hypothetical protein PHAVU_009G115200g             410   2e-134   
ref|XP_010039151.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       410   2e-134   
gb|AFJ52955.1|  UDP-glycosyltransferase 1                               409   2e-134   
ref|XP_002460531.1|  hypothetical protein SORBIDRAFT_02g030050          410   3e-134   
ref|XP_011100878.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       410   3e-134   
gb|EAZ09772.1|  hypothetical protein OsI_32059                          410   3e-134   
ref|XP_003519432.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       409   4e-134   
ref|XP_003543858.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       409   6e-134   
gb|KHN28671.1|  UDP-glycosyltransferase 74B1                            409   8e-134   
ref|XP_006664936.1|  PREDICTED: crocetin glucosyltransferase 2-like     409   1e-133   
ref|XP_004297667.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       408   2e-133   
ref|XP_010069220.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       408   2e-133   
ref|XP_003624252.1|  UDP-glucosyltransferase, putative                  408   2e-133   
gb|KHN13206.1|  UDP-glycosyltransferase 74F1                            407   3e-133   
ref|XP_004296695.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       407   4e-133   
ref|XP_006417998.1|  hypothetical protein EUTSA_v10007603mg             407   4e-133   
ref|XP_010557055.1|  PREDICTED: UDP-glycosyltransferase 74C1            407   5e-133   
gb|KGN58388.1|  hypothetical protein Csa_3G636370                       405   8e-133   
ref|NP_172059.1|  Uridine diphosphate glycosyltransferase 74E2          406   1e-132   
ref|XP_008805997.1|  PREDICTED: indole-3-acetate beta-glucosyltra...    405   1e-132   
ref|XP_007151246.1|  hypothetical protein PHAVU_004G030400g             405   1e-132   
ref|XP_002892308.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    405   2e-132   
ref|XP_010069221.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       405   3e-132   
ref|XP_004144268.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       405   3e-132   
ref|XP_009111039.1|  PREDICTED: UDP-glycosyltransferase 74E2            404   4e-132   
ref|XP_010522243.1|  PREDICTED: UDP-glycosyltransferase 74E2            404   4e-132   
gb|KCW57957.1|  hypothetical protein EUGRSUZ_H00691                     404   5e-132   
emb|CAN68288.1|  hypothetical protein VITISV_017017                     423   5e-132   
gb|KCW57958.1|  hypothetical protein EUGRSUZ_H00692                     403   2e-131   
ref|XP_004957371.1|  PREDICTED: crocetin glucosyltransferase 2-like     403   2e-131   
ref|XP_010242509.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       403   2e-131   
ref|XP_010069222.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       403   2e-131   
gb|KHN40516.1|  UDP-glycosyltransferase 74E1                            402   3e-131   
ref|XP_007222164.1|  hypothetical protein PRUPE_ppa005780mg             402   3e-131   
emb|CDP08067.1|  unnamed protein product                                395   3e-131   
gb|KCW57495.1|  hypothetical protein EUGRSUZ_H00261                     401   1e-130   
ref|XP_003552471.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       400   1e-130   
emb|CDP00213.1|  unnamed protein product                                399   1e-130   
gb|KHN45525.1|  UDP-glycosyltransferase 74E2                            399   2e-130   
ref|XP_008445485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       400   2e-130   
gb|KCW57498.1|  hypothetical protein EUGRSUZ_H00263                     401   2e-130   
ref|XP_010069223.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       401   2e-130   
ref|XP_009119126.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       400   2e-130   
ref|XP_010485192.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       399   3e-130   
ref|XP_006307470.1|  hypothetical protein CARUB_v10009096mg             399   5e-130   
ref|XP_010101352.1|  UDP-glycosyltransferase 74E2                       405   8e-130   
emb|CDP08068.1|  unnamed protein product                                398   1e-129   
ref|XP_010475277.1|  PREDICTED: UDP-glycosyltransferase 74E2            398   1e-129   
gb|EPS69486.1|  glycosyltransferase                                     397   2e-129   
ref|XP_006342417.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       397   3e-129   
ref|NP_001184915.1|  UDP-Glycosyltransferase superfamily protein        397   4e-129   
gb|AGU14135.1|  UDP-glycosyltransferase                                 395   6e-129   
ref|XP_004957373.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       396   1e-128   
emb|CDY51326.1|  BnaA10g03470D                                          395   1e-128   
ref|XP_006858827.1|  hypothetical protein AMTR_s00066p00177000          395   2e-128   
ref|XP_002467184.1|  hypothetical protein SORBIDRAFT_01g021110          395   2e-128   
ref|XP_010025874.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       395   2e-128   
gb|AFJ52956.1|  UDP-glycosyltransferase 1                               394   2e-128   
ref|XP_010457662.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       394   4e-128   
ref|XP_004253027.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       394   6e-128   
ref|XP_004957367.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       394   7e-128   
emb|CDY10139.1|  BnaC05g03820D                                          393   9e-128   
ref|XP_010457690.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       393   1e-127   
ref|XP_008670325.1|  PREDICTED: crocetin glucosyltransferase 2-like     393   1e-127   
ref|XP_008361795.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       393   2e-127   
ref|XP_006588331.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       392   2e-127   
ref|XP_006858835.1|  hypothetical protein AMTR_s00066p00178850          392   3e-127   
ref|XP_007151178.1|  hypothetical protein PHAVU_004G024500g             392   3e-127   
ref|XP_008670324.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       392   4e-127   
ref|XP_011073993.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       391   5e-127   
dbj|BAK00438.1|  predicted protein                                      391   2e-126   
ref|XP_004957369.1|  PREDICTED: crocetin glucosyltransferase 2-like     389   9e-126   
ref|XP_010475278.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    388   9e-126   
sp|Q6X1C0.1|GLT2_CROSA  RecName: Full=Crocetin glucosyltransferase 2    388   1e-125   
ref|XP_002310396.2|  hypothetical protein POPTR_0007s00860g             386   1e-125   
ref|XP_003624245.1|  UDP-glucosyltransferase, putative                  387   2e-125   
ref|XP_002460530.1|  hypothetical protein SORBIDRAFT_02g030020          387   8e-125   
gb|AAR06920.1|  UDP-glycosyltransferase 74G1                            386   8e-125   
ref|XP_010510154.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       385   9e-125   
emb|CDY19104.1|  BnaA04g18440D                                          385   1e-124   
gb|KCW49321.1|  hypothetical protein EUGRSUZ_K02875                     385   1e-124   
gb|ACR10263.1|  UDP-glucosyl transferase 74c1                           385   1e-124   
ref|XP_010469678.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       385   2e-124   
dbj|BAJ97695.1|  predicted protein                                      385   2e-124   
ref|XP_009141182.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       384   3e-124   
ref|XP_003578448.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       384   5e-124   
ref|XP_010414084.1|  PREDICTED: UDP-glycosyltransferase 74C1            383   6e-124   
ref|XP_004309287.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       379   7e-124   
ref|XP_006410308.1|  hypothetical protein EUTSA_v10016636mg             383   8e-124   
ref|XP_008449394.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       384   8e-124   
emb|CBI24721.3|  unnamed protein product                                391   1e-123   
gb|KDO37942.1|  hypothetical protein CISIN_1g048393mg                   379   1e-123   
ref|XP_004983225.1|  PREDICTED: crocetin glucosyltransferase 2-like     382   1e-123   
ref|XP_006307446.1|  hypothetical protein CARUB_v10009070mg             382   2e-123   
ref|XP_007151253.1|  hypothetical protein PHAVU_004G031000g             381   4e-123   
ref|XP_010477734.1|  PREDICTED: UDP-glycosyltransferase 74B1            382   4e-123   
gb|AEZ01222.1|  UDP-glucosyltransferase                                 382   5e-123   
ref|XP_003578449.1|  PREDICTED: crocetin glucosyltransferase 2-like     381   1e-122   
ref|NP_180738.1|  UDP-glycosyltransferase 74C1                          380   1e-122   
gb|ABP49574.1|  UDP-glucose glucosyltransferase                         380   1e-122   
gb|ACR38641.1|  unknown                                                 380   2e-122   
gb|KHN40518.1|  UDP-glycosyltransferase 74F1                            379   2e-122   
ref|XP_010498931.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       380   2e-122   
ref|XP_006294187.1|  hypothetical protein CARUB_v10023181mg             379   3e-122   
ref|NP_180734.1|  UDP-glucosyl transferase 74D1                         379   4e-122   
gb|KFK31183.1|  hypothetical protein AALP_AA6G079400                    379   5e-122   
emb|CDY15370.1|  BnaC04g42530D                                          379   5e-122   
ref|XP_006372895.1|  hypothetical protein POPTR_0017s06080g             375   5e-122   
ref|NP_001150551.1|  indole-3-acetate beta-glucosyltransferase          379   6e-122   
gb|AAM61249.1|  putative glucosyltransferase                            378   7e-122   
ref|XP_010469679.1|  PREDICTED: UDP-glycosyltransferase 74D1            378   9e-122   
emb|CDY34513.1|  BnaC04g12860D                                          378   9e-122   
ref|XP_009603219.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       377   1e-121   
ref|XP_006304660.1|  hypothetical protein CARUB_v10011842mg             377   1e-121   
gb|KFK44473.1|  hypothetical protein AALP_AA1G261000                    377   1e-121   
ref|XP_010414087.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       377   2e-121   
gb|KFK31187.1|  hypothetical protein AALP_AA6G079800                    377   2e-121   
ref|XP_010510162.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       377   2e-121   
ref|XP_009141176.1|  PREDICTED: UDP-glycosyltransferase 74D1            377   3e-121   
ref|XP_002879339.1|  hypothetical protein ARALYDRAFT_482098             376   3e-121   
ref|XP_002879343.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    376   4e-121   
ref|XP_006410305.1|  hypothetical protein EUTSA_v10016638mg             376   5e-121   
ref|XP_002462675.1|  hypothetical protein SORBIDRAFT_02g030040          377   6e-121   
gb|ABB88580.1|  UDP-glucosyltransferase                                 374   6e-121   
ref|XP_011047630.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       374   7e-121   
gb|ADW54462.1|  UDP-glucose glucosyl transferase                        376   8e-121   
ref|XP_004287163.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       377   1e-120   
ref|XP_010672477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    373   1e-120   
ref|XP_010460183.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       375   1e-120   
ref|XP_009144048.1|  PREDICTED: UDP-glycosyltransferase 74C1            375   1e-120   
emb|CDX79437.1|  BnaC03g17730D                                          374   2e-120   
gb|AAL09350.1|  thiohydroximate S-glucosyltransferase                   374   2e-120   
ref|XP_009115475.1|  PREDICTED: UDP-glycosyltransferase 74B1            374   3e-120   
emb|CDY60796.1|  BnaC05g50780D                                          374   5e-120   
gb|AFK35372.1|  unknown                                                 370   8e-120   
gb|KCW57501.1|  hypothetical protein EUGRSUZ_H00270                     372   1e-119   
ref|XP_006858838.1|  hypothetical protein AMTR_s00066p00179760          372   1e-119   
ref|XP_004140240.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       372   2e-119   
emb|CDY16245.1|  BnaA09g29790D                                          372   2e-119   
gb|AHK60847.1|  CrUGT9                                                  372   2e-119   
ref|XP_008445481.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       372   3e-119   
gb|KCW82891.1|  hypothetical protein EUGRSUZ_C04261                     371   3e-119   
gb|ACB59204.1|  glucosyltransferase                                     372   3e-119   
gb|KFK44472.1|  hypothetical protein AALP_AA1G260900                    371   3e-119   
gb|AAZ15016.1|  thiohydroximate S-glucosyltransferase                   371   3e-119   
gb|EYU41208.1|  hypothetical protein MIMGU_mgv1a025741mg                371   5e-119   
gb|ACU22885.1|  unknown                                                 369   6e-119   
ref|XP_004144190.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       370   9e-119   
emb|CDY70064.1|  BnaC08g46320D                                          369   9e-119   
ref|XP_002893325.1|  UDP-glucosyl transferase 74B1                      370   1e-118   
gb|AFJ52951.1|  UDP-glycosyltransferase 1                               368   1e-118   
gb|AGR44631.1|  UDP-glucosyltransferase 74A1                            369   2e-118   
ref|NP_173820.1|  UDP-glucosyl transferase 74B1                         369   2e-118   
ref|XP_009132814.1|  PREDICTED: UDP-glycosyltransferase 74D1            369   2e-118   
ref|XP_006416029.1|  hypothetical protein EUTSA_v10007574mg             369   3e-118   
ref|XP_002462674.1|  hypothetical protein SORBIDRAFT_02g030030          369   3e-118   
gb|AIE12488.1|  UGT8                                                    369   3e-118   
gb|EYU36667.1|  hypothetical protein MIMGU_mgv1a006023mg                369   4e-118   
gb|AGI44003.1|  UDP-glucose glucosyltransferase                         368   4e-118   
dbj|BAD34403.1|  putative UDP-glucose:salicylic acid glucosyltran...    369   5e-118   
gb|KCW57959.1|  hypothetical protein EUGRSUZ_H00694                     367   1e-117   
ref|XP_006296254.1|  hypothetical protein CARUB_v10025420mg             367   2e-117   
gb|KGN47941.1|  hypothetical protein Csa_6G418410                       367   3e-117   



>ref|XP_009599369.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Nicotiana tomentosiformis]
Length=456

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/440 (70%), Positives = 372/440 (85%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AHI+A+PYPSQGHINPMLQFCKRLVSKGLKTTLAIT F+S+S++ +S+ VGID ISDG D
Sbjct  11    AHILALPYPSQGHINPMLQFCKRLVSKGLKTTLAITNFLSHSVRLISNMVGIDTISDGFD  70

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + G+ +ADSV  YL RF+  GS+TLADLI++Y+ S+ P+ CVIYDSFMPWALDVAK HGL
Sbjct  71    EGGYAEADSVVTYLERFKKIGSQTLADLIKKYEKSEFPITCVIYDSFMPWALDVAKDHGL  130

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                CFFTQACAVNY+YY  HHG L LP++SPPVRI GLP LELRDMPSFIYVHG+YPAYF
Sbjct  131   IGACFFTQACAVNYIYYYVHHGKLTLPISSPPVRILGLPELELRDMPSFIYVHGTYPAYF  190

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ELVL+QF+N +KAD VFVNSFYKLEA+VVDTMSK++P+  IGPTVPSLYLDNR +ND EY
Sbjct  191   ELVLNQFINGDKADYVFVNSFYKLEAEVVDTMSKVTPLSTIGPTVPSLYLDNRAENDIEY  250

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+ LY +D +  I+WLNTK EGSV+YVAFGSM+++D+KQM+E+AWG K TN YFLWVVR 
Sbjct  251   GLXLYQVDASTCINWLNTKAEGSVVYVAFGSMSTLDEKQMKEIAWGLKATNCYFLWVVRT  310

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             S+  K+P++F+ +  +K L++NWSPQL+VL++KA+GCFF+HGGWNST EALS GVPMV M
Sbjct  311   SDEAKIPKSFIEETSEKGLVINWSPQLQVLSNKAIGCFFSHGGWNSTTEALSFGVPMVVM  370

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             P WTDQT NAKL+ DVW VG RV V E G+V R EIE CVR V+E   GKEMK+NA+KW 
Sbjct  371   PLWTDQTTNAKLVQDVWSVGVRVNVNEKGLVGREEIEKCVRTVIEEDKGKEMKKNALKWK  430

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEAV+EGGTSDK I+EF
Sbjct  431   DLAKEAVNEGGTSDKNIEEF  450



>ref|XP_004245060.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum lycopersicum]
Length=460

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/440 (68%), Positives = 364/440 (83%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              HI+A+PYPSQGHINPMLQFCKRLVSKGLKTTLAIT FIS+S +P S  VGID +SDG D
Sbjct  11    GHILALPYPSQGHINPMLQFCKRLVSKGLKTTLAITNFISSSTRPNSGIVGIDTVSDGFD  70

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               G+  ADS+  YL RF+  GSK+LADLI++Y+ S+ P+ C++YD+FMPWALDVAK +GL
Sbjct  71    KGGYADADSIAAYLERFEQIGSKSLADLIKKYEKSEFPITCIMYDAFMPWALDVAKKYGL  130

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                CFFTQACAVNY+YY  HHG L LP++S  V+I GL  LELRDMPSFIYVHG+YPAYF
Sbjct  131   IGACFFTQACAVNYIYYYIHHGKLTLPISSTNVKISGLSELELRDMPSFIYVHGTYPAYF  190

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             E+VL+QF NV+KAD VFVNSFYKLEA+V DTMSK+SP+  IGPT+PS Y+DNRV+ND EY
Sbjct  191   EMVLNQFTNVDKADYVFVNSFYKLEAEVADTMSKISPLSTIGPTLPSFYMDNRVENDIEY  250

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+NL+H+D +  I+WLNTKPEGSV+Y AFGSM++ D KQMEE+A G K +++YFLWVV+ 
Sbjct  251   GLNLFHVDSSTCINWLNTKPEGSVVYAAFGSMSTFDDKQMEEIAEGLKASSSYFLWVVKI  310

Query  554   SELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  K+P+  + ++ +K LI+NWSPQL+VL++KA+GCFF+HGGWNST+EALS GVPMV M
Sbjct  311   SEQSKIPKKIINENSEKGLIINWSPQLQVLSNKAIGCFFSHGGWNSTVEALSFGVPMVVM  370

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAMKWS  207
             PQWTDQT NAK + DVW VG RV+V E+G+V R EIE CVR VL   EGKEMK+NA+KW 
Sbjct  371   PQWTDQTTNAKFVQDVWSVGVRVKVNENGIVGREEIEECVRTVLQGEEGKEMKKNALKWK  430

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEAV EGGTSDK +++F
Sbjct  431   DLAKEAVQEGGTSDKNVEDF  450



>ref|XP_006351615.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum tuberosum]
Length=461

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/440 (68%), Positives = 361/440 (82%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              HI+A+PYPSQGHINPMLQFCKRLVSKGLKTTLAIT FISNS  P    V ID +SDG D
Sbjct  11    GHILALPYPSQGHINPMLQFCKRLVSKGLKTTLAITNFISNSTHPNLGIVSIDTVSDGFD  70

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               G+  ADSV  YL RF+  GSK+LADLI++Y+ S+ P+ C++YD+F+PWALDVAK HGL
Sbjct  71    KGGYADADSVAAYLERFEQIGSKSLADLIKKYEKSELPITCIMYDAFVPWALDVAKKHGL  130

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                CFFTQACAVNY+YY  HHG L LP++S PV+I GLP LEL+DMPSF YVHG+YPAYF
Sbjct  131   IGACFFTQACAVNYIYYYVHHGKLTLPISSTPVKISGLPELELQDMPSFFYVHGTYPAYF  190

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             E+VL+QF NV+KAD VFVNSFYKLEA+V DTMSK+SP+  IGPT+PS Y+DNRV+ND EY
Sbjct  191   EMVLNQFTNVDKADYVFVNSFYKLEAEVADTMSKISPLSTIGPTLPSFYMDNRVENDIEY  250

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+NL+H+D +  I+WLNTKPEGSV+Y AFGSM++ D KQMEE+A G K TN+YFLWVV+ 
Sbjct  251   GLNLFHVDSSTCINWLNTKPEGSVVYAAFGSMSTFDDKQMEEIAEGLKATNSYFLWVVKT  310

Query  554   SELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             S+  K+P+ F+ ++ +  L++NWSPQL+VL++KA+GCFF+HGGWNST+EAL  GVPMV M
Sbjct  311   SQESKIPKKFIEENSENGLVINWSPQLQVLSNKAIGCFFSHGGWNSTVEALVFGVPMVVM  370

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAMKWS  207
             PQWTDQT NAK + DVW VG RV+V E+G+V R EIE CVR VL   EGKEMK+NA+KW 
Sbjct  371   PQWTDQTTNAKFVQDVWSVGVRVKVNENGIVGREEIEECVRIVLQGEEGKEMKKNALKWK  430

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEAV EGGTSDK ++EF
Sbjct  431   DLAKEAVQEGGTSDKNVEEF  450



>ref|XP_007033645.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
 gb|EOY04571.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
Length=455

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/441 (66%), Positives = 352/441 (80%), Gaps = 5/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS-DAVGIDIISDGC  1278
             AH++A+PYPSQGH+NPMLQF KRL SKG+K T A T FIS++MKP S  +V  D IS GC
Sbjct  8     AHVLALPYPSQGHVNPMLQFSKRLASKGIKATFATTLFISHTMKPESLGSVEFDTISHGC  67

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF +A+S+ DYL R + AGSKTLADLI +YKNS  P DCVIYDSF+PWALDVAK  G
Sbjct  68    DQGGFSEAESIHDYLKRLEAAGSKTLADLIIKYKNSPHPFDCVIYDSFLPWALDVAKQFG  127

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQACAVNY+YY AHHG+L LPV+S PV IPGLP L+LRDMPSFIYV GSYP Y
Sbjct  128   LVGAAFFTQACAVNYIYYYAHHGLLSLPVSSEPVSIPGLPLLQLRDMPSFIYVAGSYPFY  187

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             FELVL QF N +KAD V VN+FYKLE + V++MSK+SP++ IGPT+PS+YLD RV+ D +
Sbjct  188   FELVLSQFSNSDKADFVLVNTFYKLEHEAVESMSKVSPLLTIGPTIPSMYLDQRVETDED  247

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             Y +NL+ +D + S +WL+TKP GSV++V+FGSMA++  KQMEELAWG K +N YFLWVVR
Sbjct  248   YDLNLFKLDSSSSTEWLSTKPPGSVVFVSFGSMANLSVKQMEELAWGIKQSNFYFLWVVR  307

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  K+P  F+ +  DK +I NW PQ++VLA+++VGCFFTH GWNSTIEAL LGVPMVA
Sbjct  308   SSEEAKIPNKFVQEMGDKGVIANWIPQMQVLANESVGCFFTHCGWNSTIEALCLGVPMVA  367

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             MPQWTDQT +AK + DVWKVG RV V E+G+V+R EIE C+R+V+E   GK MKENA KW
Sbjct  368   MPQWTDQTTDAKFVEDVWKVGVRVEVDENGIVNRDEIEYCIRQVMEGETGKVMKENAKKW  427

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LA EAVSEGG+SDK I+EF
Sbjct  428   KQLAIEAVSEGGSSDKNINEF  448



>ref|XP_010069229.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Eucalyptus grandis]
Length=469

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/452 (65%), Positives = 355/452 (79%), Gaps = 16/452 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++ +PYPSQGHINPMLQF KRL SKGLK TLA T FI NSMKP  S  VG+D ISDG 
Sbjct  9     GHVLLVPYPSQGHINPMLQFSKRLASKGLKATLATTVFIFNSMKPDTSPLVGLDTISDGH  68

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF +A+S+  Y+ R + AGSKTL+DLI +Y+++D PVDC++YDSF+PWALDVAK  G
Sbjct  69    DSGGFTEAESIHTYIARLEAAGSKTLSDLIIKYQSTDHPVDCIVYDSFLPWALDVAKGFG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ CAVNY+YY  HHG L++PV S PV +PGLP LELRDMPSFIYV GSYPAY
Sbjct  129   LIGAPFFTQXCAVNYIYYLVHHGHLKVPVESFPVCVPGLPPLELRDMPSFIYVAGSYPAY  188

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             FE+VLHQFLN +KAD V VN+FY+LEA+VVDTMSK+ PV  IGPT+PS+YLD RV+ND E
Sbjct  189   FEMVLHQFLNTDKADWVLVNTFYELEAEVVDTMSKLCPVTTIGPTIPSMYLDKRVENDIE  248

Query  737   YGINLYHMDPTKSI-DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             YG+NL+ +D +  I DWL +KP  SV+YV+FGSM+S+  +QMEELAWG K +   FLWVV
Sbjct  249   YGLNLFTLDKSTLITDWLRSKPPSSVVYVSFGSMSSLGHQQMEELAWGLKQSGFQFLWVV  308

Query  560   RDSELPKLPENFL---GDDD--------KALIVNWSPQLKVLASKAVGCFFTHGGWNSTI  414
             R SE  K+P++ L    DD+        K LIVNW PQL+VL+++A+GCFFTH GWNST+
Sbjct  309   RASEEDKVPKHILKLEADDEADHKEKSKKGLIVNWCPQLEVLSNEAIGCFFTHCGWNSTV  368

Query  413   EALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---  243
             EALS+GVPMV MPQWTDQT +AKLI DVWKVG RVRV EDGVV RGEIEGC+REV++   
Sbjct  369   EALSVGVPMVGMPQWTDQTTDAKLIQDVWKVGVRVRVDEDGVVRRGEIEGCIREVMDSER  428

Query  242   GKEMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             GKEM+ NA KW  L +EA+SEGG+SDK ID F
Sbjct  429   GKEMRRNAKKWKALGREAMSEGGSSDKNIDAF  460



>ref|XP_006442123.1| hypothetical protein CICLE_v10020092mg [Citrus clementina]
 gb|ESR55363.1| hypothetical protein CICLE_v10020092mg [Citrus clementina]
Length=457

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/443 (65%), Positives = 356/443 (80%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPV--SDAVGIDIISDG  1281
             AH++ +PYPSQGHINP  QF KRL SKGLK TLAIT FI  + KP   SD+V ID ISDG
Sbjct  9     AHVLIVPYPSQGHINPTFQFAKRLASKGLKITLAITNFIYKTKKPSQPSDSVQIDTISDG  68

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD GF +A+S+  YL   +VAGSKTLA+LI +YK+S +P+DCV+YD+F+ WALDVAK  
Sbjct  69    YDDGGFSEAESIDAYLQNMEVAGSKTLAELITKYKSSSNPIDCVVYDAFLYWALDVAKGF  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GLFA  FFTQ CAVN++YY  HHG+L+LPV++ PV IPG+P LEL+DMPSFI V G YPA
Sbjct  129   GLFAAAFFTQTCAVNFIYYLVHHGLLKLPVSTTPVSIPGMPLLELQDMPSFIGVQGQYPA  188

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YFE+VL+QF N ++AD V VN++YKLE+QV D+MSK  P++ IGPT+PS YLDNR+ ND+
Sbjct  189   YFEMVLNQFSNADRADLVLVNTYYKLESQVADSMSKFCPMVTIGPTLPSFYLDNRIVNDN  248

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +Y +NL+ +D + +++WLNTKPEGSV+YV+FGSMA +  +Q+EELAWG K ++ YFLWV+
Sbjct  249   DYDLNLFTLDKSITMNWLNTKPEGSVVYVSFGSMACLANEQVEELAWGLKKSSFYFLWVI  308

Query  560   RDS-ELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             RD+ E  KLP+ F+ G  DK LIVNWSPQL+VL++KA+GCFF+H GWNSTIEALSL VPM
Sbjct  309   RDTEETNKLPKGFVDGIGDKGLIVNWSPQLEVLSNKALGCFFSHAGWNSTIEALSLAVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             V MPQWTDQ  +AK + DVWKVG RVRV EDG+V R EIE C+REV+E   G+EM+ NA 
Sbjct  369   VVMPQWTDQPTDAKFVEDVWKVGVRVRVDEDGIVRRDEIERCIREVMEGQSGREMRMNAK  428

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KWS LA EAVSEGGTSDK IDEF
Sbjct  429   KWSDLAIEAVSEGGTSDKNIDEF  451



>ref|XP_006478555.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X1 [Citrus 
sinensis]
Length=457

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/443 (65%), Positives = 354/443 (80%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPV--SDAVGIDIISDG  1281
             AH++ + YPSQGHINP  QF KRL SKGLK TLAIT FI  + KP   SD+V ID ISDG
Sbjct  9     AHVLIVSYPSQGHINPTFQFAKRLASKGLKITLAITNFIYKTKKPPQPSDSVQIDTISDG  68

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD GF +A+S+  YL   +VAG KTLA+LI +YK+S +P+DCV+YD+F+ WALDVAK  
Sbjct  69    YDDGGFSEAESIDAYLQNMEVAGLKTLAELITKYKSSSNPIDCVVYDAFLYWALDVAKGF  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GLF+  FFTQ CAVN++YY  HHG+L+LPV+S PV IPG+P LEL+DMPSFI V G YPA
Sbjct  129   GLFSAAFFTQTCAVNFIYYLVHHGLLKLPVSSTPVSIPGMPLLELQDMPSFIGVQGQYPA  188

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YFE+VL+QF N ++AD V VN+FYKLE+QV D+MSK  P++ IGPT+PS YLDNR+ ND+
Sbjct  189   YFEMVLNQFSNADRADLVLVNTFYKLESQVADSMSKFCPMVTIGPTLPSFYLDNRILNDN  248

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +Y +NL+ +D + +++WLNTKPEGSV+YV+FGSMA +  +Q+EELAWG K ++ YFLWV+
Sbjct  249   DYDLNLFTLDKSITMNWLNTKPEGSVVYVSFGSMACLANEQVEELAWGLKKSSFYFLWVI  308

Query  560   RDS-ELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             RD+ E  KLP+ F+ G  DK LIVNWSPQL+VL++KA+GCFF+H GWNSTIEALSL VPM
Sbjct  309   RDTEETNKLPKGFVDGIGDKGLIVNWSPQLEVLSNKALGCFFSHAGWNSTIEALSLAVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             V MPQWTDQ  +AK + DVWKVG RVRV EDG+V R EIE C+REV+E   G+EM+ NA 
Sbjct  369   VVMPQWTDQPTDAKFVEDVWKVGVRVRVDEDGIVRRDEIERCIREVMEGQSGREMRMNAK  428

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KWS LA EAVSEGGTSDK IDEF
Sbjct  429   KWSDLAIEAVSEGGTSDKNIDEF  451



>ref|XP_006478556.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X2 [Citrus 
sinensis]
Length=457

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/443 (65%), Positives = 354/443 (80%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPV--SDAVGIDIISDG  1281
             AH++ + YPSQGHINP  QF KRL SKGLK TLAIT FI  + KP   SD+V ID ISDG
Sbjct  9     AHVLIVSYPSQGHINPTFQFAKRLASKGLKITLAITNFIYKTKKPPQPSDSVQIDTISDG  68

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD GF +A+S+  YL   +VAG KTLA+LI +YK+S +P+DCV+YD+F+ WALDVAK  
Sbjct  69    YDDGGFSEAESIDAYLQNMEVAGLKTLAELITKYKSSSNPIDCVVYDAFLYWALDVAKGF  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GLF+  FFTQ CAVN++YY  HHG+L+LPV+S PV IPG+P LEL+DMPSFI V G YPA
Sbjct  129   GLFSAAFFTQTCAVNFIYYLVHHGLLKLPVSSTPVSIPGMPLLELQDMPSFIGVQGQYPA  188

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YFE+VL+QF N ++AD V VN+FYKLE+QV D+MSK  P++ IGPT+PS YLDNR+ ND+
Sbjct  189   YFEMVLNQFSNADRADLVLVNTFYKLESQVADSMSKFCPMVTIGPTLPSFYLDNRILNDN  248

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +Y +NL+ +D + +++WLNTKPEGSV+YV+FGSMA +  KQ+EELAWG K ++ YFLWV+
Sbjct  249   DYDLNLFTLDKSITMNWLNTKPEGSVVYVSFGSMACLANKQVEELAWGLKKSSFYFLWVI  308

Query  560   RDS-ELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             RD+ E  KLP+ F+ G  DK LIVNWSPQL+VL++KA+GCFF+H GWNSTIEALSL VPM
Sbjct  309   RDTEETNKLPKGFVDGIGDKGLIVNWSPQLEVLSNKALGCFFSHAGWNSTIEALSLAVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             V MPQWTDQ  +AK + DVWKVG RVRV EDG+V R EIE C+REV+E   G+EM+ NA 
Sbjct  369   VVMPQWTDQPTDAKFVEDVWKVGVRVRVDEDGIVRRDEIERCIREVMEGQSGREMRMNAK  428

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KWS LA EAVS+GGTSDK IDEF
Sbjct  429   KWSDLAIEAVSKGGTSDKNIDEF  451



>emb|CAN68287.1| hypothetical protein VITISV_017016 [Vitis vinifera]
Length=458

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/440 (64%), Positives = 349/440 (79%), Gaps = 5/440 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             HI+ +PYPSQGHINPMLQF +RLVSKG+K TLA   FIS + KP + +V +D ISDG D+
Sbjct  11    HILVLPYPSQGHINPMLQFSRRLVSKGVKATLATPIFISKTFKPQAGSVQLDTISDGFDE  70

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF+QA+S+ +YL + + AGS+TLA LI+++++   P DC++YD+F+PW LDVAK  GL 
Sbjct  71    GGFMQAESIHEYLTQLEAAGSRTLAQLIQKHRDLGHPFDCIVYDAFLPWVLDVAKQFGLV  130

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
                FFTQ CAVNY+YY A+HG+L LPV S PV IPGLP LELRDMPSFIYV GSYPAYF+
Sbjct  131   GAAFFTQTCAVNYIYYHAYHGLLPLPVKSTPVSIPGLPLLELRDMPSFIYVAGSYPAYFQ  190

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             LVL+QF NV KAD V VN+FYKLE +VVD M+K+SP+I IGPT+PS YLDNR++N++EYG
Sbjct  191   LVLNQFCNVHKADWVLVNTFYKLEEEVVDAMAKLSPLITIGPTIPSKYLDNRLENEAEYG  250

Query  731   INLYHMDPT-KSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
              +L+  +P+  +I+WL+ KP  SVIYV+FGSMA + + QMEELAWG K +  YFLWVVRD
Sbjct  251   FDLFSSEPSAHTINWLDNKPTRSVIYVSFGSMACLSEAQMEELAWGLKGSGHYFLWVVRD  310

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP++F+ +   K   V WSPQL+VLA++AVGCFFTH GWNST+EALSLGVPMV M
Sbjct  311   SEEAKLPKHFIHETSGKGWFVKWSPQLEVLANEAVGCFFTHCGWNSTVEALSLGVPMVGM  370

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             PQWTDQT +AK + DVWKVG RVRV E+G+V R E+E C+REV+E   GK MKENA KW 
Sbjct  371   PQWTDQTTDAKFVEDVWKVGIRVRVDENGIVGRKEVEDCIREVMEGERGKAMKENAKKWR  430

Query  206   HLAKEAVSEGGTSDKVIDEF  147
               A EAVSEGGTSDK IDEF
Sbjct  431   KSAVEAVSEGGTSDKNIDEF  450



>ref|XP_011085046.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=465

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/443 (64%), Positives = 349/443 (79%), Gaps = 8/443 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             HI+A+PYPSQGHINPMLQFCKRLV KG K T AIT FIS +  P SD V ID ISDGCDD
Sbjct  12    HILAVPYPSQGHINPMLQFCKRLVFKGAKATFAITHFISKTTTPKSDTVSIDTISDGCDD  71

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF+QA++V DYL R +VAGSKTL  LI++Y++ ++  DC++YD+F+PW LDVAK + + 
Sbjct  72    GGFMQAENVADYLTRMEVAGSKTLQQLIQKYQDCNNTFDCIVYDAFLPWVLDVAKKYAIK  131

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPV-TSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                FFTQ+CAVNYVYY AHHG+L LP+ T PPV +PGLP L+L DMPSFIYVHGSYPAYF
Sbjct  132   GAAFFTQSCAVNYVYYYAHHGLLTLPLSTPPPVELPGLPPLDLSDMPSFIYVHGSYPAYF  191

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ++VL QF NVEKAD V VN+FYKLE  V+D+M+K+ P+I IGPTVPS+YLD RV+ND  Y
Sbjct  192   QMVLSQFSNVEKADFVLVNTFYKLEETVIDSMTKVCPLITIGPTVPSVYLDKRVENDHNY  251

Query  734   GINLYHMDPTKS--IDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              +NL+  D   S  I+WL+TKP  S++Y+AFGSM+++ ++QMEE+AWG KNTN  FLW V
Sbjct  252   DLNLFQSDTQLSSIINWLDTKPPASIVYIAFGSMSNLPKRQMEEIAWGLKNTNFDFLWTV  311

Query  560   RDSEL-PKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R S+   K+P++F+    DK L V+WSPQL+VL++KAVGCF++HGGWNST EALSLGVP+
Sbjct  312   RASDKEEKIPKDFVQASCDKGLFVDWSPQLEVLSNKAVGCFWSHGGWNSTTEALSLGVPL  371

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAM  216
             V MPQWTDQ+  AKL+ DVW VG RVR   DG+V R EIEGC+REV+EG   KEMK N  
Sbjct  372   VVMPQWTDQSTGAKLVQDVWGVGVRVRAEADGIVRREEIEGCIREVMEGEKRKEMKRNGS  431

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LAKEAVSEGGTSD  ID F
Sbjct  432   KWRDLAKEAVSEGGTSDMNIDTF  454



>ref|XP_010069228.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW57506.1| hypothetical protein EUGRSUZ_H00279 [Eucalyptus grandis]
Length=469

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/452 (64%), Positives = 353/452 (78%), Gaps = 16/452 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++ +PYPSQGHINPMLQF KRL SKGLK T A T FI NSMK   S  VG+D ISDG 
Sbjct  9     GHVLLVPYPSQGHINPMLQFSKRLASKGLKATFATTVFIFNSMKADTSPLVGLDTISDGY  68

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF +A+S+  Y+ R + AGSKTL+DLI +Y+++D PVDC++YDS +PWALDVAK  G
Sbjct  69    DSGGFAEAESIHTYITRLEAAGSKTLSDLIVKYQSTDHPVDCIVYDSILPWALDVAKEFG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQACAVNY+YY  HHG L++PV S PV +PGLP LELRDMPSFIYV GSYPAY
Sbjct  129   LVGAPFFTQACAVNYIYYLVHHGHLRVPVESLPVCMPGLPPLELRDMPSFIYVAGSYPAY  188

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             FE+VLHQFLN +KAD V VN+FY+LEA+VVDTMSK+ PV  IGPT+PS+YLD RV++D E
Sbjct  189   FEMVLHQFLNTDKADWVLVNTFYELEAEVVDTMSKLCPVSTIGPTIPSMYLDKRVEDDIE  248

Query  737   YGINLYHMDPTKSI-DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             YG+NL+ +D +  I DWL +KP  SV+YV+FGS++S+ + QMEELAWG K +   FLWVV
Sbjct  249   YGLNLFTLDKSTLITDWLRSKPPSSVVYVSFGSLSSLGRIQMEELAWGLKQSGFQFLWVV  308

Query  560   RDSELPKLPENFL---GDD--------DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTI  414
             R SE  K+P++ L    DD        +K+LIVNW PQL+VL+++A+GCFFTH GWNST+
Sbjct  309   RASEEDKVPKHMLKLEADDGADHDEKSEKSLIVNWCPQLEVLSNEAIGCFFTHCGWNSTV  368

Query  413   EALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---  243
             EALS+GVPMV MPQWTDQT +AKLI DVW+VG RVRV EDGVV RGEIEGC+REV++   
Sbjct  369   EALSVGVPMVGMPQWTDQTTDAKLIQDVWEVGVRVRVDEDGVVRRGEIEGCIREVMDSER  428

Query  242   GKEMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             GKEM+ NA KW  L +EA+ EGG+SDK ID F
Sbjct  429   GKEMRRNARKWKALGREAMIEGGSSDKNIDAF  460



>ref|XP_002278455.1| PREDICTED: UDP-glycosyltransferase 74F2 [Vitis vinifera]
Length=457

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/442 (63%), Positives = 339/442 (77%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + + YP+QGHINPMLQF KRLVSKGLK TLA T  I+ SM+    +V ID ISDG D
Sbjct  8     AHALLLSYPTQGHINPMLQFSKRLVSKGLKATLATTLSITKSMQLDCSSVQIDAISDGYD  67

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDS-PVDCVIYDSFMPWALDVAKSHG  1098
             D GF QA+SV  YL RFQ  GS+TLA+LI ++K S   P+DC+IYD+F+PWALDVAK  G
Sbjct  68    DGGFAQAESVEAYLQRFQAVGSQTLAELIRKHKRSGQVPIDCIIYDAFLPWALDVAKEFG  127

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ CAV Y++Y  HHG+L LPV+SPPV IPGLP L+L DMPSFI    SYPAY
Sbjct  128   LVGAAFFTQTCAVTYIFYYVHHGLLTLPVSSPPVSIPGLPLLDLEDMPSFISAPDSYPAY  187

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              ++VL QF NV+KADC+ VNSFYKLE  VVD MSK+  ++ IGPT+PS + D RV +D  
Sbjct  188   LKMVLDQFCNVDKADCILVNSFYKLEDSVVDAMSKVCTLLTIGPTIPSFFSDKRVNDDMA  247

Query  737   YGINLYHMDPTKS-IDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             YG+N +    +++ I+WL++KP+GSV+YV+FGSMAS+ ++QM ELAWG K ++ YFLWVV
Sbjct  248   YGLNFFKAHQSETCIEWLSSKPKGSVVYVSFGSMASLSEEQMGELAWGLKGSSHYFLWVV  307

Query  560   RDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R SE  KLP+ F+ ++ +K  +V W PQL+VLAS A+GCFFTH GWNST EAL+LGVPMV
Sbjct  308   RASEEAKLPKGFINEELEKGFLVRWCPQLEVLASNAIGCFFTHCGWNSTSEALTLGVPMV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
              MPQWTDQT NAK I DVWKVG RVR GEDGVV R EIE C+REV+E   GKEMKENAMK
Sbjct  368   GMPQWTDQTTNAKFIKDVWKVGVRVREGEDGVVRREEIEACIREVMEGERGKEMKENAMK  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             WS   +EAV EGGTSD+ IDEF
Sbjct  428   WSGFTREAVGEGGTSDRNIDEF  449



>gb|EYU17631.1| hypothetical protein MIMGU_mgv1a006064mg [Erythranthe guttata]
Length=459

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/443 (64%), Positives = 350/443 (79%), Gaps = 9/443 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             HI+ +PYPSQGH+NPMLQFCKRLVSKG K T  IT FIS S+ P S +V I  ISDG D 
Sbjct  11    HILCVPYPSQGHVNPMLQFCKRLVSKGAKATFTITNFISKSINPKSHSVDIASISDGFDT  70

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF QA+SV DYLNR +V GS+TL +LI+ Y++ +  VDC++YD+F+PW LDVA+  G+ 
Sbjct  71    GGFRQAESVSDYLNRMEVEGSRTLENLIKSYRDRNLAVDCIVYDAFLPWVLDVARRFGIA  130

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
               CFFTQACAVNYVYY  HHG+L +PV + PV IPGLP LEL D+PSF++V GSYPAYFE
Sbjct  131   GACFFTQACAVNYVYYYVHHGLLDIPVVAQPVEIPGLPPLELPDLPSFMHVSGSYPAYFE  190

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             +VL+QF NV+KAD V VN+FYKLE +VVD+M+K+ P++ IGPT+PS YLDNR++ND +Y 
Sbjct  191   MVLNQFSNVDKADFVLVNTFYKLEEKVVDSMTKVCPMLTIGPTLPSFYLDNRIENDDKYD  250

Query  731   INLYHMDPTKSI-DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR-  558
             +NL+  DP+++I DWLNTKP  SV+Y+AFGSM ++ + QMEE+AWG  NTN  FLWV+R 
Sbjct  251   VNLFQSDPSQTILDWLNTKPPKSVVYIAFGSMDNLPKAQMEEIAWGLNNTNFDFLWVIRV  310

Query  557   -DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
              D E  KLPE+F+    ++AL  +WSPQL+VL+++A+GCFF+HGGWNST EALSLGVPMV
Sbjct  311   FDKE-EKLPESFVRASSERALFAHWSPQLEVLSNEAIGCFFSHGGWNSTTEALSLGVPMV  369

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLE---GKEMKENAM  216
              MPQWTDQT +AKL+ DVW VG RVRV E+ G+V R EIE CVREV+E   GKEMK N +
Sbjct  370   VMPQWTDQTTDAKLVQDVWGVGIRVRVSEENGIVRREEIESCVREVMEGEKGKEMKRNCV  429

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LAKEAVSEGGTSD  ID F
Sbjct  430   KWRDLAKEAVSEGGTSDLNIDAF  452



>gb|EYU17634.1| hypothetical protein MIMGU_mgv1a006216mg [Erythranthe guttata]
Length=452

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 340/443 (77%), Gaps = 16/443 (4%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             HI+ +PYPSQGH+NPMLQFCKRLVSKG K T  IT FIS S+ P SD+V I  ISDG D 
Sbjct  11    HILGVPYPSQGHVNPMLQFCKRLVSKGAKATFTITNFISKSINPKSDSVDIASISDGFDA  70

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF QA+SV DYL+R ++ GS+TL +LI+ Y + + PVDC++YD+F+PW LDVA+  G+ 
Sbjct  71    GGFRQAESVSDYLHRMEIEGSRTLENLIKSYLDRNLPVDCIVYDAFLPWVLDVARRFGIA  130

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPV-TSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
               CFFTQACAVNYVYY  H G+L +PV T PPV IPGLPALEL D+PSF +V GSYPAYF
Sbjct  131   GACFFTQACAVNYVYYYVHRGLLDIPVATPPPVEIPGLPALELPDLPSFTHVSGSYPAYF  190

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             E+VL+QF NV+KAD V VN+FYKLE +VVD+M+K+ P++ IGPT+PS YLDNR++ND +Y
Sbjct  191   EMVLNQFSNVDKADFVLVNTFYKLEEKVVDSMTKVCPMLTIGPTLPSFYLDNRIENDDKY  250

Query  734   GINLYHMDPTKSI-DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
              +NL+  DP++ I DWLNTKP  SV+Y+AFGSM ++ + QMEE+AWG  NTN  FLWV+R
Sbjct  251   DVNLFQSDPSQPILDWLNTKPPKSVVYIAFGSMDNLPKAQMEEIAWGLNNTNFNFLWVIR  310

Query  557   DSEL-PKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
              S+   KLPE F+    ++AL  +WSPQL+VL+++AVGCFF+HGGWNST E        V
Sbjct  311   VSDKEEKLPEGFVRASSERALFAHWSPQLEVLSNEAVGCFFSHGGWNSTTE--------V  362

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVG-EDGVVSRGEIEGCVREVLE---GKEMKENAM  216
              MPQWTDQT +AKL+ DVW VG RVRV  EDG+V R EIE CVREV+E   GKEMK N +
Sbjct  363   VMPQWTDQTTDAKLVQDVWGVGIRVRVSEEDGIVRREEIESCVREVMEGEKGKEMKRNCV  422

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW   AKEAVSEGGTSD  ID F
Sbjct  423   KWRGSAKEAVSEGGTSDLNIDAF  445



>gb|EYU17628.1| hypothetical protein MIMGU_mgv1a020645mg [Erythranthe guttata]
Length=460

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/444 (64%), Positives = 350/444 (79%), Gaps = 10/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             HI+ +PYPSQGH+NPMLQFCKRLVSKG K T  IT FIS S+ P SD+V I  ISDG D 
Sbjct  11    HILCVPYPSQGHVNPMLQFCKRLVSKGAKATFTITNFISKSINPKSDSVDIASISDGFDA  70

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF QA+SV DYLNR +V GS+TL +LI+ Y++ +  VDC++YD+F+PW LDV    G+ 
Sbjct  71    GGFQQAESVSDYLNRMEVEGSRTLENLIKSYRDRNLAVDCIVYDAFLPWVLDVTMRFGIR  130

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLP-VTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
             A CFFTQACAVNYVYY  H G+L +P VT PPV IPGLP LEL D+PSF++V GSYPAYF
Sbjct  131   AACFFTQACAVNYVYYYVHRGLLDIPVVTPPPVEIPGLPPLELPDLPSFMHVSGSYPAYF  190

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             E+VL+QF NV+KAD V VN+FYKLE +VVD+M+K+ P++ IGPT+PS YLDNR++ND +Y
Sbjct  191   EMVLNQFSNVDKADFVLVNTFYKLEEKVVDSMTKVCPMLTIGPTLPSFYLDNRIENDDKY  250

Query  734   GINLYHMDPTKSI-DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
              +NL+  DP+++I DWLNTKP  SV+Y+AFGSM ++ + QMEE+AWG  NTN  FLWV+R
Sbjct  251   DVNLFQSDPSQTILDWLNTKPPKSVVYIAFGSMDNLPKAQMEEIAWGLNNTNFDFLWVIR  310

Query  557   --DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
               D E  KLPE+F+    ++AL  +WSPQL+VL+++A+GCFF+HGGWNST EALSLGVPM
Sbjct  311   VFDKE-EKLPESFVRASSERALFAHWSPQLEVLSNEAIGCFFSHGGWNSTTEALSLGVPM  369

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLE---GKEMKENA  219
             V MPQWTDQT +AKL+ DVW VG RVRV E+ G+V R EIE CVREV+E   GKEMK N 
Sbjct  370   VVMPQWTDQTTDAKLVQDVWGVGIRVRVSEENGIVRREEIESCVREVMEGEKGKEMKRNC  429

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
             +KW  LAKEAVSEGGTSD  ID F
Sbjct  430   VKWRDLAKEAVSEGGTSDLNIDAF  453



>ref|XP_010101355.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB88302.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=490

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/442 (61%), Positives = 335/442 (76%), Gaps = 10/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA-VGIDIISDGCD  1275
             H++A+PYPSQGH+NPML FCKRL SKGLK TLA T FISN+  P S A V +D ISDG D
Sbjct  10    HVLALPYPSQGHVNPMLHFCKRLASKGLKATLATTIFISNTFNPQSTASVQLDTISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D GF  A S+ DYL R QV+GSKTLA+LI R+ NS  P+DC++YD F+PWALDVA   G+
Sbjct  70    DGGFTHAKSIDDYLARLQVSGSKTLAELITRHNNSTYPIDCIVYDGFLPWALDVAHQLGI  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPAL--ELRDMPSFIYVHGSYPA  921
                 FFTQAC VNYVYYC HH  L LPVT+ PV I GL  L  +L DMPSFI V GSYPA
Sbjct  130   KGAAFFTQACTVNYVYYCVHHRQLTLPVTTFPVSIDGLELLLDQLHDMPSFIGVEGSYPA  189

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YFE++L QF N  KAD V VN+ Y+LE QVVD+MSK+  ++ IGPT+PS+YLDNR+++D 
Sbjct  190   YFEMLLSQFSNAHKADFVLVNTVYELEEQVVDSMSKVCSLLTIGPTIPSIYLDNRIEDDK  249

Query  740   EYGINLYHMDPTKSI---DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +YGI+L+  + + +    +WL  KP GSV+Y++FGSMA +  KQMEELA+G K TN YF+
Sbjct  250   DYGIDLFTSNDSSTFLTNNWLKNKPVGSVVYMSFGSMACLSGKQMEELAYGLKATNFYFI  309

Query  569   WVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             W +R SE  KLP+ F  +  DK LIVNWS Q+++L+  +VGCFFTH GWNSTIEALSLGV
Sbjct  310   WAIRYSEEAKLPDKFAQETRDKGLIVNWSSQVEILSHPSVGCFFTHCGWNSTIEALSLGV  369

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMV MPQWTDQ  +AKLI  +WKVG RV+VGEDG+V R EIE C+R+VLE   G E+++N
Sbjct  370   PMVGMPQWTDQPTDAKLIEHLWKVGVRVKVGEDGIVGRKEIEHCIRQVLEGDRGTEIRKN  429

Query  221   AMKWSHLAKEAVSEGGTSDKVI  156
             A KW +LA +A+S+GG+SDK I
Sbjct  430   AKKWRNLALQAISDGGSSDKNI  451



>ref|XP_010101353.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB88300.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=455

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/442 (61%), Positives = 333/442 (75%), Gaps = 7/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPV-SDAVGIDIISDGCD  1275
             H++ +PYPSQGH+NPML+FCKRL   GLKTT A T FIS S  P  S +V  D ISDG D
Sbjct  9     HVLVVPYPSQGHVNPMLEFCKRLAFYGLKTTFANTVFISKSFNPTPSPSVQFDTISDGFD  68

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D GF QA +  DYL R   AGSKTLA+LI R+ NS +P+D V+YD F+PWALDVAK   L
Sbjct  69    DGGFAQAANAADYLARMVAAGSKTLAELITRHNNSSNPIDFVVYDPFLPWALDVAKRFDL  128

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPAL-ELRDMPSFIYVHGSYPAY  918
                 FFTQ+C VNYVYYC HHG+L+LP++S PV + G   L  L DMPSFI V GSYPAY
Sbjct  129   AGAAFFTQSCTVNYVYYCVHHGVLKLPISSFPVAVDGFRFLGGLEDMPSFIGVEGSYPAY  188

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             FE+VL QF N  +AD V VNS Y+ E +VV++MSK+SP++ IGPT+PS+YLDNR+K D E
Sbjct  189   FEMVLSQFSNTHQADFVLVNSVYEWEEEVVNSMSKVSPLLTIGPTIPSIYLDNRIKEDKE  248

Query  737   YGINLYHMDPTKSI-DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             YG++L+  D + SI +WLN+KPE SV+YV+FGSMA++  KQMEELA G K TN +FLWVV
Sbjct  249   YGLDLFTADSSLSISNWLNSKPEKSVVYVSFGSMANLSVKQMEELALGLKATNLFFLWVV  308

Query  560   RDSELPKLPENFLGDDDK-ALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R SE PKLP NF  +  +  LIV W  Q++VL+  +VGCFFTH GWNST+EALSLGVPMV
Sbjct  309   RASEEPKLPHNFAQETREFGLIVKWCAQMEVLSHPSVGCFFTHCGWNSTVEALSLGVPMV  368

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
              MPQWTDQ  +AKLI  +WKVG RV+VGEDG+V R EIE C+ +VLE   G E+++NA K
Sbjct  369   GMPQWTDQPTDAKLIEHLWKVGVRVKVGEDGIVGRKEIEHCIWQVLEGDRGTEIRKNAKK  428

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W +LA +A+S+GG+SDK I EF
Sbjct  429   WRNLALQAISDGGSSDKNIREF  450



>gb|AFJ52958.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=457

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/442 (59%), Positives = 334/442 (76%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK--PVSDAVGIDIISDG  1281
              H+  +PYP QGH+NPM+ F +RL+++GL+TTL  T F  +S K  P    V ++ ISDG
Sbjct  6     GHVFLLPYPGQGHLNPMIHFARRLITRGLRTTLLTTNFSISSSKFGPTIGPVHVETISDG  65

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ GF  + S+  YL+R + AGSKTL+DL+E+YK +  PV C++Y+ F+PWALDVAK H
Sbjct  66    FDEGGFSSSSSIDHYLSRLEQAGSKTLSDLVEKYKTTPYPVSCLVYEPFLPWALDVAKEH  125

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL+A  FFTQ CAV+++YY   HG+L+LPV + PVRI GLP LE RDMPSF+    +YPA
Sbjct  126   GLYAASFFTQPCAVDFIYYNIRHGLLKLPVDTWPVRILGLPELEPRDMPSFVNAPEAYPA  185

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YF +V++QF N EKAD V +N+FY+LE + + TMSK+ PV+ IGPTVPS YLD R+ +D+
Sbjct  186   YFAMVVNQFSNTEKADYVLINTFYELEKEALHTMSKVCPVLAIGPTVPSTYLDGRIDDDA  245

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG++L+ ++ + S  W+ TKP  SVIYVAFGSM + +Q QM ELA GFK TN Y +WV+
Sbjct  246   EYGVDLFSLERSISTAWIATKPPKSVIYVAFGSMVTFNQAQMTELALGFKRTNHYIIWVI  305

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +D+EL KLP +F+ D  DKAL+VNW+PQ+++LAS AVGCFFTH GWNSTIEALSLGVPMV
Sbjct  306   QDTELAKLPIDFVSDIGDKALVVNWAPQVQILASGAVGCFFTHSGWNSTIEALSLGVPMV  365

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQ  NA L+  VWKVG RV VGEDG+VS  E+E CVREV+E   GKEM+ N  K
Sbjct  366   AMPQWTDQPPNAMLVERVWKVGIRVTVGEDGIVSGDEVERCVREVMEGEKGKEMRSNCEK  425

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
                LA  A+SEGG+SDK IDEF
Sbjct  426   LKGLACLAISEGGSSDKSIDEF  447



>gb|KDP35132.1| hypothetical protein JCGZ_10666 [Jatropha curcas]
Length=457

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/442 (58%), Positives = 335/442 (76%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVS-DAVGIDIISDG  1281
             AH++ +PYP QGHINPML F +RL+S+G+K TL  + FIS SM  P S D+V +  ISDG
Sbjct  7     AHVLLLPYPGQGHINPMLHFSRRLISRGIKATLVTSIFISKSMNLPSSIDSVHLAAISDG  66

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD G+ ++  V  YL R +  GS+TL++LIE++K S  P DCVIY+ F+PWALDVAK  
Sbjct  67    FDDGGYEKSSGVDYYLTRLKTEGSRTLSELIEKHKTSSDPFDCVIYEPFLPWALDVAKDF  126

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
              LFA  FFTQ  AV+++YY      L +PV+S PV IP LP LE+ DMPS +    +YPA
Sbjct  127   RLFAAAFFTQPAAVDFIYYNIQCKSLSVPVSSTPVSIPSLPLLEIGDMPSAVSGPEAYPA  186

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  ++ +Q+ N+EKAD V +N+FYKLE +VVD MSK+ PV+ IGPT+PS YLD R++ND 
Sbjct  187   YTAMLFNQWSNIEKADYVLINTFYKLEKEVVDEMSKVCPVLTIGPTIPSKYLDKRIENDD  246

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG++L+ ++ + S++W++ KP  SV+YVAFGS++++  KQMEELAWG K +  YFLWVV
Sbjct  247   DYGLDLFALEASFSLNWISNKPARSVVYVAFGSLSNLSDKQMEELAWGLKRSKFYFLWVV  306

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R +E  KLP++FL D  DK +IVNWSPQ+K+L ++A+GCF +H GWNSTIEALSLGVP+V
Sbjct  307   RATEASKLPKSFLEDLGDKGIIVNWSPQVKLLQNEAIGCFLSHCGWNSTIEALSLGVPIV  366

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
              MPQWTDQ  NAKL+ DVWK G RV+V EDG+V+R EIEGCVR+V+E   GKEM++NA K
Sbjct  367   RMPQWTDQPTNAKLVEDVWKAGIRVKVNEDGIVTREEIEGCVRQVMESETGKEMRKNAQK  426

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA EAV+EGGTSDK IDEF
Sbjct  427   WRELAIEAVTEGGTSDKNIDEF  448



>ref|XP_007033647.1| UDP-glycosyltransferase 74 F1, putative [Theobroma cacao]
 gb|EOY04573.1| UDP-glycosyltransferase 74 F1, putative [Theobroma cacao]
Length=458

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/442 (60%), Positives = 328/442 (74%), Gaps = 7/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGCD  1275
             H++ +PYP+QGHINPM QF KRL SKG K TLAIT FISN+MK   S +V ID ISDG D
Sbjct  9     HVIVLPYPAQGHINPMFQFSKRLASKGFKATLAITVFISNTMKLESSGSVQIDTISDGYD  68

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               G   +  +  YL R +  GSKTLA+LI ++K +  P+DC+IYD+ MPWALDVAK +GL
Sbjct  69    AGGLASSGGIQHYLPRQEAIGSKTLAELIIKHKRTSRPIDCIIYDAAMPWALDVAKQYGL  128

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFI-YVHGSYPAY  918
                 FFTQ CAVNY+YY  HH +L LP+ S P+ IPGLP L+  D+PSF+    GSY AY
Sbjct  129   HGAAFFTQMCAVNYIYYNVHHKLLNLPICSTPISIPGLPLLQPGDLPSFVCSSEGSYIAY  188

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
                VL+QF N++KAD + +N+FYKLE + V++MSK+ PV+ IGPTVPS+YLD  V+ND  
Sbjct  189   LGRVLNQFKNIDKADFILINTFYKLENEAVESMSKVYPVLTIGPTVPSIYLDKPVENDKA  248

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++L+  + + S DWL+TKP GSVI V+FGS+ S+  KQMEE+A G  N+N YFLWVVR
Sbjct  249   YGLDLFDFNSSTSTDWLSTKPPGSVICVSFGSVTSISSKQMEEIARGLNNSNFYFLWVVR  308

Query  557   DSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  KLP+ F  +  +K LIVNWSPQL VL+++AVGCFFTH GWNST EALSLGVPMVA
Sbjct  309   ASEEAKLPKGFKEESGEKGLIVNWSPQLDVLSNEAVGCFFTHCGWNSTTEALSLGVPMVA  368

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGE-DGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             MPQWTDQ    K I DVWKVG RV++ +  G+V+R EIE C+R+V+E   GKE+KENA K
Sbjct  369   MPQWTDQPTVGKYIEDVWKVGVRVKIDDVSGIVNREEIESCIRQVMEGERGKEIKENAKK  428

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA EAV EGGTSD+ IDEF
Sbjct  429   WRELALEAVGEGGTSDRNIDEF  450



>ref|XP_010242477.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=464

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/440 (57%), Positives = 326/440 (74%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH++  PYP+QGHINPMLQF KRL  KGL+ T A+T F+S SM   S++V + +ISDG D
Sbjct  10    AHVIVFPYPAQGHINPMLQFSKRLAFKGLRVTFAVTKFVSKSMHTNSNSVQVQLISDGFD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D GF QA+S+ DYL+RF+  GS TLA+LI++  +S  PVDC+IYDSF PWALDVAK  GL
Sbjct  70    DGGFEQAESIHDYLSRFKEVGSLTLAELIKKQDSSGKPVDCLIYDSFFPWALDVAKQFGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ CAVN +YY  H G+L LPV  P V IPGLPA+++ DMPS+I    SYPAY 
Sbjct  130   VGAPFFTQMCAVNNIYYHVHQGLLHLPVREPVVSIPGLPAIDIGDMPSYISDPQSYPAYH  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              +++ QF N EK D +FVN+F KLE ++++ M K  P+  IGPT+PS+YLD +V++DS+Y
Sbjct  190   AMIMSQFSNTEKVDWIFVNTFNKLEEEMIEWMEKRFPLRAIGPTIPSMYLDKQVEDDSDY  249

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G++LY  D    I+WLN + EGSV+YV+FGSMA++  +QMEE+AWG + +++YFLWVVR 
Sbjct  250   GLHLYKPDSGDCINWLNKRAEGSVVYVSFGSMAALSVEQMEEIAWGLRRSDSYFLWVVRR  309

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP  F+ +  DK LIV W PQL+VL    VGCF TH GWNST+E +SLGVPMV +
Sbjct  310   SEAEKLPSKFVEETSDKGLIVTWCPQLEVLTHNTVGCFVTHCGWNSTLEGVSLGVPMVGI  369

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWS  207
             PQWTDQ  NAK + D+W +G R +  E G+VSR E+E CVRE++E    KE+++NA+KW 
Sbjct  370   PQWTDQIPNAKFVQDIWGMGLRAQPNEKGIVSREEVERCVREIMEEEKVKEIRKNAIKWR  429

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LA+EAV EGGTSDK IDEF
Sbjct  430   DLAREAVGEGGTSDKNIDEF  449



>ref|XP_002309737.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEE90187.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=457

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/442 (58%), Positives = 333/442 (75%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDG  1281
              H++ +PYP QGHINPM+QF +RL+SKGLK TL  + FI+ SMK  S    V +D+ISDG
Sbjct  7     GHVLLVPYPGQGHINPMMQFSRRLISKGLKATLVTSIFIAKSMKLGSSIGPVHLDVISDG  66

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ GF    S   YL + + AGSKTLA+LI +Y+ +  P+ CVIY+ F+ WALDVAK  
Sbjct  67    FDEEGFPTGGSSELYLQKLEAAGSKTLAELIVKYRGTPYPIVCVIYEPFLHWALDVAKDF  126

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+    FFTQ C V+Y+YY   HG+L LP+TS PV IPGLP LE RDMPSFI V GSYPA
Sbjct  127   GVMGAAFFTQPCVVDYIYYNIQHGLLSLPITSAPVSIPGLPLLESRDMPSFINVPGSYPA  186

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YF+++L QF N +K D + +N+FYKLEA+ VDT+SK+ P + IGPTVPS YLD R+++D 
Sbjct  187   YFKMLLDQFSNTDKVDYILINTFYKLEAEAVDTISKVCPTLTIGPTVPSRYLDKRIEDDD  246

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              Y ++L+ +  + S +W++ KP  SV+YVAFGS++++ +KQ+EEL+WG KN+N YFLWV+
Sbjct  247   YYNLDLFTLHASISTNWISNKPPRSVVYVAFGSISNLCEKQIEELSWGLKNSNYYFLWVI  306

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+S    LP+ FL D  +K  +V WSPQ+++LA++AVGCF TH GWNSTIEALSLG+PMV
Sbjct  307   RESGQINLPKTFLEDLGEKGCVVGWSPQVRMLANEAVGCFLTHCGWNSTIEALSLGMPMV  366

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQ  NAKL+ DVWKVG RV+V E+G+V R EIE C++EV+E   G+EMK+NA K
Sbjct  367   AMPQWTDQPPNAKLVEDVWKVGIRVKVNEEGIVPRDEIECCIKEVMEGEKGEEMKKNAKK  426

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA EAVSEGG+SDK IDE 
Sbjct  427   WRELAIEAVSEGGSSDKNIDEL  448



>ref|XP_006442124.1| hypothetical protein CICLE_v10023826mg, partial [Citrus clementina]
 gb|ESR55364.1| hypothetical protein CICLE_v10023826mg, partial [Citrus clementina]
Length=439

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/428 (61%), Positives = 323/428 (75%), Gaps = 7/428 (2%)
 Frame = -2

Query  1409  PMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA--VGIDIISDGCDDAGFLQADSVPDY  1236
             P  QF KRL SKGLK TLA+T FI  S  P   A  V ID ISDG DD    +A+ +  +
Sbjct  6     PHFQFAKRLASKGLKITLALTNFIYKSTNPSQPAGSVQIDTISDGYDDGDLTKAEIIHAF  65

Query  1235  LNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFAGCFFTQACAVN  1056
                 + AGSKTLA+LI +YK + +P+DCV+YD F+ WALDVAK   LFA  FFTQ  AVN
Sbjct  66    FQNMEAAGSKTLAELITKYKTTSNPIDCVVYDDFLYWALDVAKGFRLFAAAFFTQTYAVN  125

Query  1055  YVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFELVLHQFLNVEKA  876
             ++YY  HHG+L+LPV+S PV IPGLP LEL+DMPSFI V G Y AYFE+VL+QF N ++A
Sbjct  126   FIYYLVHHGLLKLPVSSTPVSIPGLPLLELQDMPSFIGVQGKYSAYFEMVLNQFSNADRA  185

Query  875   DCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYGINLYHMDPTKSI  696
             D +FVN+FY+LE++V D+M+K  PV+ IGPT+P  YLD+R++ND+ Y +NL+ +D +  I
Sbjct  186   DLLFVNTFYELESEVADSMAKFCPVLTIGPTIPPFYLDSRIQNDNGYDLNLFTLDKSICI  245

Query  695   DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDS-ELPKLPENFLG  519
             +WLN KPE SV+YVAFGSMA +  KQ+EELAWG K ++ YFLWV+RD+ E  KLP+ F+ 
Sbjct  246   NWLNKKPERSVVYVAFGSMACLANKQVEELAWGLKKSSFYFLWVIRDTEETNKLPKRFVN  305

Query  518   D-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMPQWTDQTMNAKL  342
             +  DK LIVNWSPQ++VL++KA+GCF TH GWNSTIEALSL VPMVAMPQWTDQ M+AK 
Sbjct  306   EIGDKGLIVNWSPQIEVLSNKALGCFLTHAGWNSTIEALSLEVPMVAMPQWTDQPMDAKF  365

Query  341   IVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMKWSHLAKEAVSEGGT  171
             I DV KVG RV V  DG+V R +IE C+REV+EGK   EMK NA KW  LA EAVSEGGT
Sbjct  366   IEDVSKVGVRVGVDGDGIVRRDDIESCIREVMEGKSGREMKINAKKWRDLAIEAVSEGGT  425

Query  170   SDKVIDEF  147
             SDK IDEF
Sbjct  426   SDKNIDEF  433



>ref|XP_008384038.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Malus domestica]
Length=456

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 336/447 (75%), Gaps = 18/447 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD-AVGIDIISDGC  1278
             AH++ +PYP+QGHINP LQF KR+ SKG+K TLA T FI+NS++P S  +V  D ISDG 
Sbjct  9     AHVLVVPYPAQGHINPFLQFSKRVASKGIKVTLANTIFIANSLQPKSSGSVHFDTISDGY  68

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ GF +A+S+ +YL+R +  GSKTLA+LI +++NS  P++C++YD F+PWAL+VAK  G
Sbjct  69    DEGGFARAESIDEYLSRMEAVGSKTLAELITKHQNSPHPINCIVYDPFLPWALEVAKQFG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             + AG FFTQ C VNY+YY  H G  +L V+S    IPGL  LE +D+PSFI V GSYPAY
Sbjct  129   VLAGAFFTQTCTVNYIYYLQHRG--KLTVSS----IPGLHVLEPQDLPSFISVPGSYPAY  182

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSK-MSPVIPIGPTVPSLYLDNRVKNDS  741
             FE+VL+QFLN  KAD +F N+FYKLE +VVD+MSK  S ++ IGPTVPS YLDN +K+D 
Sbjct  183   FEMVLNQFLNTHKADFIFANTFYKLEQEVVDSMSKDCSNLLTIGPTVPSTYLDNSIKDDK  242

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG++L+  D T   DWLNTKP GSV+YVAFGSMA++  KQM ELA+G K +  +FLWVV
Sbjct  243   DYGLHLFKSDST-CTDWLNTKPAGSVVYVAFGSMANLSDKQMXELAFGLKESGVHFLWVV  301

Query  560   RDSELPKLPENFLGDDDK---ALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             R SE  KLP  F+ +       L+V WSPQL+VL+   VGCFFTHGGWNSTIEALSLGVP
Sbjct  302   RASEEAKLPXKFVQETSNGGXGLVVKWSPQLEVLSHAXVGCFFTHGGWNSTIEALSLGVP  361

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGE--DGVVSRGEIEGCVREVL----EGKEMK  228
             M+AMPQWTDQ  N+KL+  VWKVG RV+V E  +G+V R EI+ C+R+V+    +G EMK
Sbjct  362   MIAMPQWTDQPTNSKLVEAVWKVGVRVKVDENANGIVGRDEIKRCIRKVMXDDKDGNEMK  421

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +NA KW  LA EAVS+GGTSD  I +F
Sbjct  422   KNAKKWRELAIEAVSDGGTSDNNIQQF  448



>ref|XP_008243112.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=474

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/470 (57%), Positives = 332/470 (71%), Gaps = 42/470 (9%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              HI+AIPYPSQGHINP+LQF KRL SKGLK TLA T FIS S+    S +V  D ISDG 
Sbjct  4     GHILAIPYPSQGHINPLLQFSKRLASKGLKATLANTIFISKSLPLKSSGSVQFDTISDGY  63

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ GF QA+S+  YL R +  GS+TL +LI +Y NS  P++C+IYD F+PWALDVAK  G
Sbjct  64    DEEGFAQAESIAAYLARMEAEGSRTLIELITKYNNSPHPINCIIYDPFLPWALDVAKQFG  123

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L +  FFTQ C VNY+YY  +HG            IPGL  LE +D+PSF  V GSYPAY
Sbjct  124   LASAAFFTQTCTVNYIYYMQYHG-------GDATSIPGLHMLEPQDLPSFFSVPGSYPAY  176

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              ++VL+Q+ N+ +AD +F NSFYKLE QVVD+MSK+  ++ IGPT+PS YLDNR++++ E
Sbjct  177   LKMVLNQYSNLHEADFIFANSFYKLEQQVVDSMSKVCRMLTIGPTIPSTYLDNRIEDNKE  236

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+NLY +D   S DWLN+KP GSVIYVAFGSMA++  KQMEELA G K +  YFLWVVR
Sbjct  237   YGVNLYKIDSVCS-DWLNSKPPGSVIYVAFGSMANLSHKQMEELALGLKGSGFYFLWVVR  295

Query  557   DSELPKLPENFL-----------------GDDDKALIVNWSPQLKVLASKAVGCFFTHGG  429
             +SE  KLP  F+                 G   K L+V WSPQL+VL+++AVGCFFTHGG
Sbjct  296   ESEKAKLPPKFIEELELEISTSTSTSTSDGGKGKGLMVTWSPQLEVLSNEAVGCFFTHGG  355

Query  428   WNSTIEALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-------------GEDGV  288
             WNSTIEALSLGVPM+ MPQWTDQ  N+KL+ DVWKVG RV+V              E+G+
Sbjct  356   WNSTIEALSLGVPMIVMPQWTDQPTNSKLVQDVWKVGVRVKVDHHHHYHDANNITDENGI  415

Query  287   VSRGEIEGCVREVLEGK---EMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             V+R EIE C+R+V+EG+   EMK+NA KW  LA EAVS+GGTSD  I EF
Sbjct  416   VAREEIESCIRKVMEGETAIEMKKNAKKWKSLAIEAVSDGGTSDTDIHEF  465



>gb|ABK96547.1| unknown [Populus trichocarpa x Populus deltoides]
Length=457

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/443 (58%), Positives = 335/443 (76%), Gaps = 8/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVG---IDIISD  1284
              H++ +PYP QGHINPM+QF +RL+SKGLK TL  + FI+ SMK +  ++G   +++ISD
Sbjct  7     GHVLLVPYPGQGHINPMMQFSRRLISKGLKATLVTSIFIAKSMK-LGFSIGPVHLEVISD  65

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ GF    S   YL + + AGSKTLA+LI +Y+ +  P+DCVIY+ F+ WALDVAK 
Sbjct  66    GFDEEGFPTGGSSELYLEKLEAAGSKTLAELIVKYRGTPYPIDCVIYEPFLHWALDVAKD  125

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              G+    FFTQ C V+Y+YY   HG+L LP+TS  V IPGLP LE RDMPSFI V GSYP
Sbjct  126   FGVMGAAFFTQPCVVDYIYYNIQHGLLSLPITSATVSIPGLPLLESRDMPSFINVPGSYP  185

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYF+++L QF N EK D + +N+FYKLEA+ VDT+SK+ P + IGPTVPS YLD R+++D
Sbjct  186   AYFKMLLDQFSNTEKVDYILINTFYKLEAEAVDTISKVCPTLTIGPTVPSRYLDKRIEDD  245

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
               Y ++L+ +  + S +W++ KP  SV+YVAFGS++++ +KQ+EEL+WG KN+N YFLWV
Sbjct  246   DYYNLDLFTLHASISTNWISNKPPRSVVYVAFGSISNLCEKQIEELSWGLKNSNYYFLWV  305

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             +R+S    LP+ FL D  +K  +V WSPQ+++LA++AVGCF TH GWNSTIEALSLG+PM
Sbjct  306   IRESGQINLPKTFLEDLGEKGCVVGWSPQVRMLANEAVGCFLTHCGWNSTIEALSLGMPM  365

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQWTDQ  NAKL+ DVWKVG RV+V E+G+V R EIE C++EV+E   G+EMK+NA 
Sbjct  366   VAMPQWTDQPPNAKLVEDVWKVGIRVKVDEEGIVPRDEIECCIKEVMEGEKGEEMKKNAK  425

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LA EAVSEGG+SDK IDE 
Sbjct  426   KWRELAIEAVSEGGSSDKNIDEL  448



>ref|XP_011047643.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Populus euphratica]
Length=457

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/442 (57%), Positives = 333/442 (75%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDG  1281
              H++ +PYP QGHINPM+QF +RL+SKGLK TL  + FI+ SMK  S    V +D+ISDG
Sbjct  7     GHVLLVPYPGQGHINPMMQFSRRLISKGLKATLVNSIFIAKSMKLGSSIGPVHLDVISDG  66

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ GF    S   YL + + AGSKTL++LI +Y+++  P+DCVIY+ F+ W LDVAK  
Sbjct  67    FDEEGFPTGGSSELYLEKLEAAGSKTLSELIVKYRSTPYPIDCVIYEPFLHWVLDVAKDF  126

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+    FFTQ C V+Y+YY   HG+L LP+TS PV IPGLP LE RDMPSFI V GSYPA
Sbjct  127   GVMGAAFFTQPCVVDYIYYNIQHGLLSLPITSAPVSIPGLPLLEPRDMPSFINVPGSYPA  186

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YF+++L QF N +K D + +N+FYKLEA+ VDT+SK+ P + IGPTVPS YLD R+++D 
Sbjct  187   YFKMLLDQFSNTDKVDYILINTFYKLEAEAVDTISKVCPTLTIGPTVPSRYLDKRIEDDD  246

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              Y ++L+ +  + S +W++ KP  SV+YVAFGS++++ +KQ+EEL+WG KN+N YFLWV+
Sbjct  247   YYNLDLFTLHASISTNWISNKPPRSVVYVAFGSISNLCEKQIEELSWGLKNSNYYFLWVI  306

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+S    LP+ F+ D  +K  +V WSPQ+++LA++AVGCF TH GWNSTIEALSLG+PMV
Sbjct  307   RESGQINLPKTFMEDLGEKGCVVGWSPQVRMLANEAVGCFLTHCGWNSTIEALSLGMPMV  366

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQ  NAKL+ D WKVG RV+V E+G+V R EIE C++EV+E   G+EMK+NA K
Sbjct  367   AMPQWTDQPPNAKLVEDAWKVGIRVKVDEEGIVPRDEIECCIKEVMEGEKGEEMKKNAKK  426

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA EAVSEGG+SDK IDE 
Sbjct  427   WRELAIEAVSEGGSSDKNIDEL  448



>ref|XP_007203876.1| hypothetical protein PRUPE_ppa005294mg [Prunus persica]
 gb|EMJ05075.1| hypothetical protein PRUPE_ppa005294mg [Prunus persica]
Length=468

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/464 (58%), Positives = 333/464 (72%), Gaps = 36/464 (8%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++AIPYP+QGHINP+LQF KRL SKGLK T+A T FIS S+    S +V  D ISDG 
Sbjct  4     GHVLAIPYPAQGHINPLLQFSKRLASKGLKVTVANTIFISKSLPLKSSGSVQFDTISDGY  63

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ GF +A+S+  YL+R +  GS+TL +LI +Y NS  P++C+IYD F+PWALDVAK   
Sbjct  64    DEEGFARAESIAAYLDRMEAEGSRTLIELITKYNNSPHPINCIIYDPFLPWALDVAKQFD  123

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L +  FFTQ C VNY+YY  +HG     VTS    IPGL  LE +D+PSF  V GSYPAY
Sbjct  124   LASAAFFTQTCTVNYIYYMQYHG---GDVTS----IPGLHMLEPQDLPSFFSVPGSYPAY  176

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              E+VL+Q+ N+ KAD +F NSFYKLE QVVD+MSK+  ++ IGPT+P  YLDNR+++D E
Sbjct  177   REMVLNQYSNLHKADFIFANSFYKLEQQVVDSMSKVCRMLTIGPTIPYTYLDNRIEDDKE  236

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+ LY +D   S DWLN+KP GSVIYVAFGSMA++  KQMEELA G K +  YFLWVVR
Sbjct  237   YGVQLYKIDSVCS-DWLNSKPPGSVIYVAFGSMANLSHKQMEELALGLKGSGFYFLWVVR  295

Query  557   DSELPKLPENFL--------------GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNS  420
              SE  KLP NF+              G   K LIV WSPQL+VL+++AVGCFFTHGGWNS
Sbjct  296   GSEEAKLPPNFIEELELERSTSTSEDGGKGKGLIVTWSPQLEVLSNEAVGCFFTHGGWNS  355

Query  419   TIEALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRV----------GEDGVVSRGEI  270
             TIEALSLGVPM+ MPQWTDQ  N+KL+ DVWKVG RV+V           E+G+V+R EI
Sbjct  356   TIEALSLGVPMIVMPQWTDQPTNSKLVQDVWKVGVRVKVDHHHDANNITDENGIVAREEI  415

Query  269   EGCVREVLEGK---EMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             E C+R+V+EG+   EMK+NA KW  LA EAVS+GGTSD  I EF
Sbjct  416   ESCIRKVMEGETAIEMKKNAKKWKSLAIEAVSDGGTSDTNIHEF  459



>ref|XP_003531287.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Glycine max]
 gb|KHN48082.1| UDP-glycosyltransferase 74F1 [Glycine soja]
Length=460

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/447 (57%), Positives = 328/447 (73%), Gaps = 13/447 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA----VGIDIIS  1287
             +H++ +PYPSQGHINPMLQF KRL +KG++ T+  T FIS SM   S +    V +D IS
Sbjct  9     SHVLMVPYPSQGHINPMLQFSKRLSTKGVRVTMVTTIFISKSMHLQSSSLLGNVQLDFIS  68

Query  1286  DGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAK  1107
             DGCD  GF QA SV  YL+R Q  GS  L +LI++Y +SD P+DCV+YD  + W LDVAK
Sbjct  69    DGCDQGGFGQAGSVSTYLSRMQEIGSNNLRELIKKYNSSDHPIDCVVYDPLVIWVLDVAK  128

Query  1106  SHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
               GLF   FFTQ CAVNY+YY  +HG+L++P++SPP+ I GLP L+LRD P+F+Y  G Y
Sbjct  129   EFGLFGAAFFTQMCAVNYIYYHVYHGLLKVPISSPPISIQGLPLLDLRDTPAFVYDPGFY  188

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             PAYF+LV++QF N+ KAD + VNSFYKLE QVVD+MSK+ P++ IGPTVPS +LD  V N
Sbjct  189   PAYFDLVMNQFSNIHKADIILVNSFYKLEEQVVDSMSKLCPILMIGPTVPSFHLDKAVPN  248

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D++  +NL+ +D + +I WL  KP GSVIY++FGSM     +QMEE+A G   T   FLW
Sbjct  249   DTDNVLNLFQVD-SSAISWLRQKPAGSVIYISFGSMVCFSSQQMEEIALGLMATGFNFLW  307

Query  566   VVRDSELPKLPENFLGDD----DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             V+ D E   LP+  LG++     + LIVNW+PQL+VL++ AVGCFFTH GWNST+EAL L
Sbjct  308   VIPDLERKNLPKE-LGEEINACGRGLIVNWTPQLEVLSNHAVGCFFTHCGWNSTLEALCL  366

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMK  228
             GVPMVA+PQWTDQ  NAK + DVWKVG RV+  E+G+V+R E+E C+R V+E   G+EM+
Sbjct  367   GVPMVALPQWTDQPTNAKFVEDVWKVGIRVKENENGIVTREEVENCIRVVMEKDLGREMR  426

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
              NA KW  LA EAVS+GGTSD  I+EF
Sbjct  427   INAKKWKELAIEAVSQGGTSDNNINEF  453



>ref|XP_009366234.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Pyrus x bretschneideri]
Length=469

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 336/460 (73%), Gaps = 31/460 (7%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD-AVGIDIISDGC  1278
             AH++ +PYP+QGHINP LQF KR+ SKG+K TLA T FI+NS++P S  +V  D ISDG 
Sbjct  9     AHVLVVPYPAQGHINPFLQFSKRVASKGIKVTLANTIFIANSLQPKSSGSVHFDTISDGY  68

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ GF +A+S+ +YL+R +  GSK+LA+LI +++NS  P++C++YD F+PWAL+VAK  G
Sbjct  69    DEGGFARAESIDEYLSRMEAVGSKSLAELITKHQNSPHPINCIVYDPFLPWALEVAKQFG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             + AG FFTQ C VNY+YY  H G  +L V+S    IPGL  LE +D+PSFI V GSYPAY
Sbjct  129   VLAGAFFTQTCTVNYIYYLQHRG--KLTVSS----IPGLHMLEPQDLPSFISVPGSYPAY  182

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSK-MSPVIPIGPTVPSLYLDNRVKNDS  741
             FE+VL+QFLN  KAD +F N+FYKLE +VVD+MSK  S ++ IGPT+PS YLDN +K+D 
Sbjct  183   FEMVLNQFLNTHKADFIFANTFYKLEQEVVDSMSKDCSNLLTIGPTIPSAYLDNSIKDDK  242

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG++L+  D T   DWLNTKP GSV+YVAFGSMA++  KQMEELA+G K +  +FLWVV
Sbjct  243   DYGLHLFKSDST-CTDWLNTKPAGSVVYVAFGSMANLSDKQMEELAFGLKESGVHFLWVV  301

Query  560   RDSELPKLPENFL---GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             R SE  KLP  F+    +  K L+V WSPQL+VL+  AVGCFFTHGGWNSTIEALSLGVP
Sbjct  302   RASEEAKLPSKFVQETSNGGKGLVVKWSPQLEVLSHAAVGCFFTHGGWNSTIEALSLGVP  361

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRV---------------GEDGVVSRGEIEGCVR  255
             M+AMPQWTDQ  N+KL+  VWKVG RV+                  +G+V R EI+ C+R
Sbjct  362   MIAMPQWTDQPTNSKLVEAVWKVGVRVKAYHRDLYDQINDHDDENANGMVGREEIKRCIR  421

Query  254   EVL----EGKEMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +V+     G EMK+NA KW  LA EAVS+GGTSD  I +F
Sbjct  422   KVMGDDKAGNEMKKNAKKWRELAIEAVSDGGTSDNNIQQF  461



>ref|XP_010672475.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=458

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/441 (57%), Positives = 333/441 (76%), Gaps = 6/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA-VGIDIISDGC  1278
             AH+VA+PYP+QGHI+PMLQFC+RL SKG+K +LAIT  I  ++KP SD  V +  +SDG 
Sbjct  10    AHVVALPYPTQGHISPMLQFCRRLDSKGVKASLAITKHIFTTLKPKSDGHVHLVTVSDGY  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD GF +A+S+  YL   +  GS TL DLIE++  +D+P+ C++YDSF PW L+VAK +G
Sbjct  70    DDGGFGEAESIAAYLASLETNGSHTLGDLIEQHAGTDNPITCIVYDSFFPWCLNVAKKYG  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ+C VNYVYY AHHG L +PV SPPV I GLP L+  D+PSF+    SYP Y
Sbjct  130   LLGASFFTQSCGVNYVYYLAHHGKLSVPVFSPPVDITGLPPLDASDLPSFLDSPESYPDY  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              +LVL+Q  NV++AD V VN+ Y+LE +V+D M+K  P++ IGPTVPS+Y+DNR+  D E
Sbjct  190   LQLVLNQNSNVDEADFVLVNTVYELEDKVIDAMAKECPLLTIGPTVPSIYVDNRISYDRE  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++LYH DPT + +WL+TKP  SV+YV+FGSMA++  +QMEELAWG K ++ +FLWVVR
Sbjct  250   YGLSLYHHDPT-TTNWLSTKPPRSVVYVSFGSMANLSNEQMEELAWGLKQSDCHFLWVVR  308

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  KLP+ F+ +   K LIV WSPQL+VL+S+ +GCFFTH GWNST+EAL++GVPM+ 
Sbjct  309   ASEEGKLPKGFVNEVAAKGLIVRWSPQLEVLSSEVIGCFFTHCGWNSTLEALAMGVPMIG  368

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKEMKE---NAMKW  210
             MPQWTDQ M+AKL+V VW+VG RV V ++G+V R EI G + EV+EG++ KE   NA  W
Sbjct  369   MPQWTDQPMHAKLVVAVWRVGVRVNVNKEGLVRREEIAGRIIEVMEGEKRKEFIDNAQMW  428

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               L K A+S+ G+SD+ IDEF
Sbjct  429   KGLVKTAMSQDGSSDRNIDEF  449



>ref|XP_008243111.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=487

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/467 (58%), Positives = 332/467 (71%), Gaps = 39/467 (8%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++AIPYP+QGHINP+LQF KRL SKGLK TLA T FIS S+    S +V  D ISDG 
Sbjct  20    GHVLAIPYPAQGHINPLLQFSKRLASKGLKVTLANTIFISKSLPLKSSGSVQFDTISDGY  79

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ GF +A+S+  YL R +  GS+TL +LI +Y NS  P++ +IYD F+PWALDVAK  G
Sbjct  80    DEEGFARAESIAAYLARMEAEGSRTLIELITKYNNSPHPINFIIYDPFLPWALDVAKQFG  139

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L +  FFTQ C VNY+YY  +HG     VTS    IPGL  LE +D+PSF  V GSYPAY
Sbjct  140   LASAAFFTQTCTVNYIYYMQYHG---GDVTS----IPGLHMLEPQDLPSFFSVPGSYPAY  192

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              E+V++Q+ N+ +AD +F NSFYKLE QVVD+MSK+  ++ IGPT+PS YLDNR+++D E
Sbjct  193   LEMVMNQYSNLHEADFIFANSFYKLEQQVVDSMSKVCRMLTIGPTIPSTYLDNRIEDDKE  252

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++LY +D   + DWLN KP GSVIYVAFGSMA +  KQMEELA G K    YFLWVV+
Sbjct  253   YGVHLYKIDSVCN-DWLNGKPPGSVIYVAFGSMADLSHKQMEELALGLKGCGFYFLWVVK  311

Query  557   DSELPKLPENFL--------------GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNS  420
             +SE  KLP NFL              G   K LIV WSPQL+VL+++AVGCFFTHGGWNS
Sbjct  312   ESEKAKLPPNFLEELELERSTSTSEDGSKGKGLIVTWSPQLEVLSNEAVGCFFTHGGWNS  371

Query  419   TIEALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-------------GEDGVVSR  279
             TIEALSLGVPM+ MPQWTDQ  N+KL+ DVWKVG RV+V              E+G+V+R
Sbjct  372   TIEALSLGVPMIVMPQWTDQPTNSKLVQDVWKVGVRVKVDHHHHYQDANNVSDENGIVAR  431

Query  278   GEIEGCVREVLEGK---EMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
              EIE C+R+V+EG+   EMK+NA KW  LA EAVS+GGTSD  I EF
Sbjct  432   EEIESCIRKVMEGETAIEMKKNAKKWKSLAIEAVSDGGTSDTNIHEF  478



>ref|XP_010242476.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=458

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 333/442 (75%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H++ +PYP+QGHINP+LQ  KRL  KGLKTTL  T     SM   S +V +  ISDG D
Sbjct  10    GHVLVLPYPTQGHINPLLQVAKRLAFKGLKTTLVTTLSSWRSMYTESISVDVQTISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D GFL+A+S+  YLNRF+  GS+TLA+LI++ K+S  PVDC++YDSF+PWALDVAKS GL
Sbjct  70    DGGFLKAESIEAYLNRFKEVGSQTLAELIKKQKSSGHPVDCLVYDSFLPWALDVAKSFGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVT-SPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
                 FFTQ+CAV  +YY  H G+L +P+T +    +PGLP L++ DMPSFI V GSYP+Y
Sbjct  130   VGAPFFTQSCAVENIYYHVHQGLLTVPMTETTAASLPGLPPLDIMDMPSFISVSGSYPSY  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVI-PIGPTVPSLYLDNRVKNDS  741
             F +V++QF N+E  D + VN+F +LE + VD M++  P++  IGPT+PS+Y+D RV  D 
Sbjct  190   FAMVVNQFSNLETTDWILVNTFQELEVEEVDWMTRRWPLLRTIGPTIPSMYMDKRVTYDM  249

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG+NL+  D +  ++WLN +  GSV+YV+FGS+A+++ +QMEEL WG + TN++FLWVV
Sbjct  250   DYGLNLFKSDGSACLNWLNKRAAGSVVYVSFGSLAALEVEQMEELGWGLRRTNSHFLWVV  309

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R SE+ KLP  F+ +  DK LIV WSPQL+VLA +AVGCF TH GWNST+EA+SLGVPMV
Sbjct  310   RSSEVDKLPNKFIEETSDKGLIVAWSPQLEVLAHQAVGCFVTHCGWNSTLEAVSLGVPMV  369

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
              +PQWTDQ  NAK + DVW+VG R R GE G+V R E+E CVRE++E   G+++++NA+K
Sbjct  370   GIPQWTDQPTNAKYVEDVWEVGLRARPGEKGIVCREEVERCVREIMEGERGEQIRKNAIK  429

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W +LAKEA+ EGG+SDK +DEF
Sbjct  430   WRNLAKEAMDEGGSSDKNLDEF  451



>ref|XP_010672476.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=458

 Score =   528 bits (1361),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 249/441 (56%), Positives = 330/441 (75%), Gaps = 6/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA-VGIDIISDGC  1278
             +HI+A+PYP QGHI+PMLQFC+RL SKG+K +LAIT  I N++ P SD  V +  ISDG 
Sbjct  10    SHILALPYPVQGHISPMLQFCRRLDSKGVKASLAITKHIFNTLNPKSDGHVHLLTISDGF  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD GF +A+S+  YL   +  GS  L D+IE+Y  +D+P+ C++YDSF PW L+VAK HG
Sbjct  70    DDGGFSEAESIAAYLASLEATGSHALGDIIEQYAGTDNPITCLVYDSFFPWCLNVAKKHG  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             +    FFTQ C VNYVYY AHHG L +PV+SP + IPGLP L++ D+PSF+    SYP Y
Sbjct  130   ILGASFFTQTCGVNYVYYLAHHGKLSMPVSSPLIDIPGLPPLDIGDLPSFVGSPESYPDY  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              ELVL Q  N+++ D V VN+ Y+LE +V+D M+K  P++ IGPTVPS+Y+DNR+  D E
Sbjct  190   VELVLKQNSNLDQTDFVLVNTVYELEDKVIDAMAKECPLLTIGPTVPSIYVDNRISYDRE  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++LYH DPT + +WL+TKP  SV+YV+FGSMA++  +QMEELAWG K ++ +FLWVVR
Sbjct  250   YGLSLYHHDPT-TTNWLSTKPPRSVVYVSFGSMANLSNEQMEELAWGLKQSDCHFLWVVR  308

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  KLP+ F+ +   K LIV WSPQL+VL+S+ +GCFFTH GWNST+EAL++GVPM+ 
Sbjct  309   ASEEGKLPKGFVNEVAAKGLIVRWSPQLEVLSSEVIGCFFTHCGWNSTLEALAMGVPMIG  368

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKEMKE---NAMKW  210
             MPQWTDQ M+AKL+V VW+VG RV V ++G+V R EI G + EV+EG++ KE   NA  W
Sbjct  369   MPQWTDQPMHAKLVVAVWRVGVRVNVNKEGLVRREEIAGRIIEVMEGEKRKEFIDNAQMW  428

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               L K A+S+ G+SD+ IDEF
Sbjct  429   KGLVKTAMSQDGSSDRNIDEF  449



>ref|XP_002273866.1| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=456

 Score =   522 bits (1345),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 246/440 (56%), Positives = 322/440 (73%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYPSQGHINPMLQF KRLV  G K TLA T FIS S+   S  + I+ ISDG D
Sbjct  10    AHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLAATRFISKSLVGDSGPITIETISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + G  QA+S   YL RFQV GS+TL  LIE+ K+S  PVDCV+YD+F+PWALDVAK  GL
Sbjct  70    EGGSAQAESDGAYLERFQVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKKLGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+C VN +YY  H G+L+LP++ P V +PGL  L+  D+PSF+Y++GSYPA+F
Sbjct  130   VGAVFFTQSCTVNNIYYHVHQGMLKLPLSEPEVVVPGLFPLQACDLPSFVYLYGSYPAFF  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ++V++QF N+EK D VF N+FYKLE +VVD M+K+ P+  IGPT+PS YLD R+ +D +Y
Sbjct  190   DMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGPTLPSAYLDKRLGDDKDY  249

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+N+        ++WL++KP GSV+Y ++GS A ++ +QMEE+AWG + +N YFL VVR+
Sbjct  250   GLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAVLEPEQMEEVAWGLRRSNAYFLMVVRE  309

Query  554   SELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP+NF  +  +K L+V+W PQL+VL  +A+GCF THGGWNST+EALSLGVPMV  
Sbjct  310   SEQAKLPQNFKEETAEKGLVVSWCPQLEVLTHRAIGCFLTHGGWNSTLEALSLGVPMVVA  369

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWS  207
             P WTDQ  NAK + DVW +G R R    G+V R  +E C+ +V+     KE+K NAMKW 
Sbjct  370   PLWTDQPTNAKFVEDVWGIGLRARADHKGIVRREVLEDCIGKVMGSDGLKEIKNNAMKWK  429

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +LA+EAV EGG+SDK IDEF
Sbjct  430   NLAREAVDEGGSSDKCIDEF  449



>ref|XP_003632443.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera]
Length=456

 Score =   521 bits (1342),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 246/440 (56%), Positives = 323/440 (73%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYPSQGHINPMLQF KRLV  G K TLA T FIS S    S  + I+ ISDG D
Sbjct  10    AHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLAATRFISKSFVGDSGPITIETISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + G  QA+S   YL RF+V GS+TL  LIE+ K+S  PVDCV+YD+F+PWALDVAK  GL
Sbjct  70    EGGSAQAESDGAYLERFRVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKQLGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+C VN +YY  H G+L+LP++ P V +PGL  L+  D+PSF+Y++GSYPA+F
Sbjct  130   VGAVFFTQSCTVNDIYYHVHQGMLKLPLSEPEVVVPGLFPLQACDLPSFVYLYGSYPAFF  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ++V++QF N+EK D VF N+FYKLE +VVD M+K+ P+  IGPT+PS+YLD R+ +D +Y
Sbjct  190   DMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGPTLPSVYLDKRLGDDKDY  249

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+N+        ++WL++KP GSV+Y ++GS A ++ +QMEE+AWG + +N YFL VVR+
Sbjct  250   GLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAVLEPEQMEEVAWGLRRSNAYFLVVVRE  309

Query  554   SELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP+NF  +  +K L+V+W PQL+VLA +A+GCF THGGWNST+EALSLGVPMV  
Sbjct  310   SEQAKLPQNFKEETAEKGLVVSWCPQLEVLAHRAIGCFLTHGGWNSTLEALSLGVPMVVA  369

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWS  207
             P WTDQ  NAK + DVW +G R R    G+V R  +E C+ +V+     KE+K NAMKW 
Sbjct  370   PLWTDQPTNAKFVEDVWGIGLRARADHKGIVRREVLEDCIGKVMGSDGLKEIKNNAMKWK  429

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +LA+EAV EGG+SDK IDEF
Sbjct  430   NLAREAVDEGGSSDKCIDEF  449



>ref|XP_010242475.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=465

 Score =   521 bits (1342),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 246/442 (56%), Positives = 323/442 (73%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH++  PYP QGHINPMLQFCKRL  KGLK TL  T FIS SM+   D++ +  ISDG D
Sbjct  10    AHVLGFPYPCQGHINPMLQFCKRLAFKGLKATLVTTFFISKSMQMELDSIEVQTISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF+QA+S+  YL RF+  GS+TL DLI++   S  PV+C++YD FMPWALDVAK  GL
Sbjct  70    EGGFVQAESIEAYLTRFKEVGSQTLTDLIKKQNCSGHPVNCLVYDPFMPWALDVAKQFGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+CAVN +Y   H G+L++PV+   + IPGLP LE+ D PS I V  SYPAY 
Sbjct  130   LGAPFFTQSCAVNSIYNHVHQGVLKVPVSDSIISIPGLPPLEVMDRPSLISVSASYPAYT  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKM--SPVIPIGPTVPSLYLDNRVKNDS  741
              +VL+QF NVE AD +  NSF +LE++VV+ M+K   +P++ IGP VPS+YLD RV  D 
Sbjct  190   TMVLNQFSNVENADWILANSFNELESEVVEWMTKRLPTPLLTIGPAVPSMYLDKRVAGDK  249

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG+NL+  D    ++WL+ +   SV+YV+FGSMA++  +Q+EE+AWG + +NTYFLWV+
Sbjct  250   DYGLNLFKPDKGSCMNWLDKRAARSVVYVSFGSMAALSAEQIEEIAWGLRRSNTYFLWVL  309

Query  560   RDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R  +  KLP  FL +  +K LIV W  QL+VLA +A+GCF TH GWNST+EALS GV MV
Sbjct  310   RSDQDDKLPGEFLMETAEKGLIVRWCSQLEVLAREAIGCFITHCGWNSTLEALSTGVAMV  369

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
              MPQWTDQT NAKL++DVW++G R R  + G+VSR E+E C+ EV+E   GK++K+NA+K
Sbjct  370   GMPQWTDQTTNAKLVMDVWRIGVRARPDDKGIVSREEVERCIVEVMEGERGKQIKKNAIK  429

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W +LA+EAV EGG+SDK ID F
Sbjct  430   WKNLAREAVDEGGSSDKNIDGF  451



>ref|XP_007159561.1| hypothetical protein PHAVU_002G247700g [Phaseolus vulgaris]
 gb|ESW31555.1| hypothetical protein PHAVU_002G247700g [Phaseolus vulgaris]
Length=459

 Score =   519 bits (1337),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 251/445 (56%), Positives = 320/445 (72%), Gaps = 11/445 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA----VGIDIISD  1284
             H++ +PYPSQGHINPMLQF KRL SKGLK T+  T FISNSM   S +    V +D ISD
Sbjct  10    HVLMVPYPSQGHINPMLQFSKRLCSKGLKVTMLTTIFISNSMHLQSSSLLGTVQLDFISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D AGF +A SV  YL+R Q  GS +L ++I ++ +SD P+DCV+YD  + W LDVAK 
Sbjct  70    GYDQAGFHEAASVETYLSRMQEVGSNSLREVINKHNSSDHPIDCVVYDPLVIWVLDVAKE  129

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GLF   FFTQ CAVNY+YYC +HG+L+LP++S P+ IPGLP L L+D P+F+Y    YP
Sbjct  130   FGLFGAAFFTQMCAVNYIYYCVYHGLLKLPISSLPISIPGLPLLHLKDTPAFVYQTDFYP  189

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYF LV++QF N+ KAD + VNSFYKLE QVVD+MSK+ P++ IGPTVPS +LD  V ND
Sbjct  190   AYFHLVINQFSNIHKADLILVNSFYKLEDQVVDSMSKLCPLLTIGPTVPSFHLDKAVPND  249

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
             +E  +NL+ +D + +I WL  K  GSVIY++FGSM     +QMEE+A G   T   FLWV
Sbjct  250   TENVLNLFELD-SSAISWLKQKGAGSVIYISFGSMVCFSSQQMEEIALGLMGTGFNFLWV  308

Query  563   VRD---SELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             + D     L K  E  + +  K LIVNW PQL+VL+++AVGCFFTH GWNST+EAL LGV
Sbjct  309   IPDLFRKNLSKELEKGIDECGKGLIVNWIPQLEVLSNQAVGCFFTHCGWNSTLEALCLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVA+PQWTDQ   AK + DVWKVG RV+  E+G+V+R EI+ C+R V+E   G+E++ N
Sbjct  369   PMVALPQWTDQPTKAKFVEDVWKVGIRVKENENGIVTREEIQNCIRLVMEKDLGRELRIN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LA EAV++GGTS   I+EF
Sbjct  429   AKKWKKLAIEAVTQGGTSHHNINEF  453



>ref|XP_010522253.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Tarenaya hassleriana]
Length=457

 Score =   514 bits (1325),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 254/438 (58%), Positives = 323/438 (74%), Gaps = 17/438 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYPSQGHI P+ QFCKRLVSKG+KT+LA+T FI +S+K   S  V ++ ISDG 
Sbjct  7     GHVLAVPYPSQGHITPIHQFCKRLVSKGMKTSLALTNFIHSSIKSDPSPFVPLETISDGY  66

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF+ A+++ DYL+R +  G++TLA LI ++++SD+P+ C++YD F+PWA +V +  G
Sbjct  67    DSGGFMAAENIHDYLHRLRSVGTETLAQLIRKHQSSDNPITCLVYDPFLPWAFEVGREFG  126

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ+CAVNYVYY AH G L+LP       I GL  LE +D+PSFI V GSYPAY
Sbjct  127   LTVAPFFTQSCAVNYVYYLAHQGKLRLP-------IDGLSFLEQQDIPSFISVPGSYPAY  179

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             FE+VLHQF N  KAD V  N F KLE +  + MSK+ PV+ +GPTVPS+YLD R++ D+ 
Sbjct  180   FEMVLHQFSNFHKADFVLFNVFQKLEVEETELMSKVCPVMTVGPTVPSMYLDRRIETDNN  239

Query  737   YGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             Y + L+ M D     +WLN KP+GSV+YVAFGSMA + + QMEELAW   N +  FLWVV
Sbjct  240   YDLMLFDMKDSEFCTEWLNEKPQGSVVYVAFGSMADLSRAQMEELAWSLSNFS--FLWVV  297

Query  560   RDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R SE  KLP  FL   D DK+L+V WSPQL+VL+++A+GCF TH GWNST+EALSLGVP+
Sbjct  298   RGSEEAKLPSGFLQTVDRDKSLVVKWSPQLEVLSNRAIGCFVTHCGWNSTMEALSLGVPL  357

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEG---KEMKENA  219
             VAMPQWTDQ  NAK I DVWKVG RV+  E+ G+V R EIE C+R+V+EG   +E+KENA
Sbjct  358   VAMPQWTDQPTNAKYIEDVWKVGVRVKEDEESGIVRREEIEFCIRQVMEGEKSREVKENA  417

Query  218   MKWSHLAKEAVSEGGTSD  165
              KW  LA EAV EGGTSD
Sbjct  418   KKWRDLAMEAVGEGGTSD  435



>ref|XP_010037081.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW48705.1| hypothetical protein EUGRSUZ_K02356 [Eucalyptus grandis]
Length=468

 Score =   514 bits (1325),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 244/442 (55%), Positives = 319/442 (72%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
             AH++ +PYP+QGHI+PMLQF KRLVSKG++ TLA T F++ SM   ++D++GI+ ISDG 
Sbjct  19    AHVLVLPYPAQGHISPMLQFAKRLVSKGVRVTLATTFFVAKSMHAALNDSIGIETISDGF  78

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G  QA+S+  YL   Q  GS+TLA LI++  NS   +D +IYD F+ WALDVAK  G
Sbjct  79    DEGGSAQAESIEAYLRSLQAVGSRTLAALIKKLDNSGDAIDAIIYDGFLSWALDVAKQFG  138

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
                  F+TQACAVN VYY A+ G+L LP++   + +PGLP LE  + PSF+YV GSYPA+
Sbjct  139   KSGVAFYTQACAVNNVYYHAYQGLLPLPLSGTTISLPGLPPLEPAETPSFLYVLGSYPAF  198

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F L+++QF N++ AD V  NSFY+LE +VVD M+K+ P+  +GP +PS+YLD R+++D +
Sbjct  199   FNLIVNQFSNIDGADLVLYNSFYELEKEVVDYMAKLWPLKTVGPAIPSIYLDKRLQDDKD  258

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YGINL+  D    + WLN KP  SVIYV+FGSMA ++  QMEELAWG +N+N +FLWVVR
Sbjct  259   YGINLFRPDTESCLSWLNDKPINSVIYVSFGSMAELETSQMEELAWGLRNSNRHFLWVVR  318

Query  557   DSELPKLPENFLGDDDK--ALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +SE  KLP  F         L+V W PQL++LA  + GCF T+ GWNST+EALSL VPMV
Sbjct  319   ESETAKLPPGFAEQTRSGMGLLVPWGPQLEILAHGSTGCFITNCGWNSTLEALSLRVPMV  378

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQ  NAK + DVW VG R    EDG++ RGEIE C+ EV+E   GKE++ NA K
Sbjct  379   AMPQWTDQGTNAKFVEDVWGVGVRASKDEDGIIVRGEIERCISEVMEGGKGKEIERNAEK  438

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAKE V EGG+SD+ ID+F
Sbjct  439   WWELAKETVDEGGSSDRNIDDF  460



>ref|XP_002529826.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32575.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=466

 Score =   514 bits (1325),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 246/448 (55%), Positives = 332/448 (74%), Gaps = 12/448 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA---VGIDIISD  1284
              H++ IP+P QGH+NPMLQF +RLVSKGL+ T  +TT+IS S   VS +   +  D ISD
Sbjct  8     GHVLVIPFPGQGHLNPMLQFSRRLVSKGLQVTFIVTTYISRSKHLVSSSNRLLQFDTISD  67

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ GF QA S+  YL+     G +TL +LI +Y++S +P+DC+IY+ F+ WALD+AK 
Sbjct  68    GYDEGGFEQASSMGAYLSSIHTVGPRTLKELIAKYQSSSNPIDCLIYEPFLSWALDIAKQ  127

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLP---VTSPPVRIPGLPALELRDMPSFIYVHG  933
              GL A  FFT ACAV+YV+Y  +  ++ +P    +S PV I GLP LEL+D+P+FI +  
Sbjct  128   FGLIAAAFFTHACAVDYVFYSFYRKMVPVPDVNSSSMPVLIEGLPPLELQDLPTFIVLPE  187

Query  932   SYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRV  753
             +YPA  E++  QF NV+KAD + VN+FYKLE QVVDTMS + P++ IGPT+PS Y D R+
Sbjct  188   AYPANAEMIKRQFSNVDKADYILVNTFYKLEYQVVDTMSTLCPLLTIGPTIPSSYSDKRI  247

Query  752   KNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMA-SVDQKQMEELAWGFKNTNTY  576
             +N+ +YGI+LY  + +  I WL+TKP GSV+YV+FGS+A ++ +KQMEE+AWG K +N Y
Sbjct  248   ENEDDYGIDLYEANASIPITWLSTKPTGSVVYVSFGSIANNLSEKQMEEVAWGLKRSNFY  307

Query  575   FLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             FLWVV++SE  KLP+ ++ +   K LIVNWSPQ+K+L ++++GCFFTH GWNSTIEALSL
Sbjct  308   FLWVVKNSEEHKLPKGYVEEVAPKGLIVNWSPQVKILTNESIGCFFTHCGWNSTIEALSL  367

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLE---GKEM  231
             GVPMV +PQW+DQ  N+K + DVW+VG RV+V  D G+  R +IE C++EV+E   GKEM
Sbjct  368   GVPMVTLPQWSDQPTNSKFVEDVWRVGIRVKVDADNGIAKRDQIEYCIKEVMESVRGKEM  427

Query  230   KENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             KEN+ KW  LA EA+SEGGTSDK IDE 
Sbjct  428   KENSKKWKELAVEAISEGGTSDKNIDEL  455



>gb|KDP45202.1| hypothetical protein JCGZ_15067 [Jatropha curcas]
Length=454

 Score =   514 bits (1323),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 252/441 (57%), Positives = 321/441 (73%), Gaps = 6/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
             +H++ +PYP+QGHINPMLQF KRLVS+G+K TLA T  I+ SM +  +  + I   SDG 
Sbjct  10    SHVLVLPYPAQGHINPMLQFSKRLVSRGVKATLANTIAINKSMHRDPNSLIDIQTYSDGF  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ GF QA+S   YL+R Q  GSKT ADLI++ ++SD PV  VIYD F+ WALDVAK  G
Sbjct  70    DEGGFGQAESTEIYLSRLQEVGSKTFADLIKKLRDSDFPVTAVIYDGFLTWALDVAKQFG  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             LFA  FFTQ+CAVN +YY    G+L LP+ S  V +PGLP L++ + PSFI + GSYP +
Sbjct  130   LFAVVFFTQSCAVNNIYYHVQRGLLPLPLKSS-VSVPGLPLLQVSETPSFISIWGSYPGF  188

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               L+++QF N ++AD +  NSFYKLE + VD M+K   +  IGPT+PS+YLD R+++D  
Sbjct  189   SHLLVNQFSNFDEADWILYNSFYKLEEEAVDWMAKRWRLRTIGPTLPSMYLDKRLEDDKH  248

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YGINL+  D T  ++WL  KP GSV+YV+FGSMA +   QMEELAWG K +N YFLWV+R
Sbjct  249   YGINLFEPDTTACLNWLQDKPSGSVVYVSFGSMAQLGAAQMEELAWGLKASNYYFLWVIR  308

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
               E  KLPENF  +  DK+L+V WSPQL+VLA +++GCF TH G+NS +EALS GVPMVA
Sbjct  309   APEQAKLPENFKEETSDKSLVVTWSPQLEVLAPESIGCFVTHCGFNSVLEALSFGVPMVA  368

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             MPQWTDQ  NAK + DVWK+G R    E GVV R  IE C+R+V+E   GKE+KENA+KW
Sbjct  369   MPQWTDQPTNAKYVEDVWKMGIRAMADEKGVVRRQVIEHCLRQVMEGEKGKEIKENAIKW  428

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
              +LAKEA+SEGG SD  IDEF
Sbjct  429   KNLAKEAISEGGNSDTNIDEF  449



>ref|XP_003629941.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AET04417.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=460

 Score =   513 bits (1322),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 320/445 (72%), Gaps = 11/445 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVG----IDIISD  1284
             H++ IPYPSQGHINPMLQF KRL +KG+K T+  T FIS +M   S ++      D ISD
Sbjct  10    HVLMIPYPSQGHINPMLQFSKRLSTKGVKVTMVTTIFISKTMHLQSSSLPSSLQFDFISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ GF Q  ++  YL+  Q  GSK L +LI+++  SD P+DCV+YD F+ W LDVAK 
Sbjct  70    GYDEGGFTQVGNISTYLSHMQAIGSKNLKELIQKHNVSDHPIDCVVYDPFLQWVLDVAKE  129

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
               +    FFTQ CAVNY+YY  +HG+L+LP++S P+ IPGLP LEL+D PSF+Y  G YP
Sbjct  130   FNIIGAAFFTQMCAVNYMYYYVYHGLLKLPISSMPISIPGLPLLELKDTPSFVYDPGFYP  189

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AY+E+V++Q+ N+ KAD + VNSFYKLE QVVD+MSK+ P++ IGPTVPS YLD  V ND
Sbjct  190   AYYEMVMNQYSNIHKADIILVNSFYKLEDQVVDSMSKLCPILTIGPTVPSFYLDKGVPND  249

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +  +NL+ +D +  I+WLN+KPEGS IYV+FGSM     +QM+E+A G   + + FLWV
Sbjct  250   KDNDLNLFQLD-SSPINWLNSKPEGSAIYVSFGSMVCFSIEQMKEIALGLLGSGSNFLWV  308

Query  563   VRDSELPKLPENF---LGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             + + E   + +     +    K L+VNW PQL+VL++KA+GCF TH GWNST+EAL LGV
Sbjct  309   IPNMEKKNISKELVEEMSSSGKGLVVNWIPQLEVLSNKAIGCFLTHSGWNSTLEALCLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVA+PQWTDQ +NAK + DVWKVG RV+V E+G+V++ EIE C+ +V+E   G+EMK N
Sbjct  369   PMVAIPQWTDQPLNAKYVEDVWKVGMRVKVNENGIVTKEEIESCIMKVMENDIGREMKIN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LA EAVS  GTSD  I+EF
Sbjct  429   AKKWRELAIEAVSHSGTSDNNINEF  453



>gb|AFK43317.1| unknown [Medicago truncatula]
Length=460

 Score =   512 bits (1319),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 320/445 (72%), Gaps = 11/445 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVG----IDIISD  1284
             H++ IPYPSQGHINPMLQF KRL +KG+K T+  T FIS +M   S ++      D ISD
Sbjct  10    HVLMIPYPSQGHINPMLQFSKRLSTKGVKVTMVTTIFISKTMHLQSSSLPSSLQFDFISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ GF Q  ++  YL+  Q  GSK L +LI+++  SD P+DCV+YD F+ W LDVAK 
Sbjct  70    GYDEGGFTQVGNISTYLSHMQAIGSKNLKELIQKHSVSDHPIDCVVYDPFLQWVLDVAKE  129

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
               +    FFTQ CAVNY+YY  +HG+L+LP++S P+ +PGLP LEL+D PSF+Y  G YP
Sbjct  130   FNIIGAAFFTQMCAVNYMYYYVYHGLLKLPISSMPISMPGLPLLELKDTPSFVYDPGFYP  189

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AY+E+V++Q+ N+ KAD + VNSFYKLE QVVD+MSK+ P++ IGPTVPS YLD  V ND
Sbjct  190   AYYEMVMNQYSNIHKADIILVNSFYKLEDQVVDSMSKLCPILTIGPTVPSFYLDKGVPND  249

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +  +NL+ +D +  I+WLN+KPEGS IYV+FGSM     +QM+E+A G   + + FLWV
Sbjct  250   KDNDLNLFQLD-SSPINWLNSKPEGSAIYVSFGSMVCFSIEQMKEIALGLLGSGSNFLWV  308

Query  563   VRDSELPKLPENF---LGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             + + E   + +     +    K L+VNW PQL+VL++KA+GCF TH GWNST+EAL LGV
Sbjct  309   IPNMEKKNISKELVEEMSSSGKGLVVNWIPQLEVLSNKAIGCFLTHSGWNSTLEALCLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVA+PQWTDQ +NAK + DVWKVG RV+V E+G+V++ EIE C+ +V+E   G+EMK N
Sbjct  369   PMVAIPQWTDQPLNAKYVEDVWKVGMRVKVNENGIVTKEEIESCIMKVMENDIGREMKIN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LA EAVS  GTSD  I+EF
Sbjct  429   AKKWRELAIEAVSHSGTSDNNINEF  453



>ref|XP_002880070.1| UDP-glucosyltransferase 74F2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56329.1| UDP-glucosyltransferase 74F2 [Arabidopsis lyrata subsp. lyrata]
Length=446

 Score =   511 bits (1316),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 255/446 (57%), Positives = 326/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL SKGLKTTLA+TTF+ NS+KP +S  + I  ISDG 
Sbjct  3     GHVLAVPYPTQGHITPIRQFCKRLHSKGLKTTLALTTFVFNSIKPDLSGPISIATISDGY  62

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A S+ DYL  F+ +GSKT+AD+I +++ SDSP+ C++YD+FMPWALDVA+  G
Sbjct  63    DHGGFESAGSIADYLENFKTSGSKTIADIIRKHQTSDSPITCIVYDAFMPWALDVAREFG  122

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYVYY ++  +G L+LP       I  LP LEL+D+PSF  V GSYP
Sbjct  123   LVATPFFTQPCAVNYVYYLSYINNGSLKLP-------IEDLPFLELQDLPSFFSVSGSYP  175

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VNSF +LE       SK  PV+ IGPT+PS+YLD R+++D
Sbjct  176   AYFEMVLQQFINFEKADFVLVNSFQELELHENALWSKACPVLTIGPTIPSIYLDQRIESD  235

Query  743   SEYGINLYH-MDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL    D +   +WL+T+P+GSV+YVAFGSMA +  +QMEELA    N +  FLW
Sbjct  236   TDYDLNLIESKDDSFCTNWLDTRPQGSVVYVAFGSMAQLTNEQMEELASAVSNFS--FLW  293

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   + DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  294   VVRSSEEAKLPSGFLDTVNKDKSLVLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGV  353

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G RV+   E G+  R EIE  +REV+EG   KEMK+
Sbjct  354   PMVAMPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAKREEIEFSIREVMEGERSKEMKK  413

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA ++++EGG++D  ID F
Sbjct  414   NVKKWRDLALKSLNEGGSTDINIDTF  439



>ref|XP_010101354.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB88301.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=445

 Score =   511 bits (1315),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 257/435 (59%), Positives = 315/435 (72%), Gaps = 15/435 (3%)
 Frame = -2

Query  1406  MLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA-VGIDIISDGCDDAGFLQADSVPDYLN  1230
             MLQFCKRL SKGLK TLA T FISN+  P S A + +D ISDG DD GF  A S+ DYL 
Sbjct  1     MLQFCKRLASKGLKATLATTVFISNTFNPQSPAPIQLDTISDGYDDGGFTHAKSIDDYLA  60

Query  1229  RFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFAGCFFTQACAVNYV  1050
             R QV+GSKTLA+LI R+ NS  P+DC++YD F+PWALDVA   G+    FFTQAC VNYV
Sbjct  61    RLQVSGSKTLAELITRHNNSPHPIDCIVYDGFLPWALDVAHQLGIKGATFFTQACTVNYV  120

Query  1049  YYCAHHGILQLPVTSPPVRIPGLPAL--ELRDMPSFIYVHGSYPAYFELVLHQFLNVEKA  876
             YYC HH  L LPV+S P+ I GL  L  +L DMPS+I V GSYPAYFEL+L+QF NV  A
Sbjct  121   YYCVHHRKLTLPVSSFPLPIDGLELLLDQLHDMPSYIAVEGSYPAYFELLLNQFSNVHNA  180

Query  875   DCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYGINLYHM--DPTK  702
             D + +N+ Y+LE QVVD+MSK+ P+ PIGPT+PS+YLD+R+K+D +YG++L     DP+ 
Sbjct  181   DFILINTVYELEEQVVDSMSKLCPLRPIGPTIPSIYLDSRIKDDKDYGLDLLITSDDPSI  240

Query  701   SI--DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDSELPKLPEN  528
             S   +WLN KP GSV+YV FGSMAS+  KQMEE+A   K TN YF+W +R SE  KLP  
Sbjct  241   STNNNWLNNKPAGSVVYVTFGSMASLSDKQMEEVASALKATNFYFIWALRASEEEKLPHK  300

Query  527   FLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMPQWTDQTMN  351
             F+ +  DK LIVNW  Q++VL+  +VGCF TH GWNS IEALSLGVPMV MP WTDQ   
Sbjct  301   FVQETCDKGLIVNWCSQVEVLSHPSVGCFVTHCGWNSAIEALSLGVPMVGMPLWTDQPTV  360

Query  350   AKLIVDVWKVGKRVRVGEDG----VVSRGEIEGCVREVLEGK---EMKENAMKWSHLAKE  192
             AKL+  +WKVG RV+V  D     ++ R EIE C+REV+EG    EM+ N  KW +LA +
Sbjct  361   AKLVEHLWKVGVRVKVDYDESYNVIMERKEIEFCIREVMEGDRAAEMRMNGKKWRNLALQ  420

Query  191   AVSEGGTSDKVIDEF  147
             A+SEGG+SDK IDEF
Sbjct  421   AISEGGSSDKNIDEF  435



>emb|CDY17908.1| BnaC04g03110D [Brassica napus]
Length=451

 Score =   510 bits (1314),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 253/446 (57%), Positives = 328/446 (74%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL SKGLKTTLA+TTFI NS+KP  S  + I  ISDG 
Sbjct  10    GHVLAVPYPTQGHITPIRQFCKRLTSKGLKTTLALTTFIFNSIKPDPSGPISIATISDGY  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  + S+ DYL  F+  GSKT+ D+I +++ SD+P+ C++YD+FMPWALDVA+  G
Sbjct  70    DLHGFDSSASIHDYLQDFKTFGSKTIGDIIRKHQTSDNPITCIVYDAFMPWALDVAREFG  129

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  HG L+LP       I  LP LEL+D+PSF  V GSYP
Sbjct  130   LAASVFFTQSCAVNYVYYLSYVNHGSLKLP-------IDDLPFLELQDLPSFFSVCGSYP  182

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N EKAD V VN+F +L+    + +SK+ PV+ IGP+VPS+YLD R+K+D
Sbjct  183   AYFEMVLQQFTNFEKADFVLVNTFQELDLHEKELLSKVCPVLTIGPSVPSMYLDQRIKSD  242

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+   D      WL+T+ +GSV+YVAFGSMA ++  QMEELA    N +  FLW
Sbjct  243   TDYDLNLFDSKDSAFCTSWLDTRTQGSVVYVAFGSMAKLNNAQMEELASAISNFS--FLW  300

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVRDSE   LP  FL   D +K++++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  301   VVRDSEEATLPSGFLETVDKEKSMVLKWSPQLEVLSNKAIGCFLTHCGWNSTMEALTFGV  360

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G RV++ E+ G+V + EIE  ++EV+EG   KEMKE
Sbjct  361   PMVAMPQWTDQPMNAKYIKDVWKAGVRVKMDEESGIVKKEEIEFSIKEVMEGEKSKEMKE  420

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  421   NAKKWRDLAVKSLSEGGSTDVNIDTF  446



>ref|NP_181910.1| UDP-glucosyltransferase 74F2 [Arabidopsis thaliana]
 sp|O22822.1|U74F2_ARATH RecName: Full=UDP-glycosyltransferase 74F2; AltName: Full=AtSGT1; 
AltName: Full=Salicylic acid glucosyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAB64024.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAL32561.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAM64890.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAQ55278.1| At2g43820 [Arabidopsis thaliana]
 gb|ABD66577.1| pathogen-inducible salicylic acid glucosyltransferase [Arabidopsis 
thaliana]
 gb|AEC10331.1| UDP-glucosyltransferase 74F2 [Arabidopsis thaliana]
 gb|AHL38795.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   509 bits (1310),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 326/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P  QFCKRL  KGLKTTLA+TTF+ NS+ P +S  + I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPFRQFCKRLHFKGLKTTLALTTFVFNSINPDLSGPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  ADS+ DYL  F+ +GSKT+AD+I++++ SD+P+ C++YD+F+PWALDVA+  G
Sbjct  66    DHGGFETADSIDDYLKDFKTSGSKTIADIIQKHQTSDNPITCIVYDAFLPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYVYY ++  +G LQLP+         LP LEL+D+PSF  V GSYP
Sbjct  126   LVATPFFTQPCAVNYVYYLSYINNGSLQLPIEE-------LPFLELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VNSF +LE    +  SK  PV+ IGPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFINFEKADFVLVNSFQELELHENELWSKACPVLTIGPTIPSIYLDQRIKSD  238

Query  743   SEYGINLYH-MDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +NL+   D +  I+WL+T+P+GSV+YVAFGSMA +   QMEELA    N +  FLW
Sbjct  239   TGYDLNLFESKDDSFCINWLDTRPQGSVVYVAFGSMAQLTNVQMEELASAVSNFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   + +K+L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRSSEEEKLPSGFLETVNKEKSLVLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G RV+   E G+  R EIE  ++EV+EG   KEMK+
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAKREEIEFSIKEVMEGERSKEMKK  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA ++++EGG++D  ID F
Sbjct  417   NVKKWRDLAVKSLNEGGSTDTNIDTF  442



>ref|XP_002269003.2| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=456

 Score =   507 bits (1306),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 317/440 (72%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             +H + +PYPSQGHINPMLQF KRLV  G K TL  T FIS S+   S  + I+ ISDG D
Sbjct  10    SHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLVPTCFISKSLLGDSGPITIETISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF QA+S   Y+ RF+V GS+TL  LIE+ K+S  PVDCV+YD+F+PWALDVAK  GL
Sbjct  70    EGGFAQAESGGAYMERFRVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKKFGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+C VN +YY  H G+L LP++ P V +PGL  L+  D+PS +Y++GSYP +F
Sbjct  130   VGAVFFTQSCTVNNIYYHVHQGMLTLPLSEPEVVVPGLFPLQACDLPSLVYLYGSYPDFF  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              ++++QF N+EK D VF N+FYKLE +VVD M+K+ P+  IGPT+PS YLD R+ +D +Y
Sbjct  190   NMLVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGPTLPSAYLDKRLGDDKDY  249

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+N+        ++WL++KP GSV+Y ++GS A ++ +QMEELAWG + +N YFL VVR+
Sbjct  250   GLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAKLEPEQMEELAWGLRRSNAYFLMVVRE  309

Query  554   SELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP+ F  +  +K L+V+W PQL+VLA +A+GCF THGGWNST+EALSLGVPMV  
Sbjct  310   SEQAKLPQKFKEETAEKGLVVSWCPQLEVLAHRAIGCFLTHGGWNSTLEALSLGVPMVVA  369

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWS  207
             P W DQ  NAK + DV  VG R R  + G+V R  +E C+ +V+     KE+K NA+KW 
Sbjct  370   PLWIDQPTNAKFVEDVCGVGLRARADDKGIVRREVLEDCIGKVMGSDGLKEIKNNALKWK  429

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +LA+EAV EGG+SDK IDEF
Sbjct  430   NLAREAVDEGGSSDKCIDEF  449



>ref|XP_007201501.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
 gb|EMJ02700.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
Length=466

 Score =   507 bits (1306),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 249/451 (55%), Positives = 332/451 (74%), Gaps = 17/451 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA-------VGID  1296
             AH + +PYPSQGHINPMLQF K L  KG+K TLA T F+ N+++ +S +       +  +
Sbjct  10    AHCLVLPYPSQGHINPMLQFSKLLNHKGIKITLANTIFVHNTIQKISSSSSSSSTSIAFE  69

Query  1295  IISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALD  1116
              ISDG D+ G  QA+S+  YL+RF+  G+KTL +LI+R   S +PVDC++YD+FMPW LD
Sbjct  70    TISDGYDEGGITQAESIEAYLDRFRKIGTKTLIELIDRLSGSGNPVDCIVYDAFMPWPLD  129

Query  1115  VAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPP---VRIPGLPALELRDMPSFI  945
             VAK  G+    FFTQ+C+V+ ++Y  H G+L+LP+  PP   + +PGLP L+  DMPSFI
Sbjct  130   VAKKFGIVGAVFFTQSCSVDNIFYHVHQGLLKLPL--PPDSEILLPGLPPLQPSDMPSFI  187

Query  944   YVHGSYPAYFELVLH-QFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLY  768
             YV+GSYPA+F +V+  QF NV+KAD VF N+FY+LE +VVD M+K+ P+  IGPT+PS+Y
Sbjct  188   YVYGSYPAFFTMVVDGQFYNVDKADWVFCNTFYELEEEVVDCMAKLWPLRTIGPTIPSMY  247

Query  767   LDNRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKN  588
             LD R ++D EYG +L++ +    + WLN KP+GSV YV+FGS+A + + QMEEL WG +N
Sbjct  248   LDKRREDDREYGFSLFNPNSDACLTWLNAKPKGSVAYVSFGSLAELGENQMEELGWGLRN  307

Query  587   TNTYFLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIE  411
             +N YFLWVVR+ E  KLP+ F+ +   K L+V+W PQL VLA++AVGCF TH GWNST+E
Sbjct  308   SNNYFLWVVREKEAAKLPQGFVEETSGKGLVVSWCPQLDVLANEAVGCFVTHCGWNSTLE  367

Query  410   ALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---G  240
             ALSLGVPMVA+PQWTDQ+ NA+ I DVWK+G + +  E G+V R EI  CVRE+LE   G
Sbjct  368   ALSLGVPMVAVPQWTDQSTNARFIQDVWKMGLKAQADEKGIVRREEIANCVREILEGERG  427

Query  239   KEMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             KE+++N  KW  LAK AV EGG+SDK IDEF
Sbjct  428   KEIRKNTSKWKELAKNAVDEGGSSDKNIDEF  458



>ref|XP_006294206.1| hypothetical protein CARUB_v10023202mg [Capsella rubella]
 gb|EOA27104.1| hypothetical protein CARUB_v10023202mg [Capsella rubella]
Length=449

 Score =   506 bits (1303),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 250/446 (56%), Positives = 326/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL  KGLKTTLA+TTFI NS+KP +S  + I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRLHYKGLKTTLALTTFIFNSIKPDLSGPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A S+ DYL  F+ +GSKT+AD+I +++ SD+PV C++YD+FMPWALDVA+  G
Sbjct  66    DHGGFDTAGSIHDYLQNFKTSGSKTIADIIRKHQTSDNPVTCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYVYY ++  +G L+LP+         LP LEL+D+PSF  V GSYP
Sbjct  126   LVATPFFTQPCAVNYVYYLSYINNGSLELPIEE-------LPFLELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VNSF +LE    +  SK  PV+ IGPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFINFEKADFVLVNSFQELELHEKELWSKSCPVLTIGPTIPSIYLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+   D +   +WL+T+P+GSV+YVAFGSMA ++  QMEELA      +  FLW
Sbjct  239   TDYDLNLFGSTDASYCTNWLDTRPQGSVVYVAFGSMAQLNNVQMEELALAVSKFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D +K++++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRSSEEAKLPSGFLETVDKEKSMVLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEGK---EMKE  225
             PMVAMPQWTDQ MN+K I DVWK G RV+   E G+  R EIE  ++EV+EG+   EMK+
Sbjct  357   PMVAMPQWTDQPMNSKYIQDVWKAGVRVKTDKESGIAKRAEIEFSIQEVMEGEKSVEMKK  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA ++++EGG++D  ID F
Sbjct  417   NVKKWRDLAVKSLNEGGSTDINIDTF  442



>gb|KDP45201.1| hypothetical protein JCGZ_15066 [Jatropha curcas]
Length=457

 Score =   506 bits (1303),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 250/440 (57%), Positives = 315/440 (72%), Gaps = 5/440 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA-VGIDIISDGCD  1275
             H++ +PYP QGH+NPMLQF KRLVSKG+K TL  T  I+ SM    ++ V I+ ISDG D
Sbjct  11    HVLVVPYPLQGHLNPMLQFSKRLVSKGVKATLPNTIAINKSMHADPNSPVDIETISDGFD  70

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF QA+S   YL+R Q  GSKTLADLI R K+   PV  VIYD FMPWALDVAK  GL
Sbjct  71    EGGFAQAESTEIYLSRLQEVGSKTLADLINRLKDLGRPVTAVIYDGFMPWALDVAKQFGL  130

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FF Q+C+VN +YY    G+L+LP++ P V +PGLP L   + PSF+    SYP + 
Sbjct  131   TGVTFFNQSCSVNNIYYHVQRGLLRLPLSEPTVSLPGLPLLHASETPSFVSDSVSYPGFH  190

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              LV++QF N+++AD V  NSFYKLE ++V  M+K   +  IGPT+PS+YLD R+++D +Y
Sbjct  191   HLVMNQFCNIDEADWVLFNSFYKLEEEIVVWMAKRWRLRTIGPTLPSMYLDKRIEDDKDY  250

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             GI+ +  D T  I WL  KP  SV+YVAFGS+A +  +QMEELAWG K +N YFLWVVR 
Sbjct  251   GISTFKPDETNCIKWLQDKPSASVVYVAFGSVARLGAEQMEELAWGLKASNYYFLWVVRA  310

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             +E  KLP+NF  D  DK+L+V WSPQL+VLA+++ GCF TH G+NS +EALS GVPMVAM
Sbjct  311   AEQAKLPKNFKEDTSDKSLVVIWSPQLEVLANESTGCFVTHCGFNSVLEALSFGVPMVAM  370

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             PQWTDQ  NAK + DVWK+G R    E GVV R  IE C+R+V+E   GKE+KENA+KW 
Sbjct  371   PQWTDQPTNAKYVEDVWKMGIRAMADEKGVVRRQVIEHCLRQVMEGEKGKEIKENAIKWK  430

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +LAKEA+SEGG SD  IDEF
Sbjct  431   NLAKEAISEGGNSDTNIDEF  450



>ref|XP_004504205.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cicer arietinum]
Length=469

 Score =   506 bits (1304),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 318/445 (71%), Gaps = 11/445 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV----GIDIISD  1284
             H++ IPYPSQGH+NPMLQF KRL +KG+K T+  T FIS +M   S ++      D ISD
Sbjct  19    HVLMIPYPSQGHLNPMLQFSKRLSTKGVKVTMVTTIFISKTMHLKSSSLPSTLQFDFISD  78

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D  GF QA+++  YL+  +  GS  L +LI++Y  S+ P+DCVIYD  + W LDVAK 
Sbjct  79    GYDQGGFAQANNISTYLSHMETIGSNNLKELIKKYNFSNDPIDCVIYDPLIYWVLDVAKE  138

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GL    FFTQ   VNY+YY  HHG+L+LP++S  + I GLP L+++D PSF+   G YP
Sbjct  139   FGLLGAAFFTQMSGVNYIYYYVHHGLLKLPISSMTISIQGLPLLDIKDTPSFVNDPGFYP  198

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AY+ELV++QF N+ KAD + VNSFYKLE +VVD+MSK+ P++ IGPTVPS YLD  + ND
Sbjct  199   AYYELVMNQFSNIHKADVILVNSFYKLEDKVVDSMSKLCPILTIGPTVPSFYLDKEIPND  258

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +  +NL+ +D + +I+WLNTKPEGSVIYV+FGSM     +QM+E+A G   +   FLWV
Sbjct  259   KDNDLNLFQLD-SSAINWLNTKPEGSVIYVSFGSMVCFSIEQMKEIALGLIGSGLNFLWV  317

Query  563   VRDSELPKLPENFLGD---DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             V + E   + +  + +     K L+VNW PQL+VL++KA+GCF TH GWNST+EAL LGV
Sbjct  318   VPNMEGKNISKELVEEISLSGKGLVVNWIPQLEVLSNKAIGCFVTHCGWNSTLEALCLGV  377

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVA+PQWTDQ MNAK + DVWKVG RV V E+G+V+R EIE C+REV+E   G+EM+ N
Sbjct  378   PMVAIPQWTDQPMNAKFVEDVWKVGIRVLVYENGIVTREEIESCIREVMESEHGREMRIN  437

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LA EAVS GG+SD  I+EF
Sbjct  438   AKKWRELAIEAVSLGGSSDNNINEF  462



>ref|XP_009142974.1| PREDICTED: UDP-glycosyltransferase 74F2 [Brassica rapa]
 emb|CDX79798.1| BnaA05g03580D [Brassica napus]
Length=451

 Score =   501 bits (1291),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 253/446 (57%), Positives = 328/446 (74%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL SKGLKTTL +TTFI NS+KP  S  + I  ISDG 
Sbjct  8     GHVLAVPYPTQGHITPIRQFCKRLTSKGLKTTLTLTTFIFNSIKPDPSGPISIATISDGY  67

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  + S+ DYL  F+  GSKT+ D+I ++  SDSP+ C++YD+FMPWALDVA+  G
Sbjct  68    DLHGFDSSASIDDYLQDFKTFGSKTIGDIIRKHHTSDSPITCIVYDAFMPWALDVAREFG  127

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  HG L+LP+         LP LEL+D+PSF  V GSYP
Sbjct  128   LAASVFFTQSCAVNYVYYLSYVNHGSLKLPIQE-------LPFLELQDLPSFFSVSGSYP  180

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N EKAD V VN+F +L+    + +SK+ PV+ IGP+VPS+YLD R+K+D
Sbjct  181   AYFEMVLQQFTNFEKADFVLVNTFQELDLHEKELLSKVCPVLTIGPSVPSMYLDQRIKSD  240

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+   D +    WL+T+P+GSV+YVAFGSMA ++  QMEELA    N +  FLW
Sbjct  241   TDYDLNLFDSKDSSFCTSWLDTRPQGSVVYVAFGSMAKLNSVQMEELASAISNFS--FLW  298

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR+SE   +P  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  299   VVRESEEATMPSGFLETVDKDKSLVLKWSPQLEVLSNKAIGCFLTHCGWNSTMEALTFGV  358

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G RV++ E+ G+V R EI+  ++EV+EG   KEMKE
Sbjct  359   PMVAMPQWTDQPMNAKYIQDVWKAGVRVKMDEESGIVKREEIDFSIKEVMEGEKSKEMKE  418

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  419   NAKKWRDLAVKSLSEGGSTDVNIDTF  444



>gb|KFK37204.1| hypothetical protein AALP_AA4G227700 [Arabis alpina]
Length=449

 Score =   501 bits (1290),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 251/446 (56%), Positives = 330/446 (74%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI+P+ QFCKRL SKGLKTTLA+TTF+ NS+KP  S  + ID ISDG 
Sbjct  6     GHVLAVPYPTQGHISPVRQFCKRLDSKGLKTTLALTTFVFNSIKPDPSGPISIDTISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A S+ +YL  F+  GSKT+A++I++++ SD P+ C++YD+F PW LD+AK  G
Sbjct  66    DQDGFESAGSIHEYLQNFKTFGSKTIANIIQKHQTSDKPITCIVYDAFCPWVLDIAKEFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  HG L+LP       I  +  LEL+D+PSF+YV GSYP
Sbjct  126   LAAAPFFTQSCAVNYVYYLSYMNHGNLKLP-------IEDMSFLELQDLPSFLYVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VN+F +LE    + +SK+ PV+ IGPT+PS++LD R+K+D
Sbjct  179   AYFEMVLQQFINFEKADYVLVNTFEELELHEKELLSKVCPVLTIGPTIPSMFLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             +EY +NL+   D T   DWL+ KP+GSV+YVAFGS+A ++  QMEELA    N +  FLW
Sbjct  239   TEYDMNLFDSKDATFCTDWLDAKPQGSVVYVAFGSLAQLNIVQMEELASAVSNFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRSSEEAKLPSGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G  V+   E+G+  R EIE  ++EV+EG   K++K+
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKAGVCVKTEKENGIAKRDEIEFSIKEVMEGEKSKDIKK  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  417   NAKKWRDLAIKSLSEGGSTDINIDAF  442



>ref|XP_002310479.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE90929.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   501 bits (1289),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 246/443 (56%), Positives = 325/443 (73%), Gaps = 8/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDG  1281
             +H++ +P P  GHINPMLQF +RLVSKGLK T  IT FIS S +  S   ++ +D ISDG
Sbjct  8     SHVLVVPLPGAGHINPMLQFSRRLVSKGLKVTFVITEFISKSRQLGSSIGSIQLDTISDG  67

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD GF QA S   YL+     G KTL+DLI+RY+ S  P+  VIY+ F+ WALDVAK  
Sbjct  68    YDD-GFNQAGSREPYLSSLHDVGPKTLSDLIKRYQTSSIPIHAVIYEPFLAWALDVAKDF  126

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDM-PSFIYVHGSYP  924
             GLFA  FFT ACAV+Y++Y  +H +L++PV+S PV I GLP L      P+F+ +  SYP
Sbjct  127   GLFAAAFFTHACAVDYIFYNVYHEVLRVPVSSTPVLIEGLPLLLELQDLPTFVVLPDSYP  186

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             A  ++ + QF N++KAD + +N+FYKLE +VVDTMSK+ P++ IGPT+PS+YLD  ++++
Sbjct  187   ANVKMTMSQFANLDKADWILINTFYKLECEVVDTMSKVCPLLTIGPTIPSIYLDKSIEDE  246

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YGI+L  +D + SI+WL++KP  SV+YV+FGS A++  KQMEE+AWG K +N +FLWV
Sbjct  247   DDYGISLCEIDASLSINWLSSKPTASVVYVSFGSCATLSSKQMEEIAWGLKRSNFHFLWV  306

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             V DSE  K+PE F+ + ++K L+VNWSPQ+KVLA++AVGCFFTH GWNSTIEALSLGVPM
Sbjct  307   VMDSEKGKIPEGFVEEVENKGLVVNWSPQVKVLANEAVGCFFTHCGWNSTIEALSLGVPM  366

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             V MP W+DQ  N+KL+ D WKVG R +V E G+V R EI  C++EV+E   G+EMK N+ 
Sbjct  367   VTMPGWSDQQTNSKLVEDAWKVGVRAKVDEHGIVKREEIAICIKEVMEGDRGREMKMNSK  426

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LA EA SEGGTSD  I+E 
Sbjct  427   KWKELAIEAASEGGTSDTNINEL  449



>ref|XP_011047632.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Populus euphratica]
Length=457

 Score =   500 bits (1287),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/443 (55%), Positives = 323/443 (73%), Gaps = 8/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDG  1281
             +H++ +P P  GHINPMLQF +RLVSKGLK T  IT FIS S +  S   ++ +D ISDG
Sbjct  8     SHVLVVPLPGAGHINPMLQFSRRLVSKGLKVTFVITEFISKSRQLGSSIGSIQLDTISDG  67

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD GF Q  S   YL+     G KTL+DLI+RY+ S SP+  VIY+ F+ WALDVAK  
Sbjct  68    YDD-GFNQTGSWEPYLSSLHDVGPKTLSDLIKRYQTSSSPIHAVIYEPFLAWALDVAKDF  126

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDM-PSFIYVHGSYP  924
             GLFA  FFT ACAV+Y++Y  +H +L++PV+S PV I GLP L      P+F+ +  SYP
Sbjct  127   GLFAAAFFTHACAVDYIFYSVYHEVLKVPVSSTPVLIEGLPLLLELQDLPTFVVLPDSYP  186

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             A  ++ + QF N++KAD + +N++YKLE +VVD MSK+ P++ IGPT+PS+YLD  +++D
Sbjct  187   ANVKMTMSQFANMDKADLILINTYYKLECEVVDRMSKVCPLLTIGPTIPSIYLDKSIEDD  246

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YGI+L  +D + SI+WL+TKP  SV+YV+FGS A++  KQMEE+AWG K +N +FLWV
Sbjct  247   DDYGISLSEIDASLSINWLSTKPTASVVYVSFGSCATLSSKQMEEIAWGLKRSNFHFLWV  306

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             V DSE  K+PE F+ + ++K L+VNWSPQ+KVLA++AVGCF TH GWNSTIEALSLGVPM
Sbjct  307   VMDSEKGKIPEGFVEEVENKGLLVNWSPQVKVLANEAVGCFLTHCGWNSTIEALSLGVPM  366

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             V MP W+DQ  N+KL+ D WKVG R +V E G+V R EI  C++EV+E   G+EMK N+ 
Sbjct  367   VTMPGWSDQQTNSKLVEDAWKVGVRAKVDEHGIVKREEIALCIKEVMEGDRGREMKMNSK  426

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LA EA SEGGTSD  I+E 
Sbjct  427   KWKELAIEATSEGGTSDTNINEL  449



>ref|XP_002532442.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29928.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score =   499 bits (1284),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 317/441 (72%), Gaps = 5/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
             AH V +PYPSQGHINPMLQF KRLVSKG+K TLA T  I+ SM    S  + I+ ISDG 
Sbjct  10    AHAVILPYPSQGHINPMLQFAKRLVSKGVKATLANTKAINKSMHSDPSCLIDIETISDGF  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G  QA S   YL+  +V G+K+LA++I+R+K+SD PV  +IYD F+PWALDVAK  G
Sbjct  70    DEGGSAQAKSTEVYLSTLKVVGAKSLANVIKRFKDSDCPVTAIIYDGFLPWALDVAKQFG  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             + A  F TQACAVN  YY    G+L++P +SP V +PGLP L++ ++PSFI  + SYP +
Sbjct  130   ILAVAFLTQACAVNNAYYHVQRGLLRVPGSSPTVSLPGLPLLQVSELPSFISDYVSYPGF  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               L++ QF N++ AD V  N+FY+LE +VVD M+K   +  +GPT+PS YLD R++ D +
Sbjct  190   RNLLVDQFRNIDGADWVLCNTFYRLEEEVVDWMAKKWRLRTVGPTLPSKYLDKRLEYDKD  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YGINL+  D    ++WL TKP  SV+YV+FGS+A +  +QMEELA G K +N YFLWVVR
Sbjct  250   YGINLFKPDSGTCLNWLKTKPSRSVVYVSFGSVAELGTEQMEELALGLKGSNCYFLWVVR  309

Query  557   DSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              S   KLPENF+ +   K L V+W PQL+VLA++A+GCF TH G+NS +EALSLGVP+VA
Sbjct  310   TSGWSKLPENFIEETYGKGLAVSWCPQLEVLANEAIGCFVTHCGFNSVLEALSLGVPIVA  369

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             MPQW DQ  NAK + DVWKVG R R  E G+V R  +E C+REV+E   GKE+KENA KW
Sbjct  370   MPQWADQPTNAKYVEDVWKVGIRARPNEKGIVRRETVELCIREVMEGQKGKEIKENANKW  429

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
              +LAKEA+ E GTSDK IDE 
Sbjct  430   KNLAKEAIDESGTSDKNIDEL  450



>ref|XP_006478567.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Citrus sinensis]
Length=429

 Score =   496 bits (1277),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 242/436 (56%), Positives = 313/436 (72%), Gaps = 31/436 (7%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPV--SDAVGIDIISDG  1281
             AH++ +PYPSQGHINP  QF KRL S+GLK TLA+T FI  S KP   S +V I  ISDG
Sbjct  8     AHVLIVPYPSQGHINPTFQFAKRLASRGLKITLALTNFIYKSTKPSQPSSSVQIGTISDG  67

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD    +A+S+  +    + AGSKTLA+LI +YK++ +P+DCV+YD+F+ WALDVAK  
Sbjct  68    YDDGDLTKAESIHAFFQNMEAAGSKTLAELITKYKSTSNPIDCVVYDAFLYWALDVAKGF  127

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GLFA   FTQ CAVN++YY  HHG+L+LPV S  V IPGLP LEL+DMPSFI V G Y A
Sbjct  128   GLFAAACFTQTCAVNFIYYLVHHGLLKLPVPSTTVSIPGLPLLELQDMPSFIGVQGQYSA  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YFE+VL+QF N ++AD +FVN+FY+LE++V D+M+K  P++ IGPT+PS YLD+R++ND+
Sbjct  188   YFEMVLNQFSNADRADLLFVNTFYELESEVADSMAKFCPMLTIGPTIPSFYLDSRIQNDN  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              Y +NL+ +D +  I+WLN KPE SV+YVAFGS+A +  KQ+EELAWG K ++ YFLWV+
Sbjct  248   GYDLNLFTLDKSICINWLNKKPERSVVYVAFGSLACLANKQVEELAWGLKKSSFYFLWVI  307

Query  560   RDS-ELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             RD+ E  KLP+ F+ +  DK LIVNWSPQ++VL++KA+GCF TH GWNS IEALSL    
Sbjct  308   RDTEETNKLPKGFVDEIGDKGLIVNWSPQIEVLSNKALGCFLTHAGWNSIIEALSL----  363

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
                                 +VG RV V  DG+V R +IE C+REV+E   G+EMK NA 
Sbjct  364   --------------------EVGVRVGVDGDGIVKRDDIESCIREVMESESGREMKMNAK  403

Query  215   KWSHLAKEAVSEGGTS  168
             KW  LA EAVSE G +
Sbjct  404   KWRDLAIEAVSEEGIA  419



>gb|AFJ52957.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
 gb|AGD95008.1| UDP-glucosyltransferase [Linum usitatissimum]
Length=475

 Score =   498 bits (1281),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 246/448 (55%), Positives = 322/448 (72%), Gaps = 13/448 (3%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK--PVSDAVGIDIISDGC  1278
             H++ +PYP QGHINPM +F +RLVS+G++ TL  T FISNS+K  P    V  D+ISDG 
Sbjct  10    HVILLPYPGQGHINPMTEFARRLVSRGIRATLVTTVFISNSLKLGPTIGHVHHDVISDGF  69

Query  1277  DDAG-FLQADSVPDYLNRFQVAGSKTLADLIERYKNS--DSPVDCVIYDSFMPWALDVAK  1107
             DD+G + +  ++P+YL + +  GS++L++LIE+YK++    PVDCV+Y+ F+PWALDVAK
Sbjct  70    DDSGRYGKGRTLPEYLEKAKEVGSRSLSELIEKYKSAPFGQPVDCVVYEPFLPWALDVAK  129

Query  1106  SHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
              HGL+A  FFTQ CAV+YVYY    G L LPV   PV IPGLP +E  D PSF+    S 
Sbjct  130   EHGLYAAPFFTQPCAVDYVYYNVWAGSLGLPVDGWPVEIPGLPVMEAADAPSFLVDPVSS  189

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNR--V  753
               +  L+++QF N E+ADC  +N+FY+LE +VVDT SK+ P++PIGPT+PS YL  +  +
Sbjct  190   KDFLGLLVNQFSNAERADCFLINTFYELEKEVVDTFSKICPILPIGPTIPSNYLTTKPSM  249

Query  752   KNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYF  573
               + +YG++L+  D +  I WL+ KP  SVIYVAFGS AS+   QMEELA G K T  YF
Sbjct  250   TENGKYGLDLFEHDESIPIKWLSNKPLSSVIYVAFGSRASLTHTQMEELALGLKQTAHYF  309

Query  572   LWVVRDSELPKLPENFL---GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALS  402
             LWVVR++E  KLP+ FL   G+D+K L+V WSPQLK+LA+KA+GCF TH GWNSTIEALS
Sbjct  310   LWVVRETEQAKLPKQFLKSSGNDNKGLVVKWSPQLKILANKAIGCFLTHCGWNSTIEALS  369

Query  401   LGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGE-DGVVSRGEIEGCVREVLEGK--EM  231
             LGVPMVAMP W+DQ  NA  +  VWKVG RVRV E +GVV R EIE C+REV++G    M
Sbjct  370   LGVPMVAMPIWSDQPANASFVEKVWKVGVRVRVSEKNGVVGRDEIERCIREVMDGTGMAM  429

Query  230   KENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             K+NA KW     +AV +GG+S + ID+F
Sbjct  430   KKNATKWREAVVKAVGKGGSSFRNIDDF  457



>ref|XP_006397555.1| hypothetical protein EUTSA_v10001440mg [Eutrema salsugineum]
 gb|ESQ39008.1| hypothetical protein EUTSA_v10001440mg [Eutrema salsugineum]
Length=449

 Score =   496 bits (1276),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 249/446 (56%), Positives = 320/446 (72%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL SKGLKTTL +T FI NS+KP  S  + I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRLHSKGLKTTLTLTNFIFNSIKPDPSGPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  + S+ +YL  F+  GSKT+AD+I +++ SD+P+  ++YD+FMPWALDVA+  G
Sbjct  66    DLHGFDSSGSIHNYLQNFKTFGSKTIADVIRKHQTSDNPITSIVYDAFMPWALDVARDFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  +G L LP       I  LP LEL+D+PSF  V GSYP
Sbjct  126   LAAAPFFTQSCAVNYVYYLSYINNGSLNLP-------IGDLPFLELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N EKAD V VN+F  LE    + +SK  PV+ +GP+VPS+YLD R+K+D
Sbjct  179   AYFEMVLQQFTNFEKADFVLVNTFQDLELHENELLSKFCPVLTVGPSVPSMYLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y + L+   D      WL+T+P+GSV+YVAFGSMA +D  QMEELA      +  FLW
Sbjct  239   TDYDLTLFDSKDAAFCTSWLDTRPQGSVVYVAFGSMARLDNVQMEELASAVSKFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVRDSE  KLP  F+   D DK+L++ WSPQL+VL +KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRDSEEAKLPSGFIETVDKDKSLVLKWSPQLEVLTNKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVG-EDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G RV+   E G+V R +IE  ++EV+EG   +EMK 
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKAGVRVKTDKESGIVKREDIEFSIKEVMEGEKSEEMKT  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW +LA +++SEGG++D  ID F
Sbjct  417   NAKKWRNLAVKSLSEGGSTDINIDTF  442



>emb|CDX83455.1| BnaA03g20510D [Brassica napus]
Length=449

 Score =   495 bits (1274),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 250/446 (56%), Positives = 327/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL+S+GLKTTL +TTFI NS+KP  S  V I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRLISRGLKTTLTLTTFIFNSIKPDASGPVPIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD GF  + S+ DYL  F+  GSKT+AD+I +++ SD+P+ C++YD+FMPWALDVA+  G
Sbjct  66    DDHGFNPSGSIHDYLQNFKTFGSKTIADIIRKHQTSDNPITCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVN+VYY ++   GIL+LPV         LP LEL+D+PSF+ V GSYP
Sbjct  126   LAATPFFTQSCAVNFVYYLSYINEGILKLPVVD-------LPFLELQDLPSFLSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYF++VL QF N EKAD + VN+F +LE    + ++K+  V+ +GPT+PS+YLD R+K+D
Sbjct  179   AYFDMVLQQFTNFEKADFILVNTFQELEPHEKELLAKVCHVLTVGPTIPSMYLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +N++   D      WL+T+P+GSV+YVAFGS+A ++  QMEELA    N N  FLW
Sbjct  239   TAYDLNIFDSKDAAFCTSWLDTRPQGSVVYVAFGSLAELNNAQMEELASAVSNFN--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRGSEEAKLPSGFLETVDKDKGLVLKWSPQLEVLSNKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G  V++  E G+  RGEIE  ++EV+EG   +EMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKAGVCVKIDNESGIAKRGEIEFSIKEVMEGEKSEEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  417   NAKKWRVLAVKSLSEGGSTDVNIDTF  442



>ref|XP_006296149.1| hypothetical protein CARUB_v10025301mg [Capsella rubella]
 gb|EOA29047.1| hypothetical protein CARUB_v10025301mg [Capsella rubella]
Length=449

 Score =   494 bits (1271),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 323/446 (72%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL SKG KTT  +TTFI N++    S  + +  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISVATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SVP+YL  F+  GSKT+AD+I +++NSD+P+ C++YDSFMPWALD+A+  G
Sbjct  66    DHGGFSSAGSVPEYLQNFKTFGSKTVADVIRKHQNSDNPITCIVYDSFMPWALDLAREFG  125

Query  1097  LFAGCFFTQACAVNYVYY--CAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYV Y  C ++G L LP       I  LP LEL+D+P+F+    S+ 
Sbjct  126   LVAAPFFTQSCAVNYVNYLSCRNNGSLTLP-------IEDLPLLELQDLPTFVTPTASHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N + AD + VNSF++L+    + +SK+ PV+ IGPTVPS+YLD +VK+D
Sbjct  179   AYFEMVLQQFTNFQNADFILVNSFHELDHHEEELLSKVCPVLTIGPTVPSMYLDQQVKSD  238

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+ + +     +WL+++P+GSV+Y+AFGSMA +   QMEE+A    N +  +LW
Sbjct  239   NDYDLNLFDLKEAALCTEWLDSRPQGSVVYIAFGSMAKLSSAQMEEIALAIGNFS--YLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+LI+NWSPQL+VL+ KA+GCF TH GWNST+E LSLGV
Sbjct  297   VVRASEESKLPSGFLETVDKDKSLILNWSPQLQVLSHKAIGCFMTHCGWNSTMEGLSLGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KEMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKVGIRVKAEKESGIAKREEIEFSIKEVMEGEKSKEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  I+EF
Sbjct  417   NAEKWRDLAVKSLSEGGSTDININEF  442



>ref|XP_010506284.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Camelina sativa]
Length=453

 Score =   494 bits (1271),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 248/446 (56%), Positives = 316/446 (71%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A PYP+QGHI P+ QFCKRL  KGLKTTLA+TTF+ NS+KP  S  + I  ISDG 
Sbjct  6     GHVLAFPYPAQGHITPVRQFCKRLHYKGLKTTLALTTFVFNSIKPDQSGPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  ADS+ DYL  F+  GSKT+AD+I + + SD+P+ C++YD+FMPWALDVA+  G
Sbjct  66    DHGGFDTADSIHDYLQNFKTCGSKTVADIIRKNQTSDNPITCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  +G L+LP       I  LP LEL+D+PSF  V GSYP
Sbjct  126   LVATPFFTQSCAVNYVYYLSYLNNGCLELP-------IKELPFLELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VNSF +LE    +  SK   V+ IGPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFINFEKADFVLVNSFQELEIHEKELWSKACSVLTIGPTIPSIYLDQRIKSD  238

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +NL+   D     +WL+T+P+GSV+YVAFGSMA +   QMEELA    N +  FLW
Sbjct  239   TNYDLNLFESNDDVLCTNWLDTRPQGSVVYVAFGSMAQLTNVQMEELALAVSNFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL     D +L++ WSPQL+VL+ KA+GCF TH GWNST+EAL++GV
Sbjct  297   VVRSSEDAKLPSGFLEKVKKDTSLVLKWSPQLQVLSHKAIGCFLTHCGWNSTMEALTIGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVG-EDGVVSRGEIEGCVREVLEGK---EMKE  225
             PMV MPQWTDQ MNAK I DVWK G RV+   + G+  R EIE  ++E +EG+   EMK 
Sbjct  357   PMVTMPQWTDQPMNAKYIQDVWKAGVRVKTDKKSGIAKREEIEFSIKEAMEGERSVEMKR  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA ++++EGG++D  ID F
Sbjct  417   NVKKWRDLAVKSLNEGGSTDINIDTF  442



>ref|XP_010508370.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Camelina sativa]
Length=453

 Score =   493 bits (1270),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 247/446 (55%), Positives = 316/446 (71%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++AIPYP+QGHI P+ QFCKRL  KGLKTTLA+TTF+ NS+KP  S  + I  ISDG 
Sbjct  6     GHVLAIPYPTQGHITPVRQFCKRLHYKGLKTTLALTTFVFNSIKPDQSGPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  ADS+ DYL  F+  GSKT+AD+I +++ SD+P+ C++YD+FMPWALDVA+  G
Sbjct  66    DHGGFDTADSIHDYLQNFKTCGSKTVADIIRKHQTSDNPITCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYVYY ++  +G L+LP       I  LP  EL+D+PSF  V GSYP
Sbjct  126   LVASPFFTQPCAVNYVYYLSYLNNGSLELP-------IKELPFFELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VNSF +LE    +  SK   V+ IGPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFINFEKADFVLVNSFQELELHEKELWSKACRVLTIGPTIPSIYLDQRIKSD  238

Query  743   SEYGINLYH-MDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +NL+   D     +WL+T+P+GSV+YVAFGS+A +   QMEELA    N +  FLW
Sbjct  239   TNYDLNLFKSKDDFLCTNWLDTRPQGSVVYVAFGSLAQLTNVQMEELALAVSNFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   + D +L++ WSPQL+VL+ KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRSSEEAKLPSGFLETVNKDTSLVLKWSPQLQVLSHKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGE-DGVVSRGEIEGCVREVLEGK---EMKE  225
             PMV MPQWTDQ MNAK I DVWK G RV+  +  G+  R EIE  ++E +EG+   EMK 
Sbjct  357   PMVTMPQWTDQPMNAKYIQDVWKAGVRVKTDKLSGIAKREEIEFSIKEAMEGERSVEMKR  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA ++++EGG++D  ID F
Sbjct  417   NVKKWRDLAVKSLNEGGSTDINIDTF  442



>ref|XP_006295749.1| hypothetical protein CARUB_v10024869mg [Capsella rubella]
 gb|EOA28647.1| hypothetical protein CARUB_v10024869mg [Capsella rubella]
Length=448

 Score =   493 bits (1269),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 256/446 (57%), Positives = 326/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+ YP+QGHI P+ QFCKRL SKGLKTTL +TTFI NS+KP  SD V I  ISDG 
Sbjct  5     GHVLAVSYPTQGHITPIRQFCKRLHSKGLKTTLTLTTFIFNSIKPDPSDPVSIATISDGY  64

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SV DYL  F+  GSKT++D+I + + SD+P+ C++YD+FMPWALDVA+  G
Sbjct  65    DHGGFSSAASVHDYLRNFRTFGSKTVSDVICKLQGSDNPITCIVYDAFMPWALDVARDFG  124

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYVYY ++  +G L+LP       I  LP LEL+D+PSF+ V GSYP
Sbjct  125   LTAAPFFTQPCAVNYVYYLSYINNGSLKLP-------IEDLPFLELQDLPSFLSVSGSYP  177

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N EKAD + VNSF +LE    +  SK  PV+ +GPTVPS+YLD R+K+D
Sbjct  178   AYFEMVLQQFTNFEKADFLLVNSFQELELHEKELWSKACPVLTVGPTVPSMYLDQRIKSD  237

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+   D     +WL+T+P+GSV+YVAFGS+A ++  QMEELA   +N +  FLW
Sbjct  238   TDYDLNLFDSKDAAFCTNWLDTRPQGSVVYVAFGSVAHLNNVQMEELALAVRNFS--FLW  295

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL+LGV
Sbjct  296   VVRSSEEAKLPSGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTLGV  355

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVG-EDGVVSRGEIEGCVREVLEGK---EMKE  225
             PMVAMPQWTDQ MNAK I DVWK G RV+   E G+  R EIE  ++EV+EG+   EMK+
Sbjct  356   PMVAMPQWTDQPMNAKYIQDVWKAGVRVKTDKESGISKRTEIEFSIKEVMEGENSIEMKK  415

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  416   NAKKWRDLAVKSLSEGGSTDINIDTF  441



>ref|XP_010506287.1| PREDICTED: UDP-glycosyltransferase 74F1 isoform X1 [Camelina 
sativa]
 ref|XP_010506288.1| PREDICTED: UDP-glycosyltransferase 74F1 isoform X2 [Camelina 
sativa]
Length=449

 Score =   492 bits (1266),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 242/446 (54%), Positives = 323/446 (72%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL SKG KTT  +TTFI N++    S  + I  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SV +YL  F+  GSKT+AD+I +++N+D+P+ C++YDSFMPWALD+A+  G
Sbjct  66    DQGGFSSAGSVSEYLQNFKTFGSKTVADVIRKHQNTDNPITCIVYDSFMPWALDLAREFG  125

Query  1097  LFAGCFFTQACAVNYVYY--CAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNY+ Y  C ++G L LP       I  LP LEL+D+P+F+   GS+ 
Sbjct  126   LVAAPFFTQSCAVNYINYLSCTNNGSLTLP-------IKDLPLLELQDLPTFVTPTGSHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N +KAD V VNSF+ L+    + +SK+ PV+ IGPTVPS+YLD ++K+D
Sbjct  179   AYFEMVLQQFTNFQKADFVLVNSFHDLDLHEEELLSKVCPVLTIGPTVPSMYLDKQIKSD  238

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+ + +     +WL+++P+GSV+Y+AFGSMA +  +QM E+A    N +  +LW
Sbjct  239   NDYDLNLFDLKEAALCTEWLDSRPQGSVVYIAFGSMAKLSSEQMAEIALAVSNIS--YLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++NWSPQL+VL+ KA+GCF TH GWNST+E LSLGV
Sbjct  297   VVRASEESKLPTGFLETVDKDKSLVLNWSPQLQVLSHKAIGCFMTHCGWNSTMEGLSLGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KEM+E
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGIAKREEIELSIKEVMEGEKSKEMRE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KWS LA +++SEGG++D  I+ F
Sbjct  417   NAKKWSDLAVKSLSEGGSTDININAF  442



>ref|XP_010508369.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Camelina sativa]
Length=449

 Score =   491 bits (1263),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 323/446 (72%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL +KG KTT  +TTFI N++    S  + I  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLHAKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SVP+YL  F+  GSKT+AD+I +++N+D+P+ C++YDSFMPWALD+A+  G
Sbjct  66    DQGGFSSAGSVPEYLQNFKTFGSKTVADVIRKHQNTDNPITCIVYDSFMPWALDLAREFG  125

Query  1097  LFAGCFFTQACAVNYVYY--CAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNY+ Y  C ++G L LP       I  LP LEL+D+P+F+    S+ 
Sbjct  126   LVAAPFFTQSCAVNYINYLSCTNNGSLTLP-------IKDLPLLELQDLPTFVTPTASHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N +KAD V VNSF+ L+    + +SK+ PV+ IGPTVPS+YLD ++K+D
Sbjct  179   AYFEMVLQQFTNFQKADFVLVNSFHDLDLHEEELLSKVCPVLTIGPTVPSMYLDKQIKSD  238

Query  743   SEYGINLYHMDPTK-SIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+ ++      +WL+++P+GSV+Y+AFGSMA +  +QM E+A    N +  +LW
Sbjct  239   NDYDLNLFDLEEAALCTEWLDSRPQGSVVYIAFGSMAKLSSEQMAEIALAVSNIS--YLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++NWSPQL+VL+  A+GCF TH GWNST+E LSLGV
Sbjct  297   VVRASEESKLPTGFLETVDKDKSLVLNWSPQLQVLSHNAIGCFMTHCGWNSTMEGLSLGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I+DVWKVG RV+   E G+  R EIE  ++EV+EG   KEM+E
Sbjct  357   PMVAMPQWTDQPMNAKYILDVWKVGVRVKAEKESGIARREEIELSIKEVMEGEKSKEMRE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KWS LA +++SEGG++D  I+ F
Sbjct  417   NAKKWSDLAVKSLSEGGSTDININAF  442



>ref|XP_010517962.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Camelina sativa]
Length=453

 Score =   491 bits (1263),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 318/446 (71%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++AIPYP+QGHI P  QFCKRL  KGLKTTLA+TTF+ NS+KP  S  + I  ISDG 
Sbjct  6     GHVLAIPYPTQGHITPFRQFCKRLHYKGLKTTLALTTFVFNSIKPDQSGPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  ADS+ DYL  F+  GSKT+AD+I +++ SD+PV C++YD+FMPWALDVA+  G
Sbjct  66    DHGGFDTADSIHDYLQNFKTCGSKTVADIIRKHQTSDNPVTCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYVYY ++  +G L+LP+         LP  EL+D+PSF  V GSYP
Sbjct  126   LVATPFFTQPCAVNYVYYLSYLNNGSLELPIKE-------LPFFELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VNSF +LE    + +SK   V+ IGPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFINFEKADFVLVNSFQELEIHEKELLSKACRVLTIGPTIPSIYLDQRIKSD  238

Query  743   SEYGINLYH-MDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +NL+   D     +WL+T+P+GSV+YVAFGSMA +   QM+ELA    N +  FLW
Sbjct  239   TNYDLNLFESKDDFLCTNWLDTRPQGSVVYVAFGSMAQLTNVQMKELALAVSNFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   + +K+L++ WSPQL+VL+ KA GCF TH GWNST+EAL++GV
Sbjct  297   VVRSSEEAKLPPGFLETVNKEKSLVLKWSPQLQVLSHKATGCFLTHCGWNSTMEALTIGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRG-EIEGCVREVLEGK---EMKE  225
             PMV MPQWTDQ MNAK I DVW+ G RV+  + G +++  EIE  ++E +EG+   EMK 
Sbjct  357   PMVTMPQWTDQPMNAKYIQDVWEAGVRVKTDKKGGIAKSEEIEFSIKEAMEGERSVEMKR  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA ++++EGG++D  ID F
Sbjct  417   NVNKWRDLAVKSLNEGGSTDINIDTF  442



>emb|CDY64614.1| BnaAnng19440D [Brassica napus]
Length=449

 Score =   491 bits (1263),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 249/446 (56%), Positives = 326/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKR++SKGLKTTL +TTFI  S+KP  S  V I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRVISKGLKTTLTLTTFIFKSIKPDPSGPVPIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD GF  + S+ DYL  F+  GSKT+AD+I +++ SD+P+ C++YD+FMPWALDVA+  G
Sbjct  66    DDHGFDPSGSIHDYLQNFKTFGSKTIADIIRKHQTSDNPITCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVN+VYY ++   GIL+LPV         LP LEL+D+PSF+ V GSYP
Sbjct  126   LAATPFFTQSCAVNFVYYLSYINDGILKLPVVD-------LPFLELQDLPSFLSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYF++VL QF N EKAD + VN+F +LE    + ++K+  V+ +GPT+PS+YLD R+K+D
Sbjct  179   AYFDMVLQQFTNFEKADFILVNTFQELEPHEKELLAKVCHVLTVGPTIPSMYLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +N++   D      WL+T+P+GSV+YVAFGS+A ++  QMEELA    N N  FLW
Sbjct  239   TAYDLNIFDSKDAAFCTSWLDTRPQGSVVYVAFGSLAELNNAQMEELASAVSNFN--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRGSEEAKLPSGFLETVDKDKGLVLKWSPQLEVLSNKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G  V++  E G+  RGEIE  ++EV+EG   +EMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKAGVCVKIDNESGIAKRGEIEFSIKEVMEGEKSEEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  417   NAKKWRVLAVKSLSEGGSTDVNIDTF  442



>ref|NP_973682.1| UDP-glycosyltransferase 74 F1 [Arabidopsis thaliana]
 gb|AEC10332.1| UDP-glycosyltransferase 74 F1 [Arabidopsis thaliana]
Length=449

 Score =   490 bits (1262),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 324/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL SKG KTT  +TTFI N++    S  + I  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SVP+YL  F+  GSKT+AD+I +++++D+P+ C++YDSFMPWALD+A   G
Sbjct  66    DQGGFSSAGSVPEYLQNFKTFGSKTVADIIRKHQSTDNPITCIVYDSFMPWALDLAMDFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNY+ Y ++  +G L LP       I  LP LEL+D+P+F+   GS+ 
Sbjct  126   LAAAPFFTQSCAVNYINYLSYINNGSLTLP-------IKDLPLLELQDLPTFVTPTGSHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N +KAD V VNSF+ L+  V + +SK+ PV+ IGPTVPS+YLD ++K+D
Sbjct  179   AYFEMVLQQFTNFDKADFVLVNSFHDLDLHVKELLSKVCPVLTIGPTVPSMYLDQQIKSD  238

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+ + +     DWL+ +PEGSV+Y+AFGSMA +  +QMEE+A    N +  +LW
Sbjct  239   NDYDLNLFDLKEAALCTDWLDKRPEGSVVYIAFGSMAKLSSEQMEEIASAISNFS--YLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+E LSLGV
Sbjct  297   VVRASEESKLPPGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KEMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGICKREEIEFSIKEVMEGEKSKEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  I+EF
Sbjct  417   NAGKWRDLAVKSLSEGGSTDININEF  442



>ref|XP_009133637.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Brassica rapa]
Length=449

 Score =   490 bits (1262),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 251/446 (56%), Positives = 324/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL+SKGLKTTL +TTFI  S+KP  S  V I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRLISKGLKTTLTLTTFIFKSIKPDPSGPVPIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD GF  + S+ DYL  F+  GSKT+AD+I +++ SD+P+ C++YD+FMPWALDVA+  G
Sbjct  66    DDHGFDPSGSIHDYLQNFKTFGSKTIADIIRKHQTSDNPITCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVN+VYY ++   GIL+LPV         LP LEL+D+PSF+ V GSYP
Sbjct  126   LAATPFFTQSCAVNFVYYLSYINDGILKLPVVD-------LPFLELQDLPSFLSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N EKAD + VN+F +LE    + +S +  V+ IGPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFTNFEKADFILVNTFQELEPHEKELLSNVCHVLTIGPTIPSMYLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +N++   D      WL+T+P+GSV+YVAFGS+A ++  QMEELA    N N  FLW
Sbjct  239   TAYDLNIFDSKDAAFCTSWLDTRPQGSVVYVAFGSLAELNNAQMEELASAVSNFN--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK L++ WSPQL+VL++KA+ CF TH GWNST+EAL+ GV
Sbjct  297   VVRGSEEAKLPSGFLETVDKDKGLVLKWSPQLEVLSNKAICCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWK G  V++  E G+  RGEIE  ++EV+EG   +EMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKAGVCVKIDNESGIAKRGEIEFSIKEVMEGEKSEEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  417   NAKKWRDLAVKSLSEGGSTDVNIDTF  442



>gb|KFK37203.1| hypothetical protein AALP_AA4G227600 [Arabis alpina]
Length=449

 Score =   490 bits (1262),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 324/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P  QFCKRL SKGL TTLA+TTF+ NS+KP  S  + I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPFRQFCKRLDSKGLNTTLALTTFVFNSIKPDPSGPISITTISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  + S+ DYL  F+ +G+KT+AD+I +++ SD+P+ C++YD+F+PWALDVA+  G
Sbjct  66    DHHGFDSSGSIHDYLQNFKTSGTKTIADIIRKHQKSDNPITCIVYDAFIPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  +G L+LP+         LP LEL+D+PSF  V GSYP
Sbjct  126   LVAAPFFTQSCAVNYVYYLSYINNGTLKLPLED-------LPFLELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N   AD V VN+F +LE    + +SK+ PV+ IGP+VPS+YLD R+K+D
Sbjct  179   AYFEMVLQQFPNFGNADFVLVNTFQELELYEKELLSKVCPVLTIGPSVPSMYLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+   D    IDWL+T+P+GSV+YVAFGSMA +   Q  ELA+   N +  F+W
Sbjct  239   TDYDMNLFDSKDDAFCIDWLDTRPQGSVVYVAFGSMAKLSSVQFAELAFALSNFS--FMW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  F    D D +L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRSSEEAKLPLGFFETVDKDNSLVLQWSPQLEVLSNKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ  NAK I DVWK G RV++ E+ G+V R +IE  ++EV+EG   KEMK+
Sbjct  357   PMVAMPQWTDQPTNAKYIQDVWKAGVRVKIDEESGIVKREDIEFSIKEVMEGEKSKEMKK  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  417   NATKWRDLAVKSLSEGGSTDINIDAF  442



>ref|XP_008455265.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Cucumis melo]
Length=457

 Score =   490 bits (1262),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 233/442 (53%), Positives = 313/442 (71%), Gaps = 7/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV-GIDIISDGCD  1275
             H++ IPYP+QGH+NP++QF K L  KGL  T+A+TTFI N+ KP ++     D ISDG D
Sbjct  8     HVLVIPYPTQGHLNPLIQFSKFLSLKGLDVTVAVTTFIFNTFKPSTNVFFDWDTISDGFD  67

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF +A+S+ +YL R Q  G++TL DLI R + S  P+  V+YDSFMPWALDV K  G+
Sbjct  68    EGGFAEANSIDEYLVRIQTIGARTLTDLIHRRQGSSRPIHGVVYDSFMPWALDVVKDFGI  127

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
              A  FFTQ C+VN +YYC H G+L LP+      + GLP L + +MPSFI     YP YF
Sbjct  128   MAASFFTQPCSVNLIYYCFHEGLLSLPILDQEDSVAGLPPLRVEEMPSFISAPECYPNYF  187

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ELVL+Q+ N ++ D + VNS Y+ E +  D +SK+ P + IGPT+PS Y+D+ V +D +Y
Sbjct  188   ELVLNQWSNTKEVDWILVNSIYEFEPKEADELSKIGPTLTIGPTIPSFYVDSHVIDDKKY  247

Query  734   GINLYHMDPTK---SIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              ++L+ +DP +   +  WL+TKP+GSVIYV+FGSMA+++  QM ELA G   +N YF+WV
Sbjct  248   KLDLFKVDPEEASLTRMWLDTKPKGSVIYVSFGSMANLNITQMAELASGLLESNHYFIWV  307

Query  563   VRDSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +R+SE  KLP       +K LI++WS QL+VL+ +AVGCFF H GWNST+EAL LGVPMV
Sbjct  308   IRESEKAKLPXATSFAPEKGLILHWSSQLEVLSHEAVGCFFVHCGWNSTLEALCLGVPMV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
              MPQWTDQ  NAK + DVWKVG RV+VGEDG+V + EI+GC+R V+EG    E KENA+K
Sbjct  368   GMPQWTDQPTNAKYVEDVWKVGVRVKVGEDGIVRKEEIKGCIRRVMEGDGASEFKENALK  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  L  +A+ +GG+S K ID+F
Sbjct  428   WKQLGLKALGKGGSSMKNIDQF  449



>emb|CDY65158.1| BnaC03g72710D [Brassica napus]
Length=449

 Score =   489 bits (1260),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/446 (56%), Positives = 326/446 (73%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL+SKGLKTTL +TTFI NS+KP  S  V I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRLISKGLKTTLTLTTFIFNSIKPDPSGPVSIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD GF  + S+ DYL  F+  GSKT+AD+I +++ SD+P+ C++YD+FMPWALDVA+  G
Sbjct  66    DDHGFDPSGSIHDYLQNFKTFGSKTIADIIRKHQTSDNPITCIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVN+VYY ++   GIL+LPV         LP LEL+D+PSF+ V GSYP
Sbjct  126   LAATPFFTQSCAVNFVYYLSYINDGILKLPVVD-------LPFLELQDLPSFLSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N EKAD + VN+F +LE    + ++K+  V+ +GPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFTNFEKADFILVNTFQELEPHEKELLAKVCHVLTVGPTIPSMYLDQRIKSD  238

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +N++   D      WL+T+P+GSV+YVAFGS+A ++  QMEELA    N N  FLW
Sbjct  239   TAYDLNIFDSKDAAFCTSWLDTRPQGSVVYVAFGSLAELNNAQMEELASAVSNFN--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+E+L+ GV
Sbjct  297   VVRGSEEAKLPSGFLETVDKDKSLVLKWSPQLEVLSNKAIGCFLTHCGWNSTMESLTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             P+VAMPQWTDQ MNAK I DVWK G  V++  E G+  R EI   ++EV+EG   +EMKE
Sbjct  357   PLVAMPQWTDQPMNAKYIQDVWKAGVCVKIDNESGIAKREEIYFSIKEVMEGEKSEEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  417   NAKKWRDLAVKSLSEGGSTDVNIDTF  442



>ref|XP_007049534.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93691.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   489 bits (1260),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 320/442 (72%), Gaps = 7/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDI--ISDG  1281
             AH++ +PY +QGHINPMLQF KRLVSKGLK TL  +TFIS SM  V     IDI  ISDG
Sbjct  12    AHVLILPYTAQGHINPMLQFAKRLVSKGLKATLVTSTFISKSML-VDPNTPIDIQSISDG  70

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ GF QA+S  DYL  FQ  GS +LA L+++      PV  +IYD F+PWALDVAK  
Sbjct  71    FDEGGFAQAESSEDYLTTFQKVGSPSLATLMKKLGEIGRPVHALIYDPFLPWALDVAKQF  130

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+    FFTQ+CAVN +YY  H G+LQLP++   V +PGLP L + ++PS++ ++GSYPA
Sbjct  131   GVAGVAFFTQSCAVNSIYYHVHKGLLQLPLSVSNVSLPGLPELNVSELPSYVSLYGSYPA  190

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             +F++V++QF N++  D V  ++FY+LE QVVD MSK+  +  IGPT+PS+YLD R+++D 
Sbjct  191   FFDMVVNQFSNLDLVDWVLFDNFYELETQVVDWMSKLWKLGTIGPTLPSMYLDKRIEDDK  250

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG+NL+  D    + WLN KP+GSV+Y +FGSMA VD +QM E+AWG K ++ YFLWVV
Sbjct  251   DYGVNLFKPDTGTCMSWLNGKPKGSVVYASFGSMAEVDVEQMREIAWGLKGSSCYFLWVV  310

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP  F+ +  +K L+V W  QL+VL+ ++VGCF TH G NS +EA+ LG+PMV
Sbjct  311   RESEEAKLPTKFMEETSEKGLVVRWCSQLEVLSHESVGCFLTHCGLNSVMEAMCLGIPMV  370

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             A+PQWTDQ  NAK + D+W+VG + +  E G+V    IE  V+E++E   GKE+K+NA K
Sbjct  371   AVPQWTDQITNAKFVEDIWEVGIKAQPDEKGIVKSQAIELSVKEIMEGEKGKEIKKNANK  430

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W +LA+EA+ EGG+SDK I++F
Sbjct  431   WKNLAREAIDEGGSSDKHINQF  452



>ref|XP_006397556.1| hypothetical protein EUTSA_v10001441mg [Eutrema salsugineum]
 gb|ESQ39009.1| hypothetical protein EUTSA_v10001441mg [Eutrema salsugineum]
Length=449

 Score =   489 bits (1259),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 244/446 (55%), Positives = 323/446 (72%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL SKG KTT  +T FI N++    S  V +  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLQSKGFKTTHTLTAFIFNTIHLDPSSPVSVATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SVP+YL  F+  GSKT+AD+I +++ SD P+ C++YDSFMPWALD+A+  G
Sbjct  66    DHGGFSSAASVPEYLQNFKTFGSKTVADVIRKHQTSDDPITCIVYDSFMPWALDLAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+C VNY  Y A+  +G ++LP       I  LP LEL+D+P+F+   GS+ 
Sbjct  126   LAAAPFFTQSCGVNYYNYLAYMNNGSVKLP-------IEDLPFLELQDLPTFVTPTGSHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYF++VL QF N +KAD V VN+F +L+    + +SK+ PV+ IGPTVPS+YLD ++K+D
Sbjct  179   AYFKMVLQQFTNFDKADFVLVNTFQELDPHEEELLSKVCPVLTIGPTVPSMYLDQQIKSD  238

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+ + +     DWL+TKP+GSV+Y+AFGSMA +   QMEE+A G +N +  +LW
Sbjct  239   TDYDLNLFDLKEAALCADWLDTKPQGSVVYIAFGSMAQLSSVQMEEIASGIRNFS--YLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EALSLGV
Sbjct  297   VVRASEESKLPSGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEALSLGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWKVG RV+  +D G+  R EIE  ++EV+EG   KEMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKDTGIAKREEIELSIKEVMEGEKSKEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGGT+D  I+ F
Sbjct  417   NAKKWRDLAVKSLSEGGTTDININTF  442



>ref|XP_010506285.1| PREDICTED: UDP-glycosyltransferase 74F2 [Camelina sativa]
 ref|XP_010506286.1| PREDICTED: UDP-glycosyltransferase 74F2 [Camelina sativa]
Length=453

 Score =   489 bits (1259),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 246/446 (55%), Positives = 313/446 (70%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++AIPYP+QGHI P  QFCKRL  KGLKTTLA+TTF+ NS+KP  S  + I  ISDG 
Sbjct  6     GHVLAIPYPTQGHITPFRQFCKRLHYKGLKTTLALTTFVFNSIKPDQSGPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  ADS+ DYL  F+  GSKT+AD+I +++ SD+P+  ++YD+FMPWALDVA+  G
Sbjct  66    DHGGFDTADSIHDYLQNFKTCGSKTVADIIRKHQTSDNPITSIVYDAFMPWALDVAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYVYY ++  +G L+LP+         LP  EL+D+PSF  V GSYP
Sbjct  126   LVATPFFTQPCAVNYVYYLSYLNNGSLELPIKE-------LPFFELQDLPSFFSVSGSYP  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF+N EKAD V VNSF +LE    +  SK   V+ IGPT+PS+YLD R+K+D
Sbjct  179   AYFEMVLQQFINFEKADFVLVNSFQELELHEKELWSKACSVLTIGPTIPSIYLDQRIKSD  238

Query  743   SEYGINLYH-MDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
               Y +NL+   D     +WL+T+P+GSV+YVAFGSMA +   QMEELA    N +  FLW
Sbjct  239   INYDLNLFESKDDFLCTNWLDTRPQGSVVYVAFGSMAQLTNVQMEELALAVSNFS--FLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   + D +L++ WSPQL++L+ KA+GCF TH GWNST+EAL+ GV
Sbjct  297   VVRSSEEAKLPSGFLETVNKDTSLVLKWSPQLQILSHKAIGCFLTHCGWNSTMEALTFGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVG-EDGVVSRGEIEGCVREVLEGK---EMKE  225
             PMVAMPQWTDQ MNAK I DVWK G RV    + G+  R EIE  ++E +EG+   EMK 
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKAGVRVNTDKKSGISKREEIEFSIKEAMEGERSVEMKR  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA ++++EGG++D  ID F
Sbjct  417   NVKKWRDLAVKSLNEGGSTDINIDTF  442



>ref|NP_181912.1| UDP-glycosyltransferase 74 F1 [Arabidopsis thaliana]
 sp|O22820.1|U74F1_ARATH RecName: Full=UDP-glycosyltransferase 74F1; AltName: Full=Flavonol 
7-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAB64022.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEC10333.1| UDP-glycosyltransferase 74 F1 [Arabidopsis thaliana]
 gb|AHL38794.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   488 bits (1256),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 244/446 (55%), Positives = 323/446 (72%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL SKG KTT  +TTFI N++    S  + I  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SVP+YL  F+  GSKT+AD+I +++++D+P+ C++YDSFMPWALD+A   G
Sbjct  66    DQGGFSSAGSVPEYLQNFKTFGSKTVADIIRKHQSTDNPITCIVYDSFMPWALDLAMDFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNY+ Y ++  +G L LP       I  LP LEL+D+P+F+   GS+ 
Sbjct  126   LAAAPFFTQSCAVNYINYLSYINNGSLTLP-------IKDLPLLELQDLPTFVTPTGSHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N +KAD V VNSF+ L+    + +SK+ PV+ IGPTVPS+YLD ++K+D
Sbjct  179   AYFEMVLQQFTNFDKADFVLVNSFHDLDLHEEELLSKVCPVLTIGPTVPSMYLDQQIKSD  238

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+ + +     DWL+ +PEGSV+Y+AFGSMA +  +QMEE+A    N +  +LW
Sbjct  239   NDYDLNLFDLKEAALCTDWLDKRPEGSVVYIAFGSMAKLSSEQMEEIASAISNFS--YLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+E LSLGV
Sbjct  297   VVRASEESKLPPGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KEMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGICKREEIEFSIKEVMEGEKSKEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  I+EF
Sbjct  417   NAGKWRDLAVKSLSEGGSTDININEF  442



>ref|XP_006469356.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ACS87993.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=468

 Score =   488 bits (1257),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 317/444 (71%), Gaps = 9/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK----PVSDAVGIDIISD  1284
             H + + YP+QGHINP+LQF KRL  KGLK TL  T FIS S+       S ++ ++ ISD
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLDHKGLKVTLVTTCFISKSLHRDSSSSSTSIALEAISD  74

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ G  QA+S+  YL +F   G ++L +L+E    S  PVDC++YDSF+PWALDVAK 
Sbjct  75    GYDEGGSAQAESIEAYLEKFWQIGPRSLCELVEEMNGSGVPVDCIVYDSFLPWALDVAKK  134

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GL    F TQ+CAV+ +YY  + G+L LP+    + +PG+P LE  DMPSF+Y  GSYP
Sbjct  135   FGLVGAAFLTQSCAVDCIYYHVNKGLLMLPLPDSQLLLPGMPPLEPHDMPSFVYDLGSYP  194

Query  923   AYFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             A  ++V+ +QF N++KAD V  N+FY+LE +V + + K+  +  IGPTVPSLYLD ++++
Sbjct  195   AVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTIGPTVPSLYLDKQLED  254

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D +YG +++  +    I WLN + +GSV+YV+FGS A +  ++MEELAWG K TN YFLW
Sbjct  255   DKDYGFSMFKPNNESCIKWLNDRAKGSVVYVSFGSYAQLKVEEMEELAWGLKATNQYFLW  314

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALSLGVP
Sbjct  315   VVRESEQAKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVP  374

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVAMPQW+DQ+ NAK I+DVWK G +V   E G+V R  I  C+RE+LE   GKE+++NA
Sbjct  375   MVAMPQWSDQSTNAKYIMDVWKTGLKVPADEKGIVRREAIAHCIREILEGERGKEIRQNA  434

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              +WS+ AKEAV++GG+SDK ID+F
Sbjct  435   GEWSNFAKEAVAKGGSSDKNIDDF  458



>ref|XP_006447932.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
 gb|ESR61172.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
Length=468

 Score =   488 bits (1256),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 317/444 (71%), Gaps = 9/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK----PVSDAVGIDIISD  1284
             H + + YP+QGHINP+LQF KRL  KGLK TL  T FIS S+       S ++ ++ ISD
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLDHKGLKVTLVTTYFISKSLHRDSSSSSTSIALEAISD  74

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ G  QA+S+  YL +F   G ++L +L+E    S  PVDC++YDSF+PWALDVAK 
Sbjct  75    GYDEGGSAQAESIEAYLEKFWQIGPRSLCELVEEMNGSGFPVDCIVYDSFLPWALDVAKK  134

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GL    F TQ+CAV+ +YY  + G+L LP+    + +PG+P LE  DMPSF+Y  GSYP
Sbjct  135   FGLVGAAFLTQSCAVDCIYYHVNKGLLMLPLPDSQLLLPGMPPLEPHDMPSFVYDLGSYP  194

Query  923   AYFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             A  ++V+ +QF N++KAD V  N+FY+LE +V + + K+  +  IGPTVPSLYLD ++++
Sbjct  195   AVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTIGPTVPSLYLDKQLED  254

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D +YG +++  +    I WLN + +GSV+YV+FGS A +  ++MEELAWG K TN YFLW
Sbjct  255   DKDYGFSMFKPNNESCIKWLNDRAKGSVVYVSFGSYAQLKVEEMEELAWGLKATNQYFLW  314

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALSLGVP
Sbjct  315   VVRESEQAKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVP  374

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVAMPQW+DQ+ NAK I+DVWK G +V   E G+V R  I  C+RE+LE   GKE+++NA
Sbjct  375   MVAMPQWSDQSTNAKYIMDVWKTGLKVPADEKGIVRREAIAHCIREILEGERGKEIRQNA  434

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              +WS+ AKEAV++GG+SDK ID+F
Sbjct  435   GEWSNFAKEAVAKGGSSDKNIDDF  458



>ref|XP_007049526.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93683.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   487 bits (1254),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 324/444 (73%), Gaps = 9/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM--KPVSDAVGIDIISDG  1281
             AH++  PYP+QGHINPMLQF KRLVSKG+K TL  T F+S +    P S ++ +  ISDG
Sbjct  10    AHVLIFPYPAQGHINPMLQFAKRLVSKGVKATLVSTVFLSKTTFSDPTS-SIDMQTISDG  68

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G+ QA S   YL  F   GSK+LA LI++  ++  P+D ++YD+F+ +ALDVAK  
Sbjct  69    FDEGGYNQAGSPDVYLPTFWSVGSKSLASLIKKLVDAGHPIDAIVYDAFLDFALDVAKQF  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+    FFTQACAVN VYY    G+LQLP+  P V +PGLP LE+ ++PSF+  HGSYPA
Sbjct  129   GIRTAAFFTQACAVNSVYYHVSRGLLQLPLPEPKVSLPGLPPLEVSELPSFVCHHGSYPA  188

Query  920   YFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             +F++V+ HQF N+ +AD VF+N FY LE + VD MS+   V+ IGPT+PS+YLD R++ND
Sbjct  189   WFDVVVNHQFSNINEADWVFLNIFYDLEKEAVDWMSQFWNVMTIGPTIPSMYLDKRLEND  248

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
               YG++L+    +  + WL+ KP+ SV+YV+FGSMA +D +QM E+AWG K +N YF+WV
Sbjct  249   KHYGMHLFKPKTSTCMSWLSGKPKSSVVYVSFGSMAELDVEQMAEIAWGLKGSNCYFMWV  308

Query  563   VRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLP+NF+ +  +K L+V+W PQL+VL+ +++GCF TH G+NS +EALSLGVP+
Sbjct  309   VRESEEAKLPQNFIEETAEKGLVVSWCPQLEVLSHESIGCFLTHCGFNSVLEALSLGVPL  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLE---GKEMKENA  219
             +AMPQWTDQ  NAK + DVW++G R R  E+ G V+R  +E C++E+ E   GKE ++NA
Sbjct  369   LAMPQWTDQGTNAKYVEDVWEIGMRARPDEENGFVTREIVEHCIKELTEGEKGKEARKNA  428

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW +LA++AV EGG SDK IDEF
Sbjct  429   SKWKNLARKAVDEGGRSDKNIDEF  452



>emb|CAN70002.1| hypothetical protein VITISV_033171 [Vitis vinifera]
Length=459

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 313/443 (71%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +P+PSQGHINPMLQF KRLV  G K TL  T FIS S+   S  + I+ ISDG D
Sbjct  10    AHCIVLPFPSQGHINPMLQFSKRLVHNGAKVTLVATHFISKSLLGDSGPIAIETISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLAD-LIERYKNSDS-PVDCVIYDSFMPWALDVAKSH  1101
             D GF QA S   YL RFQV G +      IE+ K+    PVDCV+YD+F+PWALDVAK  
Sbjct  70    DGGFAQAGSGGTYLERFQVVGFRNXGSAFIEKLKSLQGVPVDCVVYDAFLPWALDVAKKL  129

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    FFTQ+C VN +YY  H G+L+LP + P V +PGL  L+  D+PS +Y++GSYP 
Sbjct  130   GLVGAVFFTQSCTVNNIYYHVHQGMLKLPHSEPEVVVPGLFPLQACDLPSLVYLYGSYPD  189

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDT-MSKMSPVIPIGPTVPSLYLDNRVKND  744
             +F ++++QF N+EK D VF N+FYKLE +VV+  M+K+ P+  IGPT+PS YL+ R+ +D
Sbjct  190   FFNMLVNQFSNIEKVDWVFYNTFYKLEEKVVEYWMAKICPLRTIGPTLPSAYLNKRLGDD  249

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG+N+        ++WL+ KP GSV+Y ++GS A ++ +QMEE+AWG + +N YFL V
Sbjct  250   KDYGLNMLKPVTGACMEWLDGKPNGSVVYASYGSFAVLEPEQMEEVAWGLRRSNAYFLMV  309

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLP+NF G+ ++K L+V+W  QL+VLA +A+GCF THGGWNST+EALSLGVPM
Sbjct  310   VRESEQAKLPQNFKGETEEKGLVVSWCQQLEVLAHRAIGCFLTHGGWNSTLEALSLGVPM  369

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAM  216
             V  P +TDQ  NAK + DVW +G R R  + G+V R  +E C+ EV+     K ++ NAM
Sbjct  370   VVAPLFTDQPTNAKFVEDVWGIGLRARADDKGIVRREVLEHCIGEVMGSDGLKGIRSNAM  429

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW +LA+EAV EGG+SDK IDEF
Sbjct  430   KWKNLAREAVEEGGSSDKCIDEF  452



>gb|KDO43525.1| hypothetical protein CISIN_1g012194mg [Citrus sinensis]
Length=468

 Score =   487 bits (1254),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 318/444 (72%), Gaps = 9/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK----PVSDAVGIDIISD  1284
             H + + YP+QGHINP+LQF KRL  KGLK TL  T FIS S+       S ++ ++ ISD
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLDHKGLKVTLVTTYFISKSLHRDSSSSSASIALEAISD  74

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D  G  QA+S+  YL +F   G ++L +L+E+   S  PVDC++YDSF+PWALDVAK 
Sbjct  75    GYDQGGSAQAESIEAYLEKFWQIGPRSLCELVEKMNGSVVPVDCIVYDSFLPWALDVAKK  134

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GL    F TQ+CAV+ +YY  + G+L+LP+    + +PG+P LE +DMPSF+Y  GSYP
Sbjct  135   FGLVGAAFLTQSCAVDCIYYHVNKGLLKLPLPDSQLLLPGMPPLEPQDMPSFVYDLGSYP  194

Query  923   AYFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             A  ++V+ +QF N++KAD V  N+FY+LE +V + + K+  +  IGPTVPSLYLD ++++
Sbjct  195   AVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTIGPTVPSLYLDKQLED  254

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D +YG +++  D    I WLN + +GSV+YV+FGS A +  ++MEELAWG K TN YFLW
Sbjct  255   DKDYGFSMFKPDNESCIKWLNDRAKGSVVYVSFGSYAPLKVEEMEELAWGLKATNQYFLW  314

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALSLGVP
Sbjct  315   VVRESEQAKLPENFSDETSQKGLVVNWCPQLEVLAHEAAGCFLTHCGWNSTMEALSLGVP  374

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVAMPQW+DQ+ N K I+DVWK+G +V   E G+V R  I  C+ E+LE   GKE+++NA
Sbjct  375   MVAMPQWSDQSTNGKYIMDVWKMGLKVPADEKGIVRREAIAHCISEILEGERGKEIRQNA  434

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KWS+ AKEAV++GG+SDK ID+F
Sbjct  435   GKWSNFAKEAVAKGGSSDKNIDDF  458



>ref|XP_004290110.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=468

 Score =   486 bits (1250),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 313/449 (70%), Gaps = 17/449 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +P+P+QGH+NPMLQF KRL  KGLK TLA T        P S ++ ++ ISDG D
Sbjct  10    AHCLVVPFPTQGHVNPMLQFSKRLQRKGLKVTLATTRSFRKLSSPPSTSIALETISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + G   A+++ DYL+RF+  GS+TL +LIE+  +    V C++YD+FMPW LDVAK  G+
Sbjct  70    EGGMAVAENIGDYLDRFREIGSRTLTELIEKLSDLGHKVHCIVYDAFMPWPLDVAKRFGI  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--------PPVRIPGLPALELRDMPSFIYV  939
                 FFTQ+CAV+ +YY    G+L++P ++        P VR+P    L   DMPSF+ V
Sbjct  130   VGATFFTQSCAVDNIYYNVQQGLLKVPPSTDEADEILVPGVRVP----LRASDMPSFVSV  185

Query  938   HGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVI-PIGPTVPSLYLD  762
                YPA+  +V+ QF NV+KAD +F N+FY+LE +  D MSK  P++  IGPT+PS+YLD
Sbjct  186   PSQYPAFLRMVVDQFSNVDKADWIFCNTFYELEVEEADWMSKFWPLLRTIGPTIPSMYLD  245

Query  761   NRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTN  582
              R ++D EYG +L+  +    + WLN + +GSV YV+FGS+A +  +QMEEL WG KN+N
Sbjct  246   KRHEDDKEYGYSLFKPNSDACLKWLNERQKGSVAYVSFGSLAELGAEQMEELGWGLKNSN  305

Query  581   TYFLWVVRDSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEAL  405
              YFLWVVR+ E  KLP+ F     +K L+V+W PQL+VLA++AVGCF TH GWNST+EAL
Sbjct  306   IYFLWVVREKEANKLPKGFAEAISEKGLVVSWCPQLEVLANEAVGCFVTHCGWNSTLEAL  365

Query  404   SLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKE  234
             S GVPMVA+PQWTDQ+ NAK I+DVWK+G R +  E G+V R EIE CVRE+LE   GKE
Sbjct  366   SSGVPMVAVPQWTDQSTNAKYIMDVWKMGLRAQADEKGIVRREEIECCVREILEGERGKE  425

Query  233   MKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             + +NA+KW  LA +A  EGG+SD+ IDEF
Sbjct  426   ITKNALKWKELAGKAADEGGSSDRNIDEF  454



>ref|XP_006469358.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006469359.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006469360.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X3 [Citrus 
sinensis]
Length=466

 Score =   486 bits (1250),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 234/443 (53%), Positives = 312/443 (70%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV--GIDIISDG  1281
             AH + + YP QGHINPMLQF KRL  KG+K T   T F+  S+   S  +   ++ ISDG
Sbjct  14    AHCLVLTYPGQGHINPMLQFSKRLQHKGIKVTFVTTHFLYKSLHRNSSTIPIALEAISDG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G  QA+S+  YL RF   G +TL +L+E+   S  PVDCV+YDS +PWALDVAK  
Sbjct  74    YDEGGAAQAESIDAYLERFWQIGPQTLTELVEKMNASSVPVDCVVYDSVLPWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F TQ+CAV  +YY A+ G L+LP+T   + +PG+P LE +DMPS +Y  GSYPA
Sbjct  134   GLLGATFLTQSCAVYCIYYHANRGFLKLPLTGNEISLPGMPPLEPQDMPSIVYDLGSYPA  193

Query  920   YFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               +LVL +QF N++K D V  N+FY+LE +V + + +  P+  IGPTVPS+YLD +++++
Sbjct  194   ISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLRAIGPTVPSMYLDKQLEDE  253

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG +++       I WLN + +GSV+YV+FGS A++  ++MEELAWG K ++ YFLWV
Sbjct  254   KDYGFSIFKQSNESCIKWLNDQAKGSVVYVSFGSAATLKIEEMEELAWGLKASDKYFLWV  313

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALSLGVPM
Sbjct  314   VRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLEALSLGVPM  373

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQWTDQ+ N+K I+DVWK+G +    E G+V R  I  C+ E+LE   GKE+K+NA 
Sbjct  374   VAMPQWTDQSTNSKYIMDVWKMGLKAPTDEKGIVRREAIAHCISEILEGERGKEIKQNAG  433

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW + AKEAV++GG+SDK IDEF
Sbjct  434   KWRNFAKEAVAKGGSSDKNIDEF  456



>ref|XP_007049529.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93686.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   485 bits (1249),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 320/443 (72%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNS-MKPVSDAVGIDIISDGC  1278
             AH++  PYP QGHINPM+QF KRLVS+G+K TL  T F+S S    ++ +V +  ISDG 
Sbjct  10    AHVLIFPYPGQGHINPMVQFAKRLVSEGVKATLVTTVFLSKSRFSDLTSSVDLQTISDGF  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G+ QA S   YL  F   GSK+LA LI++  ++  P+  ++YD F+PWALDVAK  G
Sbjct  70    DEGGYDQAGSADVYLQTFWSVGSKSLATLIKKLVDAGHPIHGLVYDGFLPWALDVAKQFG  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVT-SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             + +  FFTQ+CAVN VYY    G+LQLP+  S  + +PGLP LE+ ++PSF++ HGSYPA
Sbjct  130   IRSAVFFTQSCAVNSVYYHVSRGLLQLPLQGSNVISLPGLPPLEVSELPSFVFRHGSYPA  189

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             + ++V++QF NV++AD VF N FY+LE + VD MSK   V+ +GPTVPSLYLD R++ND 
Sbjct  190   WLDVVVNQFSNVDEADWVFFNIFYELEKEAVDWMSKFWKVMTVGPTVPSLYLDGRLENDK  249

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG+NL+    +  + WLN KP+ SV+YV+FGS AS+  +Q+ ELAW  K  N YFLWVV
Sbjct  250   DYGMNLFKPSTSACMSWLNGKPKSSVVYVSFGSFASLGVEQIAELAWALKGCNCYFLWVV  309

Query  560   RDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP  F+ +  +K L+V W PQL+VL+ ++ GCF TH G+NS +EALSLGVPM+
Sbjct  310   RESEEAKLPGKFIEETAEKGLVVTWCPQLEVLSHESTGCFLTHCGFNSVLEALSLGVPML  369

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLE---GKEMKENAM  216
             AMPQWTDQ  NAK + DVW +G R R  E  G+V+R  IE C++E+ E   GKE+K+NA+
Sbjct  370   AMPQWTDQGTNAKHVEDVWGIGIRARPDEKLGLVTREIIEQCIKELTEGEKGKEIKKNAI  429

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW +LAK+AV EGG+SDK I+EF
Sbjct  430   KWKNLAKKAVDEGGSSDKNINEF  452



>ref|XP_006447926.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
 gb|ESR61166.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
Length=466

 Score =   485 bits (1248),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 312/443 (70%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV--GIDIISDG  1281
             AH + + YP QGHINPMLQF KRL  KG+K T   T F+  S+   S  +   ++ ISDG
Sbjct  14    AHCLVLTYPGQGHINPMLQFSKRLQHKGIKVTFVTTHFLYKSLHRNSSPIPIALEAISDG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G  QA+S+  YL RF   G +TL +L+E+   S  PVDCV+YDS +PWALDVAK  
Sbjct  74    YDEGGAAQAESIDAYLERFWQIGPQTLTELVEKMNASSVPVDCVVYDSVLPWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F TQ+CAV  +YY A+ G L+LP+T   + +PG+P LE +DMPS +Y  GSYPA
Sbjct  134   GLLGATFLTQSCAVYCIYYHANMGFLKLPLTGNEISLPGMPPLEPQDMPSIVYDLGSYPA  193

Query  920   YFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               +LVL +QF N++K D V  N+FY+LE +V + + +  P+  IGPTVPS YLD ++++D
Sbjct  194   ISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLRAIGPTVPSKYLDKQLEDD  253

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG +++       I WLN + +GSV+YV+FGSMA++  ++MEELAWG K ++ YFLWV
Sbjct  254   KDYGFSMFMQSNESCIKWLNDQAKGSVVYVSFGSMATLKIEEMEELAWGLKASDKYFLWV  313

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALS+GVPM
Sbjct  314   VRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLEALSVGVPM  373

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQWTDQ+ N+K I+DVWK+G +    E G+V R  I  C+ E+LE   GKE+K+NA 
Sbjct  374   VAMPQWTDQSTNSKYIMDVWKMGLKAPTDEKGIVRREAIAHCISEILEGERGKEIKQNAG  433

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW + AKEAV++GG+SDK IDEF
Sbjct  434   KWRNFAKEAVAKGGSSDKNIDEF  456



>ref|XP_011082054.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=473

 Score =   485 bits (1249),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/440 (53%), Positives = 314/440 (71%), Gaps = 6/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL+ KG++ TL +T  +  S    S  + ++ ISDG  
Sbjct  12    AHCLILPYPIQGHINPMLQFAKRLLQKGIEITLVVTQTLVTSTLFSSSTIPLETISDGWA  71

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D        V  +L RF+  GS+TL + + R  +S  PVDC+++D F+PW LDVAK  GL
Sbjct  72    DLPPGTGYDV--HLARFKEFGSRTLKEALVRLTDSGRPVDCIVFDPFLPWCLDVAKEMGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
              A  FFTQ+CAV+ +YY    G L++P++   + IPGLP L+  DMPSF+YVHGSYP  F
Sbjct  130   AAAAFFTQSCAVDQIYYHVFKGELKVPLSGEEILIPGLPPLKPEDMPSFMYVHGSYPPLF  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             E+VL+QF  +EKAD +F+N+FY+LE +V+D M+K  PV  IGPTVPS+YLD RV +D EY
Sbjct  190   EVVLNQFSGLEKADWLFLNTFYQLEEEVIDNMAKFLPVKTIGPTVPSMYLDKRVPDDKEY  249

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+N+Y  D    ++WLN +   +V+YV+FGS+A + + QMEELAWG K +N  FLWVVR 
Sbjct  250   GLNVYKPDTVACMEWLNQQQPETVVYVSFGSLAQLGEVQMEELAWGLKLSNKQFLWVVRS  309

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP++F  +  +K LIV+W PQL VLA +AV CF TH GWNST+EALSLGVPMVA+
Sbjct  310   SEESKLPKDFAQESSEKGLIVSWCPQLDVLAHEAVCCFVTHCGWNSTLEALSLGVPMVAV  369

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             PQW+DQ  N+K ++DVWK+G R +  + GVV+R  I  C+R+V+E   G+E+K+NA+KW 
Sbjct  370   PQWSDQGTNSKFVMDVWKMGIRAKTDDSGVVNRETIASCIRDVMEGERGEEIKKNAIKWK  429

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LA+EAV EGG+SDK I +F
Sbjct  430   ELAREAVDEGGSSDKNIQDF  449



>ref|XP_006469357.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
Length=464

 Score =   485 bits (1248),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 317/444 (71%), Gaps = 12/444 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK---PVSDAVGIDIISD  1284
             AH + + YP+QGHINP+LQF KRL  KG+K TL  T FIS S+      S+++ ++ ISD
Sbjct  15    AHCLVLSYPAQGHINPLLQFSKRLEHKGIKVTLVTTYFISKSLHRDPSSSNSIALETISD  74

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ G  QA+S   Y++RF   G +T  +L+ER  +    VDC++YDSF+PWALDVAK 
Sbjct  75    GYDEGGSAQAESNQAYVDRFWKIGLQTFTELVERMND----VDCIVYDSFLPWALDVAKK  130

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GL    F TQ+CAV  +YY A+ G L+LP+T   + +PG+P LE +DMPSF+Y  GSYP
Sbjct  131   FGLLGATFLTQSCAVYCIYYHANRGFLKLPLTGNEISLPGMPPLEPQDMPSFVYDLGSYP  190

Query  923   AYFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             A  +LVL +QF N++K D V  N+FY+LE +V + + +  P+  IGPTVPS+YLD ++++
Sbjct  191   AISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLRAIGPTVPSMYLDKQLED  250

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + +YG +++       I WLN + +GSV+YV+FGS A++  ++MEELAWG K ++ YFLW
Sbjct  251   EKDYGFSIFKQSNESCIKWLNDQAKGSVVYVSFGSAATLKIEEMEELAWGLKASDKYFLW  310

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALSLGVP
Sbjct  311   VVRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLEALSLGVP  370

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVAMPQWTDQ+ N+K I+DVWK+G +    E G+V R  I  C+ E+LE   GKE+K+NA
Sbjct  371   MVAMPQWTDQSTNSKYIMDVWKMGLKAPTDEKGIVRREAIAHCISEILEGERGKEIKQNA  430

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW + AKEAV++GG+SDK IDEF
Sbjct  431   GKWRNFAKEAVAKGGSSDKNIDEF  454



>ref|XP_010095580.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB61153.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=455

 Score =   484 bits (1247),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 311/441 (71%), Gaps = 6/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAIT-TFISNSMKPVSDAVGIDIISDGC  1278
             +H + + YP+QGHINP+LQFCKRL  KGL  TL    + + N     +  + ID ISDG 
Sbjct  10    SHCLVLSYPTQGHINPLLQFCKRLRHKGLHVTLVTAKSMLKNLHVTAASLISIDTISDGY  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD G  QA S   YL+RF   G  TLA LI++   +  PVDCV+YDSF+PWALDVAK  G
Sbjct  70    DDGGLRQAGSTDAYLDRFWRVGPATLAQLIKKLSGAGRPVDCVVYDSFLPWALDVAKEFG  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ+C V+ +YY  H G+L++PV+   + IPG P     D+PSF+Y   S+ A 
Sbjct  130   LVGAVFFTQSCTVDCIYYHVHRGLLRVPVSESGISIPGCPPFRPSDLPSFVYDTVSHQAV  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              ++V+ QF NVEKAD V  N++Y+LE +V + M K+ P+  IGPT+PS+YLD R++ D +
Sbjct  190   IKMVVDQFSNVEKADWVLCNTYYELEEEVANWMMKILPLRTIGPTIPSMYLDKRLEGDDQ  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +L+       + WLN++P+GSV Y++FGS+  V+ +Q+EELA G K +N +FLWVVR
Sbjct  250   YGFSLFPSQSEACLKWLNSRPKGSVAYLSFGSLVDVEAEQIEELANGLKRSNCHFLWVVR  309

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  KLP+ F+ D  D+ L+V+W PQL+VLA+ AVGCF TH GWNST+EALSLGVPMVA
Sbjct  310   ASEADKLPKGFVDDTSDRGLVVSWCPQLEVLANDAVGCFVTHCGWNSTLEALSLGVPMVA  369

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGE-IEGCVREVL--EGKEMKENAMKW  210
             MPQW+DQ  NAK IVDVWKVG +    + G ++RGE +E CV+E++   GKEMK NA+KW
Sbjct  370   MPQWSDQFTNAKYIVDVWKVGLKAPTADKG-IARGEAVENCVKEIIGERGKEMKRNAIKW  428

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
             S LAK+AV+EGG+SDK IDEF
Sbjct  429   SSLAKKAVNEGGSSDKNIDEF  449



>ref|XP_009783231.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana sylvestris]
Length=459

 Score =   483 bits (1244),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 314/446 (70%), Gaps = 11/446 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SK +K T+A T F   +M+ +S  V I+ ISDG D
Sbjct  5     AHCLILPYPIQGHINPMLQFSKRLQSKNVKITIAATKFFLQTMQELSTPVSIEAISDGYD  64

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA+S   Y+ RF+  GS T++ LIE       PV+C++YD F+PWA++VAK +GL
Sbjct  65    DGGIYQAESFAAYITRFKEVGSDTMSQLIETLTTRGYPVNCIVYDPFLPWAVEVAKKYGL  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPALELRDMPSFIYVHGSYPA  921
                 FFTQ+CAV+ +YY  H G+L+LP T     + IPGL  +E  D+PSF+    S  A
Sbjct  125   ACAAFFTQSCAVDNIYYHVHKGVLKLPPTEVDEEISIPGLVTIESSDVPSFVSTPESARA  184

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
               E++++QF N+EK D V +NSFY+LE +V D MSK+ P+  IGPT+PS+YLD R+ +D 
Sbjct  185   -LEMLVNQFSNLEKIDWVLINSFYELEKEVTDWMSKLYPIKTIGPTIPSVYLDKRLPDDK  243

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG++++     + ++WLN +P  SV+YV+FGS+  ++ +QMEELAWG KN+N  FLWVV
Sbjct  244   EYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLTKLEPEQMEELAWGLKNSNKNFLWVV  303

Query  560   RDSELPKLPENFLGD-----DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             R +E  KLP+NFL +     ++K L+V+W PQL+VL  K+VGCF TH GWNST+EA+SLG
Sbjct  304   RSTEESKLPKNFLEELKLASENKGLVVSWCPQLQVLEHKSVGCFLTHCGWNSTLEAISLG  363

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKE  225
             VPMVAMPQW+DQ  NAKL+ DVW++G + +  E G+V R  IE C+R V+E   GK +KE
Sbjct  364   VPMVAMPQWSDQPTNAKLVEDVWEMGVKAKQDEKGLVRREVIEECIRIVMEEEKGKMIKE  423

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             N  KW  LA+ AV EGG+SD+ I+EF
Sbjct  424   NTKKWKELARNAVDEGGSSDRNIEEF  449



>ref|XP_004289758.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   483 bits (1244),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 231/445 (52%), Positives = 313/445 (70%), Gaps = 9/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS-----DAVGIDII  1290
             AH +  PYPSQGHINP+LQF K L  KG+K TL  T FI N+M   S     + + ++ I
Sbjct  10    AHCLVFPYPSQGHINPLLQFSKLLAHKGVKVTLVTTRFIYNTMYKGSCCTALETISLEAI  69

Query  1289  SDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVA  1110
             SDG D+    Q  S+  YL      GS+ LA+LIE+   S  PVDC++YD+FMPW LD+A
Sbjct  70    SDGFDEGWKTQGVSIQAYLESLWKVGSQNLAELIEKLSGSGCPVDCLVYDAFMPWPLDIA  129

Query  1109  KSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGS  930
             K  G+    FFTQ+CAV+ +Y   + G+L+LP+T   + +PG+P LE  D+PSF+   GS
Sbjct  130   KKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSEISLPGMPPLEPLDLPSFLSHFGS  189

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YPA+FE+V+ QF NV+KAD V  N+FY LE QVVD ++K  PV  IGPT+PS YLDNR+K
Sbjct  190   YPAFFEVVIGQFCNVDKADWVLCNTFYDLEEQVVDWLAKFWPVRTIGPTIPSNYLDNRLK  249

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D  YG++L+       + WLN  P+ SV Y++FGS A +  +QMEELAWG K + + FL
Sbjct  250   DDKGYGVDLFKSSNDACMKWLNKHPKNSVAYISFGSAAQLGLEQMEELAWGLKRSKSKFL  309

Query  569   WVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR+SE  K+PE F+ +  +K L+V+W  QL+VLA +AVGCF TH GWNST+E+LSLGV
Sbjct  310   WVVRESEAAKVPEGFIEETAEKGLVVSWCSQLEVLAHEAVGCFITHCGWNSTLESLSLGV  369

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             P+VAMPQWTDQ+ NAK I DVW++G + +  E G+V R E+E C+ E++E   GKE+++N
Sbjct  370   PLVAMPQWTDQSTNAKYIKDVWEIGVKAQPDEKGIVRREEVEHCINEIMERDKGKEIQKN  429

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             AMKW  LA++AV +GG+S++ IDEF
Sbjct  430   AMKWKDLARKAVVDGGSSNRNIDEF  454



>ref|XP_003548080.2| PREDICTED: UDP-glycosyltransferase 74E2-like [Glycine max]
 gb|KHN32810.1| UDP-glycosyltransferase 74E2 [Glycine soja]
Length=478

 Score =   484 bits (1246),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 223/440 (51%), Positives = 310/440 (70%), Gaps = 4/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS-DAVGIDIISDGC  1278
             AH + +PYP+QGHINPMLQF KRLV +G+K TL        +M+  +  ++ ++ ISDG 
Sbjct  27    AHCLVLPYPAQGHINPMLQFSKRLVQRGVKVTLVTVVSNWKNMRNKNFTSIEVESISDGY  86

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD G   A+S+  Y+  F   GS+T A+L+++   S  P DCVIYD+FMPW LDVAK  G
Sbjct  87    DDGGLAAAESLEAYIETFWRVGSQTFAELVQKLAGSSHPPDCVIYDAFMPWVLDVAKKFG  146

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ C  N +Y+  +  +++LP+T     +PGLP L   D+PSF+  +GSYP Y
Sbjct  147   LLGATFFTQTCTTNNIYFHVYKKLIELPLTQAEYLLPGLPKLAAGDLPSFLNKYGSYPGY  206

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F++V++QF+N++KAD V  NSFY+LE  VVD + K+ P+ PIGP +PS+YLD R+++D +
Sbjct  207   FDVVVNQFVNIDKADWVLANSFYELEQGVVDWLVKIWPLKPIGPCLPSIYLDKRLQDDKD  266

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+N+Y+ +    I WL+ KP+GSV+YV+FGSMA ++++Q EELAWG  ++ +YF+WV+R
Sbjct  267   YGVNMYNPNSEACIKWLDEKPKGSVVYVSFGSMAGLNEEQTEELAWGLGDSGSYFMWVIR  326

Query  557   DSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             D +  KLP+ F    +K LIV+W PQL+VL  +A+GCF TH GWNST+EALSLGVP++AM
Sbjct  327   DCDKGKLPKEFADTSEKGLIVSWCPQLQVLTHEALGCFLTHCGWNSTLEALSLGVPVIAM  386

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             P WTDQ  NAKL+ DVWK+G +    E  +V R  I  C++E+LE   G E+K+NA+KW 
Sbjct  387   PLWTDQITNAKLLKDVWKIGVKAVADEKEIVRRETITHCIKEILETEKGNEIKKNAIKWK  446

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +LAK  V EGG SDK I EF
Sbjct  447   NLAKSYVDEGGNSDKNIAEF  466



>ref|XP_007151915.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
 gb|ESW23909.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
Length=460

 Score =   483 bits (1242),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 312/443 (70%), Gaps = 10/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD----AVGIDIIS  1287
             AH + +PYP+QGHINPMLQF KRLV +G+K TL     +SN  K +S+    ++ ++ IS
Sbjct  9     AHCLVLPYPAQGHINPMLQFSKRLVQRGVKITL--IAVVSN-WKAISNKNFTSIEVESIS  65

Query  1286  DGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAK  1107
             DG DD G   A+S+  YL+ F   GS+TLA+L+++   S  P DCVIYD+F+PWALDVAK
Sbjct  66    DGYDDGGLKAAESLEVYLDTFCRVGSQTLAELLQKLAESSHPPDCVIYDAFLPWALDVAK  125

Query  1106  SHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
               GL    FFTQ C  N +Y+ A+   L+LP+T     +PGLP L   D+PSF+  +G+Y
Sbjct  126   DFGLLGATFFTQTCTTNNIYFHAYKKWLELPLTQTEYLLPGLPKLAAGDLPSFLNKYGTY  185

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             P YF +V++QF N++KAD V  N+FY+LE  VVD + K+ P+ PIGPT+PS+YLD RV++
Sbjct  186   PGYFAVVMNQFANIDKADWVLANTFYELEQGVVDWLVKIWPLKPIGPTLPSMYLDKRVQD  245

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D +YG+++Y       I WL+ KP+GSV+YV+FGSMA + ++Q EELAWG ++  +YF+W
Sbjct  246   DKDYGVDMYIPKSEACIKWLDDKPKGSVVYVSFGSMAGLSEEQTEELAWGLRDGGSYFIW  305

Query  566   VVRDSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             V+RDSE  KLP+ FL   +K LIV W PQL+VL  +A+GCFFTH GWNST+EALSLGVP+
Sbjct  306   VIRDSEQGKLPKEFLDTSEKGLIVTWCPQLQVLTHEALGCFFTHCGWNSTLEALSLGVPV  365

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAM  216
             +AMP WTDQ  NAKLI DVWK+G +    E  +V R  I  C++++LE +   E+K+N +
Sbjct  366   IAMPLWTDQITNAKLIKDVWKIGVKAVADEKDIVRRETITHCIKQILETETRNEIKKNCI  425

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW +LAK  V EGG SDK   EF
Sbjct  426   KWKNLAKSNVDEGGNSDKNTAEF  448



>ref|XP_010517963.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Camelina sativa]
Length=436

 Score =   480 bits (1236),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 317/445 (71%), Gaps = 30/445 (7%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL +KG KTT  +TTFI N++    S  + I  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLHAKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SV +YL  F+  GSKT+AD+I +++N+D+P+ C++YDSFMPWALD+A+  G
Sbjct  66    DQGGFSSAGSVSEYLQNFKTFGSKTVADVIRKHQNTDNPITCIVYDSFMPWALDLAREFG  125

Query  1097  LFAGCFFTQACAVNYVYY--CAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNY+ Y  C ++G L LP       I  LP LEL+D+P+F+   GS+ 
Sbjct  126   LVAAPFFTQSCAVNYINYLSCTNNGSLTLP-------IKDLPLLELQDLPTFVTPTGSHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N +KAD V VNSF+ L+    + +SK+ PV+ IGPTVPS+YLD ++K+D
Sbjct  179   AYFEMVLQQFTNFQKADFVLVNSFHDLDLHEEELLSKVCPVLTIGPTVPSMYLDKQIKSD  238

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
             ++Y             +WL+++P+GSV+Y+AFGSMA +  +QM E+A    N +  +LWV
Sbjct  239   NDYD------------EWLDSRPQGSVVYIAFGSMAKLSSEQMAEIALAVSNIS--YLWV  284

Query  563   VRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VR SE  KLP  FL   D DK+L++NWSPQL+VL+ KA+GCF TH GWNST+E LSLGVP
Sbjct  285   VRASEEAKLPPGFLETVDKDKSLVLNWSPQLQVLSHKAIGCFMTHCGWNSTMEGLSLGVP  344

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKEN  222
             MVAMPQWTDQ MNAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KEM+EN
Sbjct  345   MVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGIAKREEIELSIKEVMEGEKSKEMREN  404

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KWS LA +++SEGG++D  I+ F
Sbjct  405   AKKWSDLAVKSLSEGGSTDININAF  429



>gb|KGN43661.1| hypothetical protein Csa_7G051410 [Cucumis sativus]
Length=457

 Score =   481 bits (1238),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 230/442 (52%), Positives = 310/442 (70%), Gaps = 10/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV-GIDIISDGCD  1275
             H++ IPYP+QGH+NP++QF K L  KGL  T+A+TTFI N+ KP  +     D ISDG D
Sbjct  8     HVLVIPYPTQGHLNPLIQFSKFLSYKGLDITVAVTTFIFNTFKPSKNIFFDWDTISDGFD  67

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF +A+S+ +YL R Q  G++TL DLI R+K S  P+  V+YDSFMPWA+DVAK  G+
Sbjct  68    EGGFAEANSIDEYLVRIQTIGARTLTDLIHRHKTSSRPIHGVVYDSFMPWAVDVAKDFGI  127

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
              A  FFTQ C+VN +YYC H G+L LP+      I GLP + + +MPSF      YP YF
Sbjct  128   MAATFFTQPCSVNLIYYCFHEGLLSLPILEDN-SIAGLPPIRVEEMPSFFSAPECYPNYF  186

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ELVL+Q+ N ++ D + VNS Y+ E +  D ++K  P + IGPT+PS Y+DN   +D +Y
Sbjct  187   ELVLNQWSNTKEVDWILVNSIYEFEPKEADELAKFGPTLTIGPTIPSFYIDNHDIDDKKY  246

Query  734   GINLYHMDPTK---SIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              ++L+ ++P +   +  WL+ KP+GSVIYV+FGSMA+++  QM ELA G   +N YF+WV
Sbjct  247   MLDLFKIEPEEASLTRMWLDNKPKGSVIYVSFGSMANLNNTQMTELASGLVESNHYFIWV  306

Query  563   VRDSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +R+SE  KLP +F    +K LI+ WS QL+VL+++AVGCFF H GWNST+EAL LGVPMV
Sbjct  307   IRESEKAKLPSSFA--PEKGLILQWSSQLEVLSNEAVGCFFAHCGWNSTLEALCLGVPMV  364

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
              MPQWTDQ  NAK + DVWKVG RV+VGEDG+V + EI+GC+R V+EG    E KENA+K
Sbjct  365   GMPQWTDQPTNAKYVEDVWKVGVRVKVGEDGIVRKEEIKGCIRRVMEGDRASEFKENALK  424

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  L  +A+  GG+S K ID+ 
Sbjct  425   WKQLGLKALGNGGSSMKNIDQL  446



>ref|XP_002880071.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56330.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=449

 Score =   480 bits (1236),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 321/446 (72%), Gaps = 19/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+P+PSQGHI P+ QFCKRL SKG KTT  +T+FI N++    S  + I  ISDG 
Sbjct  6     GHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTSFIFNTIHLDPSSPISIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A SVP+YL  F+  GSKT+AD+I +++++D+P+ C++YDSFMPWALD+A+  G
Sbjct  66    DQGGFSSAGSVPEYLQNFKTFGSKTVADVIRKHQSTDNPITCIVYDSFMPWALDLAREFG  125

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNY+ Y ++  +G L LP       I  LP LEL+D+P+F+   GS+ 
Sbjct  126   LAAAPFFTQSCAVNYINYLSYINNGRLTLP-------IKDLPLLELQDLPTFVTPTGSHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N +KAD V VNSF+ L+ Q  + +SK+ PV+ IGPTVPS+YLD ++K D
Sbjct  179   AYFEMVLQQFTNFDKADFVLVNSFHDLDLQEEELLSKVCPVLTIGPTVPSMYLDQQIKFD  238

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             ++Y +NL+ + +     DWL+ +P+GSV+Y+AFGSMA +  +QMEE+A    N +  +LW
Sbjct  239   NDYDLNLFDLKEAALCTDWLDKRPQGSVVYIAFGSMAKLSSEQMEEIASAISNFS--YLW  296

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR SE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+E LSLGV
Sbjct  297   VVRASEESKLPPGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGV  356

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KEMKE
Sbjct  357   PMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGIAKREEIELSIKEVMEGEKSKEMKE  416

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA  W  LA +++SEGG++   I+ F
Sbjct  417   NAGNWRDLAVKSLSEGGSTYININAF  442



>ref|XP_002320558.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE98873.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=459

 Score =   480 bits (1236),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 312/442 (71%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIIS--DG  1281
             AH + + +P+QGHINPMLQF KRL  KG+K T   T FISN++   S +  I + +  DG
Sbjct  7     AHCLVVSFPAQGHINPMLQFSKRLEHKGVKVTPVTTRFISNAIMSGSSSSSISLQTISDG  66

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G   A+S+  YL+RF   G +TL +L+E+   SD PVDC+IYD+FMPW LDVAK  
Sbjct  67    YDEGGIGHAESIKSYLDRFWKVGLQTLDNLVEKLSGSDCPVDCIIYDAFMPWGLDVAKKF  126

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    FFTQ+CAV+ +YY  + G+++LPVT   + +PGLP LE +D+PSFIY  G+YP 
Sbjct  127   GLVGAAFFTQSCAVDSIYYHVYRGLIKLPVTETQILVPGLPPLEPQDLPSFIYHLGTYPD  186

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             +F+++L QF N+++AD VF NSFY LE +V D  +K+ P   IGPT+PS+YLD +++ND 
Sbjct  187   FFDMLLDQFSNIDRADWVFCNSFYMLEREVADWFAKLWPFRSIGPTIPSMYLDKQLENDR  246

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG + +  +    ++WLN + +GSV++V+FGS+  +  +QMEELAWG K ++ YFLWVV
Sbjct  247   DYGFSFFMQNNDVCMNWLNDRAKGSVVHVSFGSLVDLKAEQMEELAWGLKRSDCYFLWVV  306

Query  560   RDSELPKLPENFLGDDD-KALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R SE  K+ ++F  +   K L+V W  QL+VLA +AVGCF TH GWNS++EALSLGVPMV
Sbjct  307   RASEESKMSKDFAEESSAKGLVVRWCSQLEVLAHEAVGCFVTHCGWNSSLEALSLGVPMV  366

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQ TDQ+ NAK I DVW +G +  V E  +  R  IE C++E+LE   GKE+K NA K
Sbjct  367   AMPQRTDQSTNAKYITDVWNMGVKAAVDEKEIARRETIESCIKEILEGEKGKEIKRNASK  426

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAKEAV EGG+SDK IDEF
Sbjct  427   WKELAKEAVEEGGSSDKNIDEF  448



>ref|XP_009625439.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=456

 Score =   480 bits (1236),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 229/443 (52%), Positives = 314/443 (71%), Gaps = 8/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SK +K T+A T F   +M+ +S  V I+ ISDG D
Sbjct  5     AHCLILPYPIQGHINPMLQFSKRLQSKNVKITIAATKFFLKTMQELSTPVSIEAISDGYD  64

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA+S   Y+ RF+  GS TL+ LIE       PV+C++YD F+PWA++VAK +GL
Sbjct  65    DGGIDQAESFAAYITRFKEVGSNTLSQLIETLTTRGYPVNCIVYDPFLPWAVEVAKKYGL  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPALELRDMPSFIYVHGSYPA  921
              +  FFTQ+CAV+ +YY  H+G+L+LP T     + IPGL  +E  D+PSF+    S  A
Sbjct  125   ASAAFFTQSCAVDNIYYHVHNGVLKLPPTEVDEEISIPGLVTIESSDVPSFVSTPESARA  184

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
               E++++QF N+E  D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ +D 
Sbjct  185   -LEMLVNQFSNLENIDWVLINSFYELEKEVIDWMSKLYPIKTIGPTIPSIYLDKRLPDDK  243

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG++++     + ++WLN +P  SV+YV+FGS+  ++ +QMEELAWG K++N  FLWVV
Sbjct  244   EYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLTKLEPEQMEELAWGLKSSNKNFLWVV  303

Query  560   RDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R +E  KLP NFL +   +K L+V+W PQL+VL  K++GCF TH GWNST+EA+SLGVPM
Sbjct  304   RSTEESKLPNNFLEELASEKGLVVSWCPQLQVLEHKSIGCFLTHCGWNSTLEAISLGVPM  363

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQW+DQ  NAKL+ DVW +G R +  + G+V R  IE C+R V+E   GK + ENA 
Sbjct  364   VAMPQWSDQPTNAKLVEDVWGMGVRAKQDDKGIVKREVIEECIRIVMEEEKGKIITENAK  423

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LA++AV EGG+SD+ I+EF
Sbjct  424   KWKELARKAVDEGGSSDRNIEEF  446



>gb|KFK37205.1| hypothetical protein AALP_AA4G227800 [Arabis alpina]
Length=449

 Score =   480 bits (1235),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 247/449 (55%), Positives = 318/449 (71%), Gaps = 25/449 (6%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++AIP+PSQGHI P+ QFCKRL  KG KTT  +TTFI N++    S  V I  ISDG 
Sbjct  6     GHVLAIPFPSQGHITPIRQFCKRLHFKGFKTTHTLTTFIFNTVHIDPSSLVNIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  A S+P+YL  F+  GSKT++D+I +++ SD P+ C++YDSFMPWALDVA+  G
Sbjct  66    DHGGFSSAGSIPEYLENFKTFGSKTVSDIIRKHQTSDDPITCIVYDSFMPWALDVARDFG  125

Query  1097  LFAGCFFTQACAVNYVYY--CAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ CAVNYV Y  C ++G L+LP       I  LP LEL+D+P+F+    S+ 
Sbjct  126   LAAASFFTQNCAVNYVNYLSCMNNGSLKLP-------IKDLPFLELQDLPTFVTPTVSHL  178

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AYFE+VL QF N EKADCV +N+F +L+    D MSK+  V+ IGPTVPS+YLD ++K D
Sbjct  179   AYFEMVLQQFTNFEKADCVVMNTFQELDPHEKDLMSKVCHVLTIGPTVPSMYLDQQIKLD  238

Query  743   SEYGINLYHMDPTKSID----WLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTY  576
             ++  +NL+    +K  D    WL+T+P+GSV+YVAFGSMA +   QMEELA    + +  
Sbjct  239   TDCDLNLFD---SKEADLCTTWLSTRPQGSVVYVAFGSMAQLSSVQMEELASALSSFS--  293

Query  575   FLWVVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALS  402
             FLWVVR SE  KLP  +L   D +K+L++ WSPQL+VL++KAVGCF TH GWNST+EAL+
Sbjct  294   FLWVVRASEEAKLPSGYLETVDKEKSLVLKWSPQLQVLSNKAVGCFMTHCGWNSTMEALT  353

Query  401   LGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KE  234
             LGVPMVAMPQWTDQ MNAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KE
Sbjct  354   LGVPMVAMPQWTDQPMNAKYIQDVWKVGVRVKTEKESGIAKREEIEFSIKEVMEGEESKE  413

Query  233   MKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             MK+NA KW  LA +++SEGG++D  ID F
Sbjct  414   MKKNAKKWRDLAVKSLSEGGSTDINIDAF  442



>gb|KEH25943.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   480 bits (1235),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 316/441 (72%), Gaps = 5/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLA--ITTFISNSMKPVSDAVGIDIISDG  1281
             AH + +P+P QGH+NPM+QF KRL+ KG+K TL   I+ + +   K +S  + ++ ISDG
Sbjct  10    AHCLILPFPGQGHMNPMIQFSKRLIHKGVKVTLVTIISLWRTIKNKNLSSNIDVESISDG  69

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD G+  A+S+  Y++ F   GSK L++L+ +  +S  P +CVI+D+FMPWALDVAKS 
Sbjct  70    YDDGGYESAESLEIYMDTFWRVGSKDLSELLHKLSSSKYPPNCVIFDAFMPWALDVAKSF  129

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    FFTQ+C+VN +Y+  H  +++LP+T     +PGLP L   D+PSF+Y +GSYP 
Sbjct  130   GLVGVAFFTQSCSVNSIYFHTHEKLIELPLTQSEYLLPGLPKLAQGDLPSFLYKYGSYPG  189

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YF++V++QF N+ KAD +  N+FY+LE +VVD M K+ P+  IGP++PS++LD R+K+D 
Sbjct  190   YFDIVVNQFSNIGKADWILANTFYELEKEVVDWMVKIWPLRTIGPSIPSIFLDKRLKDDK  249

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG+++   +    I WLN KP+GSV+YV+FGSMA + ++Q +ELA G K++ +YFLWVV
Sbjct  250   EYGVSISDPNTEICIKWLNEKPKGSVVYVSFGSMAGLSEEQTQELALGLKDSESYFLWVV  309

Query  560   RDSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             R+SE  KLP  ++    K LIV W PQL VL  +A+GCF TH GWNST+EALS+GVP++A
Sbjct  310   RESEQVKLPNGYVESSKKGLIVTWCPQLLVLTHEALGCFVTHCGWNSTLEALSIGVPLIA  369

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             MP WTDQ  NAKLI DVWK+G R    E  +V    I+ C++E++E   G E+K+NA+KW
Sbjct  370   MPLWTDQVTNAKLIADVWKMGVRAIADEKEIVRSETIKNCIKEIIETEKGNEIKKNALKW  429

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
              +LAK++V EGG SDK I+EF
Sbjct  430   KNLAKDSVDEGGRSDKNIEEF  450



>ref|XP_007045533.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007045534.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01365.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01366.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
Length=457

 Score =   479 bits (1234),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 322/442 (73%), Gaps = 7/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNS-MKPVSDAVGIDIISDGC  1278
              H++ +PYP QGHINPMLQF KRLVSKG+K TL  T F+ NS +   + ++ +  ISDG 
Sbjct  10    GHVLVLPYPGQGHINPMLQFAKRLVSKGVKATLVTTIFLYNSILSDPTSSIDLQTISDGF  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ GF QA S   YL+ F+  GS++LA LI++  ++D P D +IYDSF+PWALDVA+  G
Sbjct  70    DEGGFAQAGSPGAYLSTFRSVGSQSLASLIQKLGDTDFPFDAIIYDSFLPWALDVARQLG  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ+CAVN + Y    G+L+LP+  P V +PGLP  ++ ++PS +Y++GS+PA+
Sbjct  130   LLGAVFFTQSCAVNSINYHVSEGLLKLPLEGPNVSLPGLPLYKVSELPSVVYLYGSHPAW  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F+++++QF N++ AD V VN+FY+LE +VVD MS++  +  +GPT+PS++LD R++ + +
Sbjct  190   FDMIVNQFSNIDAADWVLVNTFYELEKEVVDWMSEIWKLGTVGPTIPSMHLDRRLEGNKD  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+NL++ +    ++WLN KP GSV+YV+FGS+A +  ++M E+AWG K +N YFLWVVR
Sbjct  250   YGMNLFNPNTNTCMNWLNGKPNGSVVYVSFGSLADLGVEEMAEIAWGLKVSNFYFLWVVR  309

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +SE  KLP NF  +  +K L+V W PQL+VLA  +VGCF TH G+NS +EAL LGVPM+ 
Sbjct  310   ESEETKLPYNFKEETGEKGLMVEWCPQLEVLAHDSVGCFLTHCGYNSVLEALCLGVPMLG  369

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGE-IEGCVREVLE---GKEMKENAMK  213
             MPQW DQ  NAK + ++W +G R    E G+V RGE I+ C++E++E   GK++KENA K
Sbjct  370   MPQWADQATNAKHVEEIWGIGIRAFPDEKGIV-RGEIIQQCIKELMEGERGKQVKENANK  428

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W +LA++A  EGG+SDK IDEF
Sbjct  429   WKNLARDATDEGGSSDKNIDEF  450



>ref|XP_004244485.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=456

 Score =   479 bits (1233),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/444 (50%), Positives = 318/444 (72%), Gaps = 9/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +P+P QGHINPMLQF KRL SK +K T+A+T     +M+ +S +V I+ ISDG D
Sbjct  6     AHCLILPFPGQGHINPMLQFSKRLQSKRVKITIALTKSCLKTMQELSTSVSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D GF QA++   Y+ RF+  GS TL+ LI++ +NSD PV+C++YD F+PWA++VAK  GL
Sbjct  66    DGGFHQAENFVAYITRFKEVGSDTLSQLIKKLENSDCPVNCIVYDPFIPWAVEVAKQFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLP-ALELRDMPSFIYVHGSYP  924
              +  FFTQ C V+ +YY  H G+++LP T     + IPG P +++  D+PSF+ +     
Sbjct  126   ISAAFFTQNCVVDNLYYHVHKGVIKLPPTQNDEEILIPGFPNSIDASDVPSFV-ISPEAE  184

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                E++ +QF N++K DCV +NSFY+LE +V++ MSK+ P+  IGPT+PS+YLD R+ +D
Sbjct  185   RIVEMLANQFSNLDKVDCVLINSFYELEKEVIEWMSKIYPIKTIGPTIPSMYLDKRLHDD  244

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++++     + ++WLN +P  SV+YV+FGS+  +  +QMEELAWG KN+N  FLWV
Sbjct  245   KEYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSITKLGDEQMEELAWGLKNSNKSFLWV  304

Query  563   VRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VR +E PKLP NF+ +   +K L+V+W PQL+VL  ++ GCF TH GWNST+EA+SLGVP
Sbjct  305   VRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESTGCFLTHCGWNSTLEAISLGVP  364

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVAMPQW+DQ  NAKL+ DVW++G R +  E GVV R  IE C++ V+E   GK ++ENA
Sbjct  365   MVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGVVRREVIEECIKLVMEEDKGKLIRENA  424

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  +A+  V+EGG+SDK I+EF
Sbjct  425   KKWKEIARNVVNEGGSSDKNIEEF  448



>ref|XP_010524193.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Tarenaya hassleriana]
Length=448

 Score =   478 bits (1231),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 240/443 (54%), Positives = 312/443 (70%), Gaps = 18/443 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM--KPVSDAVGIDIISDG  1281
              HI+ + YP+QGHI+P+ Q CKRL+SKG+KTTL +TTF   S+   P   +V +   SDG
Sbjct  8     GHILGVAYPTQGHISPIHQLCKRLLSKGIKTTLTLTTFAHTSISPNPPHGSVSLATFSDG  67

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D  G   A+S+  YL RFQ  GS+TLA +I ++++SD P+ CV+YD+F+PW LDVAK  
Sbjct  68    FDHGGISAAESIHHYLRRFQTVGSQTLAQVIRQHQSSDHPITCVVYDAFLPWCLDVAKDF  127

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL A  FFTQ CAVNY+YY A+   L+LP       I GL  LE +D+PSF+ V GSYPA
Sbjct  128   GLVAAPFFTQTCAVNYIYYLAYQEKLELP-------IDGLTFLEPQDLPSFLSVPGSYPA  180

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y E+VL+QF N+ KA+ V VN F KLE +  + +S++ P++ +GPT+PSLYLD R+K D 
Sbjct  181   YHEMVLNQFSNLGKANFVLVNVFEKLEVKETELLSRVCPLLTVGPTLPSLYLDKRIKTDE  240

Query  740   EYGINLYHMDPTKSI-DWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              Y + L+     +S  DWLN +P+GSV+YVAFGS+A +   QMEELAW     +  F+WV
Sbjct  241   NYDLMLFDPKGVESCKDWLNERPKGSVVYVAFGSLAELCNAQMEELAWALSKFS--FIWV  298

Query  563   VRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VRDSE  KLP  F      DKAL+V WSPQL+VL+++A+GCF TH GWNST+EA+SLGVP
Sbjct  299   VRDSEETKLPSGFAESLVKDKALVVKWSPQLEVLSNRAIGCFLTHCGWNSTMEAVSLGVP  358

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEGKE---MKEN  222
             MVAMPQWTDQ  NAK + DVWKVG  V+  E+ G+V R EIE C++EV+EG+    +KEN
Sbjct  359   MVAMPQWTDQPTNAKYVEDVWKVGICVKADEENGIVKREEIEFCIKEVMEGERSRGVKEN  418

Query  221   AMKWSHLAKEAVSEGGTSDKVID  153
             A KW  LA EA++EGGTSD  ID
Sbjct  419   AKKWRDLAVEALAEGGTSDVNID  441



>ref|XP_009335348.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Pyrus x bretschneideri]
Length=460

 Score =   478 bits (1230),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 238/444 (54%), Positives = 315/444 (71%), Gaps = 10/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
             AH + +PYPSQGHINPMLQF K L  K ++ TL  T F+  +M    S+    + ISDG 
Sbjct  11    AHCLILPYPSQGHINPMLQFAKLLDHKEVRVTLVTTRFLYKTMYSSGSNCAAWETISDGF  70

Query  1277  DDAGFLQADSVPD-YLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
             DD G  + D+  D YL RF+  GSK L  L+E+  NS SPVDCV+YD+FMPW LDVAK  
Sbjct  71    DDTG--KRDTKIDIYLERFRQVGSKHLGKLLEKLSNSGSPVDCVVYDAFMPWPLDVAKKL  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRI--PGLPALELRDMPSFIYVHGSY  927
             G+    FFTQ+CAV+ VYY  H G+L+LP+     +I  PGLPAL+  D+PSF+   GSY
Sbjct  129   GIAGAVFFTQSCAVDNVYYHVHRGLLKLPLADGQSQILLPGLPALDPLDLPSFVSDCGSY  188

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             PA + +++ QF NV+KAD V  N+FY LE QVVD M+K+  +  +GPT+PS YL+ R+K+
Sbjct  189   PAAYRVLVGQFSNVDKADWVLCNTFYDLEVQVVDWMAKLWRLKTVGPTIPSNYLNKRLKD  248

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D EY +NL+  D    I WLN +P+GSV YV+FGS+A ++ +QMEELAWG + + + FLW
Sbjct  249   DKEYSVNLFKSDNDACIKWLNERPKGSVAYVSFGSLAKLEDEQMEELAWGLRRSKSSFLW  308

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR+SE  K+P+ F+ +  +K L+V+W PQ++VLA KAVGCF TH GWNST+EALSLGVP
Sbjct  309   VVRESEATKVPKGFIEETSEKGLVVSWCPQMEVLAHKAVGCFVTHCGWNSTLEALSLGVP  368

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVA+PQ +DQ  NAK I+DVW+VG R    E GVV +  ++ C+ EV+E   GKE+++NA
Sbjct  369   MVALPQLSDQRTNAKYIMDVWEVGVRAPTDEKGVVRQVVVKQCISEVMEGERGKEIQKNA  428

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  LA++AV EGG+SDK IDEF
Sbjct  429   AKWKELARKAVDEGGSSDKNIDEF  452



>dbj|BAG80541.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=463

 Score =   478 bits (1229),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 231/447 (52%), Positives = 317/447 (71%), Gaps = 12/447 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYPSQGHINPMLQF KRL SKG+K T+A T     +M+ ++ +V I+ ISDG D
Sbjct  6     AHCLILPYPSQGHINPMLQFSKRLQSKGVKITIATTKSFLKTMQELTTSVSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA S   Y+ RF+  GS TLA LI++  NS  PV+C++YD F+PWA++VAK  GL
Sbjct  66    DGGRDQAGSFVAYITRFKEVGSDTLAQLIKKLANSGCPVNCIVYDPFLPWAVEVAKDFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSFIYVHGSYP  924
              +  FFTQ CAV+ +YY  H G+L+LP T     + IPG    +E  D+PSF+ +     
Sbjct  126   VSAAFFTQNCAVDNIYYHVHKGVLKLPPTQDDEEILIPGFSCPIESSDVPSFV-ISPEAA  184

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                +++++QF N++K D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLDNR+ +D
Sbjct  185   RILDMLVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDNRLPDD  244

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++++     + ++WLN +   SV+YV+FGS+A V+ +QMEELAWG KN+N  FLWV
Sbjct  245   KEYGLSVFKPMTNECLNWLNHQLISSVVYVSFGSLAKVEVEQMEELAWGLKNSNKNFLWV  304

Query  563   VRDSELPKLPENFLGD-----DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             VR +E  KLP+NFL +     ++K L+V+W PQL+VL  K+ GCF TH GWNST+EA+SL
Sbjct  305   VRSTEESKLPKNFLEELKLVSENKGLVVSWCPQLQVLEHKSTGCFLTHCGWNSTLEAISL  364

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMK  228
             GVPM+ MPQWTDQ  NAKL+ DVW++G R +  E G+V R  IE C++ V+E   GK +K
Sbjct  365   GVPMLTMPQWTDQPTNAKLVKDVWEMGVRAKQDEKGIVRREVIEECIKLVMEEEKGKMIK  424

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             ENA KW  LA++AV EGG+SDK I+EF
Sbjct  425   ENAQKWKELARKAVDEGGSSDKNIEEF  451



>ref|XP_002532451.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29937.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=458

 Score =   478 bits (1229),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 229/442 (52%), Positives = 320/442 (72%), Gaps = 6/442 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM--KPVSDAVGIDIISDG  1281
             +H + + YP QGHINPMLQF KR+  KG+K TL  T FI  ++  KP S +V ++ ISDG
Sbjct  10    SHCIVLAYPIQGHINPMLQFSKRIQHKGVKVTLVTTRFIYKTLMHKPPSTSVDLETISDG  69

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD G   A+S+  YL+ F+  GS+TL DL+ +   S  PVDC++YD+F+PW L+VAK  
Sbjct  70    YDDGGIDDAESIKVYLDTFRKVGSQTLTDLVHKLSISGCPVDCIVYDAFLPWCLEVAKKF  129

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G++   +FTQ+CAV+ +YY A+ G+++LP+    + +PGLP L+ +D+PSF+Y  G+YPA
Sbjct  130   GIYGAVYFTQSCAVDIIYYHANQGLIELPLKEIKISVPGLPPLQPQDLPSFLYQFGTYPA  189

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
              FE+++ QF N+ KAD V  N+FY+LE +  D ++K+ P+  IGPT+PS+YLD ++++D 
Sbjct  190   AFEMLVDQFSNIGKADWVLCNTFYELEYEAADWLAKLWPLRTIGPTIPSMYLDKQLQDDR  249

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG N++  +    ++WL  KP+GSV+YV+FGS+A++  +QMEEL+WG K +++YFLWVV
Sbjct  250   DYGFNIFKPNDDACMNWLKDKPKGSVVYVSFGSLATLGVEQMEELSWGLKMSDSYFLWVV  309

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R  E  KLP+NF+ +  +K L+V W PQL+VL ++AVG F TH GWNST+EALSLGVPMV
Sbjct  310   RAPEEAKLPKNFMSEITEKGLVVKWCPQLQVLGNEAVGSFLTHCGWNSTLEALSLGVPMV  369

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMK  213
             AMPQWTDQT NAK I DVWK+G RV V E G+  R  I  C+REV+EG+   EM  NA K
Sbjct  370   AMPQWTDQTTNAKYIEDVWKMGVRVPVDEKGIGRRDAIRECIREVMEGERRTEMDVNAKK  429

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W +LA+ A  EGG+SDK I EF
Sbjct  430   WRNLAQMAAGEGGSSDKNIREF  451



>emb|CDY64613.1| BnaAnng19430D [Brassica napus]
Length=448

 Score =   476 bits (1225),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 325/446 (73%), Gaps = 20/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL+SKGLKTTL +TTF+ NS+KP  S  V I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRLISKGLKTTLTLTTFVFNSIKPDPSGPVSIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  G     ++ +YL  F+  GS+T+AD+I +++ SDSP+ C++YD+F+PWALDVA+  G
Sbjct  66    DQ-GCESPYTIHEYLQNFKTFGSRTIADIIRKHQTSDSPITCMVYDAFIPWALDVAREFG  124

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  HG L+LPV         LP LEL+D+PSF+ V GSYP
Sbjct  125   LAAAPFFTQSCAVNYVYYLSYINHGSLKLPVED-------LPFLELQDLPSFLSVSGSYP  177

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             A+ E+VL QF N EKAD V +N+F +LE    + ++K+  V+ +GPTVPS+Y+D R+K+D
Sbjct  178   AFLEMVLQQFTNFEKADFVLINTFQELELHEKELLAKVCHVLTVGPTVPSMYIDQRIKSD  237

Query  743   SEYGINLYH-MDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
              +Y +N++   D    I WLNT+P+GSV+YVAFGS+A ++  QMEELA   +N +  F+W
Sbjct  238   KDYDLNIFESKDSAFCISWLNTRPQGSVVYVAFGSIAKLNNVQMEELASAVRNFS--FMW  295

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVRDSE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  296   VVRDSEEEKLPSGFLETVDKDKSLVLKWSPQLEVLSNKAIGCFLTHCGWNSTMEALAFGV  355

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I D WKVG  V+   E G+  R EIE  ++EV+EG   +EMKE
Sbjct  356   PMVAMPQWTDQPMNAKYIQDAWKVGVSVKTDKESGIAKREEIEFSIKEVMEGEKSEEMKE  415

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  416   NAKKWRDLAIKSLSEGGSTDINIDAF  441



>emb|CDX83456.1| BnaA03g20500D [Brassica napus]
Length=447

 Score =   476 bits (1225),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 316/446 (71%), Gaps = 20/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL SKGL+TTLA+TTFI NS+KP  S  V I  ISDG 
Sbjct  5     GHVLAVPYPAQGHITPIHQFCKRLNSKGLQTTLALTTFIFNSIKPDPSGPVSIATISDGY  64

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  + S+ DY+  F+  GSKT+ D+I +++ SD+P+ C++YDSF+PWA +VA+  G
Sbjct  65    DQ-GFDSSGSIQDYVQSFKTFGSKTITDIIRKHETSDNPITCIVYDSFLPWAFNVAREFG  123

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             + A  FFTQ+CAVNYVYY ++  +G L LP       I     LEL+D+PSF+    SYP
Sbjct  124   IAAAPFFTQSCAVNYVYYLSYISNGSLNLP-------IEEFHFLELQDLPSFLSAPESYP  176

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AY E+VL QF N +KAD V VN+F + E    + +S + PV+ IGPTVPS+YLD R  +D
Sbjct  177   AYLEMVLQQFTNFQKADFVLVNTFQESELHEQELLSNVCPVLTIGPTVPSMYLDQRNISD  236

Query  743   SEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +N++   D      WLNT+P+GSV+YVAFGS+A ++  QMEELA    N +  FLW
Sbjct  237   TNYDLNIFDSKDAAFCTSWLNTRPQGSVVYVAFGSIAKLNNVQMEELASAVSNFS--FLW  294

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVRDSE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL++GV
Sbjct  295   VVRDSEEEKLPSGFLETLDKDKSLVLKWSPQLEVLSNKAIGCFLTHCGWNSTLEALAIGV  354

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQW DQ M+AK I DVWK G RV++  E  +  R EIE  ++EV+EG   KEMKE
Sbjct  355   PMVAMPQWIDQPMDAKYIQDVWKAGVRVKIDNESRIAKREEIEFSIKEVMEGEKSKEMKE  414

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  415   NAKKWRDLAVKSLSEGGSTDINIDTF  440



>emb|CDP03995.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   476 bits (1226),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 313/441 (71%), Gaps = 7/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM--KPVSDAVGIDIISDGC  1278
             H++ +PYP QGHINPMLQFCKRLV+KG+KTT   + FIS S+   P S A+  + ISDG 
Sbjct  9     HVLVLPYPGQGHINPMLQFCKRLVAKGVKTTFVNSVFISKSIPADPKS-AINFETISDGH  67

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G+  A+S   YL +    GSK LADLI + ++   PV  VIYDSF+ WALDVAK  G
Sbjct  68    DEGGYAAAESPEAYLEKLATFGSKALADLIRKLEDKGEPVQAVIYDSFLTWALDVAKQFG  127

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ CAVN +YY  +HG+L +P++  P+ +PGLP L+ ++ PSF+Y+  SYPA+
Sbjct  128   LVTAAFFTQTCAVNSIYYNVYHGLLPVPLSDSPISLPGLPLLQPKETPSFVYLPDSYPAF  187

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               ++++QF NV++AD V +N+F+KLE   V+ ++K+  VI +GPTVPS+YLD R+++D  
Sbjct  188   LHMLVNQFSNVDQADWVILNNFHKLEEDAVNWIAKLWRVITVGPTVPSIYLDKRLEDDIG  247

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YGINL+  D +  I+WLN++P+ SV+YV+FGS   +D +Q+EE+A   K +   FLWVVR
Sbjct  248   YGINLFKPDSSLCINWLNSQPKDSVVYVSFGSWTEIDVEQVEEIASALKESGFKFLWVVR  307

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
               E  KLP  F  +  +K L+V WSPQL+VLA ++V CF TH G+NS +EALSLGVP+VA
Sbjct  308   AFEKEKLPRKFAEETSEKGLVVTWSPQLEVLAHESVACFVTHCGFNSVLEALSLGVPVVA  367

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
              PQWTDQ  NAK + D+W VG +    E G+V R  +  C+RE++E   GK++KENA++W
Sbjct  368   APQWTDQPTNAKFLADIWGVGVKADADEKGIVRRETLVSCIREIMEGEKGKQIKENAIEW  427

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAKEA+ +GG+SDK IDEF
Sbjct  428   KALAKEAIDDGGSSDKNIDEF  448



>gb|KDP45199.1| hypothetical protein JCGZ_15064 [Jatropha curcas]
Length=469

 Score =   477 bits (1227),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 325/446 (73%), Gaps = 10/446 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDA--VGIDIISD  1284
              H + + YP+QGHINPMLQF KRL +KGLK T   T  +SN++ KP S +  + ++ ISD
Sbjct  10    GHCLVLAYPAQGHINPMLQFSKRLQNKGLKVTFVTTKSLSNTIHKPSSSSPSIALETISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNS--DSPVDCVIYDSFMPWALDVA  1110
               DD    Q +++  YL  F   G K+L +L++R  NS  + PVDC+IYD+FMPW LDVA
Sbjct  70    VYDDCDQSQRENIEAYLAMFWDIGPKSLTNLVQRLNNSVSECPVDCIIYDAFMPWGLDVA  129

Query  1109  KSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPV-RIPGLPALELRDMPSFIYVHG  933
             +   LF+  FFTQ+CAV+ +YY  H  +++LPV++  + R+PGLP L+L+D+PSF+   G
Sbjct  130   EKFQLFSAAFFTQSCAVDSIYYHIHKKLIELPVSNSEILRVPGLPPLQLQDLPSFVSDFG  189

Query  932   SYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRV  753
             SYPA+F++++ Q  N++KAD VF N+FY LE +VVD ++K+ P   IGP +PS+YLD ++
Sbjct  190   SYPAFFDMLVDQCSNIDKADWVFCNTFYDLEKEVVDWLAKIWPFKTIGPCIPSIYLDKQL  249

Query  752   KNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYF  573
             +ND +YGI+++  +    ++WL+ +P+GSV YV+FGS+  +  +QMEEL+ G K + +YF
Sbjct  250   ENDKDYGISIFKPNNEACMNWLSKRPKGSVAYVSFGSLVDLKIEQMEELSCGLKGSKSYF  309

Query  572   LWVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             LWVVR++E  KLP+ F+ ++ +K ++VNW PQL+VL+ +A+GCF TH GWNS++EALSLG
Sbjct  310   LWVVRENEEAKLPKKFIEENSEKGIVVNWCPQLEVLSHEAIGCFVTHCGWNSSLEALSLG  369

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKE  225
             VPMVAMPQ TDQ+ NAK I DVWK+G +V+V E G+    EIE C+ E+LE   GKE+K 
Sbjct  370   VPMVAMPQRTDQSTNAKYIRDVWKMGIKVKVDEKGITRGKEIEYCILELLEGEKGKELKR  429

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA+EAV+EGGTS K IDEF
Sbjct  430   NASKWKELAREAVNEGGTSYKNIDEF  455



>ref|XP_011079130.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Sesamum indicum]
Length=462

 Score =   475 bits (1223),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 308/441 (70%), Gaps = 5/441 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD-AVGIDIISDGC  1278
             AH + +P+P+QGHINPMLQF KRL  K +K TLA+T F+ ++    S  ++ +  ISDG 
Sbjct  9     AHCLILPHPTQGHINPMLQFAKRLTCKHIKVTLALTRFLLSTTPGFSGGSISVRAISDGF  68

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G  QA S  +Y  RFQ  G +TLADL++    S  PVDCV+YD FMPWALDVAK  G
Sbjct  69    DEGGRAQAKSSDEYQARFQKIGQETLADLLQDLAGSGCPVDCVVYDPFMPWALDVAKGLG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             LFA  FFTQ+CAV+ +Y+  + G L+LP++   V +PGLPA+   +MPSFIY HGSYP  
Sbjct  129   LFAAAFFTQSCAVDNIYHHVYRGELELPLSGGEVVVPGLPAMRPDEMPSFIYDHGSYPGT  188

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F++VL+QF NV+KAD +F+N+F +LE +V++ MS+   V  IGP +PS+YLD R+++D E
Sbjct  189   FQMVLNQFRNVDKADWIFINTFDELEEEVLEWMSRSLRVKAIGPAIPSMYLDKRLQDDRE  248

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             Y   ++  D     +WLN +   SVIYV+FGS+A +  +Q  ELA   +    +FLWVVR
Sbjct  249   YDFTIFKPDTNACKNWLNQRQPKSVIYVSFGSLAQLTAEQTLELACALRACGNHFLWVVR  308

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  KLPENF  +  +K LIV+W PQL+VLA +AV CF TH GWNST+E+LSLGVP+V 
Sbjct  309   SSEEAKLPENFSEETSEKGLIVSWCPQLEVLAHEAVACFITHCGWNSTLESLSLGVPIVG  368

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKEMK---ENAMKW  210
             MPQWTDQ+ NAK + +VW  G R +  E+G+V R EI  CV+ V+EG+E K    NA KW
Sbjct  369   MPQWTDQSTNAKFVTEVWGTGIRAQADEEGLVRREEIVRCVKNVMEGEEGKVVSTNAAKW  428

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
             S +A+ AV EGG+SD+ I+EF
Sbjct  429   SSIARAAVDEGGSSDRNIEEF  449



>ref|XP_004289755.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   475 bits (1223),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 315/445 (71%), Gaps = 9/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS-----DAVGIDII  1290
             AH + IPYPSQGHINP+LQF K L  KG+K TL  T +I N+M   S     + + ++ I
Sbjct  10    AHCLVIPYPSQGHINPLLQFSKLLDHKGVKVTLVTTRYIYNTMYKGSCCTALETISLETI  69

Query  1289  SDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVA  1110
             SDG D+    Q  S+  YL  F   GS+TLA+LIE+   S  PVDC++YD+FMPW LD+A
Sbjct  70    SDGFDEGWKTQGVSIQAYLESFWKVGSQTLAELIEKLSVSGCPVDCLVYDAFMPWPLDIA  129

Query  1109  KSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGS  930
             K  G+    FFTQ+CAV+ +Y   + G+L+LP+T   + +PG+P LE  D+PSF+   GS
Sbjct  130   KKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSEISLPGMPPLEPLDLPSFLSDFGS  189

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YPA+FE+V+ QF N++KAD V  N+FY+LE QVVD ++K  PV  IGPT+PS YLDN +K
Sbjct  190   YPAFFEVVIGQFCNIDKADWVLCNTFYELEEQVVDWLAKFWPVRTIGPTIPSNYLDNLLK  249

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D  YG++L+       + WLN  P+ +V Y++FGS A +  +QM+ELAWG K + + FL
Sbjct  250   DDQGYGVDLFKSSNDACMKWLNKHPKNTVAYISFGSGAQLGLEQMQELAWGLKRSKSKFL  309

Query  569   WVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR+SE  K+PE F+ +  +K L+V+W  QL+VLA +AVGCF TH GWNST+E+LSLGV
Sbjct  310   WVVRESEAAKVPEGFIEETAEKGLVVSWCSQLEVLAHQAVGCFVTHCGWNSTLESLSLGV  369

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             P+VAMPQ TDQ+ NAK I DVW++G + +  E G+V R E+E C+ E++E   GKE+++N
Sbjct  370   PLVAMPQLTDQSTNAKYIKDVWEIGVKAQPDEKGIVRRDEVEHCINEIMEGDKGKEIQKN  429

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             AMKW  LA++AV +GG+S++ IDEF
Sbjct  430   AMKWKDLARKAVVDGGSSNRNIDEF  454



>ref|XP_006447928.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
 gb|ESR61168.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
Length=466

 Score =   475 bits (1222),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 229/443 (52%), Positives = 308/443 (70%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV--GIDIISDG  1281
             AH + + +PSQGHINPMLQF KRL  KG+K T   T F+  S+   S  +   ++ ISDG
Sbjct  14    AHCLVLAFPSQGHINPMLQFSKRLQHKGIKVTFVTTHFLYKSLHRNSSPIPIALEAISDG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D  G  QA+S+  Y+ RF   G +TL +L+E+   S  PVDC++YDS +PWALDVAK  
Sbjct  74    YDGGGTAQAESIDAYMERFWQIGPQTLTELVEKMNASSVPVDCIVYDSILPWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F TQ+CAV  +YY  + G L+LP+T   + +PG+P LE RDMPS +Y  GSYPA
Sbjct  134   GLLGATFLTQSCAVYCIYYHVNRGFLKLPLTGNEILLPGMPPLEPRDMPSLVYDSGSYPA  193

Query  920   YFELVLH-QFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               +L L  QF N +KAD V  N+FY+LE +V + + +  P+  IGPTVPS+YLD +++++
Sbjct  194   ISDLWLKSQFDNFDKADWVLSNTFYELEEEVAEWLGRHWPLKTIGPTVPSMYLDKQLEDN  253

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG +++  +    I WLN + +GSV+YV+FGS+A++  +++EELAWG K ++ YFLW 
Sbjct  254   KDYGFSMFKQNNESCIKWLNDQAKGSVVYVSFGSVATLKIEELEELAWGLKASDKYFLWA  313

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALSLGVPM
Sbjct  314   VRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLEALSLGVPM  373

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQWTDQ  N+K I+DVWK+G +      G+V R  I  C+ E+LE   GKE+K+N  
Sbjct  374   VAMPQWTDQGTNSKYIMDVWKMGLKAPADGKGIVRREAIAHCISEILEGERGKEIKQNTG  433

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KWS+ AKEAV++GG+SDK IDEF
Sbjct  434   KWSNFAKEAVAKGGSSDKNIDEF  456



>ref|XP_009783230.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Nicotiana sylvestris]
Length=458

 Score =   474 bits (1219),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 311/446 (70%), Gaps = 11/446 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP+QGHINPMLQF KRL SK +K T+A T     +M+ +S  V I+ ISDG D
Sbjct  6     AHCLILPYPAQGHINPMLQFSKRLQSKSVKITIATTKSFLKTMQELSTLVSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA S   Y+ RF+  GS TL+ LIE       PV+C+IYD F+PWA++VAK +GL
Sbjct  66    DGGHEQAGSFVTYITRFKEVGSDTLSHLIETLTTRGCPVNCIIYDPFLPWAVEVAKKYGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPALELRDMPSFIYVHGSYPA  921
                 FFTQ+CAV+ +YY  H G+++LP T     V +PGL  +E  D+P+F+  +     
Sbjct  126   ACAAFFTQSCAVDNIYYYVHKGVIKLPPTEVDEQVLVPGLLTIEKSDVPTFVS-NPESAK  184

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
               E+++ QF N+E  D V +NSFY+LE +++D MSK+ P+  IGPT+PS+YLD R+ ND 
Sbjct  185   ILEMLVDQFSNLENVDWVLINSFYELEKEIIDWMSKLYPIKTIGPTIPSIYLDKRLPNDK  244

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG++++     + ++WLN +P  SV+YV+FGS A ++  QMEELAWG +N+N  FLWVV
Sbjct  245   EYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSYAKLEPDQMEELAWGLRNSNKNFLWVV  304

Query  560   RDSELPKLPENFLGD-----DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             R +E  KLP+N+L +     ++K L+V+W PQL++L  K++GCF TH GWNST+EA+SLG
Sbjct  305   RSNEESKLPKNYLEELKLASENKGLVVSWCPQLQILEHKSIGCFLTHCGWNSTLEAISLG  364

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKE  225
             VPMVAMPQW+DQ  NAKL+ DVW++G R +  + G+V R  IE C+R V+E   GK +KE
Sbjct  365   VPMVAMPQWSDQPTNAKLVEDVWEIGVRAKQDDKGIVRREVIEECIRLVMEEEKGKMIKE  424

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA+ AV EGG+SD+ I+EF
Sbjct  425   NAKKWKELARNAVDEGGSSDRNIEEF  450



>ref|XP_003632087.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera]
Length=452

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 307/440 (70%), Gaps = 8/440 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H++ IPYP QGHINPMLQF KRL SKGLK TL  TT  + S +P S ++ ++ I  G  
Sbjct  10    THVLVIPYPVQGHINPMLQFSKRLASKGLKVTLITTTPTNKSKQPQSSSINMEHIPVGLQ  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
                  + +S+ DYL RF++  S +L +LI RY  S+ PV  ++YDS M WA D+ +   +
Sbjct  70    G----EEESLDDYLERFKLIVSSSLVELIGRYNGSEYPVRVLVYDSVMSWAQDIVERLSV  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+CAV+ +YY  + G  ++P+  P V IP +P L + D+PSFI    SYP  +
Sbjct  126   DGAPFFTQSCAVSTIYYHVNQGAFKIPLEGPTVSIPSMPILGVNDLPSFINDTSSYPTLW  185

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              LV  QF N EK + VF N+F +LE +VV  ++   P+  IGPT+PS+YLD R+ +D +Y
Sbjct  186   SLVKTQFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTIPSMYLDRRIDDDEDY  245

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G++L+  +    I WL+TK   SV+YV+FGS+AS+ ++QMEELAWG K +N+ FLWVVR+
Sbjct  246   GLSLFKPNADACITWLDTKDTVSVVYVSFGSLASLGEEQMEELAWGLKRSNSQFLWVVRE  305

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
              E  KLP NF+ +  +K L+V+W PQL+VLA KAVGCF TH GWNST+EALSLGVPMVAM
Sbjct  306   LEKKKLPSNFVEETSEKGLVVSWCPQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPMVAM  365

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKWS  207
             PQWTDQT NAK I DVW VG RV+VGE+G+V R EI+ C+REV+EG+    M+ NA +W 
Sbjct  366   PQWTDQTTNAKFIEDVWGVGVRVKVGENGIVKREEIKECIREVMEGERGNVMQRNAQRWK  425

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEAV+EGG+SD  I+EF
Sbjct  426   ELAKEAVNEGGSSDNNIEEF  445



>emb|CDP06918.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   473 bits (1218),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 225/441 (51%), Positives = 313/441 (71%), Gaps = 7/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM--KPVSDAVGIDIISDGC  1278
             H++ +PYP+QGHINP+LQFCKRLV+KG+KTT   + F+SNS+   P S A+  + ISDG 
Sbjct  8     HVLVLPYPAQGHINPLLQFCKRLVAKGVKTTFVNSVFVSNSIPADPKS-AINFEAISDGH  66

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G+  A+S   YL +    GSK LADLI + ++   PV  VIYDS + WALDVAK  G
Sbjct  67    DEGGYAAAESTGAYLEKLATFGSKKLADLIRKLEDKGEPVQAVIYDSLLTWALDVAKQFG  126

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ CAVN +YY  +HG+L +P++  P+ +PGLP L+ ++ PSF+Y+  S PA+
Sbjct  127   LVTASFFTQTCAVNSIYYNVYHGLLPVPLSDSPISLPGLPLLQPKETPSFVYLPDSSPAF  186

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               L+++QF N+++AD V +N+F+KLE   ++ M+K+  VI +GPTVPS+YLD R+++D  
Sbjct  187   LHLLVNQFSNIDQADWVILNNFHKLEEDALNWMAKLWRVITVGPTVPSIYLDKRLEDDIG  246

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YGINL+  + +  I+WLN++P+ SV+YVAFGS   +D +QMEE+A   K T   FLWVVR
Sbjct  247   YGINLFKPESSLCINWLNSQPKDSVVYVAFGSWTEIDVEQMEEIASALKETGFKFLWVVR  306

Query  557   DSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
               E  KLP  F  +  +K L+V WSPQL+VLA ++V CF TH G+NS +EALSLGVP+VA
Sbjct  307   AFEKEKLPSKFAEETSEKGLVVTWSPQLEVLAHESVACFVTHCGFNSVLEALSLGVPVVA  366

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
              PQWTDQ  NAK +VD+W VG +    + G+V R  +  C+ E++E   GK++KENA++W
Sbjct  367   APQWTDQPTNAKFLVDIWGVGVKADADDRGIVRRETLVSCISEIMEGEKGKQIKENAIEW  426

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAKEA+ +GG+SDK IDEF
Sbjct  427   KALAKEAIDDGGSSDKNIDEF  447



>gb|KEH25944.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=456

 Score =   473 bits (1217),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 310/439 (71%), Gaps = 4/439 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTL-AITTFISNSMKPVSDAVGIDIISDGCD  1275
             H + +PYP+QGH+NPM+QF KRL+ KG+K TL  +T+F          ++ ++ ISDG D
Sbjct  11    HCLILPYPAQGHMNPMIQFSKRLIEKGVKITLITVTSFWKVISNKNLTSIDVESISDGYD  70

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + G L A+S+ DY   F   GS+TL++L+ +  +S++P +CVI+D+F+PW LDV KS GL
Sbjct  71    EGGLLAAESLEDYKETFWKVGSQTLSELLHKLSSSENPPNCVIFDAFLPWVLDVGKSFGL  130

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+C+VN VYY  H  +++LP+T     +PGLP L   D+PSF+Y +GSYP YF
Sbjct  131   VGVAFFTQSCSVNSVYYHTHEKLIELPLTQSEYLLPGLPKLAPGDLPSFLYKYGSYPGYF  190

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ++V++QF N+ KAD +  NS Y+LE +VVD + K+ P+  IGP+VPS+ LD R+K+D EY
Sbjct  191   DIVVNQFANIGKADWILANSIYELEPEVVDWLVKIWPLKTIGPSVPSMLLDKRLKDDKEY  250

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G++L   +    I WLN KP+GSV+Y +FGSMA + ++Q +ELA G K++ +YFLWVVR+
Sbjct  251   GVSLSDPNTEFCIKWLNDKPKGSVVYASFGSMAGLSEEQTQELALGLKDSESYFLWVVRE  310

Query  554   SELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMP  375
              E  KLP+ ++    K LIV W PQL VL  +A+GCF TH GWNST+EALS+GVP++AMP
Sbjct  311   YEQNKLPKGYVESSKKGLIVTWCPQLLVLTHEALGCFVTHCGWNSTLEALSIGVPLIAMP  370

Query  374   QWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWSH  204
              WTDQ  NAKLI DVWK+G R    E  +V    I+ C++E++E   G E+K+NA+KW +
Sbjct  371   LWTDQVTNAKLIADVWKMGVRAVADEKEIVRSETIKNCIKEIIETEKGNEIKKNALKWKN  430

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LAK +V EGG SDK I+EF
Sbjct  431   LAKSSVDEGGRSDKNIEEF  449



>gb|ACM09899.2| glycosyltransferase [Withania somnifera]
Length=456

 Score =   473 bits (1216),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 312/445 (70%), Gaps = 11/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGH+NPMLQF KRL SK +K T+A T      M+ +  ++ I+ ISDG D
Sbjct  6     AHCLILPYPGQGHVNPMLQFSKRLQSKSVKITIATTKSFLKKMQKLPTSISIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA S   YL RF+  GS TL+ LIE+  NS SPV+C++YD F+PW ++VAK+ GL
Sbjct  66    DDGLDQARSYAAYLTRFKEVGSDTLSQLIEKLANSGSPVNCIVYDPFLPWVVEVAKNFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLP-ALELRDMPSFIYVHGSYP  924
                 FFTQ+CAV+ +YY  H G+L+LP T     + IPGL  A+E  D+PSF     S P
Sbjct  126   AIAAFFTQSCAVDNIYYHVHKGVLKLPPTQVDEEILIPGLSYAIESSDVPSF--ESTSEP  183

Query  923   AYF-ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
                 EL+ +QF N+EK D V +NSFY+LE  V+D MSK+ P+  IGPT+PS+YLD R+ +
Sbjct  184   DLLVELLANQFSNLEKTDWVLINSFYELEKHVIDWMSKIYPIKAIGPTIPSMYLDKRLPD  243

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D EYG++++       I+WLN +P  SV+YV+FGS+A ++ +QMEELAWG KN+N  FLW
Sbjct  244   DKEYGLSMFKPITDACINWLNHQPINSVLYVSFGSLAKLEAEQMEELAWGLKNSNKNFLW  303

Query  566   VVRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR +E PKLP+NF+ +   +K L+V+W PQL+VL  +++GCF TH GWNST+EA+SLGV
Sbjct  304   VVRSAEEPKLPKNFIEELPSEKGLVVSWCPQLQVLEHESIGCFMTHCGWNSTLEAISLGV  363

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMV +PQW+DQ  N KL+ DVW++G R +  + G+V R  IE C++ V+E   GK ++EN
Sbjct  364   PMVTLPQWSDQPTNTKLVKDVWEMGVRAKQDDKGLVRREVIEECIKLVMEEEKGKVIREN  423

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LA+ AV EGG+SDK I+EF
Sbjct  424   AKKWKELARNAVDEGGSSDKNIEEF  448



>ref|XP_004292062.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   473 bits (1216),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 315/447 (70%), Gaps = 11/447 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK----PVSDAVGIDIIS  1287
             AH + + YP+QGHINPMLQF K L  KGLK TL  T F+ N+++      S  V ++ IS
Sbjct  7     AHCLVLTYPTQGHINPMLQFAKFLHHKGLKVTLVTTHFLLNTLQLHAGSSSCNVALETIS  66

Query  1286  DGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAK  1107
             DG D+ G+  A+S   YLNRF   G  TL  L+ER  +S+ PVDC++YD+FMPW+LDVAK
Sbjct  67    DGYDEGGYAAAESADAYLNRFWEIGPLTLTKLLERMSSSEYPVDCIVYDAFMPWSLDVAK  126

Query  1106  SHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSP--PVRIPGLP-ALELRDMPSFIYVH  936
               G+F   FFTQ+CAV  +YY AH G+++LPV+     + IPGL   LE  D PS +   
Sbjct  127   KFGIFGAVFFTQSCAVGNIYYHAHKGLMKLPVSGDDGEILIPGLQLPLEAVDFPSSLCDL  186

Query  935   GSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNR  756
             GS  A +++V+ QF NV++AD V  N+FY+LE +VVD MSK+ P+  IGPT+PS+YLDNR
Sbjct  187   GSNHAVYDMVVGQFSNVDEADWVLCNTFYELEPEVVDWMSKLWPLKTIGPTIPSMYLDNR  246

Query  755   VKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTY  576
             +K D  YG+NL+  +    + WLN +P+ SV+YV+FGS + +  +QMEELAWG + + + 
Sbjct  247   LKEDKGYGVNLFKQNHDACMKWLNEQPKDSVVYVSFGSGSELGAEQMEELAWGLRISRSN  306

Query  575   FLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             FLWVVR+SE  K+PE F+ +  +K L+V+W PQL+VLA +AVGCF TH GWNST+EALSL
Sbjct  307   FLWVVRESEAGKIPEGFVEEISEKGLVVSWCPQLEVLAHEAVGCFITHCGWNSTLEALSL  366

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMK  228
             GVP++AMPQWTDQ  NAK I+DVWK G R    E+G+V +  +E C+ E++E   GKE +
Sbjct  367   GVPLLAMPQWTDQGTNAKYIMDVWKTGLRALPDENGIVKKDVVELCISELMEGEIGKESR  426

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
              NAMKW  +A+ A++EGG+S K IDEF
Sbjct  427   RNAMKWKEVARSAMAEGGSSAKNIDEF  453



>ref|NP_001234680.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
 emb|CAI62049.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
Length=456

 Score =   471 bits (1213),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/444 (50%), Positives = 314/444 (71%), Gaps = 9/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SK +K T+A+T     +MK +  ++ I+ ISDG D
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLRSKRVKITIALTKSFLKNMKELPTSMSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA +   Y+ RF+  GS TL+ LI++   S  PV+C++YD F+PWA++VAK  GL
Sbjct  66    DGGRDQAGTFVAYITRFKEIGSDTLSQLIQKLAISGCPVNCIVYDPFLPWAVEVAKQFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLP-ALELRDMPSFIYVHGSYP  924
              +  FFTQ C V+ +YY  H G+++LP T     + IPG P +++  D+PSF+ +     
Sbjct  126   ISAAFFTQNCVVDNLYYHVHKGVIKLPPTQNDEEILIPGFPNSIDASDVPSFV-ISPEAE  184

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                E++ +QF N++K DCV +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ +D
Sbjct  185   RIVEMLANQFSNLDKVDCVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDD  244

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++++     + ++WLN +P  SV+YV+FGS+A +  +QMEELAWG KN+N  FLWV
Sbjct  245   KEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKLGSEQMEELAWGLKNSNKSFLWV  304

Query  563   VRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VR +E PKLP NF+ +   +K L+V+W PQL+VL  +++GCF TH GWNST+EA+SLGVP
Sbjct  305   VRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAISLGVP  364

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVAMPQW+DQ  NAKL+ DVW++G R +  E GVV R  IE C++ V+E   GK ++ENA
Sbjct  365   MVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGVVRREVIEECIKLVMEEDKGKLIRENA  424

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  +A+  V+EGG+SDK I+EF
Sbjct  425   KKWKEIARNVVNEGGSSDKNIEEF  448



>ref|XP_009133642.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Brassica rapa]
Length=448

 Score =   471 bits (1212),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 323/446 (72%), Gaps = 20/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL+SKGLKTTL  TTF+ NS+KP  S  V I  ISDG 
Sbjct  6     GHVLAVPYPTQGHITPIRQFCKRLISKGLKTTLTFTTFVFNSIKPDPSGPVSIATISDGY  65

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  G     ++ +YL  F+  GS+T+AD+I +++ SDSP+ C++YD+F+PWALDVA+  G
Sbjct  66    DQ-GCESPYTIHEYLQNFKTFGSRTIADIIRKHQTSDSPITCMVYDAFIPWALDVAREFG  124

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             L A  FFTQ+CAVNYVYY ++  HG L+LPV         LP LEL+D+PSF+ V GSYP
Sbjct  125   LAAAPFFTQSCAVNYVYYLSYINHGSLKLPVED-------LPFLELQDLPSFLSVSGSYP  177

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             A+ E+VL QF N EKAD V +N+F +LE    + ++K+  V+ +GPTVPS+Y+D R+K+D
Sbjct  178   AFLEMVLQQFTNFEKADFVLINTFQELELHEKELLAKVCHVLTVGPTVPSMYIDQRIKSD  237

Query  743   SEYGINLYH-MDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
              +Y +NL+   D    I WLNT+P+GSV+YVAFGS+A ++  QMEELA   +N +  F+W
Sbjct  238   KDYDLNLFESKDSAFCISWLNTRPQGSVVYVAFGSIAKLNNVQMEELASAVRNFS--FMW  295

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVRDSE   LP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL+ GV
Sbjct  296   VVRDSEEENLPSGFLETVDKDKSLVLKWSPQLEVLSNKAIGCFLTHCGWNSTMEALAFGV  355

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQWTDQ MNAK I D WKVG  V+   E G+  R EIE  ++EV+EG   +EMKE
Sbjct  356   PMVAMPQWTDQPMNAKYIQDAWKVGVSVKTDKESGIAKREEIEFSIKEVMEGEKSEEMKE  415

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  416   NAKKWRDLAIKSLSEGGSTDINIDAF  441



>ref|XP_004289756.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   472 bits (1214),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 227/445 (51%), Positives = 312/445 (70%), Gaps = 9/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS-----DAVGIDII  1290
             AH +  PYPSQGHINP+LQF K L  KG+K TL  T FI N+M   S     + + ++ I
Sbjct  10    AHCLVFPYPSQGHINPLLQFSKLLDHKGVKVTLVTTRFIYNTMYKGSCCTALETISLEAI  69

Query  1289  SDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVA  1110
             SDG D+    Q  S+  YL  F   GS+ L +LIE+   S  PVDC++YD+ MPW LD+A
Sbjct  70    SDGFDEGWKTQGVSIQAYLESFWKVGSQNLFELIEKLSGSGCPVDCLVYDAIMPWPLDIA  129

Query  1109  KSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGS  930
             K  G+    FFTQ+CAV+ +Y   + G+L+LP+T   + +PG+  LE  D+PSF+   GS
Sbjct  130   KKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSEISLPGMLPLEPLDLPSFLSDFGS  189

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YPAYFE+V+ QF NV+KAD V  N+FY+LE QVVD ++K  PV  IGPT+PS YLDNR+K
Sbjct  190   YPAYFEVVVGQFCNVDKADWVLCNTFYELEEQVVDWLAKFWPVRTIGPTIPSNYLDNRLK  249

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D  YG++L+       + WLN  P+ SV Y++FGS A +  +QMEELAWG K + + FL
Sbjct  250   DDKGYGVDLFKSSNDACMKWLNKHPKNSVAYISFGSAAQLGLEQMEELAWGLKRSKSKFL  309

Query  569   WVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR+SE  K+PE F+ +  +K L+V+W  Q++VLA +AVGCF TH GWNST+E+LSLGV
Sbjct  310   WVVRESEAAKVPEGFIKEIAEKGLVVSWCSQIEVLAHEAVGCFITHCGWNSTLESLSLGV  369

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             P+VAMPQ++DQ+ NAK I DVW++G + +  E G+V R E+E C+ E++E   GKE+++N
Sbjct  370   PLVAMPQYSDQSTNAKYIKDVWEIGVKAQPDEKGIVRREEVERCINEIMEGDNGKEIQKN  429

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             AMKW  LA++AV +GG+S++ IDEF
Sbjct  430   AMKWKDLARKAVVDGGSSNRNIDEF  454



>ref|XP_009783229.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana sylvestris]
Length=462

 Score =   471 bits (1213),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 311/443 (70%), Gaps = 8/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP+QGHINPMLQF KRL SKG+KTT+A T     +M+ +S +V ++ ISDG D
Sbjct  6     AHCLILPYPAQGHINPMLQFSKRLQSKGVKTTIAATKSFLKNMQELSTSVSVEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA +   Y  RF+  GS TL+ LI +  N   PV C++YD F+PWA++VAK  GL
Sbjct  66    DGGREQAGTFVAYFTRFKEVGSDTLSQLIGKLTNCGCPVSCIVYDPFLPWAVEVAKKFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
                 FFTQ+C V+ +YY  H G+L+LP T     + IPGL  +E  D+P+F  +      
Sbjct  126   ATAAFFTQSCTVDNIYYHVHKGVLKLPPTDIDEEISIPGLLTVETSDVPTF-EISPESAR  184

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
               E++++QF N+EK D V +NSFY+LE +V+D MS++ P+  IGP +PS+YLD R+ +D 
Sbjct  185   VLEMLVNQFSNLEKVDWVLINSFYELEKEVIDWMSEVYPIKTIGPAIPSMYLDKRLPDDK  244

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG++++       ++WLN +P  SV+YV+FGS+A V+ +QMEELAWG +N+N  FLWVV
Sbjct  245   EYGLSVFKPMTDACLNWLNHQPVSSVVYVSFGSLAKVEAEQMEELAWGLRNSNKNFLWVV  304

Query  560   RDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R +E  KLP+NF+ +   +K L+V+W PQL+VL  K++GCF TH GWNST+EA+SLGVPM
Sbjct  305   RSTEESKLPKNFVEELASEKGLVVSWCPQLQVLEHKSIGCFLTHCGWNSTLEAISLGVPM  364

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQW+DQ  NAKL+ DVW++G R +  E G+V R  IE C++ V+E   GK ++ENA 
Sbjct  365   VAMPQWSDQPTNAKLVKDVWEMGVRAKQDEKGIVRREIIEECIKIVMEEEKGKMIRENAK  424

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  L ++AV EGG+S++ I+EF
Sbjct  425   KWKELTRKAVDEGGSSNRNIEEF  447



>dbj|BAG80538.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=461

 Score =   470 bits (1209),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 312/449 (69%), Gaps = 14/449 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SKG+K T+A T     +M+ +  +V I+ ISDG D
Sbjct  6     AHCLILPYPLQGHINPMLQFSKRLQSKGVKITIAPTKSFLKTMQELPTSVSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA+S   Y+ RF+  GS TL  LI++  N + PV+C+ YD F+PWA++VAK+ GL
Sbjct  66    DGGIDQAESFLAYITRFKEVGSDTLTQLIQKLTNCECPVNCIGYDPFLPWAVEVAKNFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA--LELRDMPSFIYVHGSY  927
              +  FFTQ C V+ +YY  H G+++LP T     + IPGL +  +E  D+PSF     S 
Sbjct  126   VSAAFFTQNCTVDNIYYHVHKGVIKLPPTEVDEQILIPGLSSTTVESSDVPSFESSPQS-  184

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
                 EL+++QF N+EK D V +NSFYKLE +V+D M+K+ P+  IGPT+PS+YLD R+ N
Sbjct  185   DKLVELLVNQFSNLEKVDWVLINSFYKLEKEVIDWMAKLYPIKTIGPTIPSMYLDRRLPN  244

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D EYG++L+     + ++WLN +P  SV+YV+FGSMA V+ +Q+EE+AWG KN+N  FLW
Sbjct  245   DKEYGLSLFKPMANECLNWLNNQPISSVVYVSFGSMAKVEAEQLEEVAWGLKNSNKNFLW  304

Query  566   VVRDSELPKLPENFLG------DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEAL  405
             VVR +E PKLP+N L       +++K L+V+W PQL+VL   ++GCF TH GWNST+EA+
Sbjct  305   VVRSTEEPKLPKNLLEELKSTCENNKGLVVSWCPQLQVLEHNSIGCFLTHCGWNSTLEAI  364

Query  404   SLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKE  234
             SLGVPMV MPQW+DQ  NAKL+ DVW++G R +  E G+V R  IE C++ V+E   GK 
Sbjct  365   SLGVPMVTMPQWSDQPTNAKLVQDVWQMGVRAKQDEKGIVRRDIIEECIKLVMEEEKGKV  424

Query  233   MKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             + EN  KW  LA+ A+ EGG+SDK I+EF
Sbjct  425   IMENVKKWKELARNAMDEGGSSDKNIEEF  453



>ref|XP_006447240.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
 ref|XP_006469903.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ESR60480.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
Length=468

 Score =   469 bits (1208),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 311/444 (70%), Gaps = 9/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM----KPVSDAVGIDIISD  1284
             H + + YP+QGHINP+LQF KRL  KGLK TL  T FIS S+       S ++ ++ ISD
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLEHKGLKVTLVTTHFISKSLHRDSSSPSTSIALEAISD  74

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ G  QA+ V  YL RF   G ++L +L+E    S  PVDC++YDSF+PWALDVAK 
Sbjct  75    GYDEGGSAQAEGVEAYLERFWQIGPRSLCELVENMNGSGVPVDCIVYDSFLPWALDVAKK  134

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GL    F TQ+C V+ +YY  + G+L+LP+    + +PG+P LE +DMPSF+Y  GSYP
Sbjct  135   FGLVGAAFLTQSCVVDCIYYHVNKGLLKLPLLDSQLLLPGMPPLEPQDMPSFVYDLGSYP  194

Query  923   AYFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             A  ++V+ +QF N++KAD V  N+FY+LE +V   + K   +  IGPT PS+YL  +++ 
Sbjct  195   AVSDMVVKYQFDNIDKADWVLCNTFYELEKEVAQWLGKHWSLKTIGPTKPSMYLGKQIEE  254

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D +YG +++  +    I WLN +  G V+YV+FGSMA++  ++MEELAWG K ++ YFLW
Sbjct  255   DKDYGFSIFKPNNESCIKWLNDRANGCVVYVSFGSMATLKIEEMEELAWGLKASDKYFLW  314

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EA SLGVP
Sbjct  315   VVRESEQSKLPENFSEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVP  374

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENA  219
             MVAMPQWTDQ+ N+K ++DVWK G +V   + G+V R  I  C+RE+LEG   KE+++NA
Sbjct  375   MVAMPQWTDQSTNSKCVMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERCKEIRQNA  434

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KWS+ AKEAV++GG+SDK ID+F
Sbjct  435   GKWSNFAKEAVTKGGSSDKNIDDF  458



>ref|XP_011082052.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=457

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 313/440 (71%), Gaps = 9/440 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H + +P+P QGHINPMLQF KRL  KG++ TLA T  +  + +  S ++ ++ ISDG D+
Sbjct  12    HCLVLPFPIQGHINPMLQFSKRLSHKGIRITLAATKHLFKTTQQFSGSISVETISDGFDE  71

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              G    D  P YL RF+  G++TL++L+++ ++S  PVDCVIYD F+PWA+ VAK HGL 
Sbjct  72    -GKADVDLDP-YLARFEQVGTETLSELLDKLRDSGRPVDCVIYDPFLPWAVVVAKKHGLV  129

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
                FFTQ+ +VN +YY  + G L++P+    + + GLP LE+ D+PSF+    S+P  FE
Sbjct  130   GAAFFTQSSSVNSIYYNVYKGQLKVPLLDKEIAVAGLPLLEISDVPSFVRDQDSHPGSFE  189

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             LVL+QF NVE+AD VFVNSFY+LE +V D M+K+ PV  IGPT PS+YLD R+  D +Y 
Sbjct  190   LVLNQFRNVEEADFVFVNSFYELEEEVTDLMAKILPVKTIGPTTPSMYLDKRLTEDKDYD  249

Query  731   INLYHMDPTKS-IDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             ++++   P  S + WL  +   SVIYV+FGSMA ++ +QMEELA G K TN YFLWVVR 
Sbjct  250   LSIFK--PVNSCMKWLEERTNKSVIYVSFGSMAKLEGEQMEELALGLKMTNKYFLWVVRS  307

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP++F+ +  +K LIV+W PQL+VLA  A+GCF TH GWNST+EALSLGVPMVA+
Sbjct  308   SEESKLPKSFVQETQEKGLIVSWCPQLEVLAHDAIGCFITHCGWNSTLEALSLGVPMVAV  367

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMKWS  207
             P W+DQ+ NAKL++DVWK+G R R     +V R EI  C++ V+EG+   E+++NA KW 
Sbjct  368   PWWSDQSTNAKLVMDVWKMGIRARPDVKDIVGREEIVRCIKHVMEGEEGNEVRKNAKKWR  427

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LA++AV EGG+SD+ I EF
Sbjct  428   ELARKAVDEGGSSDRNIQEF  447



>ref|XP_009630995.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana tomentosiformis]
 gb|AAF61647.1|AF190634_1 UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum]
Length=459

 Score =   469 bits (1206),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 311/443 (70%), Gaps = 8/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP+QGHINPMLQF KRL SKG+K T+A T     +M+ +S +V ++ ISDG D
Sbjct  6     AHCLILPYPAQGHINPMLQFSKRLQSKGVKITIAATKSFLKTMQELSTSVSVEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA +   Y+ RF+  GS TL+ LI +  N   PV C++YD F+PWA++V  + G+
Sbjct  66    DGGREQAGTFVAYITRFKEVGSDTLSQLIGKLTNCGCPVSCIVYDPFLPWAVEVGNNFGV  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
                 FFTQ+CAV+ +YY  H G+L+LP T     + IPGL  +E  D+PSF+  +     
Sbjct  126   ATAAFFTQSCAVDNIYYHVHKGVLKLPPTDVDKEISIPGLLTIEASDVPSFVS-NPESSR  184

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
               E++++QF N+E  D V +NSFY+LE +V+D M+K+ P+  IGPT+PS+YLD R+ +D 
Sbjct  185   ILEMLVNQFSNLENTDWVLINSFYELEKEVIDWMAKIYPIKTIGPTIPSMYLDKRLPDDK  244

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG++++       ++WLN +P  SV+YV+FGS+A ++ +QMEELAWG  N+N  FLWVV
Sbjct  245   EYGLSVFKPMTNACLNWLNHQPVSSVVYVSFGSLAKLEAEQMEELAWGLSNSNKNFLWVV  304

Query  560   RDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R +E  KLP NFL +   +K L+V+W PQL+VL  K++GCF TH GWNST+EA+SLGVPM
Sbjct  305   RSTEESKLPNNFLEELASEKGLVVSWCPQLQVLEHKSIGCFLTHCGWNSTLEAISLGVPM  364

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             +AMP W+DQ  NAKL+ DVW++G R +  E G+V R  IE C++ V+E   GK+++ENA 
Sbjct  365   IAMPHWSDQPTNAKLVEDVWEMGIRPKQDEKGLVRREVIEECIKIVMEEKKGKKIRENAK  424

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LA++AV EGG+SD+ I+EF
Sbjct  425   KWKELARKAVDEGGSSDRNIEEF  447



>ref|XP_009133641.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Brassica rapa]
Length=431

 Score =   468 bits (1204),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/433 (56%), Positives = 313/433 (72%), Gaps = 19/433 (4%)
 Frame = -2

Query  1415  INPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGCDDAGFLQADSVPD  1239
             + P+ QFCKRL+SKGLKTTL +TTFI NS+KP  S  V I  ISDG DD GF  + S+ D
Sbjct  1     MTPIRQFCKRLISKGLKTTLTLTTFIFNSIKPDPSGPVSIATISDGDDDHGFDPSGSIHD  60

Query  1238  YLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFAGCFFTQACAV  1059
             YL  F+  GS+T+AD+I +++ SD+P+ C++YD+FMPWALDVA+  GL A  FFTQ+CAV
Sbjct  61    YLQNFKTFGSRTIADIIRKHQTSDNPITCIVYDAFMPWALDVAREFGLAATPFFTQSCAV  120

Query  1058  NYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFELVLHQFLNV  885
             N+VYY ++   GIL+LPV         LP LEL+D+PSF+ V GSYPAYFE+VL QF N 
Sbjct  121   NFVYYLSYINDGILKLPVVD-------LPFLELQDLPSFLSVSGSYPAYFEMVLQQFTNF  173

Query  884   EKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYGINLY-HMDP  708
             EKAD + VN+F +LE    + +S +  V+ IGPT+PS+YLD R+K+D+ Y +N++   D 
Sbjct  174   EKADFILVNTFQELEPHEKELLSNVCHVLTIGPTIPSMYLDQRIKSDTAYDLNIFDSKDA  233

Query  707   TKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDSELPKLPEN  528
                  WL+T+P+GSV+YVAFGS+A ++  QMEELA    N N  FLWVVR SE  KLP  
Sbjct  234   AFCTSWLDTRPQGSVVYVAFGSLAELNNAQMEELASAVSNFN--FLWVVRGSEEAKLPSG  291

Query  527   FLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMPQWTDQTM  354
             FL   D DK L++ WSPQL+VL++KA+ CF TH GWNST+EAL+ GVPMVAMPQWTDQ M
Sbjct  292   FLETVDKDKGLVLKWSPQLEVLSNKAICCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPM  351

Query  353   NAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKENAMKWSHLAKEAV  186
             NAK I DVWK G  V++  E G+  RGEIE  ++EV+EG   +EMKENA KW  LA +++
Sbjct  352   NAKYIQDVWKAGVCVKIDNESGIAKRGEIEFSIKEVMEGEKSEEMKENAKKWRDLAVKSL  411

Query  185   SEGGTSDKVIDEF  147
             SEGG++D  ID F
Sbjct  412   SEGGSTDVNIDTF  424



>emb|CDP03926.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 308/440 (70%), Gaps = 5/440 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGCD  1275
             H++A+P+P QGHINP+LQFCKRL +KG+K T A T  +S SM      ++  + ISDG D
Sbjct  9     HVLALPFPVQGHINPLLQFCKRLEAKGVKVTFANTVSLSKSMHADPKRSINFETISDGYD  68

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G+  A+S   Y+ +F   GSKTLADLI + K+   PV  VIYD  + WALDVAK  GL
Sbjct  69    DGGYAAAESFEAYVEKFATVGSKTLADLITKLKDDGEPVQAVIYDPHLTWALDVAKRFGL  128

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ CAVN +YY  +HG+L +P++  P+ +PGLP L+ ++ PSFIY+  SYPA+ 
Sbjct  129   VTAAFFTQTCAVNSIYYHVYHGLLPVPLSDSPISLPGLPLLQPKETPSFIYLPDSYPAFR  188

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              ++L+QF NV++AD V +++F+KLE  V++ M+++  V  +GPTVPS+YLD R+++D+ Y
Sbjct  189   HILLNQFSNVDQADWVILSNFHKLEEDVLNWMARLWRVKTVGPTVPSMYLDKRLEDDTGY  248

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             GINL+  D +  I+WL+ +P+ SV+YVAFGS   ++ +Q+EE+A         FLWVVR 
Sbjct  249   GINLFKPDSSLCINWLDNQPKDSVVYVAFGSWIGIEAEQVEEIASALMEIGYRFLWVVRA  308

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
              E  KLP NF+G+  +K L+V WSPQL+VLA ++V CF TH G NS +EALSLGVP+VA 
Sbjct  309   LEKEKLPSNFVGETSEKGLVVTWSPQLEVLAHESVACFVTHCGLNSAMEALSLGVPVVAA  368

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             PQ TDQ  NAK I DVW VG R    E G+V R  +  C+RE++E   GK++KEN +KW 
Sbjct  369   PQLTDQPTNAKFIEDVWGVGVRAAADEKGIVRRETLVSCIREIMEGERGKQIKENGIKWK  428

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEA+ EGG+SD+ IDEF
Sbjct  429   TLAKEAIDEGGSSDRNIDEF  448



>gb|KEH25945.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   466 bits (1200),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 223/444 (50%), Positives = 310/444 (70%), Gaps = 11/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTF-----ISNSMKPVSDAVGIDII  1290
             AH + +PYP+QGH+NPM+QF KRL+ KG+K TL IT +     I N  K +S  + ++ I
Sbjct  10    AHCLILPYPAQGHMNPMIQFSKRLIEKGVKVTL-ITVYSYWKTIKN--KNLSSNIEVESI  66

Query  1289  SDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVA  1110
             SDG DD G+  A S   Y+  F   GS+TL +L+ +  +S +P +CVI+D+FMPWALDVA
Sbjct  67    SDGYDDGGYESAKSFDVYIQTFWRVGSQTLCELLHKLSSSKTPPNCVIFDAFMPWALDVA  126

Query  1109  KSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGS  930
             K+ GL    FFTQ+C+VN +Y+  H  +++LP++     +PGLP L   D+PSF+Y +GS
Sbjct  127   KNFGLLGVPFFTQSCSVNSIYFHTHQKLIELPISQSEYLLPGLPKLAQGDLPSFLYKYGS  186

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YP  F++V++QF N+ KAD +  N+FY+LE +VVD +SK+ P+  IGP+VPS +LD R+K
Sbjct  187   YPIIFDVVVNQFSNIGKADWILANTFYELEPEVVDWLSKIWPLKTIGPSVPSSHLDKRIK  246

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D EYG+++   +   SI WLN KP+ SV+YV+FGS A + ++Q+EELA G  ++  YFL
Sbjct  247   DDKEYGVSVSDPNTESSIKWLNEKPKRSVVYVSFGSNARLSEEQIEELALGLNDSEKYFL  306

Query  569   WVVRDSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             WVVR+SE  KLP+ F       LIV W PQL+VL  +AV CF TH GWNST+EALS+GVP
Sbjct  307   WVVRESEQVKLPKGFEETSKNGLIVTWCPQLEVLTHEAVACFVTHCGWNSTLEALSIGVP  366

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             ++AMP WTDQ  NAK I DVWK+G R    E  +V    I+ C++E++E   G E+K+NA
Sbjct  367   LIAMPLWTDQATNAKFIADVWKMGVRAVADEKEIVRSETIKNCIKEIIETEKGNEIKKNA  426

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
             +KW +LAK +V EGG SDK I+EF
Sbjct  427   LKWKNLAKSSVDEGGRSDKNIEEF  450



>dbj|BAD95102.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=431

 Score =   465 bits (1196),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 236/433 (55%), Positives = 311/433 (72%), Gaps = 19/433 (4%)
 Frame = -2

Query  1415  INPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGCDDAGFLQADSVPD  1239
             I P+ QFCKRL SKG KTT  +TTFI N++    S  + I  ISDG D  GF  A SVP+
Sbjct  1     ITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGYDQGGFSSAGSVPE  60

Query  1238  YLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFAGCFFTQACAV  1059
             YL  F+  GSKT+AD+I +++++D+P+ C++YDSFMPWALD+A   GL A  FFTQ+CAV
Sbjct  61    YLQNFKTFGSKTVADIIRKHQSTDNPITCIVYDSFMPWALDLAMDFGLAAAPFFTQSCAV  120

Query  1058  NYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFELVLHQFLNV  885
             NY+ Y ++  +G L LP       I  LP LEL+D+P+F+   GS+ AYFE+VL QF N 
Sbjct  121   NYINYLSYINNGSLTLP-------IKDLPLLELQDLPTFVTPTGSHLAYFEMVLQQFTNF  173

Query  884   EKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYGINLYHM-DP  708
             +KAD V VNSF+ L+    + +SK+ PV+ IGPTVPS+YLD ++K+D++Y +NL+ + + 
Sbjct  174   DKADFVLVNSFHDLDLHEEELLSKVCPVLTIGPTVPSMYLDQQIKSDNDYDLNLFDLKEA  233

Query  707   TKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDSELPKLPEN  528
                 DWL+ +PEGSV+Y+AFGSMA +  +QMEE+A    N +  +LWVVR SE  KLP  
Sbjct  234   ALCTDWLDKRPEGSVVYIAFGSMAKLSSEQMEEIASAISNFS--YLWVVRASEESKLPPG  291

Query  527   FLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMPQWTDQTM  354
             FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+E LSLGVPMVAMPQWTDQ M
Sbjct  292   FLETVDKDKSLVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVAMPQWTDQPM  351

Query  353   NAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKENAMKWSHLAKEAV  186
             NAK I DVWKVG RV+   E G+  R EIE  ++EV+EG   KEMKENA KW  LA +++
Sbjct  352   NAKYIQDVWKVGVRVKAEKESGICKREEIEFSIKEVMEGEKSKEMKENAGKWRDLAVKSL  411

Query  185   SEGGTSDKVIDEF  147
             SEGG++D  I+EF
Sbjct  412   SEGGSTDININEF  424



>ref|XP_011037065.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Populus euphratica]
Length=461

 Score =   466 bits (1199),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 226/441 (51%), Positives = 310/441 (70%), Gaps = 10/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H+V IPYP+QGHINPM+QF K L SKGL+ TL I +  ++S       V +  ISDG D 
Sbjct  9     HVVVIPYPAQGHINPMIQFSKHLASKGLQVTLVIFSSPTHSTPASLGCVKVVTISDGSDT  68

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLI-ERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
                  + S+ D L +FQ   ++ L+ L+ E   +S  PV C++YDSFMPW L++A+  GL
Sbjct  69    G----SRSIADLLKQFQATVTQKLSQLVVELGISSGHPVSCLVYDSFMPWVLEIARHLGL  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIY-VHGSYPAY  918
                 FFTQ+CAVN VYY  H G L++P+   PV +PGLP L++ ++PSF++ +   Y A 
Sbjct  125   TGASFFTQSCAVNSVYYQIHEGQLKIPLEKFPVSVPGLPPLDVDELPSFVHDMESGYSAI  184

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               LV++QFLN   AD VFVNSF  LE +VV+ ++    + PIGP +PS+YLD ++++D+E
Sbjct  185   LTLVVNQFLNFRGADWVFVNSFNTLEEEVVNWLAGQRSIKPIGPMIPSVYLDRQLEDDTE  244

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++L+       ++WL++K  GSV+YV+FGS+A++ ++QM E+AWG   +  YFLWVVR
Sbjct  245   YGLSLFKPALDGCMEWLDSKETGSVVYVSFGSLAALGEEQMAEIAWGLWRSGCYFLWVVR  304

Query  557   DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +SE  KLP NF+ G  +K LIV WSPQL+VL+ K+VGCF TH GWNST+EALSLGVPMVA
Sbjct  305   ESEEKKLPCNFMEGSSEKGLIVTWSPQLEVLSHKSVGCFMTHCGWNSTLEALSLGVPMVA  364

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMKW  210
             MPQWTDQ  NAK I DVW+VG RV+  E G+V++ E+E C+REV+EG+   EM+ N+ KW
Sbjct  365   MPQWTDQPTNAKYIADVWRVGVRVKANEKGIVTKEELEKCIREVMEGERGSEMRRNSEKW  424

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAK A+ EGG+S+K I EF
Sbjct  425   KKLAKTAMGEGGSSEKNITEF  445



>ref|XP_004489724.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cicer arietinum]
 gb|AGU14099.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   466 bits (1198),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 312/441 (71%), Gaps = 6/441 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTL--AITTFISNSMKPVSDAVGIDIISDGC  1278
             H + +PYP+QGH+NPM+QF  RL+ K +K TL   ++ + + + K +S  + ++ ISDG 
Sbjct  11    HCLILPYPAQGHMNPMIQFSNRLIQKQVKVTLITVVSLWKTITNKNLSSNIQVETISDGY  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD GF  A +V DY   F   GSKTL+ L+ +  +S++P +CVI+D+F+PW LDV+K+ G
Sbjct  71    DDGGFESAKTVEDYKQTFWSVGSKTLSQLLHKLASSNNPPNCVIFDAFLPWVLDVSKTFG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFTQ+C+VN +YY  H  +++LP++     +PGLP L   D+PSF+Y +GSYP Y
Sbjct  131   LLGVAFFTQSCSVNSIYYHTHQKLIELPLSKSDYLLPGLPKLHQSDLPSFLYKYGSYPGY  190

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F++V++QF N+ KAD +  N+ Y+LE +VVD + K+ P+  IGP+VPS+ LD R+K+D E
Sbjct  191   FDIVVNQFANIGKADWILANTIYELEPEVVDWLVKIWPLKTIGPSVPSMLLDKRLKDDKE  250

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+++ + +    I WLN KP+GSV+YV+FGSMA + + Q  ELA+G K+++T+FLWVVR
Sbjct  251   YGVSISNPNTEVCIKWLNEKPKGSVVYVSFGSMAGLSEDQTIELAYGLKDSDTFFLWVVR  310

Query  557   DSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             D E  KLP+ F+    +K LIV W PQL+VL  +++GCF TH GWNST+EALSLGV ++A
Sbjct  311   DCEQVKLPKGFVESSLEKGLIVTWCPQLQVLTHESLGCFVTHCGWNSTLEALSLGVVVIA  370

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             MP WTDQ  NAKLI DVWK G +    E  +V R  ++ C++E++E   G E+K+NAMKW
Sbjct  371   MPLWTDQVTNAKLIADVWKTGVKAFADEKEIVRRETVKNCIKEIIETEKGNELKKNAMKW  430

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               +AK++V EGG SD+ I EF
Sbjct  431   MSIAKDSVDEGGRSDQNIAEF  451



>ref|XP_008236255.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Prunus mume]
Length=459

 Score =   466 bits (1198),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 238/445 (53%), Positives = 315/445 (71%), Gaps = 10/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDI--ISD  1284
             AH + +P+P QGHINPMLQF K L  KG+K TL  T +I  +M    S  + +D+  ISD
Sbjct  10    AHCLVLPFPGQGHINPMLQFAKLLAHKGVKVTLVTTRYIHKTMYGSASSCIALDLETISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+AG  +  S+  YL  F   GSKTLA+L+E+  +S SPVDCVIYD+FM W LD+A+ 
Sbjct  70    GYDEAGRGET-SIDAYLESFWKVGSKTLAELLEKLSSSGSPVDCVIYDAFMTWPLDIARK  128

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIP--GLPALELRDMPSFIYVHGS  930
              G+    FFTQ+CAV  +YY  H G+L+LP+     +I   GLP LE  D+PSF+Y  GS
Sbjct  129   FGISGAVFFTQSCAVENIYYHIHEGLLKLPLADDQSQISFPGLPPLEPLDLPSFLYDFGS  188

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YPA++E+++ QF NV+KAD +  N+FY+LE QVVD ++K  P+  +GPT+PS YLD R++
Sbjct  189   YPAFYEVLVGQFSNVDKADWILSNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLE  248

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D EYG+NL+  D    I WLN +P+GSV YV+FGS A +  +QMEELAWG +   + FL
Sbjct  249   DDKEYGVNLFKSDNDACIKWLNERPKGSVAYVSFGSAARLGIEQMEELAWGLRRGKSNFL  308

Query  569   WVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR SE  K+P+ F+ +  +K L+V+W  Q++VLA +AVGCF TH GWNST+EALSLGV
Sbjct  309   WVVRASEAAKVPKGFVEETSEKGLVVSWCSQMEVLAHEAVGCFVTHCGWNSTLEALSLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PM+AMPQWTDQT NAK I+DVWK+G      E G+V    +E C+ E++E   GKEMK N
Sbjct  369   PMLAMPQWTDQTTNAKFIMDVWKIGLTAPSDEKGLVGPEVVEHCISEIMEGERGKEMKIN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A+KW  LAK+AV+EGG+SDK IDEF
Sbjct  429   ALKWKELAKKAVAEGGSSDKNIDEF  453



>ref|XP_010037076.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW48701.1| hypothetical protein EUGRSUZ_K02352 [Eucalyptus grandis]
Length=458

 Score =   465 bits (1197),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 225/441 (51%), Positives = 309/441 (70%), Gaps = 7/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDGC  1278
             H + + +P+QGHINPMLQF KRL+ KG   T   T F+S ++  +S   ++ ++ ISDG 
Sbjct  11    HCLVLSFPAQGHINPMLQFSKRLIHKGAGVTFVTTRFMSKTLHGLSSNPSISLESISDGF  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD G   A S   YL RF   G +TL++L+ER  +S  P  C++Y+SF+PW LDVA+ +G
Sbjct  71    DDGGMKAASSPEAYLERFWKIGPETLSELVERLISSGRPPSCIVYNSFLPWVLDVAQKYG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFT +CAV+ V+Y    G+L++PV    V +PG+P LE +DMPS++    SYPAY
Sbjct  131   LVGAVFFTMSCAVSSVFYHCQKGLLEVPVRKQ-VLLPGMPPLEPQDMPSYVSDPESYPAY  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               +++ QF N++K D V  N+ Y+LE ++VD   K+ P   IGPTVPS YLDNR++ D E
Sbjct  190   LGMLVGQFSNLDKVDWVLCNTVYELEQELVDWFMKVMPFRTIGPTVPSFYLDNRLEQDRE  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++++  +   ++ WL+TKP+GSV+YV+FGS+A +   QM+ELA G K +N YFLWVVR
Sbjct  250   YGLSIFQPEHDTTMKWLSTKPKGSVVYVSFGSVAELKIDQMQELAMGLKRSNRYFLWVVR  309

Query  557   DSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
               E  KLP+++  +   K LIV W PQL+VLA +A+G F TH GWNST+EAL+LGVPM+A
Sbjct  310   SFEEDKLPQDYAKETAQKGLIVTWCPQLEVLAHEALGIFLTHCGWNSTLEALTLGVPMMA  369

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             +PQWTDQ MNAK I+DVWK+G R  V E GVV   +IE C+RE++E   GKEM+ENA KW
Sbjct  370   IPQWTDQPMNAKHIMDVWKMGLRPPVDERGVVRHEDIENCIREIMEGERGKEMRENAGKW  429

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               + KEAVSEGG+SD+ I+EF
Sbjct  430   RKITKEAVSEGGSSDRNIEEF  450



>ref|XP_006357048.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=460

 Score =   465 bits (1197),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 221/448 (49%), Positives = 315/448 (70%), Gaps = 13/448 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +P+P QGHINPMLQF KRL SK +K T+A T     +M  +S +V ID ISDG +
Sbjct  6     AHCLILPFPLQGHINPMLQFSKRLQSKRIKITIAPTKSFLKNMNELSTSVSIDTISDGYN  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA++   Y  RF+  GS TLA LI++  NS  PV+C++YD F+PWA++VAK+ GL
Sbjct  66    DGGIYQAENFLAYTTRFKEVGSDTLAQLIQKLANSGCPVNCIVYDPFLPWAVEVAKNFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSFIYVHGSYP  924
              +  FFTQ CAV+ +YY  H G+++LP T     + IPG  + +E  D+P+F+ ++    
Sbjct  126   ISAAFFTQNCAVDNIYYHVHKGVIKLPPTQNDEEILIPGFSSTIEASDVPTFV-INPEGE  184

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                E++++QF N++K D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ +D
Sbjct  185   RILEMLVNQFSNLDKVDWVLINSFYELEKEVIDYMSKIYPIKTIGPTIPSMYLDKRLHDD  244

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++++     + ++WLN +P  SV+YV+FGS+ +++ +QM ELAWG KN+N  FLWV
Sbjct  245   KEYGLSVFKPMTNECLNWLNHQPINSVVYVSFGSITNLEAEQMLELAWGLKNSNNNFLWV  304

Query  563   VRDSELPKLPENFLGD------DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALS  402
             VR +E  KLP+NFL +      ++K L+V+W PQL+VL  +++GCF TH GWNST+EA+S
Sbjct  305   VRSTEEAKLPKNFLEELKLTSGNNKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAIS  364

Query  401   LGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEM  231
             LGVPMV MPQWTDQ  NAKL+ DVW++G R +  + G+V R  IE C++ V+E   GK +
Sbjct  365   LGVPMVTMPQWTDQPTNAKLVKDVWEMGVRAKQDDKGIVRREVIEECIKLVMEEEKGKVI  424

Query  230   KENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +ENA KW  LA+  V EGG+SDK I+EF
Sbjct  425   RENAKKWRELARNVVDEGGSSDKNIEEF  452



>ref|NP_001274852.1| UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
 gb|AFX67035.1| UDP-glucose:glucosyltransferase [Solanum tuberosum]
Length=462

 Score =   465 bits (1196),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 228/448 (51%), Positives = 311/448 (69%), Gaps = 13/448 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SK +K T+A T     +MK +  +V I+ ISDG D
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLQSKRVKITIAPTKSFLKNMKELPTSVSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA +   YL RF+  GS TL+ LI++  NS  PV+C++YD F+PWA++VAK  GL
Sbjct  66    DDGINQAKTYEAYLTRFKEVGSDTLSQLIQKLANSGCPVNCIVYDPFLPWAVEVAKKFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLP-ALELRDMPSFIYVHGSYP  924
              +  FFTQ CAV+ +YY  H G+++LP T     + IPGL   +E  D+PSF     S  
Sbjct  126   VSAAFFTQNCAVDNIYYHVHKGVIKLPPTQHDAKILIPGLSCTIESSDVPSFESSPES-D  184

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                EL+++QF N+EK D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ +D
Sbjct  185   KLVELLVNQFSNLEKTDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDD  244

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++++     + ++WLN +P  SV+YV+FGS+A V  +QMEELAWG  N+N  FLWV
Sbjct  245   KEYGLSIFKPMTNECLNWLNHQPISSVLYVSFGSLAIVKAEQMEELAWGLMNSNKNFLWV  304

Query  563   VRDSELPKLPENFLGD------DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALS  402
             VR +E  KLP+NFL +      ++K L+V+W PQL+VL  +++GCF TH GWNST+EA+S
Sbjct  305   VRSTEESKLPKNFLEELELTSGNNKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAIS  364

Query  401   LGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEM  231
             LGVPMV MPQW+DQ  N KL+ DVW++G R +  + G+V R  IE C++ V+E   GK +
Sbjct  365   LGVPMVIMPQWSDQPTNTKLVQDVWEMGVRAKQDDKGIVRRDVIEKCIKLVMEEDKGKVI  424

Query  230   KENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +ENA KW  LA+ AV EGG+SDK I+EF
Sbjct  425   RENAKKWKELARNAVDEGGSSDKNIEEF  452



>ref|XP_004244487.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X1 [Solanum 
lycopersicum]
Length=458

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 228/447 (51%), Positives = 310/447 (69%), Gaps = 15/447 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SK +K T+A T     +MK +  +V I+ ISDG D
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLQSKRVKITIAPTKSFLKNMKELPTSVSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA +   YL RF+  GS TLA LI++   S   V+C++YD F+PWA++VAK  GL
Sbjct  66    DDGINQAKTYESYLARFKKVGSDTLAQLIKKLAKSGCHVNCIVYDPFLPWAVEVAKQFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSP--PVRIPGLP-ALELRDMPSFIYVHGSYP  924
              +  FFTQ C V+ +YY AH G+++LP T     + IPGL   +E   +PSF     S P
Sbjct  126   ISAAFFTQNCVVDNIYYHAHKGVIKLPPTKSDEKILIPGLSCTIESSYVPSF----ESSP  181

Query  923   ---AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRV  753
                   EL+++QF N+EK D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+
Sbjct  182   ETDKLIELLVNQFSNLEKTDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRL  241

Query  752   KNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYF  573
              +D EYG++++     + ++WLN +P  SV+YV+FGS+A +  +QMEELAWG KN+N  F
Sbjct  242   HDDKEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKLGSEQMEELAWGLKNSNKSF  301

Query  572   LWVVRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             LWVVR +E PKLP NF+ +   +K L+V+W PQL+VL  +++GCF TH GWNST+EA+SL
Sbjct  302   LWVVRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAISL  361

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMK  228
             GVPMVAMPQW+DQ  NAKL+ DVW++G R +  E G+V R  IE C++ V+E   GK ++
Sbjct  362   GVPMVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGIVRREVIEECIKLVMEEDKGKLIR  421

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             ENA KW  +A+  V EGG+SDK I+EF
Sbjct  422   ENAKKWKEIARNVVDEGGSSDKNIEEF  448



>ref|XP_009142972.1| PREDICTED: UDP-glycosyltransferase 74F1 [Brassica rapa]
 ref|XP_009142973.1| PREDICTED: UDP-glycosyltransferase 74F1 [Brassica rapa]
Length=449

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 312/447 (70%), Gaps = 21/447 (5%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNS--MKPVSDAVGIDIISDG  1281
              H++A+P+PSQGHI PM QFCKRL SKG K T  +T FI N+  + P S  + +  ISDG
Sbjct  6     GHVLAVPFPSQGHITPMRQFCKRLHSKGFKATHTLTAFIFNTVHLDP-SSPISVAKISDG  64

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D  GF  A SVP+YL  F+  GSKT+AD+I +++ SD P+ C++YDSFMPWALD+A+  
Sbjct  65    YDQGGFSSAGSVPEYLQNFKTFGSKTVADVIRKHQASDDPITCIVYDSFMPWALDLAREF  124

Query  1100  GLFAGCFFTQACAVNYVYYC--AHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
             GL+A  FFTQ+C VNYV Y    + G L LP       I  L  LE +D+P+F+   GS+
Sbjct  125   GLYAAPFFTQSCGVNYVNYLFYVNRGSLNLP-------IKDLSFLEPQDLPTFVTPTGSH  177

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
              AYFE+VL QF N ++AD V VNS+ +L+    + +SK+ P++ IGPTVPS+YLD ++K 
Sbjct  178   LAYFEMVLQQFTNFKEADFVLVNSYKELDVHEEELLSKVCPILTIGPTVPSMYLDQQIKL  237

Query  746   DSEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             D++  +NL+   +      WLNT+PE SV+Y+AFGSMA +   QMEELA   ++ +  +L
Sbjct  238   DNDNDLNLFDSKEAALCTAWLNTRPERSVVYIAFGSMAQLSSVQMEELASAVRSFS--YL  295

Query  569   WVVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             WVVR SE  KLP  FL   D DK L++ WSPQL+VL++KAVGCF TH GWNST+E L+LG
Sbjct  296   WVVRASEESKLPSGFLESVDKDKCLVLRWSPQLEVLSNKAVGCFMTHCGWNSTMEGLTLG  355

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMK  228
             VPMVAMPQWTDQ MNAK I DVWKVG RV+   E GV  R EIE  ++EV+EG   KEMK
Sbjct  356   VPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKETGVAMREEIEFSIKEVMEGEKSKEMK  415

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +NAMKW  LA +++SEGG++D  I+ F
Sbjct  416   KNAMKWRDLAGKSLSEGGSTDININIF  442



>emb|CDX79797.1| BnaA05g03590D [Brassica napus]
Length=449

 Score =   464 bits (1194),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 312/447 (70%), Gaps = 21/447 (5%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNS--MKPVSDAVGIDIISDG  1281
              H++A+P+PSQGHI PM QFCKRL SKG K T  +T FI N+  + P S  + +  ISDG
Sbjct  6     GHVLAVPFPSQGHITPMRQFCKRLHSKGFKATHTLTAFIFNTVHLDP-SSPISVAKISDG  64

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D  GF  A SVP+YL  F+  GSKT+AD+I +++ SD P+ C++YDSFMPWALD+A+  
Sbjct  65    YDQGGFSSAGSVPEYLQNFKTFGSKTVADVIRKHQASDDPITCIVYDSFMPWALDLAREF  124

Query  1100  GLFAGCFFTQACAVNYVYYC--AHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
             GL+A  FFTQ+C VNYV Y    + G L LP       I  L  LE +D+P+F+   GS+
Sbjct  125   GLYAAPFFTQSCGVNYVNYLFYVNRGSLNLP-------IKDLSFLEPQDLPTFVTPTGSH  177

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
              AYFE+VL QF N ++AD V VNS+ +L+    + +SK+ P++ IGPTVPS+YLD ++K 
Sbjct  178   LAYFEMVLQQFTNFKEADFVLVNSYKELDVHEEELLSKVCPILTIGPTVPSMYLDQQIKL  237

Query  746   DSEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             D++  +NL+   +      WLNT+PE SV+Y+AFGSMA +   QMEELA   ++ +  +L
Sbjct  238   DNDNDLNLFDSKEAALCTAWLNTRPERSVVYIAFGSMAQLSSVQMEELASAVRSFS--YL  295

Query  569   WVVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             WVVR SE  KLP  FL   D DK L++ WSPQL+VL++KAVGCF TH GWNST+E L+LG
Sbjct  296   WVVRASEESKLPSGFLESVDKDKCLVLRWSPQLEVLSNKAVGCFMTHCGWNSTMEGLTLG  355

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMK  228
             VPMVAMPQWTDQ MNAK I DVWKVG RV+   E GV  R EIE  ++EV+EG   KEMK
Sbjct  356   VPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKETGVAMREEIEFSIKEVMEGEKSKEMK  415

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +NAMKW  LA +++SEGG++D  I+ F
Sbjct  416   KNAMKWRDLAVKSLSEGGSTDININIF  442



>ref|XP_009630994.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=456

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 221/443 (50%), Positives = 304/443 (69%), Gaps = 8/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH +  PYP+QGHINPMLQF KRL SKG+K T+A T     +M+ +S  V I+ ISDG D
Sbjct  7     AHCLIFPYPAQGHINPMLQFSKRLQSKGVKITIATTKSFLKTMQELSTPVSIEAISDGYD  66

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QADS   Y+ RF+  GS TL+ LIE       PV+C++YD F+PWA++V    GL
Sbjct  67    DGGHEQADSFAAYITRFKEVGSNTLSQLIETLTTRGCPVNCIVYDPFLPWAVEVGNKFGL  126

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLP--VTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
                 FFTQ+CAV+ +YY    G+++LP       + +PGL  +E  D+P+F+  +     
Sbjct  127   VTAAFFTQSCAVDNIYYHVLKGVIKLPPIEVDKEIIVPGLVTIESSDVPTFVS-NPESAK  185

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
               E+++ QF N+E  D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ ND 
Sbjct  186   ILEMLVDQFSNLENVDWVLINSFYELENEVIDWMSKLYPISTIGPTIPSVYLDKRLPNDK  245

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG++++     + ++WLN +P  SV+YV+FGS A V+ +QMEELAWG K ++  FLWVV
Sbjct  246   EYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSYAKVEPEQMEELAWGLKKSDNNFLWVV  305

Query  560   RDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R +E  KLP NFL +    K L+V+W  QL+VL  K++GCF TH GWNST+EA+SLGVPM
Sbjct  306   RSTEESKLPNNFLEELTSKKGLVVSWCQQLQVLEHKSIGCFLTHCGWNSTLEAISLGVPM  365

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQW+DQ  NAKL+ D+W++G R +  E G+V R  IE C++ V+E   GK++++NA 
Sbjct  366   VAMPQWSDQPTNAKLVKDIWEIGVRAKQDEKGIVRREVIEECIKIVMEEEKGKKIRDNAK  425

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LA+ A+ EGGTSDK I+EF
Sbjct  426   KWKELARNAMDEGGTSDKNIEEF  448



>ref|XP_007199115.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
 gb|EMJ00314.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
Length=463

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 312/450 (69%), Gaps = 14/450 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-------KPVS-DAVGI  1299
             AH + + YP QGHINPMLQF KRL  KG+K TL  T  +  +M        P S  ++ +
Sbjct  7     AHCLVLFYPIQGHINPMLQFSKRLQHKGVKVTLVTTRSVHKAMHGDGGGKSPSSFSSIAL  66

Query  1298  DIISDGCD-DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWA  1122
             + ISDG D + G  QA+S+  Y +RF+  GS+TLA+LI++   S  P DC++YD  +PWA
Sbjct  67    ETISDGFDGEGGSSQAESIQAYWDRFREIGSQTLAELIDKLSASGHPADCLVYDQILPWA  126

Query  1121  LDVAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVT-SPPVRIPGLPALELRDMPSFI  945
             LDVAK  G+    FFT +CAV  +Y   H+G+L+LP+     + +PGLP L+  D PSF+
Sbjct  127   LDVAKRVGIAGAPFFTVSCAVTNIYSLVHNGLLKLPLNPDSEILLPGLPTLQPSDTPSFV  186

Query  944   YVHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYL  765
             +   SYPA+F+L + QF N++KAD VF ++FY+LE + VD M+K  P+  IGPT+PS+YL
Sbjct  187   HAPESYPAFFKLSMEQFSNLDKADWVFYSTFYELEQEAVDWMAKFWPLRTIGPTIPSMYL  246

Query  764   DNRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNT  585
             D R + D EYG++L + +    + WLN KP+GSV YV+FGS+A + +++MEEL +G + +
Sbjct  247   DKRHEEDKEYGLSLLNPNSDACMKWLNAKPKGSVAYVSFGSVAKLGEEKMEELCFGLRRS  306

Query  584   NTYFLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEA  408
               YFLWVVR SE  KLP+ F  +  +K L+V+W PQL+VLA +AVGCF TH GWNST+EA
Sbjct  307   KCYFLWVVRASESAKLPKGFAEETSEKGLVVSWCPQLEVLAHEAVGCFVTHCGWNSTLEA  366

Query  407   LSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GK  237
             LSLGVPMVA+PQW DQ  NAK I+DVWKVG + +  E G+V   EI  CVRE+LE   GK
Sbjct  367   LSLGVPMVAVPQWVDQGTNAKFIMDVWKVGLKAQADEKGIVRGEEIAHCVREILEGERGK  426

Query  236   EMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             E+++NA+KW  LAK AV EGG+SDK ID F
Sbjct  427   EIRKNALKWKALAKSAVDEGGSSDKNIDGF  456



>ref|XP_009590532.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=460

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 225/447 (50%), Positives = 311/447 (70%), Gaps = 12/447 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SKG+K T+A T  +  +M+ +  +V I+ ISDG D
Sbjct  7     AHCLLLPYPLQGHINPMLQFSKRLQSKGVKITIAATKSLLKTMQELPISVSIEAISDGYD  66

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA S   Y+ RF+  GS TL  LI++ +NS+ PV+C++YD F+PWA++VAK  GL
Sbjct  67    DGGIDQAKSFLAYITRFKEVGSDTLTQLIKKLENSECPVNCIVYDPFLPWAVEVAKDFGL  126

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSFIYVHGSYP  924
              +  FFTQ C V+ +YY  H GIL+LP T     + IPGL + +E  D+PSF     S  
Sbjct  127   VSAAFFTQNCVVDNIYYHVHKGILKLPPTQVDGEILIPGLSSTIESSDVPSFESSPQS-D  185

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                E++++QF N+EK D + +NSFY+LE +V+D M+K  P+  IGPT+PS+YLD R+ ND
Sbjct  186   KLVEMLVNQFSNLEKVDWILINSFYELEKEVIDWMAKFYPIKTIGPTIPSMYLDKRLPND  245

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++L+     + ++WLN +   SV+YV+FGSMA ++ +QMEELAWG KN+N  FLWV
Sbjct  246   KEYGLSLFKPMAKECLNWLNHQTISSVVYVSFGSMAKLEAEQMEELAWGLKNSNKNFLWV  305

Query  563   VRDSELPKLPENF-----LGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             VR +E   LP+NF     L  ++K L+V+W PQL+VL  K++GCF TH GWNST+EA+SL
Sbjct  306   VRSTEESNLPKNFIEELKLASENKGLVVSWCPQLQVLEHKSIGCFLTHCGWNSTLEAISL  365

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMK  228
             GVPMV MPQW+DQ  NAKL+ DVW++G R +  + G+V R  IE  ++ V+E   GK ++
Sbjct  366   GVPMVTMPQWSDQPTNAKLVQDVWEMGVRAKQDDKGIVRREIIEESIKLVMEEEKGKVIR  425

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +NA KW   ++ AV EGG+SDK I+EF
Sbjct  426   KNAKKWKEFSRNAVDEGGSSDKNIEEF  452



>ref|XP_006447931.1| hypothetical protein CICLE_v10015145mg [Citrus clementina]
 gb|ESR61171.1| hypothetical protein CICLE_v10015145mg [Citrus clementina]
Length=466

 Score =   464 bits (1194),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 232/443 (52%), Positives = 311/443 (70%), Gaps = 7/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV--GIDIISDG  1281
             AH + + YP QGHINPMLQF KRL  KG+K T   T F + S+   S  +   ++ ISDG
Sbjct  14    AHCLVLTYPGQGHINPMLQFSKRLQHKGIKVTFVTTHFFNKSLHRNSSPIPTALEAISDG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G  QA+S+  YL RF   G +TL +L+E+   S  PVDC++YDS +PWALDVAK  
Sbjct  74    YDEGGAAQAESIDAYLERFWQIGPQTLTELVEKMNASSVPVDCIVYDSILPWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F TQ+CAV  +YY A+ G L+LP+T   + +PGLP LE +DMPSF+Y    YPA
Sbjct  134   GLLGATFLTQSCAVCCIYYHANRGFLKLPLTGNEILLPGLPPLEPQDMPSFVYDLSLYPA  193

Query  920   YFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               +LV+ +QF N++KAD V  N+FY LE +VV+ + +   +  IGPTVPS YLD ++++D
Sbjct  194   ISDLVVKNQFDNIDKADWVLSNTFYDLEEEVVEWLGRHWSLRTIGPTVPSTYLDKQLEDD  253

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG +++  +    I WLN + +GSV+YV+FGSMA++  ++MEELAWG K ++ YFLWV
Sbjct  254   KDYGFSMFKQNNESCIKWLNDQAKGSVVYVSFGSMATLKIEEMEELAWGLKASDKYFLWV  313

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLPENF  +   K L+VNW PQL+VLA +A GCF TH GWNST+EALSLGVPM
Sbjct  314   VRESEQSKLPENFSEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLEALSLGVPM  373

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAM  216
             VAMPQWTDQ+ N+K I+D WK+G +    + G+V R  I  C+ E+LE   GKE+++NA 
Sbjct  374   VAMPQWTDQSTNSKYIMDGWKMGLKAPADKKGIVRREAIAHCISEILEGERGKEIRQNAG  433

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW + AKEAV++GG+SDK IDEF
Sbjct  434   KWRNFAKEAVAKGGSSDKNIDEF  456



>ref|XP_009133636.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Brassica rapa]
Length=447

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/446 (53%), Positives = 315/446 (71%), Gaps = 20/446 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
              H++A+PYP+QGHI P+ QFCKRL SKGL+TTLA+TTFI NS+KP  S  V I  ISDG 
Sbjct  5     GHVLAVPYPAQGHITPIHQFCKRLNSKGLQTTLALTTFIFNSIKPDPSGPVSIATISDGY  64

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  + S+ DY+  F+  GSKT+ D+I +++ SD+P+ C++YDSF+PWA +VA+  G
Sbjct  65    DQ-GFDSSGSIQDYVQSFKTFGSKTITDIIRKHETSDNPITCIVYDSFLPWAFNVAREFG  123

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             + A  FFTQ+CAVNYVYY ++  +  L LP       I     LE +D+PSF+    SYP
Sbjct  124   IAAAPFFTQSCAVNYVYYLSYISNESLNLP-------IEEFHFLEHQDLPSFLSAPESYP  176

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AY E+VL QF N +KAD V VN+F +LE    + +S +  V+ IGPTVPS+YLD R+ +D
Sbjct  177   AYLEMVLQQFTNFQKADFVLVNTFQELELHEQELLSNVCHVLTIGPTVPSMYLDQRIISD  236

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +N++ + D      WLNT+P+GSV+YVAFGS+A ++  QMEELA      +  FLW
Sbjct  237   TNYDLNIFDLKDAAFCTSWLNTRPQGSVVYVAFGSIAKLNNVQMEELASAVSKFS--FLW  294

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVRDSE  KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL++GV
Sbjct  295   VVRDSEEEKLPSGFLETLDKDKSLVLKWSPQLEVLSNKAIGCFLTHCGWNSTLEALAIGV  354

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMKE  225
             PMVAMPQW DQ M+AK I DVWK G RV++  E  +  R EIE  ++EV+EG   KEMKE
Sbjct  355   PMVAMPQWIDQPMDAKYIQDVWKAGVRVKIDNESRIAKREEIEFSIKEVMEGEKSKEMKE  414

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  415   NAKKWRDLAVKSLSEGGSTDINIDTF  440



>gb|KEH25946.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=461

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 216/440 (49%), Positives = 306/440 (70%), Gaps = 5/440 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS--DAVGIDIISDGC  1278
             H + IPYP+QGHINPMLQF KRL+ KGLK TL  T   S + K ++   ++  + ISDG 
Sbjct  11    HCLIIPYPTQGHINPMLQFSKRLLQKGLKVTLVNTISSSKTFKTINLNTSIEFETISDGF  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD G   A ++  Y+  F+  GS+TL  L+ +   S++ +DCVI+D+F+PW +DVAK   
Sbjct  71    DDGGLTAAKNIETYIETFRRTGSQTLTQLLHKLTKSNNSIDCVIHDAFLPWVVDVAKEFE  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L+   F TQAC VN + + A  G L LP+    + +PGLP LE  D+PSF+Y +G++P Y
Sbjct  131   LYVAVFLTQACCVNSINFHAFKGWLDLPLLEKEIVLPGLPKLEAADLPSFLYKYGTHPGY  190

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F+++ +QF  +++ D V  N+FY+LE +VVD + K+  +  IGP VPS++LD R+++D++
Sbjct  191   FDILTNQFSMIDQVDWVLANTFYELEPEVVDWLKKIWSLKTIGPCVPSMFLDRRIQDDND  250

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YGIN+++ +    I WL+ KP+GSV+YV+FGS +S+ + Q EE+A+G KN   +F+WVVR
Sbjct  251   YGINIFNPNSESCIKWLDDKPKGSVVYVSFGSRSSLSEDQTEEIAYGLKNCGRFFIWVVR  310

Query  557   DSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             +SE  K+P+ F    +K LIV W  QL+V A +AVGCF TH GWNST+EALSLGVPM+AM
Sbjct  311   ESEKSKIPKGFSETLEKGLIVTWCQQLEVFAHEAVGCFVTHCGWNSTLEALSLGVPMIAM  370

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             P WTDQ  NAK IVDVWK+  +    E GVV R  IE C+RE++E   G E+K NA+KW 
Sbjct  371   PIWTDQITNAKFIVDVWKIAVKGVGDEKGVVRRESIEDCIREIMETEKGNELKNNAIKWK  430

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +++K++V EGG+SDK I EF
Sbjct  431   NVSKKSVDEGGSSDKNIVEF  450



>ref|XP_010679006.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   463 bits (1192),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 308/449 (69%), Gaps = 13/449 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS------DAVGIDI  1293
             +H++ +P+P+QGHINPMLQF KRL  KG+K TL  T +I+ SM+  +       ++ I  
Sbjct  10    SHVLVVPFPAQGHINPMLQFSKRLAFKGIKPTLTPTVYIAKSMQTTTIPTHYGPSIQIRP  69

Query  1292  ISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDV  1113
             ISDG DD GF QA+S   YL+  +  GSKTLA LI++       V  VIYD F+PW LDV
Sbjct  70    ISDGYDDGGFSQAESTKAYLDNLRTNGSKTLAQLIQKLTEEGDSVKAVIYDGFLPWVLDV  129

Query  1112  AKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSP---PVRIPGLPALELRDMPSFIY  942
             A   GL    FFTQ+C+VN +YY    G++QLP+  P    V +PG+P L+L ++PSF+ 
Sbjct  130   ANQFGLVGVVFFTQSCSVNSIYYHVQRGLIQLPLLGPGPSTVSVPGVPELQLWEVPSFVG  189

Query  941   VHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLD  762
              +GSYP +F++VL QF N+++ D V  N FY++E +V+D M+KM  V  IGPTVPS YLD
Sbjct  190   QYGSYPFWFDVVLEQFSNIDQVDWVLCNIFYEMEKEVIDWMAKMWKVRTIGPTVPSYYLD  249

Query  761   NRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTN  582
              R+++D +Y + L   +     +WL+TK + SVIYV+FGSMA + ++Q EELAWG KN++
Sbjct  250   KRLEDDRDYSLQLLKPNTALCKNWLDTKTKESVIYVSFGSMADLSEQQFEELAWGLKNSH  309

Query  581   TYFLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEAL  405
               FLWVVR+SE  KLP+ F+ +   + L+V W+ QL+VLA +A GCF TH G+NS +EAL
Sbjct  310   KSFLWVVRESEQAKLPKGFVEEASGQGLVVGWASQLEVLAHEATGCFVTHCGFNSVLEAL  369

Query  404   SLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KE  234
              LGVP+V +PQWTDQ  NAK + DVW VG R +V E G+V R E+E C+R+V+EG   +E
Sbjct  370   CLGVPVVGVPQWTDQGTNAKFVEDVWGVGIRAKVDEKGIVRRKEVEECIRKVMEGEKKEE  429

Query  233   MKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             + +N  KW  LAKEA+ EGG SD+ IDEF
Sbjct  430   LGKNVAKWKKLAKEAMDEGGNSDENIDEF  458



>ref|XP_004244486.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum lycopersicum]
Length=456

 Score =   463 bits (1191),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 219/444 (49%), Positives = 313/444 (70%), Gaps = 9/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SK +K T+A+T     +MK +  ++ I+ ISDG D
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLRSKRVKITIALTKSFLKNMKELPTSMSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA +   Y+ RF+  GS TL+ LI++   S  PV+C++YD F+PWA++VAK  GL
Sbjct  66    DGGRDQAGTFVAYITRFKEIGSDTLSQLIQKLAISGCPVNCIVYDPFLPWAVEVAKQFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSFIYVHGSYP  924
              +  FFTQ C V+ +YY  H G+++LP T     + IPG  + ++  D+P+F+ ++    
Sbjct  126   ISAAFFTQNCVVDNIYYHVHKGVIKLPPTQNDEKIIIPGFSSPIKASDVPNFV-INPEGE  184

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                E++++QF N++K D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ +D
Sbjct  185   RILEMLVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDD  244

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++++     + ++WLN +P  SV+YV+FGS+A +  +QMEELAWG KN+N  FLWV
Sbjct  245   KEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKLGSEQMEELAWGLKNSNKSFLWV  304

Query  563   VRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VR +E PKLP NF+ +   +K L+V+W PQL+VL  +++GCF TH GWNST+EA+SLGVP
Sbjct  305   VRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAISLGVP  364

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MVAMPQW+DQ  NAKL+ DVW++G R +  E G+V R  IE C++ V+E   GK ++ENA
Sbjct  365   MVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGIVRREVIEECIKLVMEEDKGKLIRENA  424

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  +A+  V EGG+SDK I+EF
Sbjct  425   KKWKEIARNVVDEGGSSDKNIEEF  448



>emb|CDY17907.1| BnaC04g03120D [Brassica napus]
Length=449

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 311/447 (70%), Gaps = 21/447 (5%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNS--MKPVSDAVGIDIISDG  1281
              H++A+P+PSQGHI PM QFCKRL SKG K T  +T FI N+  + P S  + +  ISDG
Sbjct  6     GHVLAVPFPSQGHITPMRQFCKRLHSKGFKATHTLTAFIFNTVHLDP-STPISVAKISDG  64

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D  GF  A SVP+YL  F+  GSKT+AD+I +++ SD P+ C++YDSFMPWALD+A+  
Sbjct  65    YDQGGFSSAGSVPEYLQNFKTFGSKTVADVIRKHQTSDDPITCIVYDSFMPWALDLAREF  124

Query  1100  GLFAGCFFTQACAVNYVYYC--AHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
             GL+A  FFTQ+C VNYV Y    +HG L LP       I  L  LE +D+P+F+   GS+
Sbjct  125   GLYAAPFFTQSCGVNYVNYLFYVNHGSLNLP-------IKDLSFLETQDLPTFVTPTGSH  177

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
              AYFE+VL QF N ++AD V VNS+ +L+    + +S + PV+ IGPTVPS+YLD ++K 
Sbjct  178   LAYFEMVLQQFTNFKEADFVLVNSYKELDIHEEELLSNVCPVLTIGPTVPSMYLDQQIKL  237

Query  746   DSEYGINLY-HMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             D++  +NL+   +      WLNT+P+GSV+Y+AFGSMA +   QMEELA   ++ +  +L
Sbjct  238   DTDNDLNLFDSKEAAFCTAWLNTRPQGSVVYIAFGSMAQLSSVQMEELASAVRSFS--YL  295

Query  569   WVVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             WVVR SE  KLP  FL   D DK L++ WSPQL+VL++KAVGCF TH GWNST+E L+LG
Sbjct  296   WVVRASEESKLPSGFLESVDKDKCLVLRWSPQLEVLSNKAVGCFMTHCGWNSTMEGLTLG  355

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRV-GEDGVVSRGEIEGCVREVLEG---KEMK  228
             VPMVAMPQWTDQ MNAK I DVWKVG RV+   E GV  R EIE  ++ V+EG   K+MK
Sbjct  356   VPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKETGVAMREEIEFSIKAVMEGEKSKDMK  415

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +NA KW  LA +++SEGG++D  I+ F
Sbjct  416   KNARKWRDLAVKSLSEGGSTDININIF  442



>ref|XP_008788244.1| PREDICTED: crocetin glucosyltransferase 2-like isoform X2 [Phoenix 
dactylifera]
Length=456

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/442 (52%), Positives = 296/442 (67%), Gaps = 8/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ +PYPSQGHINPMLQF KRL S+GL  TLA T F+ ++ +P    V +  ISDG D 
Sbjct  9     HVLVLPYPSQGHINPMLQFAKRLSSRGLLATLATTRFVLSTTRPEPGPVALATISDGFDQ  68

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF  ADS+  YL+R +  GS TL +LI   + +  PV  ++YDSF PWA +V +  GL 
Sbjct  69    GGFASADSIEAYLDRVESVGSATLDELIRSERAAGRPVRALVYDSFFPWAREVGERRGLA  128

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYV--HGSYPAY  918
                FFTQ C VN VY   +   L +PVT  PV +PGLP LE  DMPSF+     G + +Y
Sbjct  129   TAAFFTQPCGVNIVYGHVNERRLGIPVTE-PVSLPGLPRLEPDDMPSFVSQADAGLFASY  187

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              +LVL Q+ N++KAD VFVNSFY+LE +    M+       +GPTVPS YLDNR+ +DS 
Sbjct  188   LKLVLEQYKNLDKADAVFVNSFYELEPEEAGYMASTWRATTMGPTVPSSYLDNRLPSDSH  247

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +LY       + WL++ P  SV+YV+FGSM  +  +QM ELA+G   +   FLWVVR
Sbjct  248   YGFDLYTPSVDLCMQWLDSLPSNSVVYVSFGSMTPLGPEQMAELAFGLLGSGKRFLWVVR  307

Query  557   DSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
              SE  KLPENF  D   ++ L+V+WSPQ+ VL+ +AVGCF TH GWNST+E +SLGVPMV
Sbjct  308   SSEASKLPENFAEDLSPERGLVVSWSPQMAVLSHEAVGCFLTHCGWNSTMEGISLGVPMV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
              +PQWTDQ  NAK + DVW+VG R R GE G+V R E+E CVR V+EG   +E++ N+ K
Sbjct  368   GVPQWTDQPTNAKYVEDVWRVGVRARAGERGLVGREEVERCVRVVMEGERSEEIRRNSSK  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAK+AV+EGG+SD+ I EF
Sbjct  428   WRELAKKAVAEGGSSDRNILEF  449



>gb|AFJ52952.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=441

 Score =   461 bits (1186),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 303/432 (70%), Gaps = 12/432 (3%)
 Frame = -2

Query  1406  MLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV--GIDIISDGCDDAGFLQADSVPDYL  1233
             MLQF KRL+SK ++ TL  T FIS ++   S      +D ISDG DD G   A+S   YL
Sbjct  1     MLQFSKRLLSKSIRITLVNTRFISKTISSTSSTSTINLDTISDGYDDGGHAAAESTQAYL  60

Query  1232  NRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFAGCFFTQACAVNY  1053
               FQ  GSKTL++LI++   ++ P  C+IYD F+PW LDVAK  GLFA  FFTQ+CAV+ 
Sbjct  61    ESFQKEGSKTLSELIQKLSKTEYPAHCIIYDPFLPWCLDVAKELGLFAAPFFTQSCAVDA  120

Query  1052  VYYCAHHGILQLPVTSPP--VRIPGLPA-LELRDMPSFIYVHGSYPAYFELVLHQFLNVE  882
             +YY  + G L+LPVT  P  + IPGLPA LE  DMPSFI  +GSYPA F++++ QF N+ 
Sbjct  121   IYYHVYKGSLKLPVTDQPQSLIIPGLPAPLEADDMPSFISDYGSYPAAFDMIISQFSNIH  180

Query  881   KADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYGINLYHMDPTK  702
             KADC+  N+ Y LE +  D +S + P+  +GPT+PS+YLD ++++D +YG +++  +   
Sbjct  181   KADCILCNTVYDLENETADWLSTIWPLRTVGPTIPSMYLDKQLQDDRDYGFSIFKPNNEA  240

Query  701   SIDWLNT-KPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDSELPKLPENF  525
              I+WLN  KP+GSVIYV+FGS+AS+  +QMEE+A G KN+N YFLWVVR SE+ KLP NF
Sbjct  241   CINWLNNNKPKGSVIYVSFGSLASLGAEQMEEIAHGLKNSNHYFLWVVRASEVAKLPPNF  300

Query  524   LGD---DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMPQWTDQTM  354
               D   D K LIV+W PQL+VL  +AVGCF TH GWNST+E LSLGVPMVAMPQWTDQ  
Sbjct  301   AADVDIDGKGLIVSWCPQLEVLEHEAVGCFVTHCGWNSTLEGLSLGVPMVAMPQWTDQAT  360

Query  353   NAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAMKWSHLAKEAVS  183
             NAK I DVWK+G R +  E+G+V R  +E C+R V+   EGKEMK NA KW  + KEA  
Sbjct  361   NAKYIEDVWKMGVRCQKNEEGIVKREMVEKCLRGVMEGEEGKEMKRNADKWRKMMKEAAG  420

Query  182   EGGTSDKVIDEF  147
             EGG+SD+ I +F
Sbjct  421   EGGSSDRNISDF  432



>ref|XP_010037078.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW48702.1| hypothetical protein EUGRSUZ_K02353 [Eucalyptus grandis]
Length=458

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 310/441 (70%), Gaps = 7/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDGC  1278
             H + + +P+QGHINPMLQF KRL+ KG   T   T F+S ++  +S   ++ ++ ISDG 
Sbjct  11    HCLVLSFPAQGHINPMLQFSKRLIHKGAGVTFVTTRFMSKTLHGLSSNPSISLESISDGF  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD G   A S   YL RF   G +TL++L+ER  +S  P  C++Y+SF+PWALDVA+ +G
Sbjct  71    DDGGMKAASSREAYLERFWKIGPETLSELVERLISSGRPPSCIVYNSFLPWALDVAQKYG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFT +CAV+ V+Y    G+L++PV    V +PG+P LE +DMPS++    SYPA 
Sbjct  131   LVGAVFFTMSCAVSSVFYHCQKGLLEVPVRKQ-VLLPGMPPLEPQDMPSYVSDPESYPAN  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               +++ QF N++K D V  N+ Y+LE ++VD   K+ P   IGPTVPS YLDNR++ D+E
Sbjct  190   LGVLVGQFSNLDKVDWVLCNTVYELEQELVDWFMKVMPFRTIGPTVPSSYLDNRLEQDTE  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++++  +   ++ WL+TKP+GSV+YV+FGS+A +   QM+E+A G K +N YFLWVVR
Sbjct  250   YGLSIFQPEHDTTMKWLSTKPKGSVVYVSFGSVAELKIDQMQEIAMGLKRSNRYFLWVVR  309

Query  557   DSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  KLP+++  +   K LIV W PQL+VLA +A+G F TH GWNST+EAL+LGVPM+A
Sbjct  310   SSEEDKLPQDYAKETAQKGLIVTWCPQLEVLAHEALGLFLTHCGWNSTLEALTLGVPMMA  369

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             +PQWTDQ  NAK I+DVWK+G R  V E GVV   +IE C+RE++E   GKEM+ENA KW
Sbjct  370   IPQWTDQPTNAKHIMDVWKMGLRPPVDERGVVRSEDIENCIREIMEGERGKEMRENAGKW  429

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               + KEAVSEGG+SD+ I+EF
Sbjct  430   RKIIKEAVSEGGSSDRNIEEF  450



>ref|XP_006357047.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=456

 Score =   461 bits (1185),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 312/445 (70%), Gaps = 11/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF K L SK +K T+A+T ++  +MK ++ +V I+ ISDG D
Sbjct  6     AHCLMLPYPFQGHINPMLQFSKCLQSKRVKITIALTKYLLKNMKELTTSVSIEAISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA S   Y+ RF+  GS TL+ LI++  NS+ PV+C++YD F+ W ++VA+  GL
Sbjct  66    DGGRDQAGSFVAYVTRFKEVGSDTLSQLIQKLANSECPVNCIVYDPFLSWVVEVARKFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSFIY-VHGSY  927
              +  FFTQ CAV+ +YY  H G+++LP T     + IPG    +E  D P+++  + G  
Sbjct  126   VSAAFFTQNCAVDNIYYHVHKGVIKLPPTQNDEKILIPGFSCPIEASDGPNYVMKIEG--  183

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             P   E +++QF N++K D V +NSFY+LE +++D MSK+ P+  IGPT+PS+YLD R+ +
Sbjct  184   PKILEYMVNQFSNLDKVDWVLINSFYELEKEIIDWMSKLYPIKTIGPTIPSMYLDKRLHD  243

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D EYG++++     + ++WLN +P  SV+YV+FGS A V+ +QMEELAWG KN+N  FLW
Sbjct  244   DKEYGLSIFKPMTNECLNWLNHQPISSVLYVSFGSFAIVEAEQMEELAWGLKNSNNNFLW  303

Query  566   VVRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR +E PKLP++FL +   +K L+V W PQL+VL  +++GCF TH GWNS +EA+SLGV
Sbjct  304   VVRSTEEPKLPKDFLEELTIEKGLVVPWCPQLQVLEHESIGCFLTHCGWNSILEAISLGV  363

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVAMPQWTDQ  NAK + DVW++G R +  E G+V R  IE C++ V+E   GK ++EN
Sbjct  364   PMVAMPQWTDQPTNAKFVKDVWEIGVRAKQDEKGIVRREVIEECIKLVMEEEKGKLIREN  423

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LA+  V EGG+SDK I+EF
Sbjct  424   AKKWKELARNVVDEGGSSDKNIEEF  448



>ref|XP_011037069.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Populus euphratica]
Length=461

 Score =   461 bits (1186),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 225/441 (51%), Positives = 306/441 (69%), Gaps = 10/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H+V IPYP QGHINPM+QF KRL SKGL+ TL I +  + S       V +  ISDG D 
Sbjct  9     HVVVIPYPVQGHINPMIQFSKRLASKGLQVTLVIFSSQTLSTPASLGCVKVVTISDGSDT  68

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLI-ERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
                  + S+ D L +FQ   ++ L+ L+ E   +S  PV C++YDSFMPW L++A+  GL
Sbjct  69    G----SRSIADLLKQFQATVTQKLSQLVVELGISSGHPVSCLVYDSFMPWVLEIARHLGL  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIY-VHGSYPAY  918
                 FFTQ+CAVN VYY  H G L++P+   PV +PGLP L++ ++PSF++ +   Y + 
Sbjct  125   TGASFFTQSCAVNSVYYQIHEGQLKIPLEKLPVSVPGLPPLDVDELPSFVHDMESEYSSI  184

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               LV++QFLN   AD VFVNSF  LE +VV+ ++    + PIGP +PS+YLD ++++D+E
Sbjct  185   LTLVVNQFLNFRGADWVFVNSFNPLEEEVVNWLAGQRSIKPIGPMIPSVYLDRQLEDDTE  244

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++L+       ++WL+ K  GSV+YV+FGS+A++ + QM E+AWG   +  YFLWVVR
Sbjct  245   YGLSLFKPALDGCMEWLDAKETGSVVYVSFGSLAALGEDQMAEIAWGLWRSGCYFLWVVR  304

Query  557   DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +SE  KLP NF+ G  +K LIV WSPQL+VL+ K+VGCF TH GWNST+EALSLGVPMVA
Sbjct  305   ESEEKKLPCNFVEGSSEKGLIVTWSPQLEVLSHKSVGCFMTHCGWNSTLEALSLGVPMVA  364

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             +PQWTDQ  NAK I DVW+VG RV+  E G+V++ E+E C+REV+E   G EM+ N+ KW
Sbjct  365   VPQWTDQPTNAKYIADVWRVGVRVKANEKGIVTKEELEKCIREVMESERGSEMRRNSEKW  424

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAK A+ EGG+S+K I EF
Sbjct  425   KKLAKTAMGEGGSSEKNITEF  445



>ref|XP_008236256.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=459

 Score =   461 bits (1185),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 307/445 (69%), Gaps = 10/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDI--ISD  1284
             AH + +P+P QGHINPMLQF K L  KG+K TL  T +   +M    S  + +D+  ISD
Sbjct  10    AHCLVLPFPCQGHINPMLQFAKLLAHKGVKVTLVTTRYTHKTMYGSASSCIALDLETISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+AG  +  S+  YL  F+  GSKTLA+L+E+  +S SPVDCVIYD+FM W LD+A+ 
Sbjct  70    GYDEAGRGET-SIDAYLEIFREVGSKTLAELLEKLSSSGSPVDCVIYDAFMTWPLDIARK  128

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMP--SFIYVHGS  930
              G+    FFTQ+CAV  +YY  H G+L+LP+     RI       L  +   SF+Y  GS
Sbjct  129   FGIGGAVFFTQSCAVENIYYHIHEGLLKLPLADDQSRILLPGLPPLEPLDLPSFVYDFGS  188

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YP +++  L QF NV+KAD +  N+FY+LE QVVD ++K  P+  +GPT+PS YLD R++
Sbjct  189   YPVFYQASLAQFSNVDKADWILFNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLE  248

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D EYG+NL+  +    I WLN +P+GSV YV+FGS A +  +QMEELA G + + + FL
Sbjct  249   DDKEYGVNLFKSENDACIKWLNERPKGSVAYVSFGSFAELGVEQMEELARGLRRSKSNFL  308

Query  569   WVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR SE  K+P+ F+ +  +K L+V+W PQ++VLA +AVGCF TH GWNST+EALSLGV
Sbjct  309   WVVRASEAAKVPKGFVEETLEKGLVVSWCPQMEVLAHEAVGCFVTHCGWNSTLEALSLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PM+AMPQWTDQT NAK I+DVWK+G      E G+V    +E C+ E++E   GKEMK N
Sbjct  369   PMLAMPQWTDQTTNAKFIMDVWKIGLTAPSDEKGLVGPEVVEHCISEIMEGERGKEMKIN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A+KW  LAK+AV+EGG+SDK IDEF
Sbjct  429   ALKWKELAKKAVAEGGSSDKNIDEF  453



>ref|XP_004137037.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Cucumis sativus]
 gb|KGN43660.1| hypothetical protein Csa_7G051400 [Cucumis sativus]
Length=466

 Score =   461 bits (1185),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 312/447 (70%), Gaps = 14/447 (3%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGI---DIISDG  1281
             H++ + YP+QGH+NPMLQFCK L SKG+ TT+A+T FI N+  P SDA      D ISDG
Sbjct  10    HVLVLTYPTQGHVNPMLQFCKSLSSKGVDTTVAVTKFIFNTFNPKSDASNFIQWDTISDG  69

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ GF  A S+ DYL   + AGSKTL +LI+R+++   P+D V+YD+ MPWALD+AKS 
Sbjct  70    FDEGGFSAATSIEDYLETMKKAGSKTLIELIQRHQDRGHPIDAVVYDALMPWALDIAKSF  129

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPV--TSPPVRIPGLPALELRDMPSFIYVHGSY  927
              L A  FFT  C+VN +YY    G+++LPV   S PV +P LP L   DMPSFIYV  SY
Sbjct  130   NLTAATFFTMPCSVNLIYYYVDRGLVRLPVPEDSYPVCLPSLPPLMPPDMPSFIYVPDSY  189

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSP-VIPIGPTVPSLYLDNRVK  750
             P Y  L+L+Q  N+E AD + VNS ++ E    D MSK+ P ++ IGPT+PS Y+D   +
Sbjct  190   PQYLYLLLNQMPNIEGADYILVNSIHEFEPLETDAMSKIGPTLLTIGPTIPSYYIDKSNE  249

Query  749   NDSEYGINLYHMDP---TKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNT  579
             ND +Y ++L+ ++P   + + +WL TKP+GSVIYV+FGSMA ++  QM ELA G   +N 
Sbjct  250   NDKKYELDLFKIEPKEASSTREWLKTKPKGSVIYVSFGSMAKLNTTQMVELAAGLVESNY  309

Query  578   YFLWVVRDSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             YF+WVVR SE  KLP+ F    +K L++ WS QL+VL+++A+G FFTH GWNST+E+L L
Sbjct  310   YFIWVVRASEEEKLPKGFA--PEKGLVLRWSSQLEVLSNEAIGSFFTHSGWNSTLESLCL  367

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMK  228
             GVPMVAMPQWTDQ    K + DVWKVG RV+VGEDG+V + EI+ CV+ V+EG    E K
Sbjct  368   GVPMVAMPQWTDQPTTGKYVADVWKVGVRVKVGEDGIVGKDEIKACVKAVMEGDRAIEFK  427

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +NA+KW  L   A+ EGG+S K IDEF
Sbjct  428   QNALKWKQLGLGALREGGSSSKHIDEF  454



>ref|XP_008455273.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Cucumis melo]
Length=466

 Score =   461 bits (1185),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 314/447 (70%), Gaps = 14/447 (3%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA---VGIDIISDG  1281
             H++ + YP+QGH+NPMLQFCK L SKG+ TT+A+T FI N+  P SDA   +  D ISDG
Sbjct  10    HVLVLTYPTQGHVNPMLQFCKSLSSKGVDTTVAVTKFIFNTFNPKSDASNTIQWDTISDG  69

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ GF  A S+ DYL   + AGSKTL +LI+R+++   P+D V+YD+ MPWALD+AKS 
Sbjct  70    FDEGGFSAATSIEDYLETMKKAGSKTLTELIKRHQDLGHPIDAVVYDALMPWALDIAKSF  129

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPV--TSPPVRIPGLPALELRDMPSFIYVHGSY  927
              L A  FFT  C+VN +YY    G+++LPV   S P+ +P LP L   DMPSFIYV  SY
Sbjct  130   NLTAATFFTMPCSVNLIYYYVDRGLVRLPVPKDSYPICLPSLPPLMPPDMPSFIYVPESY  189

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSP-VIPIGPTVPSLYLDNRVK  750
             P Y  L+L+Q  N+E AD + VNS ++ E    D M+K+ P ++ IGPT+PS Y+D   +
Sbjct  190   PQYLYLLLNQMPNIEGADYILVNSIHEFEPLETDAMAKIGPTLLTIGPTIPSYYIDKSYE  249

Query  749   NDSEYGINLYHMDP---TKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNT  579
             ND +Y ++L+ ++P   + + +WL TKP+GSVIYV+FGSMA ++  QM ELA G   +N 
Sbjct  250   NDKKYELDLFKIEPKEASSTREWLKTKPKGSVIYVSFGSMAKLNTTQMAELAAGLVESNY  309

Query  578   YFLWVVRDSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             YF+WVVR SE  KLP+ F    +K L++ WS QL+VL+++A+G FFTH GWNST+E+L L
Sbjct  310   YFIWVVRASEEEKLPKGFA--PEKGLVLRWSSQLEVLSNEAIGSFFTHSGWNSTLESLCL  367

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMK  228
             GVPMVAMPQWTDQ    K + DVWKVG RV+VGEDG+V + EI+ CV+ V+EG+   E K
Sbjct  368   GVPMVAMPQWTDQPTTGKYVADVWKVGVRVKVGEDGIVGKDEIKACVKAVMEGERAIEFK  427

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +NA+KW  L   A+ EGG+S K IDEF
Sbjct  428   QNALKWKQLGLGALREGGSSSKHIDEF  454



>ref|XP_008338819.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
 ref|XP_008338820.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
Length=456

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/442 (50%), Positives = 306/442 (69%), Gaps = 11/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDII---SDG  1281
             HI+ +P P QGHINPMLQF KRL SKGL+ TL   +  + +++     V I+ I   S+ 
Sbjct  12    HILVVPLPVQGHINPMLQFSKRLASKGLRVTLVTISSNTEAIETQLCKVKIEPIHATSEE  71

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              ++AG    ++V + +  FQ   S+ L  LI + +N   P+ C++YDS MPW LD AK  
Sbjct  72    EEEAG----NNVENKVLWFQTILSRRLPQLILKQENDGYPIICLVYDSAMPWVLDTAKGL  127

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+F   FFT +CAV  VYY  H G+L++P+  P + +PGLP LE +D+PSFIY  GSYP+
Sbjct  128   GIFGASFFTHSCAVGAVYYNVHEGLLRVPLKEPTISLPGLPLLEPQDLPSFIYDPGSYPS  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             +  LV+ +F N+  AD +F N+F+ LE +VV+ M    P+  IGPT+PS+YLD R+++D 
Sbjct  188   FLNLVVSRFSNISGADWIFFNTFHGLEKEVVNWMRTRWPIKTIGPTLPSMYLDKRLEDDK  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG ++++ +      WL +K  G+V+YV+FGSMA++ +KQMEE+A G K +N  FLWVV
Sbjct  248   DYGFSIFNSNTEACKKWLESKETGTVVYVSFGSMANLGEKQMEEIALGLKGSNANFLWVV  307

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP NF     +K L+VNW PQL+VL  +A+GCF TH GWNST+EALS GVPMV
Sbjct  308   RESETQKLPSNFEEQTSEKGLVVNWCPQLEVLGHRALGCFMTHCGWNSTLEALSSGVPMV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQT NAK + D WKVG RV+V + G+V++ EIE C+ EV+E   GKE+K N M+
Sbjct  368   AMPQWTDQTTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAEVIEGERGKEIKRNLMR  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAKEA+ EGG+SDK I+EF
Sbjct  428   WRELAKEAMDEGGSSDKNIEEF  449



>ref|XP_009776061.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=459

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 224/447 (50%), Positives = 311/447 (70%), Gaps = 13/447 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SKG+K T++ T     +M+ +  +V I+ ISDG +
Sbjct  7     AHCLILPYPVQGHINPMLQFSKRLQSKGVKITISPTKSFLKTMQELPTSVSIEAISDGYN  66

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               G  QA+S   Y+ RF+  GS TL  LI++ +N + PV+C++YD F+PWA++VAK  GL
Sbjct  67    -GGIDQAESFLAYITRFKEVGSDTLTQLIKKLENCECPVNCIVYDPFLPWAVEVAKDFGL  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSFIYVHGSYP  924
              +  FFTQ C V+ +YY  H G+L+LP T     + IPGL + +E  D+PSF     S  
Sbjct  126   VSAAFFTQNCVVDNIYYHVHKGVLKLPPTQVDGEILIPGLSSTIESSDVPSFESSPQS-E  184

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                E++++QF N+EK D V +NSFY+LE +V+D M+K+ P+  IGPT+PS+YLD R+ ND
Sbjct  185   KLVEMLVNQFSNLEKVDWVLINSFYELEKEVIDWMAKLYPIKTIGPTIPSMYLDKRLPND  244

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++L+     + ++WLN +P  SV+YV+FGSMA ++ +QMEELAWG KN+N  FLWV
Sbjct  245   KEYGLSLFKPMAKECLNWLNHQPISSVVYVSFGSMAKLEAEQMEELAWGLKNSNKNFLWV  304

Query  563   VRDSELPKLPENF-----LGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSL  399
             VR +E  KLP+NF     L  ++K  +V+W PQL+VL  K++GCF TH GWNST+EA+SL
Sbjct  305   VRSTEESKLPKNFIEELKLASENKGFVVSWCPQLQVLEHKSIGCFLTHSGWNSTLEAISL  364

Query  398   GVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMK  228
             GVPMV MPQW+DQ  NAKL+ DVW++G R +  + G+V R  IE  ++ V+E   GK ++
Sbjct  365   GVPMVTMPQWSDQPTNAKLVHDVWEMGVRAKQDDKGIVRREIIEENIKLVMEEEKGKVIR  424

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             ENA KW   A+ AV EGG+SDK I+EF
Sbjct  425   ENAKKWKEFARNAVDEGGSSDKNIEEF  451



>ref|XP_009410732.1| PREDICTED: crocetin glucosyltransferase 2-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 293/439 (67%), Gaps = 5/439 (1%)
 Frame = -2

Query  1448  IVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDDA  1269
             I+ +PYPSQGHINPMLQF KR  + G+  TLA T FI N+ +P    V +  ISDGCD A
Sbjct  30    ILLLPYPSQGHINPMLQFGKRCAAHGVSATLATTRFILNTTRPQPGPVHLAAISDGCDRA  89

Query  1268  GFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFA  1089
             G+ +  S+PDYL+R +  GS+TL  L+     +  PV  +++D+F+PWA DV +  GL  
Sbjct  90    GYAEVSSIPDYLDRLERVGSETLESLLRSEAAAGRPVRLLVFDAFLPWAGDVGRRLGLAT  149

Query  1088  GCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGS-YPAYFE  912
               FFTQ+CAVN +Y+    G L +PV +  + +PGLP L  RD+PSF+    S YPAY +
Sbjct  150   AAFFTQSCAVNALYFHVWEGRLHVPVQAAELDLPGLPRLRPRDLPSFLPDRDSIYPAYLQ  209

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             LVL+QF N+EKAD V VN+FY+LE Q  + +   S    IGPTVPS +LD R+ +DS YG
Sbjct  210   LVLNQFKNLEKADEVLVNTFYELEPQESEYLKVESGAKTIGPTVPSSHLDGRLPSDSHYG  269

Query  731   INLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDS  552
              +L+       + WL++KP  SV+YV+FGSMA++ Q+QMEELA G   T  +FLWVVR S
Sbjct  270   FHLFEPSVAACMSWLDSKPPASVVYVSFGSMAAICQEQMEELAQGLSATGKHFLWVVRSS  329

Query  551   ELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMP  375
             E  K P  F+ G  D+ L+V WSPQL+VLA  A GCF TH GWNST+E L LGVPMVAMP
Sbjct  330   EAHKFPPGFVEGCRDRGLVVPWSPQLEVLAHPATGCFLTHCGWNSTVEGLGLGVPMVAMP  389

Query  374   QWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWSH  204
             QWTDQ  NA  + +VW VG RVR   +G+V R E+E CVREV+EG    EM+ NA +W  
Sbjct  390   QWTDQPTNAMYVEEVWGVGVRVREDGEGLVRRVEVERCVREVMEGGRSSEMRSNAARWRA  449

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LAK AV   G+SDK I E 
Sbjct  450   LAKAAVGLNGSSDKNIVEL  468



>ref|XP_008788243.1| PREDICTED: crocetin glucosyltransferase 2-like isoform X1 [Phoenix 
dactylifera]
Length=457

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/443 (52%), Positives = 296/443 (67%), Gaps = 9/443 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ +PYPSQGHINPMLQF KRL S+GL  TLA T F+ ++ +P    V +  ISDG D 
Sbjct  9     HVLVLPYPSQGHINPMLQFAKRLSSRGLLATLATTRFVLSTTRPEPGPVALATISDGFDQ  68

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF  ADS+  YL+R +  GS TL +LI   + +  PV  ++YDSF PWA +V +  GL 
Sbjct  69    GGFASADSIEAYLDRVESVGSATLDELIRSERAAGRPVRALVYDSFFPWAREVGERRGLA  128

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYV--HGSYPAY  918
                FFTQ C VN VY   +   L +PVT  PV +PGLP LE  DMPSF+     G + +Y
Sbjct  129   TAAFFTQPCGVNIVYGHVNERRLGIPVTE-PVSLPGLPRLEPDDMPSFVSQADAGLFASY  187

Query  917   FELVLHQFLNVEKADCVFVNSFYKLE-AQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
              +LVL Q+ N++KAD VFVNSFY+LE  Q    M+       +GPTVPS YLDNR+ +DS
Sbjct  188   LKLVLEQYKNLDKADAVFVNSFYELEPEQEAGYMASTWRATTMGPTVPSSYLDNRLPSDS  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +LY       + WL++ P  SV+YV+FGSM  +  +QM ELA+G   +   FLWVV
Sbjct  248   HYGFDLYTPSVDLCMQWLDSLPSNSVVYVSFGSMTPLGPEQMAELAFGLLGSGKRFLWVV  307

Query  560   RDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R SE  KLPENF  D   ++ L+V+WSPQ+ VL+ +AVGCF TH GWNST+E +SLGVPM
Sbjct  308   RSSEASKLPENFAEDLSPERGLVVSWSPQMAVLSHEAVGCFLTHCGWNSTMEGISLGVPM  367

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAM  216
             V +PQWTDQ  NAK + DVW+VG R R GE G+V R E+E CVR V+EG   +E++ N+ 
Sbjct  368   VGVPQWTDQPTNAKYVEDVWRVGVRARAGERGLVGREEVERCVRVVMEGERSEEIRRNSS  427

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LAK+AV+EGG+SD+ I EF
Sbjct  428   KWRELAKKAVAEGGSSDRNILEF  450



>ref|XP_006357098.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=457

 Score =   458 bits (1178),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 219/445 (49%), Positives = 311/445 (70%), Gaps = 11/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGHINPMLQF KRL SK ++ T+A T      MK +  +V I+ ISDG D
Sbjct  7     AHCLILPYPFQGHINPMLQFSKRLQSKHVEITIAPTKSFLKKMKELPTSVSIEAISDGYD  66

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA +   YL RF+  GS TL+ LI++ +NS  PV+C++YD F+PW ++VAK  GL
Sbjct  67    DGGIDQAKTYEAYLTRFKEVGSDTLSQLIQKLENSGCPVNCIVYDPFLPWVVEVAKKFGL  126

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSF-IYVHGSY  927
              +  FFTQ C V+ +YY  H G+++LP T     + IPG    +E  D+P+F IY  G  
Sbjct  127   ISAAFFTQNCTVDNIYYHVHKGVIKLPPTQNDEKILIPGFSCPIEASDVPTFVIYPEGE-  185

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
                 +++++QF N++K D + +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ +
Sbjct  186   -RILQVLVNQFSNLDKVDWILINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHD  244

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D EYG++++     + ++WLN +P  SV+YV+FGS+A ++ +QMEELAWG KN+N  FLW
Sbjct  245   DKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKLEAEQMEELAWGLKNSNNNFLW  304

Query  566   VVRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR +E  KLP+NFL +   +K L+V+W PQL+VL  +++GCF TH GWNST+E++S+GV
Sbjct  305   VVRSTEESKLPKNFLEELTIEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLESISMGV  364

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVA+PQWTDQ  NAKL+ DVW++G R +  E G+V R  IE  ++ V+E   GK ++EN
Sbjct  365   PMVAIPQWTDQPTNAKLVKDVWEIGVRAKQDEKGIVRREIIEEYIKLVMEEEKGKLIREN  424

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  +A+  V EGG+SDK I+EF
Sbjct  425   AKKWKEMARNVVDEGGSSDKNIEEF  449



>ref|XP_009366994.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366995.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366996.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366997.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
Length=463

 Score =   458 bits (1178),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 306/442 (69%), Gaps = 11/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDII---SDG  1281
             HI+ +P P QGHINPMLQF KRL SKGL+ TL   +  + +++     V I+ I   S+ 
Sbjct  12    HILVVPLPVQGHINPMLQFSKRLASKGLRVTLVTISSNAEAIETQLCKVKIEPIHATSEE  71

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              ++AG    ++V + +  FQ   S+ L  LI + +N   PV C++YDS MPW LD AK  
Sbjct  72    EEEAG----NNVENKVLWFQTILSRRLPQLILKQENDGYPVICLVYDSAMPWVLDTAKGL  127

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+F   FFT +CAV  VYY  H G+L++P+  P + +PGLP LE +D+PSFIY  GSYP+
Sbjct  128   GIFGASFFTHSCAVGAVYYNVHEGLLRVPLKEPTISLPGLPLLEPQDLPSFIYDPGSYPS  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             +  LV+ +F N+  AD +F N+F+ LE +VV+ M    P+  IGPT+PS+YLD R+++D 
Sbjct  188   FLNLVVSRFSNITGADWIFFNTFHGLEKEVVNWMRTQWPIKTIGPTLPSMYLDKRLEDDK  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG+++++ +      WL +K  G+V+YV+FGSMA++ +KQMEE+A G K +N  FLWVV
Sbjct  248   EYGLSVFNPNTEACNKWLESKETGTVVYVSFGSMANLGEKQMEEIALGLKRSNANFLWVV  307

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP NF     +K L+VNW PQL+VL  +A+GCF TH GWNST+EALS GVPMV
Sbjct  308   RESETQKLPSNFEEQTSEKGLVVNWCPQLEVLGHRALGCFMTHCGWNSTLEALSCGVPMV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQT NAK + D WKVG RV+V + G+V++ EIE C+ EV+E   GKE+K N+M 
Sbjct  368   AMPQWTDQTTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAEVIEGERGKEIKRNSMI  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAK A+ EGG+SDK I+EF
Sbjct  428   WRELAKAAMDEGGSSDKNIEEF  449



>ref|XP_002529825.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32574.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   458 bits (1179),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 216/442 (49%), Positives = 306/442 (69%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
             +H++  P+P QGHINPM Q  K L SKGLK TL  T+ I+ +M+ P + +V I+ I DG 
Sbjct  13    SHVLVFPFPIQGHINPMFQLSKHLASKGLKVTLIATSSIARTMRAPQASSVHIETIFDGF  72

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
              +    +A +  +++  +     K+LA+LIE++  S  PV CVIYDS  PW  DVA+S G
Sbjct  73    KEGE--KASNPSEFIKTYDRTVPKSLAELIEKHAGSPHPVKCVIYDSVTPWIFDVARSSG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             ++   FFTQ+CA   +YY    G L++P+  P V +P  P LE  D+PSF+   GSY A 
Sbjct  131   VYGASFFTQSCAATGLYYHKIQGALKVPLEEPAVSLPAYPELEANDLPSFVNGPGSYQAV  190

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             +++   Q  NV++ D +  N+F +LE ++V+ M+    ++PIGP +PS++LDNR+++D +
Sbjct  191   YDMAFSQLSNVDEVDWLLWNTFTELEDEIVNWMASKWTIMPIGPAIPSMFLDNRLEDDKD  250

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+NL+  +    + WL++K   SVIYV+FGS+A++ + QM ELAWG K +N  FLWVVR
Sbjct  251   YGVNLFKPNSDACMKWLDSKEPSSVIYVSFGSLAALGEDQMAELAWGLKRSNNNFLWVVR  310

Query  557   DSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             + E  KLP NF+ +  ++  L+V WSPQL+VLA K+VGCF TH GWNST+EALSLGVPMV
Sbjct  311   ELEQKKLPPNFVEEVSEENGLVVTWSPQLQVLAHKSVGCFMTHCGWNSTLEALSLGVPMV  370

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQ  NAK + DVW+VG RV+V ++G+V+R EIE C+REV+E   GKEM+ N+ K
Sbjct  371   AMPQWTDQPTNAKFVTDVWRVGVRVKVDQNGIVTREEIEKCIREVMEGETGKEMRRNSEK  430

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA+ AV +GG+SDK I+EF
Sbjct  431   WKELARIAVDKGGSSDKNIEEF  452



>emb|CDP13110.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   457 bits (1176),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 304/441 (69%), Gaps = 7/441 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYP QGH+NPMLQF KRL  +G+K T AIT F+  ++  VS ++ ++ ISDG D
Sbjct  6     AHCLLLPYPVQGHLNPMLQFAKRLQHEGVKITFAITKFLFETLDEVSASISVETISDGYD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             +        +  Y  RFQ  GS+TL +LI + ++S  PVDC+IYDSF+PW LDVAK  G+
Sbjct  66    EGA--NGIVMEIYWPRFQKVGSETLTELILKLQDSGCPVDCIIYDSFLPWCLDVAKDLGV  123

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
              AG FFTQ+CAVN +Y   H G+L+LP+    V IPGLP L   D+PSF+   G YPA  
Sbjct  124   RAGVFFTQSCAVNNIYNHVHKGLLKLPLEESGVDIPGLPPLLASDLPSFVSNPGLYPAST  183

Query  914   ELVLH-QFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             +L  H Q  N E+AD +F N+FY LE + +  M+K+ PV  IGPT+PS+YL+ R+++D +
Sbjct  184   QLFAHDQMENFEEADWIFFNTFYGLEEEAIHWMAKILPVKTIGPTIPSMYLEKRLEDDKQ  243

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+NL+       + WLN +   SV+YV+FGS+A ++ KQMEELAW  + ++  FLWVVR
Sbjct  244   YGLNLFKPMTNACMSWLNERSISSVVYVSFGSLAELEVKQMEELAWSLRASSYNFLWVVR  303

Query  557   DSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +SE  KLP++F+ +   K LI++W PQL VLA K+VGCF TH GWNST+EALSLGVPM+A
Sbjct  304   ESESKKLPKDFVKETFGKGLIISWCPQLDVLAHKSVGCFVTHCGWNSTLEALSLGVPMIA  363

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMKW  210
             MPQWTDQ+ NAK ++DVWK G +    E G+V R  I  C+  V++GK   E+ ++A KW
Sbjct  364   MPQWTDQSTNAKFVMDVWKTGIKAGPDEAGIVRRDAISQCINLVMDGKKGQEISKHAKKW  423

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LA++A  EGG+SDK I +F
Sbjct  424   KDLARQAFDEGGSSDKNIKDF  444



>ref|XP_007044514.1| UDP-glucosyl transferase 74B1 [Theobroma cacao]
 gb|EOY00346.1| UDP-glucosyl transferase 74B1 [Theobroma cacao]
Length=462

 Score =   457 bits (1177),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 218/442 (49%), Positives = 308/442 (70%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H+V +PYPSQGHINP+LQF KRL SKG+K TLA T +   S+   +  +G++ ISDG D
Sbjct  8     GHVVVLPYPSQGHINPLLQFAKRLASKGVKATLATTHYTVESI--CAAHIGVEPISDGFD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               GF QA +V  YL  F+  GS+TL+ LI++++NS +PV+CV+YDSF+PWALDVAK HG+
Sbjct  66    QGGFSQAGNVDFYLKSFRENGSRTLSQLIQKFQNSTTPVNCVVYDSFLPWALDVAKQHGI  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPV--TSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             +   FFT +  V  ++   H G+L LP+   S PV++PGLP L   D+P+F+    SYPA
Sbjct  126   YGAPFFTNSATVCSIFSHIHRGLLPLPLMPESTPVKLPGLPPLNYPDLPTFLRFPDSYPA  185

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + L Q+ N+++AD +F N+F  LE +    +S++ P   IGP VPS YLD R+K D 
Sbjct  186   YLAMKLSQYSNLDEADWIFDNTFEDLEGKEARGVSEIWPAKLIGPMVPSAYLDERIKGDR  245

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     + ++WL TKP  SV+Y +FGSM S+ ++QMEE+AWG K +N +FLWVV
Sbjct  246   GYGSSLWKPLSEECMEWLETKPFQSVVYASFGSMVSLTEEQMEEIAWGLKESNLHFLWVV  305

Query  560   RDSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP+  +    +K ++V W  QL++LA  AVGCF TH GWNST+E LSLGVPM+
Sbjct  306   RESEQKKLPKWLVDSTKEKGMVVTWCNQLEMLAHPAVGCFVTHCGWNSTLEGLSLGVPMI  365

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
              +P+WTDQ  +AK + ++W++G R +  E+GVV R E+  C++EV+E   GK+M++NA K
Sbjct  366   GVPKWTDQLTDAKFVEEIWEIGVRAKEDEEGVVRREELMKCLKEVMEGKKGKKMRKNAKK  425

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W   AK+A+SEGG+SD  I+EF
Sbjct  426   WRESAKKAISEGGSSDDCINEF  447



>emb|CDP05435.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   462 bits (1190),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 308/442 (70%), Gaps = 9/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH++AIP+ S GHINPMLQ CK+LV KGLK TLAIT F S    P SD V IDIISDG D
Sbjct  10    AHVLAIPFQSAGHINPMLQLCKKLVRKGLKATLAITKFTSKVSFPKSDKVQIDIISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF   D VP  + RF+  GS+++ +L+++Y++  +P+D +IYDS +P+ LD+ K  GL
Sbjct  70    EGGFFFTDPVPISMARFKEVGSQSILELLKKYESLGTPIDFIIYDSLLPFVLDLCKEIGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
              A   FT  C VNY+ +   HG L  PVT  PV IPGLP LE +D+P   Y   + P +F
Sbjct  130   PAVASFTHQCGVNYIMHQFSHGKLTNPVTEFPVLIPGLPPLEHQDLP---YFGSNIPYHF  186

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
               V  QF NV +AD V VN+F +LE +VVD  SK  PV+ +GPTVP+ YLD RV +D EY
Sbjct  187   AYVCTQFSNVNQADYVLVNTFCELEKEVVDEFSKHLPVLTVGPTVPTFYLDRRVVDDKEY  246

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSM--ASVDQKQMEELAWGFKNTNTYFLWVV  561
             GI     DP+  ++WLN+KP  SVIY +  S+  AS  +KQ+EELA   KN+N YFLW V
Sbjct  247   GIASADSDPSICLNWLNSKPARSVIYASLSSVRSASFGEKQLEELALALKNSNYYFLWSV  306

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +  E  KLP+NF  +  DK L+V W+PQL+VL+S+AVGC  +H GWNS++EA+SLGVP+V
Sbjct  307   KHFEAEKLPKNFNEEASDKGLLVPWTPQLEVLSSEAVGCILSHCGWNSSLEAISLGVPIV  366

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQ+ DQ  NAK I DVWKVG RV+   +G+ +R EI  C++EV+E   GKE+KENAMK
Sbjct  367   AMPQFIDQQPNAKFIQDVWKVGIRVKHDRNGLATREEIGRCIKEVMEGETGKEIKENAMK  426

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             +S+LAK AVSEGG+SD  ++ F
Sbjct  427   FSNLAKAAVSEGGSSDTNLNYF  448



>gb|KDP35129.1| hypothetical protein JCGZ_10663 [Jatropha curcas]
Length=452

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 223/439 (51%), Positives = 304/439 (69%), Gaps = 14/439 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
              H++A+P P QGHINPMLQF KRL SKGLK TL   TFI N + K  + +V I+ IS   
Sbjct  12    THVLALPLPFQGHINPMLQFSKRLASKGLKVTLL--TFIDNQITKTKNGSVNIEFISS--  67

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
                    A+   DY    +   S  L +++ +   S  PV C+IYDS MPWALD+A+  G
Sbjct  68    ------DANEEDDYFQNLKSIVSVKLPEIVAKISESGFPVSCLIYDSIMPWALDMARELG  121

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             LF  C FTQ+CAV+ +YY A+ G L+ PV   PV I G+P L+L D+PSF +   +YP  
Sbjct  122   LFGACLFTQSCAVSNIYYKANEGKLRTPVEKVPVSIEGMPLLDLYDLPSFFFDLENYPTS  181

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMS-KMSPVIPIGPTVPSLYLDNRVKNDS  741
               L+ +QFLN+  AD VF N+F  LE +V++ M+ +  P+ PIGP++PS++LD R++ + 
Sbjct  182   LNLLTNQFLNLGDADWVFFNTFNGLEDEVINRMTARQFPIKPIGPSIPSMFLDKRIQENK  241

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG+NLY  +    + WL+++   SVIYV+FGS+  + +KQMEE+A+G K +N YFLWVV
Sbjct  242   EYGLNLYKPNIESCMKWLDSRETFSVIYVSFGSLCIMGEKQMEEIAFGLKRSNHYFLWVV  301

Query  560   RDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP NF+ +  +K +IV W  QL+VLA K++GCF TH GWNST+EALSLGVPMV
Sbjct  302   RESEEEKLPSNFVEETMEKGMIVTWCNQLEVLAHKSIGCFMTHCGWNSTMEALSLGVPMV  361

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKEMKENAMKWSH  204
             AMPQW DQT NAK + DVW+ G RV+V E+G+V++ EIE C++EV+EG E+++N  KW  
Sbjct  362   AMPQWCDQTTNAKFVADVWRTGIRVKVDEEGIVTKEEIEMCLKEVMEG-EIRKNCEKWKK  420

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LAKEA+ E G+SDK I+EF
Sbjct  421   LAKEAMEEDGSSDKNIEEF  439



>ref|XP_010037079.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Eucalyptus grandis]
Length=462

 Score =   457 bits (1175),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 226/444 (51%), Positives = 309/444 (70%), Gaps = 10/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDGC  1278
             H + + YP+QGH+NP LQFCKRL+ KG+K TL     +S ++   S   ++ ++ ISDG 
Sbjct  11    HCLVLSYPTQGHMNPTLQFCKRLLHKGVKVTLVTAKSMSKTLHGSSSCTSIALEAISDGF  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD G   A S   Y+ RF   G +TL++L++R  +S  P  C++YDSF+PWALDVA++ G
Sbjct  71    DDGGIGAAGSPEAYIERFWKVGPETLSELVKRLISSGPPPTCIVYDSFLPWALDVARNFG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L A  FFT +CAVN V+Y    G L++PV    V +PG+P LE +DMPS +   G+YPA+
Sbjct  131   LVAAAFFTMSCAVNSVFYHCQKGWLEVPVKKQ-VLLPGVPPLEPQDMPSLVCDVGTYPAF  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               ++++QF N++K D V  N+ Y+L+ +V D   K+ P   IGPTVPS YLDNR++ D E
Sbjct  190   TGMLVNQFSNLDKVDWVLCNTVYELDPEVADWFMKILPFRTIGPTVPSAYLDNRLEQDQE  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +++  +   ++ WL TKP+GSV+YV+FGSMA +   QM ELA G K +N YFLWVVR
Sbjct  250   YGFSIFQPEHDTTMRWLGTKPKGSVVYVSFGSMAELKIDQMHELAMGLKRSNCYFLWVVR  309

Query  557   DSELPKLPENFLGDDDKA---LIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
              SE  KLP++F    + +   LIV W PQLKVLA +A+G F TH GWNST+EALSLGVPM
Sbjct  310   SSEAEKLPQDFANGSETSQNGLIVTWCPQLKVLAHEALGLFVTHCGWNSTLEALSLGVPM  369

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEG---KEMKENA  219
             +A+PQWTDQ  NAK I+DVWK+G R +V E+ GVV+  EIE C+R+V+EG   K+MKE+A
Sbjct  370   LAIPQWTDQATNAKYIMDVWKMGLRPQVDEERGVVTSDEIEHCIRKVMEGETWKKMKEHA  429

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  + K+AV EGG+SD+ I+EF
Sbjct  430   GKWRKITKDAVGEGGSSDRNIEEF  453



>ref|XP_007201011.1| hypothetical protein PRUPE_ppa005386mg [Prunus persica]
 gb|EMJ02210.1| hypothetical protein PRUPE_ppa005386mg [Prunus persica]
Length=463

 Score =   457 bits (1175),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 310/450 (69%), Gaps = 14/450 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA---------VG  1302
             AH + + YPSQGHINP+LQF KRL  KGLK T   T  +  +M               + 
Sbjct  7     AHCLVLFYPSQGHINPLLQFSKRLEHKGLKVTFITTRSVLKAMHGGGGGGQSPSSFSSIA  66

Query  1301  IDIISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWA  1122
             ++ ISDG D+ G  QA+S+  YL+RF+  GS+TLA+LIE    S  P DC++YDS M WA
Sbjct  67    LETISDGYDEGGASQAESIEAYLDRFREIGSQTLAELIEEISGSGHPADCLVYDSCMSWA  126

Query  1121  LDVAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVT-SPPVRIPGLPALELRDMPSFI  945
             LDVAK  G+    FFT +CAV  +Y    +G+L++P+     + +PGLP L+  D PSF+
Sbjct  127   LDVAKRVGIAGAAFFTFSCAVTNIYSLVQNGLLKVPLNPGSEILLPGLPPLQPSDTPSFV  186

Query  944   YVHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYL  765
             YV GSYPA+F+L+L QF N++KAD V  N+F++LE + VD M+K  P+  IGPT+PS+Y+
Sbjct  187   YVSGSYPAFFKLILDQFSNLDKADWVLCNTFHELEQEAVDWMAKFWPLRTIGPTIPSMYM  246

Query  764   DNRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNT  585
             D R +++ EYG++L   +    + WLN KP+GSV YV+FGS+A + ++QMEEL  G + +
Sbjct  247   DKRHEDNWEYGLSLLKPNSDACMKWLNVKPKGSVAYVSFGSVAEIGEEQMEELGLGLRRS  306

Query  584   NTYFLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEA  408
              +YFLWVVR+ E  KLP+ F+ +  +K L+V+W PQL+VLA KAVGCF TH GWNST+E 
Sbjct  307   KSYFLWVVREKEAAKLPKGFVEETSEKGLVVSWCPQLEVLAHKAVGCFVTHCGWNSTLEG  366

Query  407   LSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GK  237
             LSLGVPMVA+PQWTDQ+ NA+ I+DVWK G + +  + G+V   EI  C+RE+L+   GK
Sbjct  367   LSLGVPMVAVPQWTDQSTNARFIMDVWKTGLKAQADKKGIVRGEEITHCLREILDGERGK  426

Query  236   EMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             E+++N  KW  LAK AV EGG+SDK IDEF
Sbjct  427   EIRKNTSKWKALAKNAVDEGGSSDKNIDEF  456



>ref|XP_006357100.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum tuberosum]
Length=457

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 307/444 (69%), Gaps = 9/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H + +PYP QGHINPMLQF KRL SK ++  +A T ++  +MK +  +V I+ ISDG D
Sbjct  7     THCLILPYPVQGHINPMLQFSKRLQSKRVEIIIATTKYLLKNMKELPTSVSIEAISDGYD  66

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G  QA S   Y+ RF+  GS TL+ LI++  NS  PV+C++YD ++ WA++VA   GL
Sbjct  67    DGGRDQAGSFVAYVTRFKEVGSDTLSQLIQKLANSGCPVNCIVYDPYLNWAVEVATKFGL  126

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTS--PPVRIPGLPA-LELRDMPSFIYVHGSYP  924
              +  FFTQ CAV+ +YY  H G+++ P T     + IPG    +E  D+PSF++      
Sbjct  127   VSAAFFTQNCAVDNIYYHVHKGVIKFPPTQNDKEIIIPGFSCPIEASDVPSFVF-RPEAE  185

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
                E++++QF N++K D V +NSFY+LE +V+D MSK+ P+  IGPT+PS+YLD R+ +D
Sbjct  186   RIIEMMVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDD  245

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG++++     + ++WLN +P  SV+YV+FGS+A ++ KQMEELAWG KN+N  FLWV
Sbjct  246   KEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKLEAKQMEELAWGLKNSNNNFLWV  305

Query  563   VRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VR +E  KL + F+ +   +K L+V+W PQL+VL  ++ GCF TH GWNST+EA+SLGVP
Sbjct  306   VRSTEESKLTKTFIEELTIEKGLVVSWCPQLQVLEHESTGCFLTHCGWNSTLEAISLGVP  365

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MV MPQWTDQT NAKL+ DVW++G R +  E G+V R  IE C++ V+E   GK ++E+A
Sbjct  366   MVTMPQWTDQTTNAKLVKDVWEIGVRAKQDEKGIVRREAIEECIKLVMEEERGKLIREHA  425

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  LA+  V EGG+SDK I+EF
Sbjct  426   KKWKELARNVVDEGGSSDKNIEEF  449



>ref|XP_006388126.1| hypothetical protein POPTR_0322s00200g [Populus trichocarpa]
 gb|ERP47040.1| hypothetical protein POPTR_0322s00200g [Populus trichocarpa]
Length=461

 Score =   455 bits (1171),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 221/441 (50%), Positives = 310/441 (70%), Gaps = 10/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H+V IPYP+QGHINPM+QF KRL SKGL+ TL I  F S ++   +    + +++    D
Sbjct  9     HVVVIPYPAQGHINPMIQFSKRLASKGLQVTLVI--FSSQTLSTPASLGSVKVVT--VSD  64

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLI-ERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             +    + S+ D L +FQ   +  L  L+ E   +S  PV C++YDSFMPW L++A+  GL
Sbjct  65    SSDTGSSSIGDLLKQFQATVAPKLPQLVVELGISSGHPVSCLVYDSFMPWVLEIARQLGL  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIY-VHGSYPAY  918
                 FFTQ+CAV+ VYY  H G L++P+   PV +PGLP L++ ++PSF++ +   Y + 
Sbjct  125   IGASFFTQSCAVSSVYYQIHEGQLKIPLEKFPVSVPGLPPLDVDELPSFVHDMESEYSSI  184

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               LV++QFLN   AD VFVNSF  LE +VV+ ++    + PIGP +PS+YLD ++++D+E
Sbjct  185   LTLVVNQFLNFRGADWVFVNSFNTLEEEVVNGLASQRSIKPIGPMIPSVYLDRQLEDDTE  244

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++L+       ++WL++K  GSV+YV+FG++A++ ++QM E+AWG + ++ YFLWVVR
Sbjct  245   YGLSLFKPALDGCMEWLDSKETGSVVYVSFGTLAALGEEQMAEIAWGLRRSDCYFLWVVR  304

Query  557   DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +SE  KLP NF+ G  +K LIV WSPQL+VLA K+VGCF TH GWNST+EALSLGVPMVA
Sbjct  305   ESEEKKLPCNFVEGSSEKGLIVTWSPQLEVLAHKSVGCFMTHCGWNSTLEALSLGVPMVA  364

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMKW  210
             +PQWTDQ  NAK I DVW+VG RV+  E G+V++ E+E C REV+EG+   EM+ N+ KW
Sbjct  365   VPQWTDQPTNAKYIADVWRVGVRVKANEKGIVTKEELEKCTREVMEGERGSEMRRNSEKW  424

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAK A+ EGG+SDK I EF
Sbjct  425   KKLAKTAMGEGGSSDKNITEF  445



>ref|XP_002275387.2| PREDICTED: UDP-glycosyltransferase 74E1-like [Vitis vinifera]
Length=459

 Score =   455 bits (1170),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 223/443 (50%), Positives = 308/443 (70%), Gaps = 9/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAIT-TFISNSMKPVSDAVGIDIISDGC  1278
              HI+ +P+ +QGHINPMLQF KRL SKG+K TL I  T  S SM   + ++ I+IIS+  
Sbjct  10    THIMVLPFHAQGHINPMLQFSKRLASKGIKVTLVIAATSNSQSMHAQTSSINIEIISEEF  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D     Q +S+ DYL RF++  S+ L  L+E++  S+ P   +IYDS +PWA D+A+  G
Sbjct  70    DRRQ--QEESIEDYLERFRILASQGLTALMEKHNRSNHPAKLLIYDSVLPWAQDLAEHLG  127

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY-PA  921
             L    FFTQ+CAV+ +YY  + G+   P+    V +P +P L + D+PSFI V      A
Sbjct  128   LDGVPFFTQSCAVSAIYYHFYQGVFNTPLEESTVSMPSMPLLRVDDLPSFINVKSPVDSA  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIP-IGPTVPSLYLDNRVKND  744
                LVL QF N +K   +  N+F KLE QV+  M+   P+I  IGPTVPS+YLD R+++D
Sbjct  188   LLNLVLSQFSNFKKGKWILCNTFDKLEDQVMKWMTSQRPLIKTIGPTVPSMYLDKRLEDD  247

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG++L+  +    I WL+TK  GSV+YV+FGS+AS+ ++QMEELAWG K +N++F+WV
Sbjct  248   KDYGLSLFQQNVDTCITWLDTKGIGSVVYVSFGSLASLGEEQMEELAWGLKRSNSHFMWV  307

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+ E  KLP NF+ +  +K L+V+W  QL+VLA KAVGCF TH GWNST+EALSLGVPM
Sbjct  308   VRELEKKKLPNNFIEETSEKGLVVSWCCQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPM  367

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAM  216
             +AMP+++DQT NAK + D+W+VG RV+  E G+V R EIE C+ E++EG+   EMK NA 
Sbjct  368   IAMPRFSDQTTNAKFVEDIWQVGVRVKADEKGIVKREEIEMCLSEIMEGERGYEMKRNAA  427

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             +W  LAKEAV+EGG+SDK ++EF
Sbjct  428   RWKELAKEAVNEGGSSDKNLEEF  450



>ref|XP_010091337.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB44327.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=453

 Score =   454 bits (1168),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/440 (51%), Positives = 303/440 (69%), Gaps = 9/440 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              HI+ IP P QGHINPMLQF KRL SKGLK TL +T F +N  +   +  G+      C+
Sbjct  10    THILVIPLPIQGHINPMLQFSKRLASKGLKVTL-VTAFSNN--EATHNQAGLIRFEPICN  66

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               G  ++D + + +  FQ   SK L +LI + + +  PV C++YDS MPW LD+AK HGL
Sbjct  67    --GLEESDKIENMVEWFQNIASKRLPELIVKQETNGFPVSCLVYDSAMPWILDLAKRHGL  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFT +CAV  +YY  H  +L++P+  P V + GLP+L+  D+PSFIY  GSYP++ 
Sbjct  125   SGASFFTHSCAVACIYYYLHQDLLRVPLKEPQVSLAGLPSLKAHDLPSFIYDPGSYPSFL  184

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             +LV+ +F N+ KAD +F +SF  LE +VV  M  +  +  IGPT+PS+YLD R++ D +Y
Sbjct  185   KLVISRFSNLTKADWIFFSSFDNLEKEVVSWMRTLWRIKTIGPTIPSMYLDKRLEEDKDY  244

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G  L++ +    I WL++K   SV+Y++FGS+A++  +QMEELA G K +N  FLWV R+
Sbjct  245   GFGLFNPNADACIKWLDSKEVDSVVYLSFGSIANLGNEQMEELAEGLKRSNCNFLWVARE  304

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE+ KLP  F+ +  +K L+VNW PQL VL+ ++ GCF TH GWNST+EALSLGVPMVAM
Sbjct  305   SEVGKLPSKFVEETSEKGLVVNWCPQLGVLSHRSTGCFVTHCGWNSTLEALSLGVPMVAM  364

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             PQWTDQT NAK + DVW+VG RVRV   G+V R EIE C+REVL+   GK +KEN+++W 
Sbjct  365   PQWTDQTTNAKFVADVWRVGLRVRVDPSGIVPREEIELCIREVLQGERGKGIKENSIRWR  424

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEAV EGG+S+  I+EF
Sbjct  425   ELAKEAVDEGGSSNNNIEEF  444



>ref|XP_008235864.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=461

 Score =   454 bits (1168),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 225/448 (50%), Positives = 311/448 (69%), Gaps = 12/448 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM------KPVS-DAVGID  1296
             +H + + YPSQGHINP+LQF KRL  KGLK T   T  +  +M       P S  ++ ++
Sbjct  7     SHCLVLFYPSQGHINPLLQFSKRLEHKGLKVTFITTRSVLKAMHGGGGQSPSSFSSIALE  66

Query  1295  IISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALD  1116
              ISDG D+ G  QA+S+  YL+RF+  GS+TLA+LIE    S  P DC++YDS M WALD
Sbjct  67    TISDGYDEGGASQAESIEAYLDRFREIGSQTLAELIEEISGSGHPADCLVYDSCMSWALD  126

Query  1115  VAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVT-SPPVRIPGLPALELRDMPSFIYV  939
             VAK  G+    FFT +CAV  +Y    +G+L++P+     + +PGLP L+  D PSF+Y 
Sbjct  127   VAKRAGIAGAAFFTFSCAVTNIYSLVQNGLLKVPLNPGSEILLPGLPPLQPSDTPSFVYD  186

Query  938   HGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDN  759
              GSYPA+F+L+L QF N++KAD V  N+F++LE + VD M+K  P+  IGPT+PS+Y+D 
Sbjct  187   SGSYPAFFKLILDQFSNLDKADWVLCNTFHELEQEAVDRMAKFWPLRTIGPTIPSMYMDK  246

Query  758   RVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNT  579
             R +++ EYG++L   +    + WLN KP+GSV YV+FGS+A + ++QMEE+  G + + +
Sbjct  247   RHEDNWEYGLSLLKPNSDACMKWLNVKPKGSVAYVSFGSVAEIGEEQMEEMGLGLRRSKS  306

Query  578   YFLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALS  402
             YFLWVVR+ E  KLP+ F+ +  +K L+V+W PQL+VLA + VGCF TH GWNST+E LS
Sbjct  307   YFLWVVREKEAAKLPKGFVEETSEKGLVVSWCPQLEVLAHETVGCFVTHCGWNSTLEGLS  366

Query  401   LGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEM  231
             LGVPM+A+PQWTDQ+ NA+ IVDVWK G + +  + G+V   EI  CVRE+L+   GKE+
Sbjct  367   LGVPMLAVPQWTDQSTNARFIVDVWKTGVKAQADKKGIVRGEEIAHCVREILDGEIGKEI  426

Query  230   KENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             ++N  KW  LAK AV EGG+SDK IDEF
Sbjct  427   RKNTSKWKALAKNAVDEGGSSDKNIDEF  454



>emb|CDP03994.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 302/440 (69%), Gaps = 5/440 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGCD  1275
             H++A+P P QGHINP+LQFCKRL +KG+K T A T  +S SM      ++  + ISDG D
Sbjct  9     HVLALPLPVQGHINPLLQFCKRLEAKGVKVTFANTVSLSKSMHADPKRSINFETISDGYD  68

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D G+  A+S   Y+ +F   GSKTLADLI + ++   PV  VIYD  + WALDVAK  GL
Sbjct  69    DGGYAAAESFEAYVEKFATVGSKTLADLITKLEDDGEPVQAVIYDPHLTWALDVAKRFGL  128

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ CAVN +YY  +HG+L +P++  P+ +PGLP L+ ++ PSFIY+  SYP + 
Sbjct  129   VTAAFFTQTCAVNSIYYHVYHGLLPVPLSDSPISLPGLPLLQPKETPSFIYLPDSYPDFR  188

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              ++++QF NV++AD V +++F+KLE   V+ M+++  V  +GPTVPS+YLD R+++D+ Y
Sbjct  189   HILVNQFSNVDQADWVILSNFHKLEEDAVNWMARLWRVKTVGPTVPSMYLDKRLEDDTGY  248

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             GINL+  D +  I+WL+ +P+ SV+YVAFGS   ++ +Q+EE+A         FLWVVR 
Sbjct  249   GINLFKPDSSLCINWLDNQPKDSVVYVAFGSWIGIEAEQVEEIASALMEIGFRFLWVVRA  308

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
              E  KLP NF+ +  ++ L+V WSPQL+VLA ++V CF TH G NS +EALSLGVP+VA 
Sbjct  309   LEKEKLPSNFVDETSERGLVVTWSPQLEVLAHESVACFVTHCGLNSVMEALSLGVPVVAA  368

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             PQ  DQ  NAK I DVW VG R    E G+V R  +  C+RE++E   GK +KEN +KW 
Sbjct  369   PQLADQPTNAKFIEDVWGVGVRAAADEKGIVRRETLVSCIREIMEGERGKRIKENGIKWK  428

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEA+ EGG+SD+ IDEF
Sbjct  429   TLAKEAIDEGGSSDRNIDEF  448



>ref|XP_002529823.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32572.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   454 bits (1168),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/442 (49%), Positives = 308/442 (70%), Gaps = 10/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPV-SDAVGIDIISDGCD  1275
             H++  PYP QGHINPMLQ  KRL SKGL+ TL  T+ I+ +MK   + +V I+ I DG +
Sbjct  14    HVLVFPYPVQGHINPMLQLSKRLASKGLRVTLVATSSIAKAMKASHASSVHIETIFDGFE  73

Query  1274  DAGFLQADSVPDYLNR-FQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             +    +  S P+  +  F+    K+L +LIE++  S  PV C+IYDS  PW  DVA+  G
Sbjct  74    EG---EKASDPNAFDETFKATVPKSLVELIEKHAGSPYPVKCLIYDSVTPWLFDVARRSG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             ++   FFTQ+CAV  +YY    G L++P+    V +P  P LE  D+PS++   GSY A 
Sbjct  131   IYGASFFTQSCAVTGLYYHKIQGALRVPLEESVVSLPSYPELESNDLPSYVNGAGSYQAI  190

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             +++   QF NV++ D +  N+F +LE +VV+ M    P++PIGPT+PS++LD R+++D +
Sbjct  191   YDMAFSQFSNVDEVDWLLWNTFNELEDEVVNWMKSKWPIMPIGPTIPSMFLDRRLEDDKD  250

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++L+  +    + WL++K   SV+YV+FGS A++++ QM E+AWG + +N+ FLWVVR
Sbjct  251   YGLSLFKPNSDACMKWLDSKEARSVVYVSFGSQAALEEDQMAEVAWGLRRSNSNFLWVVR  310

Query  557   DSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +SE  KLP NF  +  ++K ++V WSPQL+VLA K+VGCF TH GWNST+EALSLGVPMV
Sbjct  311   ESEAKKLPANFAEEITEEKGVVVTWSPQLEVLAHKSVGCFMTHCGWNSTLEALSLGVPMV  370

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQWTDQ  NAK + DVW+VG RV+V ++G+V++ EIE C+REV+E   GKEM+ N+ K
Sbjct  371   AMPQWTDQPTNAKFVTDVWRVGVRVKVDQNGIVTQEEIEKCIREVMEGETGKEMRMNSEK  430

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA+ AV EGG+SDK I+EF
Sbjct  431   WKELARIAVDEGGSSDKNIEEF  452



>ref|XP_010679010.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=464

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 223/449 (50%), Positives = 304/449 (68%), Gaps = 13/449 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK----PVSDAVGIDI--  1293
             AH++ +P+P QGHINPM QF KRL SKG+K TL  T +IS SM+    P      I I  
Sbjct  10    AHVLVVPFPGQGHINPMFQFSKRLASKGIKPTLTPTIYISKSMQTHTIPTQYGPSIQIRP  69

Query  1292  ISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDV  1113
             ISDG DD G+ QA+S   YL+   + G KTLA LI++      PV  VIYD F PWALDV
Sbjct  70    ISDGYDDGGYAQAESTKAYLDSIAIEGPKTLAQLIQKLAEEGDPVKAVIYDGFAPWALDV  129

Query  1112  AKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSP---PVRIPGLPALELRDMPSFIY  942
             AK  GL    FFTQ+C+VN +YY    G+++LP+  P    V +PG+P L+  ++PSF+ 
Sbjct  130   AKKFGLVGVLFFTQSCSVNSIYYHVQRGLIELPLLGPGPNTVSVPGVPELQPWEVPSFVE  189

Query  941   VHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLD  762
              +GSYP +F+ V+ QF ++++ D V  N FY +E +VVD MSKM  V  IGPTVPS YLD
Sbjct  190   NYGSYPFWFDAVMEQFSSIDQVDWVLCNIFYDMEIEVVDWMSKMWKVKTIGPTVPSYYLD  249

Query  761   NRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTN  582
              R+++D +Y + L+  +     +WL++KP+ SVIY++FGS A + ++Q EEL+   +N++
Sbjct  250   KRLEDDKDYSLQLFKPNTVLCKNWLDSKPKESVIYISFGSAAELSEEQFEELSCSLRNSH  309

Query  581   TYFLWVVRDSELPKLPENFLGDDDK-ALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEAL  405
               FLWVVR+ E  KLP+ F+ +  K  L+V W+ QL +LA +A GCF TH G+NS +E L
Sbjct  310   NNFLWVVREKEQTKLPKRFIDETSKQGLVVGWASQLDILAHEATGCFVTHCGFNSVLETL  369

Query  404   SLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KE  234
             SLGVP+VA+PQWTDQ  NAK + DVW+VG R +V E G+V +  +E C++EV+EG   +E
Sbjct  370   SLGVPVVAVPQWTDQGTNAKFVEDVWRVGVRAKVDEKGIVRKEMLEECIKEVMEGENREE  429

Query  233   MKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
              K+NA KW  LAKEA+ EGG+SDK IDEF
Sbjct  430   FKKNAAKWKKLAKEAMYEGGSSDKNIDEF  458



>gb|KCW48703.1| hypothetical protein EUGRSUZ_K02355 [Eucalyptus grandis]
Length=461

 Score =   453 bits (1165),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 226/444 (51%), Positives = 305/444 (69%), Gaps = 10/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD--AVGIDIISDGC  1278
             H + + YP+QGH+NP LQFCKRL+ KG+K TL     +S ++   S   ++ ++ ISDG 
Sbjct  11    HCLVLSYPTQGHMNPTLQFCKRLLHKGVKVTLVTAKSMSKTLHGSSSCTSIALEAISDGF  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             DD G   A S   Y+ RF   G +TL++L++R  +S  P  C++YDSF+PWALDVA++ G
Sbjct  71    DDGGIGAAGSPEAYIERFWKVGPETLSELVKRLISSGPPPTCIVYDSFLPWALDVARNFG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L A  FFT +CAVN V+Y    G L++PV    V +PG+P LE +DMPS +   G+YPA+
Sbjct  131   LVAAAFFTMSCAVNSVFYHCQKGWLEVPVKKQ-VLLPGVPPLEPQDMPSLVCDVGTYPAF  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               ++++QF N++K D V  N+ Y+L+ +V D   K+ P   IGPTVPS YLD+R++ D E
Sbjct  190   TGMLVNQFSNLDKVDWVLCNTVYELDPEVADWFMKILPFRTIGPTVPSTYLDSRLEQDKE  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +++  D   ++ WL+TKP+GSV+YV+FGSMA +   QM ELA G K +N YFLWVVR
Sbjct  250   YGFSIFEPDHDTTMRWLSTKPKGSVVYVSFGSMAELKTDQMHELAMGLKRSNCYFLWVVR  309

Query  557   DSELPKLPENFLG---DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
              SE  KLP+ F        K LIV W PQL+VLA  A+G F TH GWNST+EALSLGVPM
Sbjct  310   SSEAEKLPQGFANCTETSQKGLIVTWCPQLEVLAHGALGLFVTHCGWNSTLEALSLGVPM  369

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLE---GKEMKENA  219
             +A+PQWTDQ  NAK I+DVWK+G R  V E+ GVV+  EIE C+R+V+E    K+MKENA
Sbjct  370   LAIPQWTDQATNAKYIMDVWKMGLRPLVDEERGVVTSEEIEHCLRKVMEEETRKKMKENA  429

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  + K+AV EGG+SD+ I+EF
Sbjct  430   GKWRKITKDAVGEGGSSDRNIEEF  453



>ref|XP_011086491.1| PREDICTED: UDP-glycosyltransferase 74B1 [Sesamum indicum]
Length=458

 Score =   453 bits (1165),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 228/441 (52%), Positives = 295/441 (67%), Gaps = 8/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ +PYPSQGHINP+LQF KRL SKG+K TLA T +   S+   + AV ++ ISDG D 
Sbjct  5     HVIVLPYPSQGHINPLLQFAKRLASKGVKATLATTHYTLRSIG--AGAVAVEPISDGFDH  62

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF +A +   YL  F+  GSK+L+ LI +YKN+ SPV C+IYDSF+PWALDVAK HG+F
Sbjct  63    GGFAEAHNEDTYLKSFRENGSKSLSKLIWKYKNTSSPVSCIIYDSFLPWALDVAKQHGIF  122

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRD--MPSFIYVHGSYPAY  918
                FFT +  V  V+   H G L LPV      +       L D  +P FI V  SYPAY
Sbjct  123   GASFFTNSATVCAVFSHIHRGTLTLPVKMEHEPLLLPGLPPLYDCDIPGFIKVPESYPAY  182

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               + ++QFLN++KAD VF NSF +LE Q   ++ K  P   IGP VPS YLD R++ D  
Sbjct  183   LAMKMNQFLNLDKADFVFDNSFQELEGQEATSVEKWWPAKLIGPMVPSAYLDGRIEGDKG  242

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +L+     +   WL TKP+ SVIY++FGSM S+  KQM E+AW    +N+YFLWVVR
Sbjct  243   YGASLWKPLSEQCTSWLKTKPQESVIYISFGSMVSLTSKQMAEIAWALTCSNSYFLWVVR  302

Query  557   DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             ++E  KLP +F+   + K LIV W  QL++LA  AVGCF TH GWNST+E LSLG+PMVA
Sbjct  303   ETERRKLPTHFVESTNGKGLIVAWCNQLELLAHPAVGCFVTHCGWNSTLEGLSLGMPMVA  362

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKW  210
             +PQW+DQ  +AK I D+W+VG R +  E G+ SR E+  C++EV+EG   +EMK NA KW
Sbjct  363   IPQWSDQMTDAKFIEDIWRVGVRAKEDEFGIASREEVLFCLKEVMEGERSEEMKRNARKW  422

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAK A+ EGG+SDK IDEF
Sbjct  423   RELAKRAIDEGGSSDKAIDEF  443



>gb|AIT15666.1| UDP-glycosyltransferase, partial [Cicer arietinum]
Length=410

 Score =   450 bits (1158),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 215/390 (55%), Positives = 281/390 (72%), Gaps = 7/390 (2%)
 Frame = -2

Query  1298  DIISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWAL  1119
             D ISDG D  GF QA+++  YL+  +  GS  L +LI++Y  S+ P+DCVIYD  + W L
Sbjct  15    DFISDGYDQGGFAQANNISTYLSHMETIGSNNLKELIKKYNFSNDPIDCVIYDPLIYWVL  74

Query  1118  DVAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYV  939
             DVAK  GL    FFTQ   VNY+YY  HHG+L+LP++S  + I GLP L+++D PSF+  
Sbjct  75    DVAKEFGLLGAAFFTQMSGVNYIYYYVHHGLLKLPISSMTISIQGLPLLDIKDTPSFVND  134

Query  938   HGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDN  759
              G YPAY+ELV++QF N+ KAD + VNSFYKLE +VVD+MSK+ P++ IGPTVPS YLD 
Sbjct  135   PGFYPAYYELVMNQFSNIHKADVILVNSFYKLEDKVVDSMSKLCPILTIGPTVPSFYLDK  194

Query  758   RVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNT  579
              + ND +  +NL+ +D + +I+WLNTKPEGSVIYV+FGSM     +QM+E+A G   +  
Sbjct  195   EIPNDKDNDLNLFQLD-SSAINWLNTKPEGSVIYVSFGSMVCFSIEQMKEIALGLIGSGL  253

Query  578   YFLWVVRDSELPKLPENFLGD---DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEA  408
              FLWVV + E   + +  + +     K L+VNW PQL+VL++KA+GCF TH GWNST+EA
Sbjct  254   NFLWVVPNMEGKNISKELVEEISLSGKGLVVNWIPQLEVLSNKAIGCFVTHCGWNSTLEA  313

Query  407   LSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GK  237
             L LGVPMVA+PQWTDQ MNAK + DVWKVG RV V E+G+V+R EIE C+REV+E   G+
Sbjct  314   LCLGVPMVAIPQWTDQPMNAKFVEDVWKVGIRVLVYENGIVTREEIESCIREVMESEHGR  373

Query  236   EMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             EM+ NA KW  LA EAVS GG+SD  I+EF
Sbjct  374   EMRINAKKWRELAIEAVSLGGSSDNNINEF  403



>gb|KDP21298.1| hypothetical protein JCGZ_21769 [Jatropha curcas]
Length=462

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 220/442 (50%), Positives = 309/442 (70%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H+V +PYPSQGHINP+LQF K L SKGLK TLA T +   S+   +  V ++ ISDG D
Sbjct  8     GHVVLLPYPSQGHINPLLQFAKLLASKGLKATLATTHYTVKSI--WAPTVTVEPISDGFD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             D GF QA     +LN F+V GS+TL+ LIE++K S+ PV+C++YDSF+PWALDVA+ HG+
Sbjct  66    DGGFSQAKDGDLFLNSFKVNGSRTLSQLIEKFKCSNFPVNCIVYDSFLPWALDVARQHGI  125

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             +   FFT + +V++++   HHG+L LP+   + P+ +PG+P L   D+P+F+    SYPA
Sbjct  126   YGASFFTNSASVSHIFCRLHHGLLTLPLEPENMPLVLPGIPPLNYCDLPTFLRYPDSYPA  185

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + L+QF +++ AD +F N+F  LE++    +SK+ P   IGP VPS YLD R++ D 
Sbjct  186   YLAMKLNQFSDLDTADWIFANTFEDLESKEAGGISKLWPAKLIGPMVPSFYLDGRIEGDK  245

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     + + WL TK   SV+Y++FGSM S+ + QMEE+A   + +N  FLWVV
Sbjct  246   GYGASLWKPLGEECLRWLETKQPQSVVYISFGSMVSLTETQMEEIALALQESNLDFLWVV  305

Query  560   RDSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE+ KLP  F+    +K LIV W  QL++LA++A+GCF TH GWNST+EALSLGVPMV
Sbjct  306   RESEMGKLPNGFIESAHEKGLIVTWCNQLEMLANQAIGCFVTHCGWNSTLEALSLGVPMV  365

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMK  213
             AMPQWTDQ  N+K + DVWK+G + +  + GVV + E+  C++EVLEGK   ++K+NA K
Sbjct  366   AMPQWTDQVPNSKFVEDVWKIGVKGKEDDKGVVRKQEVIRCLKEVLEGKKSQKIKKNARK  425

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W   A+EAV EGG+SDK I++F
Sbjct  426   WRKAAREAVGEGGSSDKHINDF  447



>ref|XP_010043823.1| PREDICTED: UDP-glycosyltransferase 74B1 [Eucalyptus grandis]
 gb|KCW85820.1| hypothetical protein EUGRSUZ_B02563 [Eucalyptus grandis]
Length=464

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 300/443 (68%), Gaps = 10/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH+V +PYPSQGHINP+LQF KRL SKGLK TLA T +   S+   +  VG++ ISDG D
Sbjct  10    AHVVVLPYPSQGHINPLLQFAKRLASKGLKATLATTHYTVKSIH--APNVGVEPISDGFD  67

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF QA S   +L  F+  GS+TL+++IE+Y ++D+PV CV+YDSF PWAL+VAK HG+
Sbjct  68    EKGFAQAGSEAVFLKSFEEHGSRTLSEVIEKYSSTDAPVTCVVYDSFFPWALNVAKQHGI  127

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             +   FFT +  ++ ++Y  H G+L+LP+      + +PGLP L  RD+PSF+   G+YPA
Sbjct  128   YGAAFFTNSVTISNIFYRLHCGLLKLPLEFHDEALLVPGLPPLNSRDLPSFLQSPGTYPA  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + L QF N +KAD +F NSF  LE +   ++S + P   IGP VPS YLD R+  D 
Sbjct  188   YLAMKLRQFTNTDKADWIFGNSFEALECEEAKSISDLWPAKLIGPMVPSAYLDCRIDKDD  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     +  +WL TKP  SV+YV+FGSM S+  +QMEE+AWG K +   FLWVV
Sbjct  248   TYGASLWKPLNIECANWLETKPPKSVVYVSFGSMISLTAEQMEEMAWGLKESGFPFLWVV  307

Query  560   RDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R SEL KLP+ F G+   +K +I  W  QL+VLA +A GCF TH GWNST+E LS GVPM
Sbjct  308   RPSELDKLPQGF-GEFVQEKVMIATWCNQLEVLAHRATGCFMTHCGWNSTLEGLSAGVPM  366

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAM  216
             V +P++ DQ  NAK + ++W VG R +  E+GVV R E+  C+ EV+ G    E++ N  
Sbjct  367   VGVPRFADQFTNAKYVEEIWGVGVRPKEDEEGVVRREEVVKCLNEVMRGDRSDEIERNGR  426

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  LAKEA+SEGG+SD+ I+EF
Sbjct  427   KWMELAKEAISEGGSSDRCINEF  449



>ref|XP_008236257.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=459

 Score =   452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 304/445 (68%), Gaps = 10/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDI--ISD  1284
              H + +PYPSQGHINPMLQF K L  KG+K TL  T +I  +M    S  + +D+  ISD
Sbjct  10    GHCLVLPYPSQGHINPMLQFAKLLSHKGVKVTLVTTRYIHKTMYGSASSCIALDLETISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+AG  +A S+  YL  F   GSKTLA+L+E+  +S  PVDCV+YD+FMPW LDVA+ 
Sbjct  70    GYDEAGRGEA-SIDAYLESFWKEGSKTLAELLEKLSSSGPPVDCVVYDAFMPWPLDVARK  128

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMP--SFIYVHGS  930
              G+    FFTQ+CAV+ +YY  H G+L++P+      I       L  +   SF+Y    
Sbjct  129   FGIAGATFFTQSCAVSNIYYHVHKGLLKVPLADDQSLISLPGLPPLDPLDLPSFVYDLEY  188

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
              PA++ +V+ QF NV+KAD V  N+FY+LE QVVD ++K  P+  +GPT+PS YLD R++
Sbjct  189   CPAFYRVVVGQFSNVDKADWVLCNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLE  248

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D EYG+NL+  D    I WLN +P+GSV YV+FGS A +D +QMEELA G + + + FL
Sbjct  249   DDKEYGVNLFKSDNDACIKWLNERPKGSVAYVSFGSAAKLDDEQMEELARGLRRSKSNFL  308

Query  569   WVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR SE  K+P+ F+ +  +K L+V+W  Q++VL  +AVGCF TH GWNST+EALSLGV
Sbjct  309   WVVRASEAAKVPKGFIEETSEKGLVVSWCSQMEVLVHEAVGCFVTHCGWNSTLEALSLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PM+AMPQWTDQ  NAK I+DVWK+G      E G V +  +E C+ E++E   GKEMK N
Sbjct  369   PMLAMPQWTDQRTNAKFIMDVWKIGITAPSDEKGKVRQEVVEHCISEIMEGERGKEMKIN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A+KW  LA++AV EGG+SDK IDEF
Sbjct  429   ALKWKKLARKAVDEGGSSDKNIDEF  453



>emb|CAN69453.1| hypothetical protein VITISV_002845 [Vitis vinifera]
Length=433

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 214/333 (64%), Positives = 258/333 (77%), Gaps = 5/333 (2%)
 Frame = -2

Query  1130  PWALDVAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPS  951
             PWALDVAK  GL    FFTQ CAV Y++Y  HHG+L LPV+SPPV IPGLP L+L DMPS
Sbjct  5     PWALDVAKEFGLVGAAFFTQTCAVTYIFYYVHHGLLTLPVSSPPVSIPGLPLLDLEDMPS  64

Query  950   FIYVHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSL  771
             FI    SYPAY ++VL QF NV+KADC+ VNSFYKLE  VVD MSK+  ++ IGPT+PS 
Sbjct  65    FISAPDSYPAYLKMVLDQFCNVDKADCILVNSFYKLEDSVVDAMSKVCTLLTIGPTIPSF  124

Query  770   YLDNRVKNDSEYGINLYHMDPTKS-IDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGF  594
             + D RV +D  YG+N +    +++ I+WL++KP+GSV+YV+FGSMAS+ ++QM ELAWG 
Sbjct  125   FSDKRVNDDMAYGLNFFKAHQSETCIEWLSSKPKGSVVYVSFGSMASLSEEQMGELAWGL  184

Query  593   KNTNTYFLWVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNST  417
             K ++ YFLWVVR SE  KLP+ F+ ++ +K  +V W PQL+VLAS A+GCFFTH GWNST
Sbjct  185   KGSSHYFLWVVRASEEAKLPKGFINEELEKGFLVRWCPQLEVLASNAIGCFFTHCGWNST  244

Query  416   IEALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE--  243
              EAL+LGVPMV MPQWTDQT NAK I DVWKVG RVR GEDGVV R EIE C+REV+E  
Sbjct  245   SEALTLGVPMVGMPQWTDQTTNAKFIKDVWKVGVRVREGEDGVVRREEIEACIREVMEGE  304

Query  242   -GKEMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
              GKEMKENAMKWS   +EAV EGGTSD+ IDEF
Sbjct  305   RGKEMKENAMKWSGFTREAVGEGGTSDRNIDEF  337



>ref|XP_006478564.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Citrus sinensis]
Length=423

 Score =   450 bits (1157),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 270/339 (80%), Gaps = 4/339 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPV--SDAVGIDIISDG  1281
             AH++ + YPSQGHINP  QF KRL SKGLK TLAIT FI  + KP   SD+V ID ISDG
Sbjct  9     AHVLIVSYPSQGHINPTFQFAKRLASKGLKITLAITNFIYKTKKPPQPSDSVQIDTISDG  68

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD GF +A+S+  YL   +VAG KTLA+LI +YK+S +P+DCV+YD+F+ WALDVAK  
Sbjct  69    YDDGGFSEAESIDAYLQNMEVAGLKTLAELITKYKSSSNPIDCVVYDAFLYWALDVAKGF  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GLF+  FFTQ CAVN++YY  HHG+L+LPV+S PV IPG+P LEL+DMPSFI V G YPA
Sbjct  129   GLFSAAFFTQTCAVNFIYYLVHHGLLKLPVSSTPVSIPGMPLLELQDMPSFIGVQGQYPA  188

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             YFE+VL+QF N ++AD V VN+FYKLE+QV D+MSK  P++ IGPT+PS YLDNR+ ND+
Sbjct  189   YFEMVLNQFSNADRADLVLVNTFYKLESQVADSMSKFCPMVTIGPTLPSFYLDNRILNDN  248

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +Y +NL+ +D + +++WLNTKPEGSV+YV+FGSMA +  +Q+EELAWG K ++ YFLWV+
Sbjct  249   DYDLNLFTLDKSITMNWLNTKPEGSVVYVSFGSMACLANEQVEELAWGLKKSSFYFLWVI  308

Query  560   RDS-ELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVG  450
             RD+ E  KLP+ F+ G  DK LIVNWSPQL+VL++KA+G
Sbjct  309   RDTEETNKLPKGFVDGIGDKGLIVNWSPQLEVLSNKALG  347



>emb|CDY44260.1| BnaC03g24520D [Brassica napus]
Length=443

 Score =   449 bits (1156),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 314/446 (70%), Gaps = 24/446 (5%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
              H++A+ YP+QGHI P+ QFCKRL+SKGL+TTLA+TTFI NS+K   S  V I  ISDG 
Sbjct  5     GHVLAVSYPAQGHITPIHQFCKRLISKGLQTTLALTTFIFNSIKHDPSGPVSIATISDGY  64

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF  + S+ DY+  F++ GSKT+ D+I +++ SD+P+ C++YDSF+PWA DVA+  G
Sbjct  65    DQ-GFDSSGSIQDYVQSFKIFGSKTITDIIRKHETSDNPITCIVYDSFLPWAFDVAREFG  123

Query  1097  LFAGCFFTQACAVNYVYYCAH--HGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
             + A  FFTQ+CAV YVYY ++  +G L LP       I     LE +D+PSF+    SYP
Sbjct  124   IAAAPFFTQSCAVKYVYYLSYISNGSLNLP-------IEEFHFLEHQDLPSFLSAPESYP  176

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AY E+VL QF N +KAD + VN+F +LE    + +S +  V+ IGPTVPS+YLD R+ +D
Sbjct  177   AYLEMVLQQFTNFQKADFLLVNTFQELELHEQELLSNVCHVLTIGPTVPSMYLDQRIISD  236

Query  743   SEYGINLYHM-DPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             + Y +N++ + D      WLNT+P+GSV+YVAFGS+A ++  QMEELA      +  FLW
Sbjct  237   TNYDLNIFDLKDAAFCTSWLNTRPQGSVVYVAFGSIAKLNNVQMEELASAVSKFS--FLW  294

Query  566   VVRDSELPKLPENFLG--DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VVR+    KLP  FL   D DK+L++ WSPQL+VL++KA+GCF TH GWNST+EAL++GV
Sbjct  295   VVRE----KLPSGFLETLDKDKSLVLKWSPQLEVLSNKAIGCFLTHCGWNSTLEALAIGV  350

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRG-EIEGCVREVLEG---KEMKE  225
             PMVAMPQW DQ M+AK I DVWK G RV++  +  +++  EIE  ++EV+EG   KEMKE
Sbjct  351   PMVAMPQWIDQPMDAKYIQDVWKAGVRVKIDNESRIAKTEEIEFSIKEVMEGEKSKEMKE  410

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA KW  LA +++SEGG++D  ID F
Sbjct  411   NAKKWRDLAVKSLSEGGSTDINIDTF  436



>ref|XP_006447930.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
 gb|ESR61170.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
Length=465

 Score =   450 bits (1158),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 225/445 (51%), Positives = 314/445 (71%), Gaps = 13/445 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK---PVSDAVGIDIISD  1284
             AH + + YP+QGHINP+LQF KRL  KG+K TL  T FIS S+      S+++ ++ ISD
Sbjct  15    AHCLVLSYPAQGHINPLLQFSKRLEHKGIKVTLVTTYFISKSLHRDPSSSNSIALETISD  74

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ G  QA+S   Y++RF   G +T  +L+ER  +    VDC++YDSF+PWALDVAK 
Sbjct  75    GYDEGGSAQAESDQAYVDRFWQIGLQTFTELVERLND----VDCIVYDSFLPWALDVAKK  130

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYP  924
              GL    F TQ+CAV  +Y+  + G+++LP+T   V +PGLP L+ +D PSFI    SYP
Sbjct  131   FGLTGAAFLTQSCAVASIYHHVNKGLIKLPLTGDQVLLPGLPPLDPQDTPSFINAPASYP  190

Query  923   AYFELVL-HQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVI-PIGPTVPSLYLDNRVK  750
             A+F++++  Q  N++KAD +  N+FY+LE +V + + K   ++  IGPT+PS+YLD +++
Sbjct  191   AFFDMIVTRQVSNIDKADWILCNTFYELEKEVTEWLGKQHWLLRTIGPTLPSIYLDKQIE  250

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D EYG +++  +    + WLN +  GSV+Y++FGSMA++  +QMEELAWG K ++ YFL
Sbjct  251   DDKEYGFSIFEPNIESCMKWLNDRANGSVVYLSFGSMATLKIEQMEELAWGLKASDKYFL  310

Query  569   WVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR+SE  KLPENF  +   K L+VNW PQL VLA +A GCF TH GWNST+EAL LGV
Sbjct  311   WVVRESEQFKLPENFSDETSQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTMEALGLGV  370

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PM+AMPQW+DQ+ NAK I+DV K+G +V   E G+V R  I  C+ E+LE   GKE+K+N
Sbjct  371   PMLAMPQWSDQSTNAKYIMDVGKMGLKVPADEKGIVRREAIAHCINEILEGERGKEIKQN  430

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW + AKEAV++GG+SDK ID+F
Sbjct  431   ADKWRNFAKEAVAKGGSSDKNIDDF  455



>ref|XP_006372897.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|ERP50694.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=461

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 308/441 (70%), Gaps = 10/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H+  IPYP+QGHINPM+QF K+L SKGL+ TL I  F S ++   +    + +++    D
Sbjct  9     HVAVIPYPAQGHINPMIQFSKQLASKGLQVTLVI--FSSQTLSTPASLGSVKVVT--VSD  64

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLI-ERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             +    + S+ D L +FQ   +  L  L+ E   +S  PV C++YDSFMPW L++A+  GL
Sbjct  65    SSDTGSSSIGDLLKQFQATVAPKLPQLVVELGISSGHPVSCLVYDSFMPWVLEIARQLGL  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIY-VHGSYPAY  918
                 FFTQ+CAV+ VYY  H G L++P+   PV +PGLP L++ ++PSF++ +   Y + 
Sbjct  125   IGASFFTQSCAVSSVYYQIHEGQLKIPLEKFPVSVPGLPPLDVDELPSFVHDMESEYSSI  184

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               +V++QFLN   AD VFVNSF  LE +VV+ ++    + PIGP +PS+YLD ++++D+E
Sbjct  185   LTVVVNQFLNFRGADWVFVNSFNTLEEEVVNCLASQRSIKPIGPMIPSVYLDRQLEDDTE  244

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++L+       ++WL++K  GSV+Y +FGS+A++ ++QM E+AWG + ++ YFLWVVR
Sbjct  245   YGLSLFKPALDGCMEWLDSKETGSVVYASFGSLAALGEEQMAEIAWGLRRSDCYFLWVVR  304

Query  557   DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +SE  KLP NF+ G  +K LIV WSPQL+VL+ K+VGCF TH GWNST+EALSLGVPMVA
Sbjct  305   ESEEKKLPCNFVEGSSEKGLIVTWSPQLEVLSHKSVGCFMTHCGWNSTLEALSLGVPMVA  364

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMKW  210
             +PQWTDQ  NAK I DVW+VG RV+  E G+VS+ E+E C REV+EG+   EM+ N+ KW
Sbjct  365   VPQWTDQPTNAKYIADVWRVGVRVKANEKGIVSKEELEKCTREVMEGERGSEMRRNSEKW  424

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAK A+ EGG+SDK I EF
Sbjct  425   KKLAKTAMGEGGSSDKNITEF  445



>ref|XP_006370131.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|ERP66700.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=471

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/444 (49%), Positives = 313/444 (70%), Gaps = 10/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
             +H++ +P P QGHINPMLQF KRL SKGL+ TL   T +  SM +  + ++ ++ I DG 
Sbjct  11    SHVLVLPLPIQGHINPMLQFSKRLASKGLRVTLITPTSMGTSMHQDNACSINMEPIFDGY  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
              +    +A +  +Y+ RF+    ++LA+LI++   S  P   +IYDS +PW LDVAKS G
Sbjct  71    KEGE--RAATAEEYIERFKATIPQSLAELIDKNSTSQYPAKFIIYDSILPWVLDVAKSWG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHG-ILQLPVTSP-PVRIPGLPALELRDMPSFIYVHGSYP  924
             +  G FFTQ+CAV  +YY    G  L++P+    PV +P LP LE  D+PS ++  GSYP
Sbjct  129   IEGGPFFTQSCAVTVLYYHTLQGSALKIPMEEKSPVSLPSLPQLEFSDLPSLVHGPGSYP  188

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               ++L+  QF N+++A  +  N+F +LE ++VD M+   P+ PIGPT+PS++LD R+++D
Sbjct  189   GIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIKPIGPTIPSMFLDKRLEDD  248

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG++L+  +    + WL++K  GSV+YV+FGS+A + + QM ELAWG K +NT+FLWV
Sbjct  249   KDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLAVLTEDQMAELAWGLKRSNTHFLWV  308

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  K+P NF+ +  +  LI+ WSPQLKVLA K+VGCF TH GWNST+EALSLGVPM
Sbjct  309   VRESEKQKVPGNFVEETTEMGLIITWSPQLKVLAHKSVGCFMTHCGWNSTLEALSLGVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREV-LEGK---EMKENA  219
             VAMPQWTDQ  NAK + DVW+ G RV+VGE+G+V++ EIE C+REV +EG+   E++ ++
Sbjct  369   VAMPQWTDQPSNAKFVADVWQAGVRVKVGENGMVTQEEIERCIREVMMEGERRDEIRTHS  428

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  LA+ A+ EGG+SDK IDEF
Sbjct  429   EKWKKLARMAMDEGGSSDKNIDEF  452



>ref|XP_008235866.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=463

 Score =   449 bits (1155),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 232/450 (52%), Positives = 308/450 (68%), Gaps = 14/450 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-------KPVS-DAVGI  1299
             AH + + YP QGHINPMLQF KRL  KGLK TL  T  +  ++        P S  ++ +
Sbjct  7     AHCLVLFYPIQGHINPMLQFSKRLQHKGLKVTLVTTRSVHKALHGDGGGKSPSSFSSIAL  66

Query  1298  DIISDGCD-DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWA  1122
             + ISDG D + G  QA+S+  Y +RF+  GS+TLA+LI++   S  P DC++YD  +PWA
Sbjct  67    ETISDGFDGEGGSSQAESIQAYWDRFREIGSQTLAELIDKLSASGHPADCLVYDQILPWA  126

Query  1121  LDVAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVT-SPPVRIPGLPALELRDMPSFI  945
             LDVAK  G+    FFT +CAV  +Y   H G+L+LP+     + +PGLP L+  D PSFI
Sbjct  127   LDVAKRVGIAGAAFFTVSCAVTNIYSLVHKGLLKLPLNPDSEILLPGLPPLQPSDTPSFI  186

Query  944   YVHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYL  765
             Y   SYPA+F+L +  F N++KAD VF ++FY+LE + VD M+K  P+  IGPT+PS+YL
Sbjct  187   YAPESYPAFFKLCVEPFSNLDKADWVFYSTFYELEHETVDWMAKFWPLRTIGPTIPSMYL  246

Query  764   DNRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNT  585
             D R + D EYG+NL + +    + WLN KP+GSV YV+FGS+A + +++MEEL  G + +
Sbjct  247   DKRHEEDKEYGLNLLNPNSDACMKWLNAKPKGSVAYVSFGSVAKLGEEKMEELCLGLRRS  306

Query  584   NTYFLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEA  408
               YFLWVVR SE  KLP+ F  +  +K L V+W PQL+VLA +AVGCF TH GWNST+EA
Sbjct  307   KCYFLWVVRASESAKLPKGFAEETSEKGLAVSWCPQLEVLAHEAVGCFVTHCGWNSTLEA  366

Query  407   LSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GK  237
             LSLGVPMVA+PQW DQ  NAK I+DVWK+G + +  E G+V   EI  CVRE+LE   GK
Sbjct  367   LSLGVPMVAVPQWVDQGTNAKFIMDVWKIGLKAQADEKGIVRGEEIAHCVREILEGERGK  426

Query  236   EMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             E+++NA KW  LAK AV EGG+S+K IDEF
Sbjct  427   EIRKNASKWKALAKSAVDEGGSSNKNIDEF  456



>ref|XP_011002911.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Populus 
euphratica]
Length=458

 Score =   449 bits (1154),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 220/444 (50%), Positives = 313/444 (70%), Gaps = 10/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
             +H++ +P P QGHINPMLQFCKRL SKGLK TL   T +  SM +  + ++ ++ I DG 
Sbjct  11    SHVLVLPLPIQGHINPMLQFCKRLASKGLKVTLITPTSMGTSMHQDNACSINMEPIFDGY  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
              +    +A +  +Y+ RF+    ++LA+LI++   S  P   +IYDS +PW LDVAKS G
Sbjct  71    REGE--RAATAKEYVERFKDTIPQSLAELIDKNSTSQYPFKFIIYDSILPWVLDVAKSWG  128

Query  1097  LFAGCFFTQACAVNYVYY-CAHHGILQLPVTSPP-VRIPGLPALELRDMPSFIYVHGSYP  924
             +  G FFTQ+CAV  +YY     G L++P+     V +P LP LE  D+PS ++  GSYP
Sbjct  129   IEGGPFFTQSCAVTVLYYHTLQGGALKIPMEEKSSVSLPSLPQLEFSDLPSLVHGPGSYP  188

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               ++L+  QF N+++A  +  N+F +LE ++VD M+   P+ PIGPT+PS++LD R+++D
Sbjct  189   GIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIKPIGPTIPSMFLDKRLEDD  248

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG++L+  +    + WL++K  GSV+YV+FGS+A++ + QM ELAWG K +NT+FLWV
Sbjct  249   KDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLATLTEDQMAELAWGLKRSNTHFLWV  308

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLP NF+ +  +  L++ WSPQLKVLA K+VGCF TH GWNST+EALSLGVPM
Sbjct  309   VRESEKQKLPGNFVEETTEMGLVITWSPQLKVLAHKSVGCFMTHCGWNSTLEALSLGVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL-EG---KEMKENA  219
             VAMPQWTDQ  NAK + DVW+VG RV+VGE+G+V++ EIE C+REV+ EG    E++ ++
Sbjct  369   VAMPQWTDQPTNAKFVADVWQVGVRVKVGENGMVTQEEIERCIREVMTEGGRRDEIRTHS  428

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  LA  A+ EGG+SDK I+EF
Sbjct  429   EKWKKLAVMAMDEGGSSDKNIEEF  452



>ref|XP_002532443.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29929.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=406

 Score =   446 bits (1148),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 214/391 (55%), Positives = 281/391 (72%), Gaps = 4/391 (1%)
 Frame = -2

Query  1307  VGIDIISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMP  1128
             + I+ ISDG D+ G  QA+S+  YL+  ++ G+K+LA+LI++   SD PV  +IYD FMP
Sbjct  9     IDIETISDGFDEGGSAQAESIEVYLSTLRIVGAKSLANLIKKLNESDCPVTAIIYDGFMP  68

Query  1127  WALDVAKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSF  948
             WALDVAK +G+ A  F TQACAVN  YY      L +PV+SP V +PGLP L++ ++PS 
Sbjct  69    WALDVAKQYGILAVAFLTQACAVNNAYYHVQRSFLPVPVSSPTVSLPGLPMLQVSELPSL  128

Query  947   IYVHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLY  768
             I   GSYP +  L++ QF N++ AD V  N+FY+LE +VVD M+K   +  IGPTVPS Y
Sbjct  129   ISDCGSYPGFRYLLVDQFRNIDGADWVLCNTFYRLEEEVVDWMAKSWRLGTIGPTVPSRY  188

Query  767   LDNRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKN  588
             LD R+++D +YGINL+  D +  ++WL TKP  SV+YV+FGSM  +  +Q+EELA G K 
Sbjct  189   LDKRLEDDKDYGINLFKPDSSTCMNWLKTKPSSSVVYVSFGSMVELGTEQIEELALGLKG  248

Query  587   TNTYFLWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIE  411
             +N YFLWVVR SE  KLPENF+ +  +K L+V+W PQL++LA + +GCF TH G+NS +E
Sbjct  249   SNCYFLWVVRTSERSKLPENFIEETSEKGLVVSWCPQLEILAQEVIGCFVTHCGFNSILE  308

Query  410   ALSLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---G  240
             ALSLGVP+VAMPQWTDQ  NAK + DVWKVG R R  E G+V R  +E C+REV+E   G
Sbjct  309   ALSLGVPIVAMPQWTDQPTNAKYVEDVWKVGIRARRNEKGIVRRETVELCIREVMEGQKG  368

Query  239   KEMKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             KE+K+NA KW  LAKEA+ EGGTSDK IDE 
Sbjct  369   KEIKKNANKWKELAKEAIDEGGTSDKNIDEL  399



>ref|XP_003613351.1| N-hydroxythioamide S-beta-glucosyltransferase [Medicago truncatula]
 gb|AES96309.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   449 bits (1154),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 213/439 (49%), Positives = 305/439 (69%), Gaps = 6/439 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ IPYP+QGHI+P++QF KRLVSKG+KTT A T +   S+   +  + ++ ISDG D+
Sbjct  13    HVLVIPYPAQGHISPLIQFSKRLVSKGIKTTFATTHYTVKSI--TAPNISVEPISDGFDE  70

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
             +GF QA +V  +LN F+  GSKTL++LI++++ + +P+ C++YDSF+PWALDVAK H ++
Sbjct  71    SGFSQAKNVELFLNSFKTNGSKTLSNLIQKHQKTSTPITCIVYDSFLPWALDVAKQHRIY  130

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
                FFT + AV  ++   HHG+++ PV   P+ +PGLP L  RD+PSFI    SYPAY  
Sbjct  131   GAAFFTNSAAVCNIFCRIHHGLIETPVDELPLIVPGLPPLNSRDLPSFIRFPESYPAYMA  190

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             + L+QF N+ +AD +FVN+F  LEA+VV  +++M P   IGP VPS YLD R+K D  YG
Sbjct  191   MKLNQFSNLNQADWMFVNTFEALEAEVVKGLTEMFPAKLIGPMVPSAYLDGRIKGDKGYG  250

Query  731   INLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDS  552
              NL+       I+WLN KP  SV+Y++FGSM S+  +Q+EELA G K +   FLWV+R+S
Sbjct  251   ANLWKPLSEDCINWLNAKPSQSVVYISFGSMVSLTSEQIEELALGLKESEVNFLWVLRES  310

Query  551   ELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMP  375
             E  KLP+ +     +K +IV W  QL++LA  AVGCF TH GWNST+E+LSLGVP+V +P
Sbjct  311   EQGKLPKGYKDSIKEKGIIVTWCNQLELLAHDAVGCFVTHCGWNSTLESLSLGVPVVCLP  370

Query  374   QWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKWSH  204
             QW DQ  +AK + ++W+VG R +  E+GVV R E    ++ V+E +    ++ NA +W  
Sbjct  371   QWADQLPDAKFLEEIWEVGVRPKEDENGVVKREEFMLSLKVVMESERSEVIRRNASEWKK  430

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LA++AV EGG+SDK I++F
Sbjct  431   LARDAVCEGGSSDKNINQF  449



>ref|XP_011002910.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Populus 
euphratica]
Length=458

 Score =   448 bits (1153),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 220/444 (50%), Positives = 313/444 (70%), Gaps = 10/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
             +H++ +P P QGHINPMLQFCKRL SKGLK TL   T +  SM +  + ++ ++ I DG 
Sbjct  11    SHVLVLPLPIQGHINPMLQFCKRLASKGLKVTLITPTSMGTSMHQDNACSINMEPIFDGY  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
              +    +A +  +Y+ RF+    ++LA+LI++   S  P   +IYDS +PW LDVAKS G
Sbjct  71    REGE--RAATAEEYVARFKDTIPQSLAELIDKNSTSQYPFKFIIYDSILPWVLDVAKSWG  128

Query  1097  LFAGCFFTQACAVNYVYY-CAHHGILQLPVTSPP-VRIPGLPALELRDMPSFIYVHGSYP  924
             +  G FFTQ+CAV  +YY     G L++P+     V +P LP LE  D+PS ++  GSYP
Sbjct  129   IEGGPFFTQSCAVTVLYYHTLQGGALKIPMEEKSSVSLPSLPQLEFSDLPSLVHGPGSYP  188

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               ++L+  QF N+++A  +  N+F +LE ++VD M+   P+ PIGPT+PS++LD R+++D
Sbjct  189   GIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIKPIGPTIPSMFLDKRLEDD  248

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG++L+  +    + WL++K  GSV+YV+FGS+A++ + QM ELAWG K +NT+FLWV
Sbjct  249   KDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLATLTEDQMAELAWGLKRSNTHFLWV  308

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE  KLP NF+ +  +  L++ WSPQLKVLA K+VGCF TH GWNST+EALSLGVPM
Sbjct  309   VRESEKQKLPGNFVEETTEMGLVITWSPQLKVLAHKSVGCFMTHCGWNSTLEALSLGVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL-EG---KEMKENA  219
             VAMPQWTDQ  NAK + DVW+VG RV+VGE+G+V++ EIE C+REV+ EG    E++ ++
Sbjct  369   VAMPQWTDQPTNAKFVADVWQVGVRVKVGENGMVTQEEIERCIREVMTEGGRRDEIRTHS  428

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  LA  A+ EGG+SDK I+EF
Sbjct  429   EKWKKLAVMAMDEGGSSDKNIEEF  452



>ref|XP_002280305.1| PREDICTED: UDP-glycosyltransferase 74B1 [Vitis vinifera]
Length=457

 Score =   448 bits (1152),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 298/442 (67%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H++ + YP+QGHINP+LQF KRL SKGLK TLA T +  N ++  SDAVG++ ISDG D
Sbjct  6     GHVMVLTYPAQGHINPLLQFSKRLASKGLKATLATTHYTVNFIQ--SDAVGVEAISDGFD  63

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF+QA S+  YL  FQ  GS+T+ +LI ++  S SPVDC++YDS +PW L VA+  G+
Sbjct  64    EGGFMQAPSLEAYLESFQAVGSRTVGELILKFNESASPVDCLVYDSILPWGLSVARQFGI  123

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPV--RIPGLPALELRDMPSFIYVHGSYPA  921
             +   F+T + +V  +Y+    G+L LPV   PV   +PGLP L L D+P F+   G   A
Sbjct  124   YGAAFWTTSASVCSMYWQLRQGVLSLPVKQEPVPVSMPGLPPLRLSDLPDFLAQPGHLSA  183

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y   V+ Q   +E+ D VF+NSF  LE+++V  MS +  V  IGP VPS YLD +++ D+
Sbjct  184   YMSAVMEQISTLEQNDWVFMNSFDALESELVKAMSGLWSVAMIGPMVPSAYLDQQIEGDT  243

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     + + WL TKP  SV+Y++FGSMA +  KQ+EE+AWG K ++ +F+WVV
Sbjct  244   VYGASLWKPTNDECLGWLETKPPKSVVYISFGSMAEIPVKQVEEIAWGLKESDYHFIWVV  303

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             ++SE  KLP NFL   ++  L+V W  QL+VLA KAVGCF TH GWNS +E LSLGVPMV
Sbjct  304   KESESGKLPINFLNSMNETGLVVTWCNQLEVLAHKAVGCFVTHCGWNSILEGLSLGVPMV  363

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
              MPQ  DQ  NAK + DVW+ G R +  E+G+V+R E+E C++E++ G   +E+K NA  
Sbjct  364   GMPQRVDQPTNAKFVEDVWRAGVRAQKDEEGIVTRKELEKCIKEIMVGERSEEIKRNACM  423

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W   AK AVS+GG+SDK  DEF
Sbjct  424   WRQSAKSAVSKGGSSDKNTDEF  445



>ref|XP_010037080.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Eucalyptus grandis]
Length=461

 Score =   448 bits (1152),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 298/444 (67%), Gaps = 10/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGI--DIISDGC  1278
             H + + YPSQGHINPMLQF KRL+ KG+K TL  T  IS ++   S    I  ++ISDG 
Sbjct  11    HCLILSYPSQGHINPMLQFAKRLLHKGVKVTLVTTKSISKTLHGSSTCTSIPLEVISDGF  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  G   A S   YL RF   G +TL++L+ER      P  C++YDSF+PWALDVA+   
Sbjct  71    DSGGIGAAGSPEAYLERFWKVGPETLSELVERLIFRGPPPTCIVYDSFLPWALDVARKFK  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L    FFT +CAVN V+Y    G L++PV    V +PG+P LE +DMPS +   G+YP +
Sbjct  131   LVGAAFFTMSCAVNSVFYHCQKGWLEVPVKKQ-VLLPGMPPLEPQDMPSLVCDLGTYPGF  189

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               ++++QF N++K D +  N+ Y+L+ +V D   K+ P   IGPTVPS YLD+R++ D E
Sbjct  190   TGMLVNQFSNLDKVDWMLCNTVYELDPEVADWFMKILPFRTIGPTVPSTYLDSRLEQDKE  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +++  D   ++ WL+TKP+GSV+YV+FGSMA +   QM ELA G K +N YFLWVVR
Sbjct  250   YGFSIFEPDHDTTMRWLSTKPKGSVVYVSFGSMAELKTDQMHELAMGLKRSNCYFLWVVR  309

Query  557   DSELPKLPENFLG---DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
              SE  KLP+ F        K LIV W PQL+VLA  A+G F TH GWNST+EALSLGVPM
Sbjct  310   SSEAEKLPQGFANCTETSQKGLIVTWCPQLEVLAHGALGLFVTHCGWNSTLEALSLGVPM  369

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLE---GKEMKENA  219
             +A+PQWTDQ  NAK I+DVWK+G R  V E+ GVV+  EIE C+R+V+E    K+MKENA
Sbjct  370   LAIPQWTDQATNAKYIMDVWKMGLRPLVDEERGVVTSEEIEHCLRKVMEEETRKKMKENA  429

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  + K+AV EGG+SD+ I+EF
Sbjct  430   GKWRKITKDAVGEGGSSDRNIEEF  453



>ref|XP_008460408.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cucumis melo]
Length=460

 Score =   447 bits (1150),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 303/443 (68%), Gaps = 12/443 (3%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFI---SNSMKPVSDAVGIDIISDG  1281
             HI+ + YPSQGHINPMLQF KRL  +G K TL +T FI   S+S+ P      I  ISDG
Sbjct  13    HILTVTYPSQGHINPMLQFSKRLQKRGFKITLVLTNFIARVSHSLPPFP----ILTISDG  68

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              DD GF  ADS   YL+ F+  GS++L +L+ R  +S SPVDC+IYDSF+PWALDVAK  
Sbjct  69    HDDGGFASADSAQTYLDSFRRFGSESLRELLRRLSSSASPVDCLIYDSFLPWALDVAKEF  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
              +    FFTQ+CAV  +YY  H G++ LP+ +    IPGLP ++  + PSFIY  GSYPA
Sbjct  129   QIATAVFFTQSCAVANIYYHVHKGLIDLPLPNRESEIPGLPLMKPAEFPSFIYQLGSYPA  188

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVI-PIGPTVPSLYLDNRVKND  744
             Y++L+++Q+ NV+KAD +F N+F +LE +V++ + K  P I  IGP++PS YLD  ++ D
Sbjct  189   YYDLLVNQYANVDKADWIFCNTFDELEREVLEYLKKTWPSIRAIGPSIPSGYLDGGIEGD  248

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG+++  +D   S  WL+ + +GSV+YV+FGS+  V  +QMEE+A   K+ +  FLWV
Sbjct  249   REYGLSILDLDGDVSRKWLDGRRKGSVVYVSFGSIGKVAAEQMEEMAGCLKSIDRQFLWV  308

Query  563   VRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR SE+ KLP+NF+ +   K L+V+W  QL+VL  +A+GCF TH GWNST+E +SLGVPM
Sbjct  309   VRSSEVTKLPKNFMVETAKKGLVVSWCQQLEVLTHEAIGCFVTHCGWNSTLEGVSLGVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAM  216
             V +P WTDQT NAK I DVWKVG +     DGVV R  +  C+ EV+    G E+++NA 
Sbjct  369   VTVPGWTDQTTNAKFITDVWKVGLKALANSDGVVKREVLLQCIEEVMVGERGNEIRQNAT  428

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  +A++    GG+ +KV+D+F
Sbjct  429   KWKVMAQKTFEFGGSFNKVVDDF  451



>ref|XP_006447933.1| hypothetical protein CICLE_v10015155mg [Citrus clementina]
 gb|ESR61173.1| hypothetical protein CICLE_v10015155mg [Citrus clementina]
Length=464

 Score =   447 bits (1151),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 222/445 (50%), Positives = 307/445 (69%), Gaps = 14/445 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK--PVSDAVGIDIISDG  1281
             AH + + YP QGHINP+LQF +RL  KG+K TL  T F   S+     S ++ ++ ISDG
Sbjct  14    AHCLVLTYPGQGHINPLLQFSRRLQHKGIKVTLVTTRFFYKSLHRDSSSSSIPLEAISDG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G+ QA+S+  YL RF   G +TL +L+E+   SDSPVDC++YDS + WALDVAK  
Sbjct  74    YDEGGYAQAESIEAYLERFWQIGPQTLTELVEKMNGSDSPVDCIVYDSILLWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F +Q+CAV+Y+YY    G L+LP+T   + +PG+P+LE +DMPSFI+  GSYPA
Sbjct  134   GLLGAPFLSQSCAVDYIYYHVKKGSLELPLTGNEILLPGMPSLEPQDMPSFIHDLGSYPA  193

Query  920   Y-FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               + ++  QF N++KAD V  N+FY+LE +VV+ + K   +  IGPT+PS YLD ++++D
Sbjct  194   VSYMMMKFQFENIDKADWVLCNTFYELEEEVVEWLRKTWSLRTIGPTIPSFYLDKQIEDD  253

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG +++       + WLN + E SV+YV++GS   +  ++MEELAWG K+++ +FLWV
Sbjct  254   KDYGFSMFKSSTEACMKWLNDRAEESVVYVSYGSFVELKAEEMEELAWGLKSSDQHFLWV  313

Query  563   VRDSELPKLPENFLGD---DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VR+SE  KLP+ F  +     K L+V+W PQL+VLA +A GCF TH GWNST+EALSLGV
Sbjct  314   VRESEQAKLPKKFSDETLTSHKGLVVSWCPQLEVLAHEATGCFVTHCGWNSTMEALSLGV  373

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVAMPQW+DQ+ NAK I+DVWK G +       +V R  I  C+ E+LE   GKE++ N
Sbjct  374   PMVAMPQWSDQSTNAKYILDVWKTGLKFP-----IVKRDAIADCISEILEGERGKELRRN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LAKEAV++GG+SD  IDEF
Sbjct  429   AGKWRKLAKEAVAKGGSSDSNIDEF  453



>gb|KDO43523.1| hypothetical protein CISIN_1g012277mg [Citrus sinensis]
Length=464

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/445 (50%), Positives = 307/445 (69%), Gaps = 14/445 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK--PVSDAVGIDIISDG  1281
             AH + + YP QGHINP+LQF +RL  KG+K TL  T F   S+     S ++ ++ ISDG
Sbjct  14    AHCLVLTYPGQGHINPLLQFSRRLQHKGIKVTLVTTRFFYKSLHRDSSSSSIPLEAISDG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G+ QA+S+  YL RF   G +TL +L+E+   SDSPVDC++YDS + WALDVAK  
Sbjct  74    YDEGGYAQAESIEAYLERFWQIGPQTLTELVEKMNGSDSPVDCIVYDSILLWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F TQ+CAV+Y+YY    G L+LP+T   + +PG+P LE +DMPSFI+  GSYPA
Sbjct  134   GLLGAPFLTQSCAVDYIYYHVKKGSLELPLTGNEILLPGMPPLEPQDMPSFIHDLGSYPA  193

Query  920   Y-FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               + ++  QF N++KAD V  N+FY+LE +VV+ + K   +  IGPT+PS YLD ++++D
Sbjct  194   VSYMMMKFQFENIDKADWVLCNTFYELEEEVVEWLRKTWSLRTIGPTIPSFYLDKQIEDD  253

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG +++       + WLN + + SV+YV++GS   +  ++MEELAWG K+++ +FLWV
Sbjct  254   KDYGFSMFKSSTEACMKWLNDRAKESVVYVSYGSFVELKAEEMEELAWGLKSSDQHFLWV  313

Query  563   VRDSELPKLPENFLGD---DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VR+SE  KLP+ F  +     K+L+V+W PQL+VLA +A GCF TH GWNST+EALSLGV
Sbjct  314   VRESEQAKLPKKFSDETLTSHKSLVVSWCPQLEVLAHEATGCFVTHCGWNSTMEALSLGV  373

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVAMPQW+DQ+ NAK I+DVWK G +       +V R  I  C+ E+LE   GKE++ N
Sbjct  374   PMVAMPQWSDQSTNAKYILDVWKTGLKF-----PIVKRDAIADCISEILEGERGKELRRN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LAKEAV++GG+SD  IDEF
Sbjct  429   AGKWRKLAKEAVAKGGSSDSNIDEF  453



>ref|XP_010095579.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB61152.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=456

 Score =   445 bits (1145),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 222/444 (50%), Positives = 299/444 (67%), Gaps = 10/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS----DAVGIDIIS  1287
             +H + + +P QGHINP+LQFCKRL  KGL  TL     I  ++   +    DA+ +D IS
Sbjct  9     SHCLVLSFPLQGHINPLLQFCKRLHHKGLHVTLVTAKSILRTLNVTAASAVDAISLDAIS  68

Query  1286  DGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAK  1107
             DG DD    + +S   Y +RF   G  +LA LI +   +  PVDC++YDSF+PWALDVAK
Sbjct  69    DGYDDGE--KEESFDAYFDRFWRVGPVSLAQLIRKLSETGRPVDCIVYDSFIPWALDVAK  126

Query  1106  SHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
               GL    FFTQ+CAV  +Y     G+L++PV+   V IPG P     D+PSF+Y   SY
Sbjct  127   EFGLIGAAFFTQSCAVVSIYNHVQGGLLRVPVSESEVSIPGCPPFRPSDLPSFVYDTVSY  186

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             P   ++ + QF NVEKAD V  N+ Y+LE +V + M K+ P+  IGPT+PS++LD R++ 
Sbjct  187   PVITKVAVDQFSNVEKADWVLCNTCYELEEEVANWMMKILPLKTIGPTIPSMFLDKRLEG  246

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D  YG +L+       + WL+++P+GSV Y++FGS+A V+ +Q++ELA G K +N +FLW
Sbjct  247   DKLYGFSLFPSQSEACLKWLDSRPKGSVAYLSFGSLAVVEAEQIDELANGLKRSNCHFLW  306

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR SE  KLP+ F+ D   K L+V+W PQL+VL++ AVGCF TH GWNST+EALSLGVP
Sbjct  307   VVRASEADKLPKGFVDDTSGKGLVVSWCPQLEVLSNDAVGCFVTHCGWNSTLEALSLGVP  366

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
             MV +PQW+DQ  NAK +VDVWKVG R    E G+V    +E  V+E++E   G+EMK NA
Sbjct  367   MVVIPQWSDQFTNAKYVVDVWKVGLRAPTDEKGIVRGEAVEHYVKEIIEGERGREMKMNA  426

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
             +KWS LAK AV+EGG+SDK IDEF
Sbjct  427   IKWSALAKMAVNEGGSSDKNIDEF  450



>emb|CAN67249.1| hypothetical protein VITISV_008684 [Vitis vinifera]
Length=419

 Score =   444 bits (1142),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 290/440 (66%), Gaps = 41/440 (9%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H++ IPYP QGHINPMLQF KRL SKG                                
Sbjct  10    THVLVIPYPVQGHINPMLQFSKRLASKG--------------------------------  37

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
                  + +S+ DYL RF++  S +L +LI RY  S+ PV  ++YDS M WA D+ +   +
Sbjct  38    -----EEESLDDYLERFKLIVSSSLVELIGRYNGSEYPVRVLVYDSVMSWAQDIVERLSV  92

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+CAV+ +YY  + G  ++P+  P V IP +P L + D+PSFI    SYP  +
Sbjct  93    DGAPFFTQSCAVSTIYYHVNQGAFKIPLEGPTVSIPSMPILGVNDLPSFINDTSSYPTLW  152

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              LV  QF N EK + VF N+F +LE +VV  ++   P+  IGPT+PS+YLD R+ +D +Y
Sbjct  153   SLVKTQFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTIPSMYLDRRIDDDEDY  212

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G++L+  +    I WL+TK   SV+YV+FGS+AS+ ++QMEELAWG K +N+ FLWVVR+
Sbjct  213   GLSLFKPNADACITWLDTKDTVSVVYVSFGSLASLGEEQMEELAWGLKRSNSQFLWVVRE  272

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
              E  KLP NF+ +  +K L+V+W PQL+VLA KAVGCF TH GWNST+EALSLGVPMVAM
Sbjct  273   LEKKKLPSNFVEETSEKGLVVSWCPQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPMVAM  332

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKWS  207
             PQWTDQT NAK I DVW VG RV+VGE+G+V R EI+ C+REV+EG+    M+ NA +W 
Sbjct  333   PQWTDQTTNAKFIEDVWGVGVRVKVGENGIVKREEIKECIREVMEGERGNVMQRNAQRWK  392

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LAKEAV+EGG+SD  I+EF
Sbjct  393   ELAKEAVNEGGSSDNNIEEF  412



>ref|XP_010069571.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
Length=466

 Score =   446 bits (1146),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 298/444 (67%), Gaps = 9/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGCD  1275
             H++ +P P+QGH+NPMLQF KRLVS+GLK TLA+T   + SM    S  V I+ ISDG D
Sbjct  12    HVLVLPTPAQGHLNPMLQFSKRLVSRGLKATLALTVHFAASMHADPSLPVDIETISDGHD  71

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               GF +A+S+  Y    +V GS+TLA LI +   S  P+D VIYD F+PWALDVAK    
Sbjct  72    IGGFTEAESIEAYQVDLRVVGSRTLAKLIRKLDRSGRPIDAVIYDGFLPWALDVAKQCCK  131

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ CAVN +YY    G+L LP++ P V +PGLP LE  + PSF+Y  GSYPA+ 
Sbjct  132   LGVVFFTQTCAVNNIYYHLQRGLLPLPLSGPSVEVPGLPPLEPSETPSFVYKLGSYPAFC  191

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMS-KMSPVIPIGPTVPSLYLDNRVKNDSE  738
             +++++QF N + AD V  ++FY+LE +VVD MS  + P+  IGPT+PSLYLD R+ +D+ 
Sbjct  192   DMLVNQFTNADGADFVLFDTFYELEKEVVDWMSTNLWPLKTIGPTLPSLYLDKRLPDDTA  251

Query  737   YGINLYHMDPTKSID-WLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             YGINL+    T ++  WL + P  SV+YV+FGSMA +D  Q+ ELA G       FLW+V
Sbjct  252   YGINLFTPTTTSTVSAWLCSHPPRSVVYVSFGSMADLDPSQVVELAHGLALAGHPFLWIV  311

Query  560   RDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             R SE  KLP + +     ++ALI+ W  QL+VLAS A+GCF TH G NS IEA+ LGVPM
Sbjct  312   RSSEQHKLPRDLMDSIPSEQALILPWCNQLEVLASDAIGCFVTHCGLNSVIEAICLGVPM  371

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL----EGKEMKENA  219
             VAMPQWTDQ  NAK + DVW+VG R +  E G V+R E+E  V EVL     G+EM E+A
Sbjct  372   VAMPQWTDQPTNAKFVEDVWRVGVRAKADEPGFVAREEVERRVTEVLGGGERGREMAESA  431

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW   AK A+ EGG+SD+ I+EF
Sbjct  432   RKWMAAAKAAIGEGGSSDRNINEF  455



>ref|XP_007224980.1| hypothetical protein PRUPE_ppa020679mg [Prunus persica]
 gb|EMJ26179.1| hypothetical protein PRUPE_ppa020679mg [Prunus persica]
Length=470

 Score =   445 bits (1145),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 218/442 (49%), Positives = 297/442 (67%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H+V +PYPSQGHINP+LQF KRL SKG+K TLA T++  NS+      VGI+ ISDG D
Sbjct  10    GHVVVLPYPSQGHINPLLQFAKRLASKGVKATLATTSYTVNSI--CVPNVGIEPISDGFD  67

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
              AGF QA     +L  F+  GS+TL+ ++++Y+NSD PV+CV+YDSF+PWALDVAK   +
Sbjct  68    QAGFAQATDEDTFLQSFKTNGSRTLSQVLDKYQNSDFPVNCVVYDSFLPWALDVAKKRRI  127

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLP--VTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             +   FFT +  V  ++   HHG+L LP  +   P+ +PGLP L   D+P+F+    SYPA
Sbjct  128   YGASFFTNSATVCSIFCRIHHGLLSLPCKLEDMPLFVPGLPPLNFPDLPTFLKKPDSYPA  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y ++ L+QF ++++AD VFVN+F  LE Q  + +SK+     IGP VPS YLD ++  D 
Sbjct  188   YLKMKLNQFPDLDRADWVFVNTFEALEGQAANGLSKLFSGKLIGPMVPSAYLDGQITGDR  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     +   WL  KP  SV+YV+FGSM S+ +KQMEELA G K +  +FLWVV
Sbjct  248   GYGASLWKPLGEECTKWLEAKPPKSVVYVSFGSMVSLTEKQMEELAMGLKESGVHFLWVV  307

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP+       +K L V W  QL+ LA +A+GCF TH GWNS +E LSLGVPMV
Sbjct  308   RESERSKLPKEISDSAKEKGLFVTWCNQLEALAHEAIGCFVTHCGWNSILEGLSLGVPMV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
             A+PQWTDQ  NAK + ++W+VG R +  E GVV + E  GC+++V+EG   +E+++N+  
Sbjct  368   AVPQWTDQLTNAKFVEEIWEVGVRAKEDEQGVVRKEEFVGCLKKVMEGERSQEIRKNSSM  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAK+  SEGG+SDK I  F
Sbjct  428   WRELAKKEFSEGGSSDKNITGF  449



>ref|XP_008237299.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=471

 Score =   445 bits (1145),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 216/446 (48%), Positives = 301/446 (67%), Gaps = 10/446 (2%)
 Frame = -2

Query  1454  AHIVAIPYP-SQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM---KPVSDAVGIDIIS  1287
             AH + +P+P  QGH+NPMLQF K L  KG+K TL  T F+ N++      S  + ++ IS
Sbjct  10    AHCLVLPFPILQGHVNPMLQFSKLLHHKGIKVTLVTTIFVHNTLMHGSSGSSGIALETIS  69

Query  1286  DGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAK  1107
             DG D     +A+ +  YL RF   G +TL  LIE+  +S  PVDC++YDS +PW+LDVAK
Sbjct  70    DGYDQGWREEAEGIDAYLERFWQVGPQTLGQLIEKLSSSGFPVDCIVYDSMVPWSLDVAK  129

Query  1106  SHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVH--G  933
              +G+    F TQ+CAV+ + Y  H G+L+LPV      I       L  +    +VH  G
Sbjct  130   KYGIAGASFLTQSCAVDNILYHVHKGLLKLPVIDDQSEISLPGLPPLELLDLPSFVHDFG  189

Query  932   SYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRV  753
             SYP  +++V+ QF N+ KAD V  NSFY+LE QVVD M+   P+  IGPT+PS YLD R+
Sbjct  190   SYPGIYKVVVGQFSNIHKADWVLCNSFYELEEQVVDWMATFLPLKTIGPTIPSHYLDKRL  249

Query  752   KNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYF  573
             ++D +YG++L+  +    + WLN +P+GSV YVAFGS A +  +QMEELAWG + + + F
Sbjct  250   EDDKQYGVSLFDTNNDACMKWLNEQPKGSVAYVAFGSAAQLGVEQMEELAWGLRRSKSKF  309

Query  572   LWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             LWVVR++E  KLP+ F+ +  +K L+V+W PQL+VLA++AVGCF +H GWNST+EA SLG
Sbjct  310   LWVVREAEAAKLPKGFVEETSEKGLVVSWCPQLEVLANEAVGCFISHCGWNSTLEAFSLG  369

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKE  225
             VP+VA+PQWTDQ+ NAK I+DVWK+G +    E GVV + E+E C+ E++E   GKEM+ 
Sbjct  370   VPVVALPQWTDQSTNAKFIMDVWKIGVKALADEKGVVRQEEVEHCISEIMEGERGKEMQR  429

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
              A++W  LA++AV EGG+S   IDEF
Sbjct  430   KALEWKELARKAVDEGGSSSNNIDEF  455



>gb|KDP35128.1| hypothetical protein JCGZ_10662 [Jatropha curcas]
Length=448

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 299/439 (68%), Gaps = 14/439 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
              H++A+P P QGHINPMLQF KRL SKGLK TL   +FI   + +    +V I+ IS   
Sbjct  12    THVLALPLPFQGHINPMLQFSKRLASKGLKVTLL--SFIDKQITRTKHGSVNIEFISS--  67

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
                     +   DY    +   S  L +++ R   S  PV C++YDS MPWALD+A+  G
Sbjct  68    ------DGNKEDDYFQNLKSIVSIKLPEIVARNGESGYPVSCLLYDSVMPWALDIARELG  121

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             LF  C FTQ+CAV+ +YY AH G L  PV   PV I G+P L+L D+PSF +   +YP  
Sbjct  122   LFGACLFTQSCAVSTIYYKAHEGALSTPVEKVPVSIEGMPLLDLYDLPSFFFDLENYPTV  181

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTM-SKMSPVIPIGPTVPSLYLDNRVKNDS  741
               L+ +QFLN   AD VF N+F +LE +V++ M ++  P+ PIGP++PS++LD R++++ 
Sbjct  182   LTLLGNQFLNTGDADWVFFNTFCELEDEVINGMIARKFPIKPIGPSIPSMFLDKRIQDNK  241

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG+NL+  +    + WL++    SVIYV+FGS+  + +KQMEE+A+G K +N YFLWVV
Sbjct  242   DYGLNLHKPNIENYMKWLDSNETCSVIYVSFGSLCIMGEKQMEEIAFGLKRSNHYFLWVV  301

Query  560   RDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP NF+ +  +K +IV W  QL+VLA K+ GCF TH GWNST+EALSLGVPMV
Sbjct  302   RESEEEKLPSNFVEETMEKGMIVTWCNQLEVLAHKSTGCFMTHCGWNSTMEALSLGVPMV  361

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKEMKENAMKWSH  204
             AMPQW DQT NAK + DVW+ G RV+V E+G+V++ EIE C++EV+EG E+++N  KW  
Sbjct  362   AMPQWCDQTTNAKFVADVWRTGVRVKVDEEGIVTKEEIEMCLKEVMEG-EIRKNCEKWKK  420

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LAKEA+ E G+SDK ++EF
Sbjct  421   LAKEAMDEDGSSDKNVEEF  439



>gb|KHG30812.1| hypothetical protein F383_15387 [Gossypium arboreum]
Length=487

 Score =   444 bits (1142),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 223/442 (50%), Positives = 306/442 (69%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H++ +PYPSQGHINP+LQF KRL SKG+K TLA T +  NS+      + ++ ISDG D
Sbjct  34    GHVLVLPYPSQGHINPLLQFAKRLASKGVKATLATTHYTLNSISAAH--IAVEPISDGFD  91

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF QA +V  YL  F+  GS+TLA+LI+++ NS +PV+CV+YDSF+PWALDVAK HG+
Sbjct  92    EGGFSQAGNVDFYLKSFRDHGSRTLAELIQKFSNSVTPVNCVVYDSFLPWALDVAKQHGI  151

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             +   FFT +  V  ++   HHG+L LP+T  + P+ +PGLP L   D+PSF+    SYPA
Sbjct  152   YGAAFFTNSATVCSIFAHIHHGLLTLPLTPETTPLLLPGLPPLNFPDLPSFLGFPDSYPA  211

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + L Q+  + +AD VF N+F +LE +    +S++ P   IGP VPS YLD R+K D 
Sbjct  212   YLAMKLSQYSTLNQADWVFSNTFEELEGKEARGVSEIWPAKLIGPMVPSAYLDERIKGDR  271

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     + I+WL TKP  SVIYV+FGSM S+ ++Q+ ELAWG K +N YFLWVV
Sbjct  272   GYGSSLWKPLSEECIEWLETKPSNSVIYVSFGSMISLSEEQIAELAWGLKESNMYFLWVV  331

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             RDSE  KLP+ FL    +K  +V W  QL++LA + VGCF TH GWNST+E LSLGVPM+
Sbjct  332   RDSEQQKLPKWFLDSVQEKGKVVTWCNQLEMLAHRTVGCFVTHCGWNSTLEGLSLGVPMI  391

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
              +P+WTDQ  +AK + ++W++G R +  E GVV + E+  C++EV+EG   KE+K NA K
Sbjct  392   GVPKWTDQLTDAKFVEEIWEIGVRAKEDEVGVVRKDELLRCLKEVMEGEKSKEIKRNANK  451

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W   A +A++EGG+SDK I+EF
Sbjct  452   WRDSAMKAINEGGSSDKCINEF  473



>emb|CDP08071.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   443 bits (1140),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 216/443 (49%), Positives = 300/443 (68%), Gaps = 8/443 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDII--SDGC  1278
             H++AIPYP QGH+NPMLQ CKRL SKGL+ TL  +T    S++   +++ I+ I   D  
Sbjct  9     HVLAIPYPLQGHLNPMLQLCKRLTSKGLRITLVTSTSARISVQNQFESIQIEYILDDDNI  68

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH-  1101
             +  G   ++    +  R Q+A S  LA L+E   +S  PV+ V+YDS MPW L++ +   
Sbjct  69    EAEGSNDSEKGAAHFKRIQIAVSDNLAKLVEEKASSGHPVNIVLYDSMMPWILEIVQGQL  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    FFTQACAV+ +Y   H G L++P+ +  + +P +P LE  D+PSF+Y  G YP 
Sbjct  129   GLKGAAFFTQACAVSAIYNHIHRGTLKVPLETSTILLPSMPQLESNDLPSFVYNPGPYPG  188

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
               +LVL Q +N+EK+D +  NSF KLE + V  +++  P+  IGP+ PS+Y D R+K+D 
Sbjct  189   VLDLVLGQNINLEKSDWLLFNSFDKLENEAVTWLTERYPIKTIGPSTPSMYTDKRLKDDK  248

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +Y IN +  D    + WL+TK  GSV+YV+FGSM+ + + QM+E+A G  N+N  FLWVV
Sbjct  249   DYTINFFTPDSGACLKWLDTKETGSVVYVSFGSMSDLGENQMQEIACGLMNSNCNFLWVV  308

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R SE  K+P +F+ + +++ LIVNW PQ KVL+ +AVGCF TH GWNSTIEALSLGVPMV
Sbjct  309   RPSEESKIPRDFMSEAEERGLIVNWCPQPKVLSHRAVGCFMTHCGWNSTIEALSLGVPMV  368

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDG-VVSRGEIEGCVREVLEGK---EMKENAM  216
              MP W DQT N+K IVDVWKVG RV+  E+  +V+R E+E  +REV+ G+   E++ NA+
Sbjct  369   TMPVWADQTTNSKYIVDVWKVGLRVKASEEREMVTREEVERTIREVMHGEKASELRSNAL  428

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             +W  LAKEA SEGG+SDK I+EF
Sbjct  429   RWKELAKEANSEGGSSDKNIEEF  451



>emb|CBI24722.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   441 bits (1135),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 220/425 (52%), Positives = 296/425 (70%), Gaps = 8/425 (2%)
 Frame = -2

Query  1406  MLQFCKRLVSKGLKTTLAITTF-ISNSMKPVSDAVGIDIISDGCDDAGFLQADSVPDYLN  1230
             M QF KRL SKGLK TL ITT  IS SM     ++ I+II +G D     +A+S+ D L 
Sbjct  1     MFQFSKRLASKGLKVTLLITTSSISKSMHAQDSSINIEIICEGFDQR---KAESIEDSLE  57

Query  1229  RFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFAGCFFTQACAVNYV  1050
             R+++A S++L +LIE++  S+ P   ++YDS +PWA DVA+  GL    FFTQ+CAV+ +
Sbjct  58    RYRIAASQSLVELIEQHSRSNHPAKILVYDSILPWAQDVAERQGLHGASFFTQSCAVSAI  117

Query  1049  YYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFELVLHQFLNVEKADC  870
             YY  +      P+    V +P +P   + D+PSFI   GS  A   L+L+QF N +K   
Sbjct  118   YYHFNQRAFSSPLEGSVVALPSMPLFHVNDLPSFISDKGSDAALLNLLLNQFSNFQKVKW  177

Query  869   VFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYGINLYHMDPTKSIDW  690
             +  N+F KLE +V++ M    PV  IGPTVPS+YLD R+++D +YG++L+  +    I W
Sbjct  178   ILFNTFTKLEDEVMNWMDSQRPVKTIGPTVPSMYLDKRLEHDRDYGLSLFKQNIDTCITW  237

Query  689   LNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDSELPKLPENFLGDDD  510
             L+TK  GSV+YV+FGS+AS+ ++QMEELAWG K +N++FLWVVR+ E  K P NF+ +  
Sbjct  238   LDTKEIGSVVYVSFGSVASLGEEQMEELAWGLKRSNSHFLWVVRELEEKKFPYNFVEETS  297

Query  509   -KALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMPQWTDQTMNAKLIVD  333
              K L+V+W PQLKVLA KAVGCF TH GWNST+EALSLGVPMVAMPQ++DQT NAK I D
Sbjct  298   GKGLVVSWCPQLKVLAHKAVGCFLTHCGWNSTLEALSLGVPMVAMPQFSDQTTNAKFIED  357

Query  332   VWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMKWSHLAKEAVSEGGTSDK  162
             VW+VG RV+  E G+V R EIE C++E++EG+   EMK NA +W  LAKEAV+EGG+SDK
Sbjct  358   VWRVGVRVKADEKGIVKRQEIEMCIKEIMEGERGNEMKRNAERWKELAKEAVNEGGSSDK  417

Query  161   VIDEF  147
              I+EF
Sbjct  418   NIEEF  422



>ref|XP_002520220.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF42275.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=471

 Score =   443 bits (1139),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 303/443 (68%), Gaps = 9/443 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H+V +PYP QGHINP+LQF KRL SKG+K T A T +  NS+   +  V +  ISDG D
Sbjct  9     GHVVVLPYPGQGHINPLLQFAKRLASKGVKITFATTHYTVNSI--CAPNVTVHAISDGFD  66

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF QA  V  YL  F+  GS+TL+ LI+++++S+ PV+C++YDSF+PWALDVA+ HG+
Sbjct  67    EGGFAQAQEVDLYLKSFKANGSRTLSHLIQKFQDSNFPVNCIVYDSFLPWALDVARQHGI  126

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALEL---RDMPSFIYVHGSYP  924
             F   FFT + AV+ ++   HHG L LP+     +   LP L      D+P+F+ +  SYP
Sbjct  127   FGAPFFTNSAAVSSIFCRLHHGFLSLPLDVEGDKPLLLPGLPPLYYSDLPTFLKIPESYP  186

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
             AY  + L+QF N++ AD +F N+F +LE++VV  +SK+ P   IGP VPS YLD R+  D
Sbjct  187   AYLAMKLNQFSNLDMADWIFANTFEELESKVVGGVSKLWPAKLIGPMVPSSYLDGRIDGD  246

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
               YG +L+     + + WL TK   SV+Y++FGSM S+  KQMEE+AWG K +N  FLWV
Sbjct  247   KGYGASLWKPLGEECLKWLETKQPQSVVYISFGSMVSLTVKQMEEIAWGLKESNLNFLWV  306

Query  563   VRDSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR+SE+ KLP+ F+    DK LIV W  QL++LA +A+GCF +H GWNST+EALSLGV M
Sbjct  307   VRESEMDKLPKGFIDSTSDKGLIVRWCNQLEMLAHQAIGCFVSHCGWNSTLEALSLGVSM  366

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAM  216
             VA+PQW DQ  NAK I ++WKVG R +V E GVV + E+  C++EV+EGK   E+K++A 
Sbjct  367   VAIPQWADQLPNAKFIEEIWKVGVRGKVDERGVVRKQEVIRCLKEVMEGKKSEEIKKHAR  426

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  +A+    EGG+SDK I++F
Sbjct  427   KWRQVAERTFDEGGSSDKNINDF  449



>ref|XP_006469355.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Citrus sinensis]
Length=464

 Score =   443 bits (1139),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 306/445 (69%), Gaps = 14/445 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK--PVSDAVGIDIISDG  1281
             AH + + YP QGHINP+LQF +RL  KG+K TL  T F   S+     S ++ ++ IS G
Sbjct  14    AHCLVLTYPGQGHINPLLQFSRRLQHKGIKVTLVTTRFFYKSLHRDSSSSSIPLEAISYG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G+ QA+S+  YL RF   G +TL +L+E+   SDSPVDC++YDS + WALDVAK  
Sbjct  74    YDEGGYAQAESIEAYLERFWQIGPQTLTELVEKMNGSDSPVDCIVYDSILLWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F TQ+CAV+Y+YY    G L+LP+T   + +PG+P LE +DMPSFI+  GSYPA
Sbjct  134   GLLGAPFLTQSCAVDYIYYHVKKGSLELPLTGNEILLPGMPPLEPQDMPSFIHDLGSYPA  193

Query  920   Y-FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
               + ++  QF N++KAD V  N+FY+LE +VV+ + K   +  IGPT+PS YLD ++++D
Sbjct  194   VSYMMMKFQFENIDKADWVLCNTFYELEEEVVEWLRKTWSLRTIGPTIPSFYLDKQIEDD  253

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              +YG +++       + WLN + + SV+YV++GS   +  ++MEELAWG K+++ +FLWV
Sbjct  254   KDYGFSMFKSSTEACMKWLNDRAKESVVYVSYGSFVELKAEEMEELAWGLKSSDQHFLWV  313

Query  563   VRDSELPKLPENFLGD---DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             VR+SE  KLP+ F  +     K+L+V+W PQL+VLA +A GCF TH GWNST+EALSLGV
Sbjct  314   VRESEQAKLPKKFSDETLTSHKSLVVSWCPQLEVLAHEATGCFVTHCGWNSTMEALSLGV  373

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMVAMPQW+DQ+ NAK I+DVWK G +       +V R  I  C+ E+LE   GKE++ N
Sbjct  374   PMVAMPQWSDQSTNAKYILDVWKTGLKF-----PIVKRDAIADCISEILEGERGKELRRN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A KW  LAKEAV++GG+SD  IDEF
Sbjct  429   AGKWRKLAKEAVAKGGSSDSNIDEF  453



>emb|CBI24715.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   440 bits (1131),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 207/325 (64%), Positives = 251/325 (77%), Gaps = 5/325 (2%)
 Frame = -2

Query  1106  SHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSY  927
             S GL    FFTQ CAV Y++Y  HHG+L LPV+SPPV IPGLP L+L DMPSFI    SY
Sbjct  56    SFGLVGAAFFTQTCAVTYIFYYVHHGLLTLPVSSPPVSIPGLPLLDLEDMPSFISAPDSY  115

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             PAY ++VL QF NV+KADC+ VNSFYKLE  VVD MSK+  ++ IGPT+PS + D RV +
Sbjct  116   PAYLKMVLDQFCNVDKADCILVNSFYKLEDSVVDAMSKVCTLLTIGPTIPSFFSDKRVND  175

Query  746   DSEYGINLYHMDPTKS-IDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             D  YG+N +    +++ I+WL++KP+GSV+YV+FGSMAS+ ++QM ELAWG K ++ YFL
Sbjct  176   DMAYGLNFFKAHQSETCIEWLSSKPKGSVVYVSFGSMASLSEEQMGELAWGLKGSSHYFL  235

Query  569   WVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR SE  KLP+ F+ ++ +K  +V W PQL+VLAS A+GCFFTH GWNST EAL+LGV
Sbjct  236   WVVRASEEAKLPKGFINEELEKGFLVRWCPQLEVLASNAIGCFFTHCGWNSTSEALTLGV  295

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PMV MPQWTDQT NAK I DVWKVG RVR GEDGVV R EIE C+REV+E   GKEMKEN
Sbjct  296   PMVGMPQWTDQTTNAKFIKDVWKVGVRVREGEDGVVRREEIEACIREVMEGERGKEMKEN  355

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             AMKWS   +EAV EGGTSD+ IDEF
Sbjct  356   AMKWSGFTREAVGEGGTSDRNIDEF  380


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 47/85 (55%), Gaps = 7/85 (8%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + + YP+QGHINPMLQF KRLVSKGLK TLA T  I+ SM+       +D  S G  
Sbjct  8     AHALLLSYPTQGHINPMLQFSKRLVSKGLKATLATTLSITKSMQ-------LDCSSFGLV  60

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTL  1200
              A F        Y+  +   G  TL
Sbjct  61    GAAFFTQTCAVTYIFYYVHHGLLTL  85



>gb|AFK36738.1| unknown [Medicago truncatula]
Length=466

 Score =   442 bits (1137),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 212/439 (48%), Positives = 304/439 (69%), Gaps = 6/439 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ IPYP+QGHI+P++QF KRLV KG+KTT A T +   S+   +  + ++ ISDG D+
Sbjct  13    HVLVIPYPAQGHISPLIQFSKRLVPKGIKTTFATTHYTVKSI--TAPNISVEPISDGFDE  70

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
             +GF Q  +V  +LN F+  GSKTL++LI++++ + +P+ C++YDSF+PWALDVAK H ++
Sbjct  71    SGFSQTKNVELFLNSFKTNGSKTLSNLIQKHQKTSTPITCIVYDSFLPWALDVAKQHRIY  130

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
                FFT + AV  ++   HHG+++ PV   P+ +PGLP L  RD+PSFI    SYPAY  
Sbjct  131   GAAFFTNSAAVCNIFCRIHHGLIETPVDELPLIVPGLPPLNSRDLPSFIRFPESYPAYMA  190

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             + L+QF N+ +AD +FVN+F  LEA+VV  ++++ P   IGP VPS YLD R+K D  YG
Sbjct  191   MKLNQFSNLNQADWMFVNTFEALEAEVVKGLTEVFPAKLIGPMVPSAYLDGRIKGDKGYG  250

Query  731   INLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDS  552
              NL+       I+WLN KP  SV+Y++FGSM S+  +Q+EELA G K +   FLWV+R+S
Sbjct  251   ANLWKPLSEDCINWLNAKPSQSVVYISFGSMVSLTSEQIEELALGLKESGVNFLWVLRES  310

Query  551   ELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMP  375
             E  KLP+ +     +K +IV W  QL++LA  AVGCF TH GWNST+E+LSLGVP+V +P
Sbjct  311   EQGKLPKGYKDSIKEKGIIVTWCNQLELLAHDAVGCFVTHCGWNSTLESLSLGVPVVCLP  370

Query  374   QWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL--EGKE-MKENAMKWSH  204
             QW DQ  +AK + ++W+VG R +  E+GVV R E    ++ V+  EG E ++ NA +W  
Sbjct  371   QWADQLPDAKFLEEIWEVGVRPKEDENGVVKREEFMLSLKVVMESEGSEVIRRNASEWKK  430

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LA++AV EGG+SDK I++F
Sbjct  431   LARDAVCEGGSSDKNINQF  449



>gb|KDO43524.1| hypothetical protein CISIN_1g012277mg [Citrus sinensis]
Length=467

 Score =   442 bits (1136),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/448 (49%), Positives = 305/448 (68%), Gaps = 17/448 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK--PVSDAVGIDIISDG  1281
             AH + + YP QGHINP+LQF +RL  KG+K TL  T F   S+     S ++ ++ ISDG
Sbjct  14    AHCLVLTYPGQGHINPLLQFSRRLQHKGIKVTLVTTRFFYKSLHRDSSSSSIPLEAISDG  73

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D+ G+ QA+S+  YL RF   G +TL +L+E+   SDSPVDC++YDS + WALDVAK  
Sbjct  74    YDEGGYAQAESIEAYLERFWQIGPQTLTELVEKMNGSDSPVDCIVYDSILLWALDVAKKF  133

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             GL    F TQ+CAV+Y+YY    G L+LP+T   + +PG+P LE +DMPSFI+  GSYPA
Sbjct  134   GLLGAPFLTQSCAVDYIYYHVKKGSLELPLTGNEILLPGMPPLEPQDMPSFIHDLGSYPA  193

Query  920   Y-FELVLHQFLNVEKADCVFVNSFYKLEAQVVDT---MSKMSPVIPIGPTVPSLYLDNRV  753
               + ++  QF N++KAD V  N+FY+LE +V      + K   +  IGPT+PS YLD ++
Sbjct  194   VSYMMMKFQFENIDKADWVLCNTFYELEEEVAVVVEWLRKTWSLRTIGPTIPSFYLDKQI  253

Query  752   KNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYF  573
             ++D +YG +++       + WLN + + SV+YV++GS   +  ++MEELAWG K+++ +F
Sbjct  254   EDDKDYGFSMFKSSTEACMKWLNDRAKESVVYVSYGSFVELKAEEMEELAWGLKSSDQHF  313

Query  572   LWVVRDSELPKLPENFLGD---DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALS  402
             LWVVR+SE  KLP+ F  +     K+L+V+W PQL+VLA +A GCF TH GWNST+EALS
Sbjct  314   LWVVRESEQAKLPKKFSDETLTSHKSLVVSWCPQLEVLAHEATGCFVTHCGWNSTMEALS  373

Query  401   LGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEM  231
             LGVPMVAMPQW+DQ+ NAK I+DVWK G +       +V R  I  C+ E+LE   GKE+
Sbjct  374   LGVPMVAMPQWSDQSTNAKYILDVWKTGLKF-----PIVKRDAIADCISEILEGERGKEL  428

Query  230   KENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             + NA KW  LAKEAV++GG+SD  IDEF
Sbjct  429   RRNAGKWRKLAKEAVAKGGSSDSNIDEF  456



>ref|XP_011082055.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=476

 Score =   442 bits (1137),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 305/442 (69%), Gaps = 7/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNS--MKPVSDAVGIDIISDG  1281
             AH + +P+P QGHINPMLQF KRL+  G++ T  +T  ++ +      + A+ ++IIS G
Sbjct  21    AHCLILPFPVQGHINPMLQFAKRLLQNGIQITFVVTQNVAKTALFSSTTSAIPLEIISLG  80

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
                A      S   YL RF   GS+TL + + R  +S  PVDC++YD  +PW LDVAK  
Sbjct  81    -SAADLPHGTSYDVYLARFLEFGSRTLKEALVRLADSGRPVDCIVYDPILPWGLDVAKEF  139

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+ A  FFT +CAV+ +YY    G L++P++   + +PGLP L   DMPSF++VHG+YP 
Sbjct  140   GMAAAAFFTHSCAVDQIYYHVFKGELKVPLSGEEILLPGLPPLMPDDMPSFVHVHGAYPP  199

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             + E+ +++F  +E AD +F N+FYKLE +V+D M+K  PV  +GPT+PS+YLD R+ +D 
Sbjct  200   FLEMTVNRFSGLENADWLFFNTFYKLEEEVIDNMAKFFPVKTVGPTIPSMYLDKRLSDDR  259

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             EYG+++Y+ D    ++WL  +   SV+YV+FGS+A + ++QMEELAWG + +N +FLWVV
Sbjct  260   EYGLSIYNPDTEACMEWLKQRQPESVVYVSFGSLAKLGEEQMEELAWGLRLSNKHFLWVV  319

Query  560   RDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R SE  KLP++F  +  +  LIV W PQL VLA +AV CF TH GWNST+EALSLGVPMV
Sbjct  320   RSSEESKLPKDFAKESWEMGLIVPWCPQLDVLAHEAVCCFVTHCGWNSTLEALSLGVPMV  379

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMK  213
             A+PQW+DQT N+K ++DVWK+G   +V ++GVV R  +  C+++V+EG+   +MK NA K
Sbjct  380   AIPQWSDQTTNSKFVMDVWKMGVWAKVDDNGVVGRETVARCIKDVMEGQRREDMKRNAGK  439

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA+EAV EGGTS K I +F
Sbjct  440   WKELAREAVEEGGTSHKNIQDF  461



>gb|EYU20869.1| hypothetical protein MIMGU_mgv1a005301mg [Erythranthe guttata]
Length=490

 Score =   442 bits (1137),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 300/440 (68%), Gaps = 17/440 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSD-AVGIDIISDGC  1278
             AH + +P+P+QGHINP+LQF KRL  K +K TLA+T F   +    S  ++    ISDG 
Sbjct  53    AHCLILPHPTQGHINPILQFAKRLTHKRIKITLALTKFTLKTTTGFSGGSISTRSISDGF  112

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G   A+S  +Y  RFQ  G +TLA+L++    S  PVDCV+YD F+PW LDVAK  G
Sbjct  113   DEGGRAHANSSEEYQARFQQVGRETLAELLQDLAGSGRPVDCVVYDPFIPWVLDVAKGFG  172

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L A  FFTQ+CA            L+LP++   V +PGLP ++  +MPSFI+ HGSYP  
Sbjct  173   LLAAAFFTQSCA------------LKLPLSGGEVVVPGLPPMKPEEMPSFIHDHGSYPGT  220

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F+++L+QF NV+KAD + +N+F KLE +V++ MS+   V  IGPT+PS+YLD R+++D E
Sbjct  221   FQMLLNQFRNVDKADWILINTFDKLEQEVLEWMSRFWRVKAIGPTIPSMYLDKRLQDDKE  280

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+N+++      ++WL+ +   SVIY +FGS+A +  +Q +ELA+    +N  FLWVVR
Sbjct  281   YGLNMFNPMTNTCMNWLDNQEPKSVIYASFGSLAQLTARQTKELAYALTTSNKPFLWVVR  340

Query  557   DSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
              +E  KLPE+F     K L+V W+PQL+VL+  AVGCF TH GWNST+E LSLGVP+VAM
Sbjct  341   STEESKLPEDF-SKSRKGLVVTWAPQLEVLSHMAVGCFVTHCGWNSTLEGLSLGVPLVAM  399

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWS  207
             PQWTDQ+ NAKL+ DVW VG R R   +G+VSR EI  CV+ V+E   GK +  NA+KW 
Sbjct  400   PQWTDQSTNAKLVTDVWGVGVRARADCNGIVSREEIVSCVKSVMESEDGKRIGSNAVKWK  459

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              +A+EA+  GG+SDK I+EF
Sbjct  460   GIAREALDLGGSSDKNIEEF  479



>ref|XP_010672479.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=455

 Score =   440 bits (1131),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 294/440 (67%), Gaps = 7/440 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAIT-TFISNSMKPVSDAVGIDIISDGCD  1275
             H +  PYP QGHINPMLQF K+L S+GLK TLA T TF S  M   S+++ I+ ISDG  
Sbjct  11    HAIVFPYPIQGHINPMLQFSKQLASRGLKVTLATTSTFSSKFMMLQSNSITIETISDGSG  70

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             +      +++  Y+ RF V   ++L +LIE+   S   + C+IYDS +PWAL++AK   +
Sbjct  71    ENA--TTENLDTYVKRFDVVAPRSLTELIEKKIGSGHDIRCLIYDSCIPWALNIAKKLEI  128

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
             ++  FFTQ+C V  +Y  A+ GIL  PV  P V + G+P +E RD+PSF+ + G +P   
Sbjct  129   YSASFFTQSCLVGLIYLQAYQGILSAPVKGPGVCVVGMPLIEDRDLPSFVRLVGVHPILE  188

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             +L+  Q  N   AD  F N+F  LE++VV+ M+   PV  IGP +PS YLD R+ +D +Y
Sbjct  189   KLMFSQVSNCGDADWRFFNTFEGLESEVVNWMTNQWPVKTIGPCIPSTYLDKRLPDDKDY  248

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G++L+       I WL+ +   SV+Y++ GSMAS+  +QM E+A G   +N YFLWVVR 
Sbjct  249   GLSLFEAQTNACIQWLDARKPASVVYISMGSMASLGNEQMGEIAKGLDKSNKYFLWVVRA  308

Query  554   SELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP NF      KALIV+W PQL+VLA  A+GCF TH GWNST+EA+SLGVPM+A 
Sbjct  309   SEENKLPLNFKEKTSQKALIVSWCPQLEVLAHHAIGCFVTHCGWNSTLEAISLGVPMIAF  368

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWS  207
             PQWTDQ  NAK IVD WK+G RVRV E+G +S  EIE C+REV+EG   KE+K NA KW 
Sbjct  369   PQWTDQPTNAKCIVDHWKIGVRVRVDENGFLSADEIELCIREVMEGEFTKEIKNNAAKWR  428

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             HL ++A+ +GG+SD+ I+EF
Sbjct  429   HLTRQAMEQGGSSDRNIEEF  448



>ref|XP_010321783.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum lycopersicum]
Length=460

 Score =   440 bits (1131),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 308/444 (69%), Gaps = 9/444 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISN-SMKPVSDAVGIDIISDGCD  1275
             H + IP+P+QGHINPMLQF KRL  KG++ TL  T +I N SM+ ++ ++ I+ ISDG D
Sbjct  9     HCLVIPFPTQGHINPMLQFSKRLQHKGIEITLVPTIYIFNKSMQELTSSITIEPISDGYD  68

Query  1274  DA-GFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  G   A S+  YL   Q+ GS+ L  LIE+ KN  +P++CVIYDSFMPW LDVAK  G
Sbjct  69    DVNGLFCAKSIETYLESHQIVGSQALIQLIEKLKNKGNPINCVIYDSFMPWILDVAKMFG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTS-PPVRIPGL-PALELRDMPSFIYVHGSYP  924
             L +G FFT +CAV  ++Y      L+LPV     V +PGL   L   D+PSF+   GSYP
Sbjct  129   LVSGVFFTMSCAVENIFYHIQLKELKLPVEGHDQVLLPGLLQPLVPSDLPSFVNDMGSYP  188

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKND  744
              + ++++ QF N+++AD +  N+ Y+LE   VD ++K   +  IGPT+PS+Y+D R++ND
Sbjct  189   PFLKMLVDQFSNIQEADWILCNTIYELEKHEVDWITKRLRLRTIGPTIPSMYVDKRLEND  248

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
             + YG+++Y       + WL+   +GSV+YV+FGSMA + ++QM+E+A G   +N  FLWV
Sbjct  249   NSYGLSIYKPKSDVCMKWLSDCDDGSVVYVSFGSMAELKEEQMKEIACGLNKSNHNFLWV  308

Query  563   VRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VR+SE PK+P++FL +   +K L+V W PQL VL+ KA+GCF TH GWNST+EALSLGVP
Sbjct  309   VRESEEPKIPKDFLDNIKREKGLVVTWCPQLDVLSHKAIGCFMTHCGWNSTLEALSLGVP  368

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENA  219
              VA+P WTDQ  NAK ++D+W++G + +  E GVV +  +E C+REV+E   GKE+++NA
Sbjct  369   TVAIPIWTDQCTNAKYVMDIWEMGIKAQANEKGVVEQEVVEHCIREVMEGERGKEIRKNA  428

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  + K+A+ EGG+SD+ I++F
Sbjct  429   TKWREVTKKAMDEGGSSDRNINDF  452



>gb|KDP45197.1| hypothetical protein JCGZ_15062 [Jatropha curcas]
Length=463

 Score =   440 bits (1131),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 215/449 (48%), Positives = 314/449 (70%), Gaps = 13/449 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK---PVSDAVGIDIISD  1284
             AH + +P+P+QGHINPM QF KR+ +KG++ TL  T F+S ++K     + ++ ++ ISD
Sbjct  8     AHCIVLPHPAQGHINPMFQFSKRIQNKGVRVTLVTTKFVSKTIKHKPSSTSSIVLETISD  67

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+ G  QA+SV  YL  F+  G+KTL DL+++  ++  PV C++YD+FMPW L+VAK 
Sbjct  68    GYDEGGIDQAESVEVYLESFKKVGTKTLCDLLDKLNDNGFPVSCIVYDAFMPWCLEVAKK  127

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPV-TSPPVRIPGLPALELRDMPSFIYVHGSY  927
             +GL    FFTQ+CAV+ +YY  + G+++ P+     V  PGL  LE+ D+PSF++  GS 
Sbjct  128   NGLVGAVFFTQSCAVDIIYYNVYKGLIKPPLDRETQVLAPGLTPLEVEDLPSFVHHFGSD  187

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
             PA F++++ QF N+++ D V  N+FY+LE +  D ++K+ P+  IGPT+PS+YLD ++++
Sbjct  188   PAVFDMLVDQFSNIDEVDWVLCNTFYELEQEAADWLAKLWPLRTIGPTIPSMYLDKQLQD  247

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFK----NTNT  579
             D +YG  +Y  +     +WLN KP+GSV+YV+FGS+A++  +Q+EEL+W  K    + N 
Sbjct  248   DKDYGFYIYKPNNEACKNWLNGKPKGSVVYVSFGSLATLATEQIEELSWALKSITISNNY  307

Query  578   YFLWVVRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEAL  405
             YFLWVVR+SE  KLP NF+ +  +   L+V WS QL VLA +A+GCF TH GWNST+EAL
Sbjct  308   YFLWVVRESEQTKLPRNFIQEISEKGNLVVKWSAQLDVLACEAIGCFVTHCGWNSTLEAL  367

Query  404   SLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---  234
             SLGVPMVAMPQWTD++ NAK I+DVWK+G R  V E G+V    I  C+++V++G+    
Sbjct  368   SLGVPMVAMPQWTDRSTNAKYIMDVWKMGIRAHVDEKGIVREDAIRDCIQKVMDGERREC  427

Query  233   MKENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             +KEN  KW  LAK A + GG+SD+ I EF
Sbjct  428   IKENVEKWKKLAKAAANGGGSSDRNITEF  456



>ref|XP_007033641.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 ref|XP_007033642.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04567.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04568.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
Length=442

 Score =   439 bits (1129),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 214/440 (49%), Positives = 307/440 (70%), Gaps = 18/440 (4%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H++ +  P QGHINP+LQF KRL S+GL+ TL  T  ++ SM      V ++++   CD
Sbjct  10    THVLVLALPGQGHINPILQFSKRLGSEGLEVTLC-TASVNKSMPVQVGPVKLELV---CD  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             +   LQ D+  D L RF+   +  L  +I +       + C++YD+  PWALD+AK  GL
Sbjct  66    E---LQVDN--DMLERFKAVVTLRLPQIIAKLG-----ISCLVYDAHFPWALDIAKKLGL  115

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
              A  FFTQ+CAV+ +YY  H G+++LP+    + I GLP L+  D+PSF+Y  GSYPA+ 
Sbjct  116   PAAAFFTQSCAVDTIYYNVHEGLVKLPLAESSLSIDGLPLLQGCDLPSFVYDIGSYPAFL  175

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
                ++QF N  +AD VF+N+F  LE +V++ M+   P+  IGP +PS YLD RV++D EY
Sbjct  176   HTCVNQFSNFMEADWVFINTFTSLEEEVLNWMASQRPIKAIGPVIPSKYLDKRVEDDEEY  235

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G++L+  +    I+WLN+K  GSV+Y++FGS+A++ ++QM+E A G +++N+YFLWVVR+
Sbjct  236   GLHLFKPEIDICINWLNSKETGSVVYISFGSLAALGEEQMQEFASGLQSSNSYFLWVVRE  295

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             +E  KLP +F+G+  DK L+V+WSPQL+VLA +AVGCF TH GWNST+EALSLGVPMVA+
Sbjct  296   TEQKKLPASFIGETSDKGLVVSWSPQLEVLAHEAVGCFMTHCGWNSTLEALSLGVPMVAV  355

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWS  207
             P WTDQT NAK + DVW+VG R R  + G++++ EI+ C+RE++EG   K++K NA KW 
Sbjct  356   PHWTDQTTNAKYVADVWQVGIRARKDDKGIITKEEIQRCIREIMEGDKTKDIKRNAEKWK  415

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LA EAV+ GG+SDK I EF
Sbjct  416   TLAVEAVNVGGSSDKNIREF  435



>emb|CBI24719.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 227/446 (51%), Positives = 300/446 (67%), Gaps = 15/446 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA-----VGIDII  1290
             +HI+  P+P+ GHINPMLQF KRL S GL+ TL  T     + KP+ +A     + I+ I
Sbjct  6     SHILVFPFPTPGHINPMLQFSKRLASMGLRVTLVTT---QPNTKPIEEAQSNYPIHIEPI  62

Query  1289  SDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVA  1110
             SDG       +A SV  YL +FQ   S++LA L+E+   S  P+  ++YDS MPWALD A
Sbjct  63    SDGFQPGE--KAQSVEVYLEKFQKVASQSLAQLVEKLARSKRPIKFIVYDSVMPWALDTA  120

Query  1109  KSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGS  930
             +  GL    F+TQ+CAV+ +YY    G++++P+       P +P L + D+PSFI    S
Sbjct  121   QELGLDGAPFYTQSCAVSAIYYHVSQGMMKIPIEGKTASFPSMPLLGINDLPSFISDMDS  180

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YP+   LVL +F N  KA C+ +N+F  LEA+VV  M    PV  IGPT+PS+YLD R++
Sbjct  181   YPSLLRLVLGRFSNFRKAKCLLINTFDMLEAEVVKWMGSQWPVKTIGPTIPSMYLDKRLE  240

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D +YG++  +++    I WL+ +  GSV+YV+FGS+AS+ ++QMEELAWG K +  YFL
Sbjct  241   DDKDYGLSPLNLNVDACITWLDARDIGSVVYVSFGSLASLGEEQMEELAWGLKRSKGYFL  300

Query  569   WVVRDSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR+ E  KLP NF+ +  DK L+V+W PQL VLA KAVGCF TH GWNST+EALSLGV
Sbjct  301   WVVRELEEQKLPSNFIENTADKGLVVSWCPQLDVLAHKAVGCFMTHCGWNSTLEALSLGV  360

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVG-EDGVVSRGEIEGCVREVLE---GKEMKE  225
             PMV MPQWTDQ  NAK + DVW VG RV+   E G+V R EIE C+RE +E   GKEMK 
Sbjct  361   PMVVMPQWTDQMTNAKFVADVWGVGVRVKASDEKGIVKREEIEECIREAMEGERGKEMKR  420

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             NA +W  LAKEA +EGG+SDK I+EF
Sbjct  421   NAERWKELAKEAATEGGSSDKNIEEF  446



>gb|AES96307.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=501

 Score =   440 bits (1131),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/439 (48%), Positives = 304/439 (69%), Gaps = 6/439 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ IPYP+QGHI+P++QF KRLVSKG+KTT A T +   S+   +  V ++ ISDG D+
Sbjct  11    HVLVIPYPAQGHISPLIQFSKRLVSKGIKTTFATTHYTVQSI--TAPNVSVEPISDGFDE  68

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
             +GF QA++V  +L  F+  GS +L+++I++Y+ + +P+ C++YDSF+PWALDVAK HG++
Sbjct  69    SGFTQANNVELFLTSFKTNGSNSLSNIIQKYQKTSTPITCIVYDSFLPWALDVAKQHGIY  128

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
                FFT + AV  ++   HHG++++PV   P+ +P LP L  RD+PSFI    SYPAY  
Sbjct  129   GAAFFTNSAAVCNIFCRIHHGLIEIPVDELPLVVPDLPPLNSRDLPSFIRFPESYPAYMA  188

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             + L QF N+++AD +FVN+F  LE +VV  ++++ P   IGP VPS YLD R+K D  YG
Sbjct  189   MKLSQFSNLDQADWMFVNTFEALEGEVVKGLTELFPAKMIGPMVPSAYLDGRIKGDKGYG  248

Query  731   INLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDS  552
              NL+       I+WLN+KP  SV+Y++FGSM S+  +Q+EELA G K +   FLWV+R+ 
Sbjct  249   ANLWKPLSEYCINWLNSKPSQSVVYISFGSMVSLTSEQIEELALGLKESEVNFLWVLREL  308

Query  551   ELPKLPENFLG-DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMP  375
             E  KLP+ +     +K +IV W  QL++LA  AVGCF TH GWNST+E+LSLGVP+V +P
Sbjct  309   EQGKLPKGYKDFIKEKGIIVTWCNQLELLAHDAVGCFVTHCGWNSTLESLSLGVPVVCLP  368

Query  374   QWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKWSH  204
             QW DQ  +AK + ++W+VG R +  E+GVV R E    ++ V+E +    ++ NA +W  
Sbjct  369   QWADQLPDAKFLEEIWEVGVRPKEDENGVVKREEFMLSLKVVMESERSEVIRRNASEWKK  428

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LA++AVSE G+S+K IDEF
Sbjct  429   LARDAVSERGSSNKNIDEF  447



>ref|XP_010679007.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=466

 Score =   438 bits (1127),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/450 (48%), Positives = 302/450 (67%), Gaps = 14/450 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVS------DAVGIDI  1293
             AH++ +P+P QGHINPMLQF KRL SKG+K TL  T +I+ SM   +        + +  
Sbjct  10    AHVLVVPFPGQGHINPMLQFSKRLASKGIKPTLTPTVYIAKSMHTTTIPTLYGPPIQLRP  69

Query  1292  ISDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDV  1113
             ISDG DD G  QA S   YL+  QV G KTL  L+++      PV  +IYD F+PWALDV
Sbjct  70    ISDGYDDGGKNQAQSTAVYLDSLQVHGPKTLVQLVKKLIEEGDPVKAIIYDGFLPWALDV  129

Query  1112  AKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSP---PVRIPGLPALELRDMPSFIY  942
             AK  GL    FFTQ+C+VN +YY    G++QLP+  P    V +PG P L+  ++PSF+ 
Sbjct  130   AKQFGLLGVVFFTQSCSVNSIYYHVQRGLIQLPLLGPGPSTVSVPGAPELQPWEVPSFVG  189

Query  941   VHGSYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLD  762
              +GSYP +F +VL QF N+++ D V  N FY +E +VVD M+KM  +  IGPTVPS YLD
Sbjct  190   QYGSYPFWFHVVLEQFSNIDQVDWVLCNIFYDMEKEVVDWMAKMWKIRTIGPTVPSFYLD  249

Query  761   NRVKNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTN  582
              R+++D +Y +  +  +     +WL++KP+ SVIY++FGS A + ++Q EELA G K +N
Sbjct  250   KRLEDDKDYNLQFFKPNTILCKNWLDSKPKHSVIYISFGSAAKLSEEQFEELAQGLKISN  309

Query  581   TYFLWVVRDSELPKLPENFLGDDDK-ALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEAL  405
               FLWVVR+SE  KLP+ F+ +  +  L+V+W+ QL+VL+ +A  CF TH G+NS +EAL
Sbjct  310   QTFLWVVRESEQAKLPKRFIDETSELGLVVSWASQLEVLSHEATCCFVTHCGFNSVLEAL  369

Query  404   SLGVPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGED-GVVSRGEIEGCVREVLEGKEMK  228
              +GVP+V +PQ+TDQ  NAK + DVW+VG R ++ E+ G+V R E+E C+RE++ GK+ +
Sbjct  370   CIGVPVVGVPQYTDQGTNAKFMEDVWRVGIRAKIDENKGIVRREEVEKCIREMMGGKKKE  429

Query  227   E---NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             E   N  KW  LAK+A+ EGG+SDK IDEF
Sbjct  430   EFMMNVAKWKKLAKQAMDEGGSSDKNIDEF  459



>ref|XP_002267665.1| PREDICTED: UDP-glycosyltransferase 74B1 [Vitis vinifera]
Length=458

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/442 (49%), Positives = 303/442 (69%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
              H+V +PYPSQGHINP+LQF KRL SKG+K TLA T +  N ++  +  +G++ ISDG D
Sbjct  5     GHVVVVPYPSQGHINPLLQFAKRLASKGVKATLATTRYTVNFIR--APNIGVEPISDGFD  62

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + GF QA     YLN F+  GS+TL+ LI +++++  P++CV+YDSF+PWAL+VA+ HG+
Sbjct  63    EGGFAQAGKEDVYLNAFKANGSRTLSQLIHKHQHTTHPINCVLYDSFLPWALNVAREHGI  122

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
                 FFT +  V  ++   HHG+L LPV     P+ +PGLP L   D+P+F+    SYPA
Sbjct  123   HGAAFFTNSATVCAIFCRIHHGLLTLPVKLEDTPLLLPGLPPLNFPDLPTFVKFPESYPA  182

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + L Q+ N++  D V  NSF +LE +   ++S++ P + +GP VPS YLD R+  D 
Sbjct  183   YLTMKLSQYSNLDNVDWVIGNSFEELEGEAAKSISELWPGMLVGPMVPSAYLDGRIDGDK  242

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     K I WL  K   SV+YV+FGSM S+  KQMEE+AWG K +  +FLWVV
Sbjct  243   GYGASLWKPLSDKCIKWLEKKAPQSVVYVSFGSMVSLSAKQMEEIAWGLKASGQHFLWVV  302

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             ++SE  KLPE F+   +++ LIV W  QL++LA +A+GCF +H GWNST+E LSLGVPMV
Sbjct  303   KESERSKLPEGFIDSAEEQGLIVTWCNQLEMLAHEAIGCFVSHCGWNSTLEGLSLGVPMV  362

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMK  213
              +PQWTDQ  +AK + ++W+VG R +  E G+V RGE+  C++EV+ GK   E+K NA K
Sbjct  363   GVPQWTDQHTDAKFVEEIWEVGVRAKEDELGIVRRGELLMCLKEVMVGKRSEEIKRNAGK  422

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAKEA+SEGG+SD+ I++F
Sbjct  423   WRRLAKEAISEGGSSDQCINQF  444



>ref|XP_006484310.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Citrus sinensis]
Length=525

 Score =   440 bits (1132),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 303/441 (69%), Gaps = 8/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H+V +PYPSQGHINP+LQF KRL SKG+K TLA T + + S+   +  VG++ ISDG D+
Sbjct  51    HVVLLPYPSQGHINPLLQFAKRLASKGVKATLATTHYTAKSI--CAPHVGVEPISDGFDE  108

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              G+ QA +   YL  F+  GS+TL++LI+RYKNS  PV+CV+YDSF+PWALDVAK +GL+
Sbjct  109   GGYAQAKNEDLYLKSFEDNGSRTLSELIKRYKNSSFPVNCVVYDSFLPWALDVAKEYGLY  168

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
                FFT +  V  ++   HHG+L LPV     P+ IPGLP+L   D+P+F+    SYPAY
Sbjct  169   GAAFFTNSATVCNIFCRMHHGLLTLPVKLEDTPLSIPGLPSLNFIDLPTFVKFPESYPAY  228

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               + L Q+ N++KAD +F N+F +LE +   ++S++ P   IGP VPS YLD R+K DS 
Sbjct  229   LAMKLGQYSNLDKADWIFGNTFQELEGEGARSISELWPGKLIGPMVPSAYLDGRIKGDSG  288

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +L+     +  +WL TKP+ SV+Y++FGSM S+  +QMEE+A   K+++  FLWVVR
Sbjct  289   YGSSLWQPLSEECSEWLETKPQQSVVYISFGSMVSLTAEQMEEIALALKDSSLDFLWVVR  348

Query  557   DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +S+  KLP  F+     K L+V+W  QL+VL   AVGCF TH GWNST+E LSLGVPM+ 
Sbjct  349   ESQQEKLPNWFMDSTKQKGLVVSWCNQLEVLEHPAVGCFVTHCGWNSTLEGLSLGVPMIG  408

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKW  210
             +PQW DQ  +AK I +VW +G R +  E G+V + EI  C +EV+EG+    +K+NA +W
Sbjct  409   VPQWADQLTDAKYIEEVWGIGVRAKEDEKGIVRKEEILKCFKEVMEGERSQVIKKNASEW  468

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
                +++A+ EGG+SD+ I +F
Sbjct  469   KKKSEKAMREGGSSDQNICDF  489



>ref|XP_002529824.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32573.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   438 bits (1126),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 308/442 (70%), Gaps = 8/442 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMK-PVSDAVGIDIISDGC  1278
             +H++  P+P QGHINPMLQ  KRL SKGLK TL  T+ I+ +M+ P + +V I+ I DG 
Sbjct  13    SHVLVFPFPVQGHINPMLQLSKRLASKGLKVTLIATSSIAKTMQAPQAGSVHIETIFDGF  72

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
              +    +   + +++  F     ++LA LIE+Y +S  PV CVIYDS  PW  D+A+S G
Sbjct  73    KEGE--RTSDLEEFIETFNRTIPESLAGLIEKYASSPQPVKCVIYDSATPWIFDIARSSG  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             ++   FFTQ+CAV  +YY    G L++P+    V +P  P LE  DMPS++   GSY A 
Sbjct  131   VYGASFFTQSCAVTGLYYHKIQGALKVPLGESAVSLPAYPELEANDMPSYVNGPGSYQAI  190

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             +++   QF NV++ D V  N+F +LE +VV  M+   P+IPIGPT+PS++LD R+K+D +
Sbjct  191   YDMAFSQFSNVDEVDWVLWNTFNELEDEVVKWMASKWPIIPIGPTIPSMFLDKRLKDDKD  250

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG++L+  +    + WL++K   SV+YV+FGS+A++ + QM +LAWG K +N  FLWVVR
Sbjct  251   YGVSLFKPNSDTCMKWLDSKEPSSVVYVSFGSLAALGEDQMAQLAWGLKRSNNNFLWVVR  310

Query  557   DSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +SE  K+P NF+ +  ++K L+V WSPQLKVLA ++VGCF TH GWNST+EALSLGVPMV
Sbjct  311   ESEEKKVPPNFIEETTEEKGLVVTWSPQLKVLAHRSVGCFLTHCGWNSTLEALSLGVPMV  370

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             AMPQW+DQ+ NAK + DVW+VG RV V ++G+V+R EIE C+REV+E   GK M+ N+ K
Sbjct  371   AMPQWSDQSTNAKFVTDVWRVGVRVEVDQNGIVTREEIEKCIREVMEGETGKGMRMNSEK  430

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA+  V EGG+SDK I+EF
Sbjct  431   WKELARITVDEGGSSDKNIEEF  452



>ref|XP_002309739.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE90189.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   437 bits (1124),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 213/444 (48%), Positives = 298/444 (67%), Gaps = 11/444 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             +H++ IPYP+QGHINPM+QF KRL SKGL+ T  I  F S ++   +    + +++  C 
Sbjct  4     SHVLVIPYPAQGHINPMIQFSKRLASKGLQVTAVI--FSSQALLEHTQLGSVGVVTIDCQ  61

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDS-PVDCVIYDSFMPWALDVAKSHG  1098
                  +  S+ DYL +FQ   +  L +L+   KNS   P+ C++YDS MPW L+ A+  G
Sbjct  62    SHEEAKI-SIDDYLKQFQATVTLKLRELVAELKNSSGYPICCLVYDSLMPWVLETARQLG  120

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIY---VHGSY  927
             L A  FFTQ+CAV+ VYY  H G L++P+   P+     PALE+ D+PSF+        Y
Sbjct  121   LSAASFFTQSCAVDTVYYHIHEGQLKIPLEKLPLTFSRPPALEITDLPSFVQGLESKSEY  180

Query  926   PAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKN  747
              +   LV+ QF N  +AD +FVN+F  LE + V+ ++    + PIGPT+PS+YLD ++++
Sbjct  181   SSLLNLVVSQFSNFREADWIFVNTFNTLEEEAVNWLASQRSIKPIGPTIPSVYLDRQLED  240

Query  746   DSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLW  567
             D EYG++L+  +     +WL++K  GSV+YV++GSMA++ ++QM E+AWG K +  YFLW
Sbjct  241   DREYGLSLFKPNLYGCKEWLDSKETGSVVYVSYGSMAALGEEQMAEIAWGLKRSGCYFLW  300

Query  566   VVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVP  390
             VVR+SE  KLP NF  +  +K LIV WS QL+VLA K+VGCF TH GWNST+EALSLGVP
Sbjct  301   VVRESEKKKLPSNFAEESSEKGLIVTWSQQLEVLAHKSVGCFMTHCGWNSTLEALSLGVP  360

Query  389   MVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENA  219
             MVAMPQWTDQ  NAK I DVW VG RV V +  +V++ E+E C+REV+E +    +++N+
Sbjct  361   MVAMPQWTDQPTNAKYIADVWHVGVRVEVNQKRIVTKEEVERCIREVMESERSNVIRKNS  420

Query  218   MKWSHLAKEAVSEGGTSDKVIDEF  147
              KW  L K AV EGG+SDK I+EF
Sbjct  421   DKWKKLVKMAVDEGGSSDKNIEEF  444



>ref|XP_009776895.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=445

 Score =   437 bits (1123),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 222/440 (50%), Positives = 302/440 (69%), Gaps = 10/440 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             +H++ +P+P QGHINPM+QF KRLVS+G+K TL     IS SM   S +V I+ I    D
Sbjct  8     SHVLVLPFPVQGHINPMVQFSKRLVSRGVKVTLVTIDSISKSMPMESCSVKIESIPH--D  65

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             ++      S+  +L  F V  S  L  ++E+  +S+ PV  +++DS   WA+D+A   G+
Sbjct  66    ES---PPKSIDIFLEWFFVLISNNLKKIVEKLFDSEYPVKVLVFDSVTAWAIDLAHELGI  122

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+C+++ +YY     I ++ +    V +P LP LE  D+PSF+Y   SYP+  
Sbjct  123   KGAAFFTQSCSLSAIYYHLDPEIRKIILDGSAVSLPSLPLLEKEDLPSFVYEGDSYPSLV  182

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
              LV  Q +N +KAD +F N+F  LE +VVD M    P+  IGPT+PS+YLD R+K+D EY
Sbjct  183   RLVFSQNINFKKADWLFFNTFDVLE-EVVDWMRTQYPIKTIGPTIPSMYLDKRLKDDKEY  241

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G +L   +    + WL+ K  GSV+YV+FGS+AS+ +KQMEELA+G   +N+YFLWVVRD
Sbjct  242   GSSLIKPNGETCMKWLDLKEIGSVVYVSFGSLASLGEKQMEELAFGLIMSNSYFLWVVRD  301

Query  554   SELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             +E  KLP +F+    +K LIVNWSPQL VLA K+VGCFFTH GWNST+EALSLGVPMV M
Sbjct  302   TEENKLPNDFMSKVSEKGLIVNWSPQLDVLAHKSVGCFFTHCGWNSTLEALSLGVPMVCM  361

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKWS  207
             PQWTDQ  NAK I DVW+ G RV+ G+DGV++R E+   +REV+EG++   +KENA+KW 
Sbjct  362   PQWTDQPTNAKFISDVWRTGIRVKAGKDGVITREEVASSIREVMEGEKGVMLKENAIKWK  421

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +LAKEAV EGG+SDK I+EF
Sbjct  422   NLAKEAVDEGGSSDKNIEEF  441



>ref|XP_011002951.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74E2-like 
[Populus euphratica]
Length=493

 Score =   438 bits (1127),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 217/446 (49%), Positives = 311/446 (70%), Gaps = 12/446 (3%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDIISDGC  1278
             +H++ +P P QGHINPMLQFCKRL SKGLK TL   T +  SM +  + ++ ++ I DG 
Sbjct  11    SHVLVLPLPIQGHINPMLQFCKRLASKGLKVTLITPTSMGTSMHQDNACSINMEPIFDGY  70

Query  1277  DDAGFLQADSVPDYLNRFQ--VAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
              +    +A +  +Y+ RF+  +A  ++LA+LI++   S  P   +IYDS +PW LDVAKS
Sbjct  71    REGE--RAATAKEYVERFKDTIARPQSLAELIDKNSTSQYPFKFIIYDSILPWVLDVAKS  128

Query  1103  HGLFAGCFFTQACAVNYVYY-CAHHGILQLPVTSPP-VRIPGLPALELRDMPSFIYVHGS  930
              G+  G FFTQ+CAV  +YY     G L++P+     V +P LP LE  D+PS ++  GS
Sbjct  129   WGIEGGPFFTQSCAVTVLYYHTLQGGALKIPMEEKSSVSLPSLPQLEFSDLPSLVHGPGS  188

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
             YP  ++L+  QF N+++A  +  N+F +LE ++VD M+   P+ P GPT+PS++LD R++
Sbjct  189   YPGVYDLLFSQFSNIDEASWLLGNTFNELEDEIVDWMASKWPIKPTGPTIPSMFLDKRLE  248

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D +YG++L+  +    + WL++K  GSV+YV+FG  A++ + QM ELAWG K +NT+FL
Sbjct  249   DDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGGFAALTEDQMAELAWGLKRSNTHFL  308

Query  569   WVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR+SE  KLP NF+ +  +  L++ WSPQ KVLA K+VGCF TH GWNST+EA+SLGV
Sbjct  309   WVVRESEKQKLPGNFVEETTEMGLVITWSPQPKVLAHKSVGCFMTHCGWNSTLEAVSLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL-EG---KEMKE  225
             P+VAMPQWTDQ  NAK + DVW+VG RV+VGE+G+V++ EIE C+REV+ EG    E++ 
Sbjct  369   PVVAMPQWTDQPTNAKFVADVWQVGVRVKVGENGMVTQEEIERCIREVMTEGGRRDEIRT  428

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
             ++ KW  LA  A+ EGG+SDK IDEF
Sbjct  429   HSEKWKKLAVMAMDEGGSSDKNIDEF  454



>ref|XP_003517852.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Glycine max]
Length=465

 Score =   437 bits (1124),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 210/442 (48%), Positives = 303/442 (69%), Gaps = 9/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ +PYP+QGHINP++QF KRL SKG+K T+A T + +NS+   +  + ++ ISDG D 
Sbjct  10    HVLVLPYPAQGHINPLVQFAKRLASKGVKATVATTHYTANSIN--APNITVEAISDGFDQ  67

Query  1271  AGFLQADS-VPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             AGF Q ++ V  +L  F+  GS+TL++LI +++ + SPV C++YDSF PW LDVAK HG+
Sbjct  68    AGFAQTNNNVQLFLASFRTNGSRTLSELIRKHQQTPSPVTCIVYDSFFPWVLDVAKQHGI  127

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSP--PVRIPGLPALELRDMPSFIYVHGSYPA  921
             +   FFT + AV  ++   HHG +QLPV     P+R+PGLP L+ R +PSF+    SYPA
Sbjct  128   YGAAFFTNSAAVCNIFCRLHHGFIQLPVKMEHLPLRVPGLPPLDSRALPSFVRFPESYPA  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + L QF N+  AD +FVN+F  LE++V+  ++++ P   IGP VPS YLD R+K D 
Sbjct  188   YMAMKLSQFSNLNNADWMFVNTFEALESEVLKGLTELFPAKMIGPMVPSGYLDGRIKGDK  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     +  +WL +KP  SV+Y++FGSM S+ ++QMEE+AWG K +   FLWV+
Sbjct  248   GYGASLWKPLTEECSNWLESKPPQSVVYISFGSMVSLTEEQMEEVAWGLKESGVSFLWVL  307

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP  +     DK LIV W  QL++LA +A GCF TH GWNST+E+LSLGVP+V
Sbjct  308   RESEHGKLPCGYRESVKDKGLIVTWCNQLELLAHQATGCFVTHCGWNSTLESLSLGVPVV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
              +PQW DQ  +AK + ++W+VG   +  E G+V + E    +++V+EG   +E++ NA K
Sbjct  368   CLPQWADQLPDAKFLDEIWEVGVWPKEDEKGIVRKQEFVQSLKDVMEGQRSQEIRRNANK  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA+EAV EGG+SDK I++F
Sbjct  428   WKKLAREAVGEGGSSDKHINQF  449



>ref|XP_007199830.1| hypothetical protein PRUPE_ppa005475mg [Prunus persica]
 gb|EMJ01029.1| hypothetical protein PRUPE_ppa005475mg [Prunus persica]
Length=459

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 305/445 (69%), Gaps = 10/445 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSM-KPVSDAVGIDI--ISD  1284
              H + +PYPSQGHINPMLQF K L  KG+K TL  T +I  +M    S  + +D+  ISD
Sbjct  10    GHCLVLPYPSQGHINPMLQFAKLLSHKGVKVTLVTTRYIHKTMYGSASSCIALDLETISD  69

Query  1283  GCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKS  1104
             G D+AG  +A S+  YL  F   GSKTLA+L+E+  +S  PV+CV+YD+FMPW LDVA+ 
Sbjct  70    GYDEAGRGKA-SIDAYLESFWKEGSKTLAELLEKLSSSGPPVECVVYDAFMPWPLDVARK  128

Query  1103  HGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMP--SFIYVHGS  930
              G+    FFTQ+CAV+ +YY  H G+L++P+      I       L  +   SF+Y    
Sbjct  129   FGIAGATFFTQSCAVSNIYYHVHKGLLKVPLADDQSLISLPGLPPLDPLDLPSFVYDLEY  188

Query  929   YPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVK  750
              PA++ +V+ QF NV+KAD V  N+FY+LE QVVD ++K  P+  +GPT+PS YLD R++
Sbjct  189   CPAFYRVVVGQFSNVDKADWVLCNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLE  248

Query  749   NDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             +D EYG+NL+  D    I WLN +P+GSV YV+FGS A +D +QMEELAWG + + + FL
Sbjct  249   DDKEYGVNLFKSDNDACIKWLNERPKGSVAYVSFGSTAKLDDEQMEELAWGLRRSKSNFL  308

Query  569   WVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGV  393
             WVVR SE  K+P+ F+ +  +K L+V+W  Q++VL  +AVGCF TH GWNST+EALSLGV
Sbjct  309   WVVRASEAAKVPKGFIEETSEKGLVVSWCSQMEVLVHEAVGCFVTHCGWNSTLEALSLGV  368

Query  392   PMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKEN  222
             PM+AMPQWTDQ  NAK I+DVWK+G      E G V +  +E C+ E++E   GKEMK N
Sbjct  369   PMLAMPQWTDQRTNAKFIMDVWKIGITAPSDEKGKVRQEVVEHCISEIMEGERGKEMKIN  428

Query  221   AMKWSHLAKEAVSEGGTSDKVIDEF  147
             A+KW  LAK+AV EGG+SDK IDEF
Sbjct  429   ALKWKKLAKKAVDEGGSSDKNIDEF  453



>ref|XP_006438479.1| hypothetical protein CICLE_v10031201mg [Citrus clementina]
 gb|ESR51719.1| hypothetical protein CICLE_v10031201mg [Citrus clementina]
Length=533

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/441 (49%), Positives = 302/441 (68%), Gaps = 8/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H+V +PYPSQGHINP+LQF KRL SKG+K TLA T + + S+   +  VG++ ISDG D+
Sbjct  59    HVVLLPYPSQGHINPLLQFAKRLASKGVKATLATTHYTAKSI--CAPHVGVEPISDGFDE  116

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              G+ QA +   YL  F+  GS+TL++LI+RYKNS  PV+CV+YDSF+PWALDVAK +GL+
Sbjct  117   GGYAQAKNEDLYLKSFKDNGSRTLSELIKRYKNSSFPVNCVVYDSFLPWALDVAKEYGLY  176

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVT--SPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
                FFT +  V  ++   HHG+L LPV     P+ IPGLP+L   D+P+F+    SYPAY
Sbjct  177   GATFFTNSATVCNIFCRMHHGLLTLPVKLEDTPLSIPGLPSLNFIDLPTFVKFPESYPAY  236

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               + L Q+ N++KAD +F N+F +LE +   ++S++ P   IGP VPS YLD R+K DS 
Sbjct  237   LAMKLGQYSNLDKADWIFGNTFQELEGEEARSISELWPGKLIGPMVPSAYLDGRIKGDSG  296

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +L+     +  +WL TKP+ SV+Y++F SM S+  +QMEE+A   K+++  FLWVVR
Sbjct  297   YGSSLWQPLSEECSEWLETKPQQSVVYISFASMVSLTAEQMEEIALALKDSSLDFLWVVR  356

Query  557   DSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             +S+  KLP  F+     K L+V+W  QL+VL   AVGCF TH GWNST+E LSLGVPM+ 
Sbjct  357   ESQQEKLPNWFMDSTKQKGLVVSWCNQLEVLEHPAVGCFVTHCGWNSTLEGLSLGVPMIG  416

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKW  210
             +PQW DQ  +AK I +VW +G R +  E G+V + EI  C +EV+EG+    +K+NA +W
Sbjct  417   VPQWADQLTDAKYIEEVWGIGVRAKEDEKGIVRKEEILKCFKEVMEGERSQVIKKNASEW  476

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
                +++A+ EGG+SD+ I +F
Sbjct  477   KKKSEKAMREGGSSDQNICDF  497



>ref|XP_007208259.1| hypothetical protein PRUPE_ppa016486mg, partial [Prunus persica]
 gb|EMJ09458.1| hypothetical protein PRUPE_ppa016486mg, partial [Prunus persica]
Length=448

 Score =   436 bits (1121),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/446 (48%), Positives = 299/446 (67%), Gaps = 22/446 (5%)
 Frame = -2

Query  1454  AHIVAIPYPSQ-GHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAV----GIDII  1290
             AH + +P+P+Q GHINPMLQF K L  KG+K TL  T F  N++   S        ++ I
Sbjct  5     AHCLVLPFPTQQGHINPMLQFSKLLNQKGVKITLVTTIFDYNTIMEKSSGSDSYNALETI  64

Query  1289  SDGCDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPV-DCVIYDSFMPWALDV  1113
             SD  D  G   A SV  YL      GS+TLA L+ +  +S  PV DC++YD+F+ W LDV
Sbjct  65    SDCYDQGGIRHAQSVEAYLESLCQVGSQTLAQLLVKLSSSGCPVIDCIVYDAFLHWPLDV  124

Query  1112  AKSHGLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHG  933
             A   G+F   FFTQ+CAVN + Y  + G L+LP++   + +PGLP L   DMPS++Y  G
Sbjct  125   ANKFGIFGAIFFTQSCAVNNILYHVYKGELKLPLSQSQILLPGLPRLVPSDMPSYVYELG  184

Query  932   SYPAYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRV  753
             +YPA +++++ QF NVEKAD             VVD M+   P+  IGPT+PS YLD R+
Sbjct  185   TYPAVYKMLVGQFPNVEKAD------------WVVDWMATFLPLKTIGPTIPSHYLDKRL  232

Query  752   KNDSEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYF  573
             ++D +YG++L++ +    + WLN +P+GSV YVAFGS A +  +QMEELAWG + + + F
Sbjct  233   EDDKQYGVSLFNTNNDACMKWLNEQPKGSVAYVAFGSAAQLGVEQMEELAWGLRRSKSKF  292

Query  572   LWVVRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             LWVVR++E  KLP+ F+ +  +K L+V+W PQL+VLA++AVGCF +H GWNST+EA SLG
Sbjct  293   LWVVREAEAAKLPKGFVEETSEKGLVVSWCPQLEVLANEAVGCFISHCGWNSTLEAFSLG  352

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKE  225
             VP+VA+PQWTDQ+ NAK I+DVWK+G +    E GVV + E+E C+ E++E   GKEM+ 
Sbjct  353   VPVVALPQWTDQSTNAKFIMDVWKIGVKALADEKGVVRQEEVEHCISEIMEGERGKEMQR  412

Query  224   NAMKWSHLAKEAVSEGGTSDKVIDEF  147
              A++W  LA++AV EGG+S   IDEF
Sbjct  413   KALEWKELARKAVDEGGSSSNNIDEF  438



>ref|XP_006344123.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum tuberosum]
Length=458

 Score =   436 bits (1122),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 216/442 (49%), Positives = 308/442 (70%), Gaps = 7/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFI-SNSMKPVSDAVGIDIISDGCD  1275
             H + IP+P+QGHINPMLQF KRL  KG++ TL  T  I   SM+ ++ ++ I+ ISDG D
Sbjct  9     HCLVIPFPTQGHINPMLQFSKRLQHKGIEITLVPTIHIFKKSMQELTSSITIEPISDGYD  68

Query  1274  DA-GFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  G   A S+  YL  +Q  GS+ +  LIE+ KN  +P++CVIYDSFMPW LDVAK  G
Sbjct  69    DVNGLFCAKSIETYLESYQKVGSQAIIQLIEKLKNKGNPINCVIYDSFMPWILDVAKMFG  128

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             L +  FFT +CAV  ++Y      L+LPV    V +PGLP L   D+PSF+   GSYP +
Sbjct  129   LVSCVFFTMSCAVENIFYHIQLKELKLPVEGHQVLLPGLPPLVPSDLPSFVNDLGSYPPF  188

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
              ++++ QF N+++AD +  N+ Y+LE   VD ++K   +  IGPT+PS+Y+D R++ND+ 
Sbjct  189   LKMLVDQFSNIQEADWILCNTIYELEKHEVDWITKRLSLRTIGPTIPSMYVDKRLENDNS  248

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+++Y       + WL+   +GSV+YV+FGSMA + ++QM+E+A G K +N  FLWVVR
Sbjct  249   YGLSMYTPKTDVCMKWLSDCDDGSVVYVSFGSMAELKEEQMKEIACGLKKSNHNFLWVVR  308

Query  557   DSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             +SE PK+P++FL +   +K L+V W PQL VL+ KA+GCF TH GWNST+EALSLGVPMV
Sbjct  309   ESEEPKIPKDFLENITKEKGLVVTWCPQLDVLSHKAIGCFMTHCGWNSTLEALSLGVPMV  368

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMK  213
             A+P WTDQ  NAK ++DVW++G + +  E GVV +  +E C++EV+E   GKE+++NA K
Sbjct  369   AIPIWTDQCTNAKYVMDVWEMGIKAQANEKGVVKQEVVEHCIKEVMEGERGKEIRKNATK  428

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  + K+A+ EGG+SD+ I+EF
Sbjct  429   WREVTKKAMDEGGSSDRNINEF  450



>ref|XP_007133505.1| hypothetical protein PHAVU_011G184600g [Phaseolus vulgaris]
 gb|ESW05499.1| hypothetical protein PHAVU_011G184600g [Phaseolus vulgaris]
Length=457

 Score =   436 bits (1121),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/438 (47%), Positives = 303/438 (69%), Gaps = 7/438 (2%)
 Frame = -2

Query  1445  VAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDDAG  1266
             + + YP QGHINP+LQF KRL   G++ TL  T F   ++  +  ++ ++  SDG DD G
Sbjct  15    LVLAYPHQGHINPLLQFSKRLQHDGVRVTLVTTHFYCKTIPKLPASITLEGFSDGFDDGG  74

Query  1265  FLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLFAG  1086
               +A+S+  YL+RF   G +TL++L++R   S +P+ CV+YDSF+PW LD+AK HGL   
Sbjct  75    IAEAESIKAYLDRFWKVGPQTLSELLQRLITSGNPIHCVVYDSFLPWTLDIAKKHGLTCA  134

Query  1085  CFFTQACAVNYVYYCAHHGILQLPV-TSPPVRIPGLPALELRDMPSFIYVHGSYPAYFEL  909
              F TQ   VN VY+    G L++P+  S  + +PGLP L+  D+PSFIY +G+Y A FEL
Sbjct  135   VFLTQPLFVNCVYHHVQKGNLKVPLENSNVISLPGLPLLQPFDLPSFIYSYGTYSASFEL  194

Query  908   VLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIP-IGPTVPSLYLDNRVKNDSEYG  732
             VL+QF N+++A  V  N+FY LE +V D + K+ P +  IGPT+PS++LD R K+D EYG
Sbjct  195   VLNQFSNIKEAHWVLCNTFYDLEKEVADWLMKIWPKLKTIGPTIPSMFLDKRDKDDDEYG  254

Query  731   INLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDS  552
              +L+  +  + + W++ KP+GS++YV+FGS +++ ++QMEE+A+G + +   FLWVVR +
Sbjct  255   FSLFKSE--ECVKWMDEKPKGSIVYVSFGSFSTLSEEQMEEVAFGLQESGCNFLWVVRAT  312

Query  551   ELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMPQ  372
             E+ K+P+ F  + +  L+V W  QLKVL  +AVGCF TH GWNST+EALSLGVPM+AMPQ
Sbjct  313   EMGKIPKGFERNSENGLVVTWCSQLKVLEHEAVGCFVTHCGWNSTLEALSLGVPMIAMPQ  372

Query  371   WTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKWSHL  201
             WTDQT NAKLI D+WK+G RV   + GV     ++  ++E++E   GKE+K+ A++W +L
Sbjct  373   WTDQTTNAKLIEDIWKIGLRVSPDDKGVFRGEALKHAIKEIMETEIGKEIKKKAIQWKNL  432

Query  200   AKEAVSEGGTSDKVIDEF  147
             A ++V EGG+S   I EF
Sbjct  433   AAKSVDEGGSSHMNIREF  450



>emb|CBI33059.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   434 bits (1117),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/440 (50%), Positives = 287/440 (65%), Gaps = 47/440 (11%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + +PYPSQGHINPMLQF KRLV  G K TLA T FIS S    S  + I+ ISDG D
Sbjct  10    AHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLAATRFISKSFVGDSGPITIETISDGYD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             + G  QA+S   YL RF+V GS+TL  LIE+ K+S  PVDCV+YD+F+PWALDVAK  GL
Sbjct  70    EGGSAQAESDGAYLERFRVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKQLGL  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 FFTQ+C VN +YY  H G+L+LP++ P V +PGL  L+  D+PSF+Y++GSYPA+F
Sbjct  130   VGAVFFTQSCTVNDIYYHVHQGMLKLPLSEPEVVVPGLFPLQACDLPSFVYLYGSYPAFF  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             ++V++QF N+EK D VF N+FYKLE +VVD M+K+ P+  IGPT+PS+YLD R+ +D +Y
Sbjct  190   DMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGPTLPSVYLDKRLGDDKDY  249

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+N+        ++WL++KP GSV+Y                       +N YFL VVR+
Sbjct  250   GLNMLKPVTGACMEWLDSKPNGSVVYA----------------------SNAYFLVVVRE  287

Query  554   SELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
             SE  KLP+NF  +  +K L+V+W PQL                     EALSLGVPMV  
Sbjct  288   SEQAKLPQNFKEETAEKGLVVSWCPQL---------------------EALSLGVPMVVA  326

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKWS  207
             P WTDQ  NAK + DVW +G R R    G+V R  +E C+ +V+     KE+K NAMKW 
Sbjct  327   PLWTDQPTNAKFVEDVWGIGLRARADHKGIVRREVLEDCIGKVMGSDGLKEIKNNAMKWK  386

Query  206   HLAKEAVSEGGTSDKVIDEF  147
             +LA+EAV EGG+SDK IDEF
Sbjct  387   NLAREAVDEGGSSDKCIDEF  406



>ref|XP_003624250.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|ABN08986.1| UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula]
 gb|AES80468.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=465

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/439 (48%), Positives = 296/439 (67%), Gaps = 5/439 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H + +PYP+QGHINPMLQF K L  +G++ TL  T +   +++ V  +  I+ ISDG D+
Sbjct  11    HCLVLPYPAQGHINPMLQFSKDLQHEGIRVTLVTTLYHRKTLQSVPPSFTIETISDGFDN  70

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              G  +A     YL RF   G KTLA LIE++ +    VDCVIYDSF PWALDVAK  G+ 
Sbjct  71    GGVEEAGGYKAYLGRFWQVGPKTLAQLIEKFGSLGDKVDCVIYDSFFPWALDVAKRFGIV  130

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
                + TQ  +VN +YY  H   L++P+    + +P LP L+L DM SF    G  P   +
Sbjct  131   GVTYLTQNMSVNSIYYHVHLEKLKVPLIEDVISLPLLPRLDLGDMSSFFSTKGENPVLLD  190

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVI-PIGPTVPSLYLDNRVKNDSEY  735
             L++ QF N++KAD V  N+FY+LE +VVD   K+ P   PIGP++PS++LDNR K+D +Y
Sbjct  191   LLVGQFSNIDKADWVLCNTFYELEKEVVDWTMKIWPKFRPIGPSIPSMFLDNRHKDDEDY  250

Query  734   GINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRD  555
             G+  +  +  K ++WLN KP+GSV+YV+FGSM S+D++Q++ELA+G +++ +YFLWVVR 
Sbjct  251   GVAQFKYN-EKCMEWLNDKPKGSVVYVSFGSMVSLDEEQIQELAYGLRDSGSYFLWVVRA  309

Query  554   SELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMP  375
             SE  KLP++F  +  K+L+V W  QLKVLA +A+GCF TH GWNST+EALSLGVP +A+P
Sbjct  310   SEENKLPKDFEKESKKSLVVTWCSQLKVLAHEAIGCFVTHCGWNSTLEALSLGVPTIAIP  369

Query  374   QWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAMKWSH  204
             QW+DQ  NAK I DVWK+G R  + E  +V + + + C+ E++   +GKE+K NA +W  
Sbjct  370   QWSDQRTNAKFIADVWKMGIRAPIDEKQIVRQDKFKDCILEIMKGEKGKEIKSNATQWKT  429

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LA  A  E G+S K I EF
Sbjct  430   LAVGAFEEHGSSQKNIIEF  448



>ref|XP_010908641.1| PREDICTED: crocetin glucosyltransferase 2-like [Elaeis guineensis]
Length=456

 Score =   435 bits (1119),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 219/441 (50%), Positives = 290/441 (66%), Gaps = 7/441 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H + +PYP+QGHINPMLQF KRL S GL+ TL  T F+ ++ +P    V +  ISDG D 
Sbjct  9     HALFLPYPAQGHINPMLQFAKRLSSHGLRATLVTTRFLLSTTRPELGPVALASISDGFDR  68

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF +A S P Y +RF+  GS TL DL+   + +  PV  ++YDS +PWA DV + HGL 
Sbjct  69    GGFAEAGSGPAYQDRFESVGSTTLDDLVRSERAAGRPVRVLVYDSHLPWARDVGERHGLV  128

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIY-VHGSYPAYF  915
                 FTQ C+VN VY     G L++PVT  PV +PGLP LE   +PSF+     +Y    
Sbjct  129   TVSLFTQPCSVNIVYGLVKEGRLRMPVTE-PVSLPGLPRLEPDCLPSFVVEADLAYAWCL  187

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEY  735
             + +L Q+ N+EKAD VFVNS Y+L+ +  D M  +     IGP VPS YLDNR+ +DS Y
Sbjct  188   KALLEQYKNLEKADVVFVNSSYELQPEEADYMRSIWRAKIIGPMVPSSYLDNRLPSDSHY  247

Query  734   GINLYHMDPTK-SIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             G +L H       + WL++ P  SV+YV+FG++A++D  QM E+A+G  N+   FLWVVR
Sbjct  248   GFDLQHSPSINLCMQWLDSGPSNSVVYVSFGTVAALDPSQMVEIAFGLLNSGKRFLWVVR  307

Query  557   DSELPKLPENFLG-DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
              SE  K+PEN      ++ L+V+W PQ+ VL+ KAVGCF TH GWNST+E ++LGVPMV 
Sbjct  308   SSESFKIPENMKDLPSERGLVVSWIPQMAVLSHKAVGCFLTHCGWNSTMEGITLGVPMVG  367

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMKW  210
             +PQWTDQ MNAK I DVW+VG R R  E G+V R E+E CVR V+EG   +E++ NA KW
Sbjct  368   VPQWTDQPMNAKYIEDVWRVGVRARANEKGLVGREEVERCVRVVMEGERSEEIRRNARKW  427

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
               LAK++V EGG+SD+ I EF
Sbjct  428   GELAKKSVEEGGSSDRNIAEF  448



>ref|XP_003613349.1| UDP-glucose glucosyltransferase [Medicago truncatula]
Length=627

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 209/439 (48%), Positives = 304/439 (69%), Gaps = 6/439 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ IPYP+QGHI+P++QF KRLVSKG+KTT A T +   S+   +  V ++ ISDG D+
Sbjct  11    HVLVIPYPAQGHISPLIQFSKRLVSKGIKTTFATTHYTVQSI--TAPNVSVEPISDGFDE  68

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
             +GF QA++V  +L  F+  GS +L+++I++Y+ + +P+ C++YDSF+PWALDVAK HG++
Sbjct  69    SGFTQANNVELFLTSFKTNGSNSLSNIIQKYQKTSTPITCIVYDSFLPWALDVAKQHGIY  128

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYFE  912
                FFT + AV  ++   HHG++++PV   P+ +P LP L  RD+PSFI    SYPAY  
Sbjct  129   GAAFFTNSAAVCNIFCRIHHGLIEIPVDELPLVVPDLPPLNSRDLPSFIRFPESYPAYMA  188

Query  911   LVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSEYG  732
             + L QF N+++AD +FVN+F  LE +VV  ++++ P   IGP VPS YLD R+K D  YG
Sbjct  189   MKLSQFSNLDQADWMFVNTFEALEGEVVKGLTELFPAKMIGPMVPSAYLDGRIKGDKGYG  248

Query  731   INLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVRDS  552
              NL+       I+WLN+KP  SV+Y++FGSM S+  +Q+EELA G K +   FLWV+R+ 
Sbjct  249   ANLWKPLSEYCINWLNSKPSQSVVYISFGSMVSLTSEQIEELALGLKESEVNFLWVLREL  308

Query  551   ELPKLPENFLG-DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAMP  375
             E  KLP+ +     +K +IV W  QL++LA  AVGCF TH GWNST+E+LSLGVP+V +P
Sbjct  309   EQGKLPKGYKDFIKEKGIIVTWCNQLELLAHDAVGCFVTHCGWNSTLESLSLGVPVVCLP  368

Query  374   QWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGKE---MKENAMKWSH  204
             QW DQ  +AK + ++W+VG R +  E+GVV R E    ++ V+E +    ++ NA +W  
Sbjct  369   QWADQLPDAKFLEEIWEVGVRPKEDENGVVKREEFMLSLKVVMESERSEVIRRNASEWKK  428

Query  203   LAKEAVSEGGTSDKVIDEF  147
             LA++AVSE G+S+K IDEF
Sbjct  429   LARDAVSERGSSNKNIDEF  447



>ref|XP_007222137.1| hypothetical protein PRUPE_ppa005722mg [Prunus persica]
 gb|EMJ23336.1| hypothetical protein PRUPE_ppa005722mg [Prunus persica]
Length=447

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 303/442 (69%), Gaps = 11/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDA---VGIDIISDG  1281
             HI+ +P P QGHINPM QF KRL SKGL+ TL +T       +P+      V I+ I   
Sbjct  3     HILVVPLPLQGHINPMFQFSKRLASKGLRVTL-VTISSDTHHEPIETQLSLVKIESIYAA  61

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              ++A  + A++   +L   Q   SK L +LI + ++   P+ C+IYDS M WALD+AK  
Sbjct  62    SEEADKINAENKMQWL---QNILSKRLPELISKQESIGYPISCIIYDSAMTWALDMAKGL  118

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
             G+    FFT +CAV  VY   H G+L +P+   P+ +PGLP LE  D+PSFIY  GSYP+
Sbjct  119   GIAGASFFTHSCAVGTVYCNVHQGVLSVPLKEGPILLPGLPLLEPHDLPSFIYDPGSYPS  178

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             + +LV+ +F N+  AD +F NSF  LE +VV  M    P+  IGPT+PS+YLD R+++D 
Sbjct  179   FLKLVVGRFSNITDADWIFWNSFDCLEQEVVSWMRTRLPIKTIGPTLPSMYLDKRLEDDR  238

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
             +YG NL+  +    I WL +K  G+V+YV+FGSMA++++KQM+ELA G K + T FLWVV
Sbjct  239   DYGFNLFTPNIDTCIKWLESKDTGTVVYVSFGSMANLEEKQMQELALGLKRSKTNFLWVV  298

Query  560   RDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE+ KLP NF     +K L+VNW PQL+VLA KAVGCF TH GWNST+EALS GVPMV
Sbjct  299   RESEIQKLPSNFEEQTSEKGLVVNWCPQLQVLAHKAVGCFMTHCGWNSTLEALSSGVPMV  358

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAMK  213
             AMPQWTDQ  NAK + D WKVG RV+V + G+V++ EIE C+ +V+EG+   E+K N+M+
Sbjct  359   AMPQWTDQLTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAQVMEGERGNEIKRNSMR  418

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LAKEAV+EGG+SDK I+EF
Sbjct  419   WRELAKEAVAEGGSSDKNIEEF  440



>gb|KEH25950.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   432 bits (1112),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 209/441 (47%), Positives = 300/441 (68%), Gaps = 6/441 (1%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDI--ISDGC  1278
             HI+  PYP QGHINPMLQF KRL  KG+K TL  T  I N +    D   I+   ISDG 
Sbjct  11    HILVFPYPLQGHINPMLQFSKRLSQKGVKITLVNTISIWNKINNNIDLNSIETESISDGY  70

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D+ G   A+++  Y + F   G K+L+ L+ + ++S++PVDCV+YD+F+ W  DV+KS  
Sbjct  71    DNGGMSSAENMESYKDTFWKVGPKSLSQLLHKLQSSNNPVDCVVYDAFLNWTFDVSKSFE  130

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAY  918
             +    F TQAC+VN + + A    ++LP++   + +PGLP L+  D+PSF+Y +G+YP Y
Sbjct  131   IPVAVFLTQACSVNTINFHAFMKWIELPISKSEIVLPGLPTLQDADLPSFLYQYGTYPGY  190

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
             F+++ +QF  +++ D V VN+FY+LE +VVD M+K   +  IGP +PS++LD R+++D++
Sbjct  191   FDILTNQFSKIDQVDWVLVNTFYELEPEVVDWMAKKWRLKTIGPCIPSMFLDKRLEDDND  250

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YGI+ +  +    I WL+ KP+ SV+YV+FGS+A + + Q +E+A+G ++   YFLWVVR
Sbjct  251   YGISTFGPNSEACIKWLDNKPKDSVVYVSFGSLAGLSEDQTKEMAYGLRDCGMYFLWVVR  310

Query  557   DSELPKLPENFLGDD-DKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVA  381
             DSE  K+P+  L    +K LIVNW  QL+VL  +AVGCF TH GWNST+EALS+GV ++A
Sbjct  311   DSEKSKVPKEMLESSIEKGLIVNWCSQLQVLTHEAVGCFVTHCGWNSTLEALSVGVLVIA  370

Query  380   MPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLE---GKEMKENAMKW  210
             MP WTDQ  NAK IVDVWK+G +    E GVV R  I  C++E++E   G  MK+NAMKW
Sbjct  371   MPLWTDQITNAKFIVDVWKIGVKAHADEKGVVRRETIMDCLKEIMEIEKGDAMKKNAMKW  430

Query  209   SHLAKEAVSEGGTSDKVIDEF  147
              +LA+ +V E G+S K I EF
Sbjct  431   KNLARISVGEDGSSHKNIVEF  451



>ref|XP_006355936.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Solanum tuberosum]
Length=469

 Score =   432 bits (1112),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 304/443 (69%), Gaps = 10/443 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ +PYPSQGHINP+LQF KRL SKG+K+T+A T +  NS+   S  + ++ ISDG D+
Sbjct  9     HVILVPYPSQGHINPLLQFAKRLASKGVKSTIATTKYTVNSI--YSPNISVEPISDGFDE  66

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
              GF QA +   +L  F+  GS+TL+ +I +Y+NS  P+ C++YDSF+ WALDVAK HG++
Sbjct  67    GGFTQAQNTDVFLKSFRENGSRTLSQIITKYENSTHPISCIVYDSFLSWALDVAKKHGIY  126

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVT---SPPVRIPGLPALELRDMPSFIYVHGSYPA  921
                FFT +  V  V+   HHG   LPV    + P+ +PGLP L   D+P FI    SYPA
Sbjct  127   GASFFTNSATVCAVFAHIHHGTFSLPVKIEENEPLLLPGLPCLYPIDVPGFIREPESYPA  186

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + + QF N+E AD +F NSF +LE ++   +SK  P   IGP VPS YLD R++ND 
Sbjct  187   YLAMKMSQFSNLENADWIFDNSFQELEGEIARGISKFWPAKLIGPMVPSSYLDGRIENDK  246

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     + ++WL TKP+ SVIY++FGSM S+  KQMEE+A+     N  FLWVV
Sbjct  247   GYGASLWKPLSEECLNWLKTKPKQSVIYISFGSMVSLTPKQMEEIAYALIGINMNFLWVV  306

Query  560   RDSELPKLPENFL-GDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             RD+E  KLP+ F+   + K LIV+W  QLK LA++A+GCF TH GWNST+E LSLGVPMV
Sbjct  307   RDTEKCKLPKGFIESTEGKGLIVSWCNQLKTLANQAIGCFVTHCGWNSTLEGLSLGVPMV  366

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGE-DGVVSRGEIEGCVREVLEGK---EMKENAM  216
             AMPQW+DQ  +AK I ++W++G R ++ E  G+V R E+  C++EV++G+   E++ NA 
Sbjct  367   AMPQWSDQMTDAKFIDEIWEIGVRPKLDELLGIVKREELLFCLKEVMKGEKSYEIRRNAT  426

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             K  +LAK+ VSEGG+SDK I+EF
Sbjct  427   KLRNLAKKTVSEGGSSDKTINEF  449



>ref|XP_003543857.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Glycine max]
Length=457

 Score =   432 bits (1111),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 208/440 (47%), Positives = 292/440 (66%), Gaps = 6/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + + YP QGHINP+LQF K L  +G + TL    F  N+++ V  +  I+ ISDG D
Sbjct  10    AHCLVLAYPLQGHINPILQFSKLLEHQGSRITLVTYRFYQNNLQRVPPSFAIETISDGFD  69

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               G + A+S   Y++R    GS++LA+L+E+   S + VDCVIYDSF PWALDVAKS G+
Sbjct  70    QGGPIHAESHKAYMDRSTQVGSESLAELLEKLGQSKNHVDCVIYDSFFPWALDVAKSFGI  129

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 F TQ   VN +YY  H G LQ+P+T     +P LP L+L DMPSF+  +  +P Y 
Sbjct  130   MGAVFLTQNMTVNSIYYHVHLGKLQVPLTEHEFSLPSLPKLQLEDMPSFLLTYVEHPYYL  189

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIP-IGPTVPSLYLDNRVKNDSE  738
             +  + QF N++KAD V  N+FY+L+ +V + ++K+ P    IGP +PS++LD R ++D +
Sbjct  190   DFFVDQFSNIDKADWVLCNTFYELDKEVANWITKIWPKFRNIGPNIPSMFLDKRHEDDKD  249

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+  +  +  + I+WLN KP+GSV+YV+FGS+A +  +QMEELA+G    + YFLWVVR
Sbjct  250   YGVAQF--ESEECIEWLNDKPKGSVVYVSFGSIAMLGGEQMEELAYGLNECSNYFLWVVR  307

Query  557   DSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
              SE  KLP  F    +K LIV W  QLKVLA +A+GCF TH GWNST+E L +GVP +A+
Sbjct  308   ASEEIKLPRGFEKKSEKGLIVTWCSQLKVLAHEAIGCFVTHCGWNSTLETLCIGVPTIAI  367

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAMKWS  207
             P W+DQT NAKL+ DVWK+G R +  E  +V R  ++ C+R+V+   EGK +K N ++W 
Sbjct  368   PHWSDQTTNAKLMADVWKIGIRAQTNEKKIVRRETLKQCIRDVMESEEGKVIKSNVIQWK  427

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LA +A+ EGG+S + I EF
Sbjct  428   TLALKAIGEGGSSYQNIIEF  447



>ref|XP_010069572.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
Length=467

 Score =   432 bits (1112),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 225/447 (50%), Positives = 298/447 (67%), Gaps = 11/447 (2%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKP-VSDAVGIDIISDGC  1278
             AH++ +PYP+QGHINPMLQF KRLVS+GLK TLA+T  ++ SM    S  + ++ ISDG 
Sbjct  10    AHVLVLPYPAQGHINPMLQFSKRLVSRGLKATLALTVHLTGSMHADPSSFIDLETISDGH  69

Query  1277  DDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHG  1098
             D  GF++A+S   Y    QV GS+TLA+LI +   S  P+D VIYD F+PWALDVAK   
Sbjct  70    DVGGFMEAESNEAYQMDLQVVGSRTLAELIHKLDRSGRPLDAVIYDGFLPWALDVAKQCD  129

Query  1097  LFAGCFFTQACAVNYVYYCAHHGILQLPV--TSPPVRIPGLPALELRDMPSFIYVHGSYP  924
                  FFTQ CAVN +YY    G+L LP+  +   VR+PGLP L+  + PS++Y  G YP
Sbjct  130   KLGVVFFTQTCAVNNIYYHVQRGLLPLPLPLSEGSVRVPGLPPLKPWEAPSYVYELGLYP  189

Query  923   AYFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMS-KMSPVIPIGPTVPSLYLDNRVKN  747
             A++++V++QF  V+ AD V  ++FY+LE +VVD MS  + P+  +GPT+PSLYLD R+ N
Sbjct  190   AFYDMVINQFTTVDDADFVLFDTFYELEKEVVDWMSANLWPLKTVGPTLPSLYLDKRLPN  249

Query  746   DSEYGINLYHMDPTKSID-WLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFL  570
             D+ YG NL+    T ++  WL   P  SV+YV+FGSMA +D  Q  ELA G       F+
Sbjct  250   DTAYGANLFTPTTTSTVSAWLRRHPPRSVVYVSFGSMADLDPSQFAELAHGLALAGHPFI  309

Query  569   WVVRDSELPKLPENFLGD--DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLG  396
             W+VR +E  KLP + +     ++A+I+ W  QL+VL S A+GCF TH G NS IEA+ LG
Sbjct  310   WIVRSTEQHKLPRDLMDSIPSEEAIILPWCNQLEVLESDAIGCFVTHCGLNSVIEAICLG  369

Query  395   VPMVAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL----EGKEMK  228
             VPMVAMPQWTDQ  NAK + DVW+VG R R  E GVV R E+E  V EV+     G+EM 
Sbjct  370   VPMVAMPQWTDQPTNAKFVEDVWRVGVRARADEAGVVGREEVERRVTEVVGRGERGREMA  429

Query  227   ENAMKWSHLAKEAVSEGGTSDKVIDEF  147
             E+A +W   AK A+ EGG+SD+ IDEF
Sbjct  430   ESARRWMAAAKAAIGEGGSSDRNIDEF  456



>ref|XP_010695870.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Beta vulgaris subsp. 
vulgaris]
Length=480

 Score =   433 bits (1113),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 211/443 (48%), Positives = 296/443 (67%), Gaps = 9/443 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H+V +PYPSQGHINP+LQF KRL SKG+K TLA T    +S+  + + V ++ ISDG DD
Sbjct  24    HVVVVPYPSQGHINPLLQFAKRLASKGMKATLATTKNTISSISYLQN-VAVEPISDGYDD  82

Query  1271  AGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGLF  1092
                 QA S   +LN F+  GSKTLA LI+ Y+NS +PV CV+YD+F+PWALDVAK +GL 
Sbjct  83    GVHPQAGSEDVFLNSFKSNGSKTLARLIDSYQNSSAPVTCVVYDAFLPWALDVAKEYGLL  142

Query  1091  AGCFFTQACAVNYVYYCAHHGILQLPVTSPPVR--IPGLPALELRDMPSFIYVHGSYPAY  918
                FFT + +V  ++ C   G++ LP+    V+  +P +P  +  D+P+F+    SYPAY
Sbjct  143   GAAFFTNSASVCAIFACVSRGLINLPLEPDQVKCALPKMPLFKGNDLPTFLRKPESYPAY  202

Query  917   FELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDSE  738
               + L QF N+  AD VF NSF  LE++V++ ++   P   IGP VPS YLD R++ D  
Sbjct  203   LAMKLSQFTNLHLADYVFCNSFQDLESEVIEGVTDKWPAKLIGPMVPSAYLDGRIEGDIG  262

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG +L+     K  +WL +KP  SVIY++FGSM S+ Q+QMEE+A   K +N YFLWVVR
Sbjct  263   YGSSLWKPLSEKCKEWLQSKPTKSVIYISFGSMVSLTQEQMEEIALALKESNYYFLWVVR  322

Query  557   DSELPKLPENF---LGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             +S++ KLP+ F   +   DK +IV W  QL++LA +A  CF TH GWNST+E LSLG+PM
Sbjct  323   ESQISKLPKEFQAEISTTDKGMIVTWCNQLEILAHEATACFVTHCGWNSTLEGLSLGIPM  382

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEGK---EMKENAM  216
             + +PQW+DQ  +AK I +VW VG   +  E G++ +  +  C +E++EGK   E +ENAM
Sbjct  383   IGIPQWSDQLPDAKFIEEVWGVGVWPKEDEKGMIRKENLRDCFKEIMEGKRSRERRENAM  442

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
             KW  L+K+AV+ GG+SD  +++F
Sbjct  443   KWRELSKKAVNYGGSSDNHVEDF  465



>ref|XP_007157504.1| hypothetical protein PHAVU_002G075200g [Phaseolus vulgaris]
 gb|ESW29498.1| hypothetical protein PHAVU_002G075200g [Phaseolus vulgaris]
Length=465

 Score =   432 bits (1111),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 211/442 (48%), Positives = 302/442 (68%), Gaps = 9/442 (2%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCDD  1272
             H++ +PYP+QGHINP+LQF KRL SKG+K T+A T + +NS+   +  + ++ ISDG D 
Sbjct  10    HVLLLPYPAQGHINPILQFAKRLASKGVKATVATTHYTANSI--AAPNITVEPISDGFDR  67

Query  1271  AGFLQA-DSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
             AGF +A D V  +L+ F+  GS+TL+ LI ++  + SPV C++YDSF PWALDVAK HG+
Sbjct  68    AGFAEAKDDVQLFLSSFRTNGSRTLSQLIHKHHQTPSPVTCIVYDSFFPWALDVAKEHGV  127

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSP--PVRIPGLPALELRDMPSFIYVHGSYPA  921
             +   FFT + AV  ++   H G+++LPV +   P+R+PGLP LE R +PSF+    SYPA
Sbjct  128   YGAAFFTNSAAVCSIFCRIHRGLIELPVGAEDLPLRVPGLPPLESRALPSFVRFPQSYPA  187

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIPIGPTVPSLYLDNRVKNDS  741
             Y  + L QF N+++AD +FVN+F  LE+QVV+ ++++ P   IGP VPS YLD R+K D 
Sbjct  188   YMAMKLSQFSNLDEADWMFVNTFEALESQVVEGLTELFPAKMIGPMVPSAYLDGRIKGDK  247

Query  740   EYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVV  561
              YG +L+     +   WL  K   SV+Y++FGSM S+  +Q+EE+AWG K +   FLWV+
Sbjct  248   GYGASLWKPLNEECSTWLEEKAPQSVVYISFGSMVSLKAEQVEEVAWGLKESGVSFLWVL  307

Query  560   RDSELPKLPENFLG-DDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMV  384
             R+SE  KLP  +     DK LIV W  QL++LA +A GCF TH GWNST+E+LSLGVP+V
Sbjct  308   RESEQGKLPCGYRDLVKDKGLIVTWCNQLELLAHQATGCFVTHCGWNSTLESLSLGVPVV  367

Query  383   AMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVLEG---KEMKENAMK  213
              +PQW DQ  +AK + ++W+VG   +  E+G+V + E    ++ V+EG   +E++ NA K
Sbjct  368   CLPQWADQLPDAKFLDEIWEVGLWPKEDENGIVKKQEFVSSLKVVMEGERSEEIRRNASK  427

Query  212   WSHLAKEAVSEGGTSDKVIDEF  147
             W  LA+E V EGG+SDK I++F
Sbjct  428   WKKLAREVVGEGGSSDKHINQF  449



>ref|XP_004162644.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cucumis sativus]
Length=457

 Score =   432 bits (1110),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 211/443 (48%), Positives = 297/443 (67%), Gaps = 12/443 (3%)
 Frame = -2

Query  1451  HIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFI---SNSMKPVSDAVGIDIISDG  1281
             HI+ + YPSQGHINPMLQF K L  +GLK TL +T FI   S+S+ P      I  ISDG
Sbjct  13    HILIVTYPSQGHINPMLQFSKHLYKRGLKITLILTNFIARVSHSLPPFP----ILTISDG  68

Query  1280  CDDAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSH  1101
              D  GF  A+S   YL+ F+  GS++L +L+    +S SP DC+IYDSF+PW LDVA   
Sbjct  69    YDHGGFASAESAQTYLDSFRRFGSQSLRELLRHLSSSASPADCLIYDSFLPWVLDVANEL  128

Query  1100  GLFAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPA  921
              +    FFTQ+CAV  +YY  H G++ LP+ +  + IPGLP ++  + PSFIY  G+YPA
Sbjct  129   QIATAVFFTQSCAVANIYYHVHKGLIDLPLPNREIEIPGLPLMKPAEFPSFIYQLGTYPA  188

Query  920   YFELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVI-PIGPTVPSLYLDNRVKND  744
             Y++L+++Q+ NV+KAD +  N+F +LE +V++ + K+ P I  IGP++PS YLD R++ D
Sbjct  189   YYDLLVNQYANVDKADWILCNTFEELEREVLEYLKKIWPSIRAIGPSIPSGYLDGRIEGD  248

Query  743   SEYGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWV  564
              EYG+++  +D   S  WL  + +GSV+YV+FGS+  V  +QMEE+A   K+ +  FLWV
Sbjct  249   REYGMSILDLDGDVSRKWLEGRRKGSVVYVSFGSIGKVAAEQMEEMAGCLKSIDRQFLWV  308

Query  563   VRDSELPKLPENFLGD-DDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPM  387
             VR SE+ KLP+NF+ + ++K L+V+W  QL+VL  +A+GCF TH GWNST+E +SLGVPM
Sbjct  309   VRPSEVVKLPKNFMVETEEKGLVVSWCQQLEVLTHEAIGCFVTHCGWNSTLEGVSLGVPM  368

Query  386   VAMPQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAM  216
             V +P WTDQT NAK I DVWKVG +     DGVV R  +  C+ EV+    G E+++NA 
Sbjct  369   VTVPGWTDQTTNAKFITDVWKVGLKALANSDGVVKREVLLQCIEEVMVGERGSEIRQNAT  428

Query  215   KWSHLAKEAVSEGGTSDKVIDEF  147
              W  + +     GG+ + V+DEF
Sbjct  429   IWKTMTQNTFESGGSFNGVVDEF  451



>gb|KHN13207.1| UDP-glycosyltransferase 74E1 [Glycine soja]
Length=452

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/440 (47%), Positives = 292/440 (66%), Gaps = 6/440 (1%)
 Frame = -2

Query  1454  AHIVAIPYPSQGHINPMLQFCKRLVSKGLKTTLAITTFISNSMKPVSDAVGIDIISDGCD  1275
             AH + + YP QGHINP+LQF K L  +G + TL    F  N+++ V  +  I+ ISDG D
Sbjct  5     AHCLVLAYPLQGHINPILQFSKLLEHQGSRITLVTYRFYQNNLQRVPPSFAIETISDGFD  64

Query  1274  DAGFLQADSVPDYLNRFQVAGSKTLADLIERYKNSDSPVDCVIYDSFMPWALDVAKSHGL  1095
               G + A+S   Y++R    GS++LA+L+E+   S + VDCVIYDSF PWALDVAKS G+
Sbjct  65    QGGPIHAESHKAYMDRSTQVGSESLAELLEKLGQSKNHVDCVIYDSFFPWALDVAKSFGI  124

Query  1094  FAGCFFTQACAVNYVYYCAHHGILQLPVTSPPVRIPGLPALELRDMPSFIYVHGSYPAYF  915
                 F TQ   VN +YY  H G LQ+P+T     +P LP L+L DMPSF+  +  +P Y 
Sbjct  125   MGAVFLTQNMTVNSIYYHVHLGKLQVPLTEHEFSLPSLPKLQLEDMPSFLLTYVEHPYYL  184

Query  914   ELVLHQFLNVEKADCVFVNSFYKLEAQVVDTMSKMSPVIP-IGPTVPSLYLDNRVKNDSE  738
             +  + QF N++KAD V  N+FY+L+ +V + ++K+ P    IGP +PS++LD R ++D +
Sbjct  185   DFFVDQFSNIDKADWVLCNTFYELDKEVANWITKIWPKFRNIGPNIPSMFLDKRHEDDKD  244

Query  737   YGINLYHMDPTKSIDWLNTKPEGSVIYVAFGSMASVDQKQMEELAWGFKNTNTYFLWVVR  558
             YG+  +  +  + I+WLN KP+GSV+YV+FGS+A +  +QMEELA+G    + YFLWVVR
Sbjct  245   YGVAQF--ESEECIEWLNDKPKGSVVYVSFGSIAMLGGEQMEELAYGLNECSNYFLWVVR  302

Query  557   DSELPKLPENFLGDDDKALIVNWSPQLKVLASKAVGCFFTHGGWNSTIEALSLGVPMVAM  378
              SE  KLP  F    +K LIV W  QLKVLA +A+GCF TH GWNST+E L +GVP +A+
Sbjct  303   ASEEIKLPRGFEKKSEKGLIVTWCSQLKVLAHEAIGCFVTHCGWNSTLETLCIGVPTIAI  362

Query  377   PQWTDQTMNAKLIVDVWKVGKRVRVGEDGVVSRGEIEGCVREVL---EGKEMKENAMKWS  207
             P W+DQT NAKL+ DVWK+G R +  E  +V R  ++ C+R+V+   EGK +K N ++W 
Sbjct  363   PHWSDQTTNAKLMADVWKIGIRAQTNEKKIVRRETLKQCIRDVMESEEGKVIKSNVIQWK  422

Query  206   HLAKEAVSEGGTSDKVIDEF  147
              LA +A+ EGG+S + I EF
Sbjct  423   TLALKAIGEGGSSYQNIIEF  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4566745072624