BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c111774_g1_i1 len=119 path=[1:0-118]

Length=119
                                                                      Score     E

ref|WP_029759554.1|  hypothetical protein                             48.9    5e-06   
gb|KHK14003.1|  RNA-directed DNA polymerase                           48.5    7e-06   
gb|EDN65341.1|  conserved hypothetical protein                        47.8    9e-06   Beggiatoa sp. PS
ref|WP_032529179.1|  hypothetical protein                             47.0    3e-05   
ref|WP_032525483.1|  hypothetical protein                             46.2    4e-05   
ref|WP_032631627.1|  endonuclease                                     47.8    5e-05   
gb|EAX05005.1|  hCG1820778                                            46.2    5e-05   
gb|KHK25500.1|  recombinase                                           47.4    1e-04   
ref|WP_029549493.1|  endonuclease                                     46.2    1e-04   
gb|KAK51372.1|  PF08333 family protein                                47.0    2e-04   
gb|ETO03995.1|  hypothetical protein RFI_33407                        47.0    2e-04   
gb|AIE45854.1|  ORF2                                                  47.4    2e-04   
gb|EPT52249.1|  hypothetical protein SAG0051_02725                    47.0    2e-04   
ref|WP_008930570.1|  RNA-directed DNA polymerase                      47.0    2e-04   
ref|WP_029550595.1|  endonuclease                                     46.2    2e-04   
ref|WP_039678096.1|  endonuclease                                     47.0    2e-04   
ref|WP_001897351.1|  endonuclease                                     47.0    2e-04   
gb|KHM23816.1|  endonuclease                                          47.0    2e-04   
ref|WP_032459752.1|  endonuclease                                     47.0    2e-04   
gb|EPT66614.1|  endonuclease                                          46.6    3e-04   
pir||B34087  hypothetical protein (L1H 3' region) - human             46.6    3e-04
gb|ELR54311.1|  hypothetical protein M91_18376                        45.8    4e-04   
gb|ELR58139.1|  hypothetical protein M91_02702                        45.8    4e-04   
gb|ELR57077.1|  hypothetical protein M91_12176                        45.8    5e-04   
gb|ELR53834.1|  hypothetical protein M91_03393                        45.8    5e-04   
gb|ELR50830.1|  hypothetical protein M91_07955                        45.8    5e-04   
gb|ELR62772.1|  hypothetical protein M91_11495                        45.8    5e-04   
gb|ELR57783.1|  hypothetical protein M91_04059                        45.8    5e-04   
gb|ELR58001.1|  hypothetical protein M91_20110                        45.8    5e-04   
gb|ELR47881.1|  hypothetical protein M91_03766                        45.8    5e-04   
gb|ELR59242.1|  hypothetical protein M91_06506                        45.8    5e-04   
gb|ELR60383.1|  hypothetical protein M91_04365                        45.8    5e-04   
gb|KHK05566.1|  groupII intron-encoded protein                        45.1    5e-04   
gb|ELR56608.1|  hypothetical protein M91_06993                        45.8    6e-04   
gb|ELR46636.1|  hypothetical protein M91_20043                        45.8    6e-04   
gb|ELR47131.1|  hypothetical protein M91_12925                        45.8    6e-04   
gb|ELR54602.1|  LINE-1 reverse transcriptase-like protein             45.8    6e-04   
gb|ELR58543.1|  hypothetical protein M91_01925                        45.8    6e-04   
gb|ELR59187.1|  hypothetical protein M91_00785                        45.8    6e-04   
gb|ELR48604.1|  hypothetical protein M91_19605                        45.8    6e-04   
gb|ELR47876.1|  hypothetical protein M91_20604                        45.8    6e-04   
gb|ELR48591.1|  hypothetical protein M91_17934                        45.8    6e-04   
gb|ELR54609.1|  hypothetical protein M91_07551                        45.8    6e-04   
gb|ELR55211.1|  hypothetical protein M91_18560                        45.8    6e-04   
gb|ELR61551.1|  hypothetical protein M91_14419                        45.8    6e-04   
gb|ELR56451.1|  hypothetical protein M91_09901                        45.8    6e-04   
gb|ELR50258.1|  hypothetical protein M91_08673                        45.8    6e-04   
gb|ELR45185.1|  hypothetical protein M91_00772                        45.8    6e-04   
gb|ELR44776.1|  hypothetical protein M91_14132                        45.8    6e-04   
gb|ELR57788.1|  hypothetical protein M91_08672                        45.8    6e-04   
gb|ELR60459.1|  hypothetical protein M91_06316                        45.8    6e-04   
gb|ELR46271.1|  hypothetical protein M91_17975                        45.8    6e-04   
gb|ELR62420.1|  hypothetical protein M91_10472                        45.8    6e-04   
gb|ELR62244.1|  hypothetical protein M91_20933                        45.8    6e-04   
gb|ELR60873.1|  hypothetical protein M91_12677                        45.8    6e-04   
gb|ELR59055.1|  hypothetical protein M91_11778                        45.8    6e-04   
gb|ELR54676.1|  hypothetical protein M91_15199                        45.8    6e-04   
gb|ELR58510.1|  hypothetical protein M91_05513                        45.8    6e-04   
gb|ELR51705.1|  hypothetical protein M91_10420                        45.8    6e-04   
gb|ELR53960.1|  hypothetical protein M91_16134                        45.8    6e-04   
gb|ELR48539.1|  hypothetical protein M91_08335                        45.8    6e-04   
gb|ELR55746.1|  hypothetical protein M91_14620                        45.8    6e-04   
gb|ELR55573.1|  hypothetical protein M91_15722                        45.8    6e-04   
gb|AAY53484.1|  endonuclease reverse transcriptase                    45.8    6e-04   Bos taurus [bovine]
gb|ELR58330.1|  hypothetical protein M91_20393                        45.8    6e-04   
gb|ELR49012.1|  hypothetical protein M91_01141                        45.8    6e-04   
gb|ELR50089.1|  hypothetical protein M91_20222                        45.8    6e-04   
gb|ELR57344.1|  hypothetical protein M91_03782                        45.8    6e-04   
gb|ELR48628.1|  hypothetical protein M91_07595                        45.8    6e-04   
gb|ELR61814.1|  hypothetical protein M91_08065                        45.8    6e-04   
gb|ELR58410.1|  Retrovirus-related Pol polyprotein LINE-1             45.8    6e-04   
gb|ELR48978.1|  hypothetical protein M91_07252                        45.8    6e-04   
gb|ELR48937.1|  hypothetical protein M91_02115                        45.8    6e-04   
gb|ELR48758.1|  hypothetical protein M91_16623                        45.8    6e-04   
gb|ELR50540.1|  hypothetical protein M91_05014                        45.8    6e-04   
gb|ELR48316.1|  hypothetical protein M91_13338                        45.8    6e-04   
gb|ELR59381.1|  hypothetical protein M91_14726                        45.8    6e-04   
gb|ELR59648.1|  hypothetical protein M91_01704                        45.8    6e-04   
gb|ELR61175.1|  hypothetical protein M91_01570                        45.4    7e-04   
emb|CAA36480.1|  unnamed protein product                              45.4    7e-04   Homo sapiens [man]
ref|WP_029666940.1|  endonuclease                                     45.4    8e-04   
gb|AAA88037.1|  unknown protein                                       45.4    8e-04   Homo sapiens [man]
pir||I38588  reverse transcriptase homolog - human retrotransposo...  45.4    9e-04
gb|EPT69641.1|  endonuclease                                          45.1    9e-04   
pir||S65824  reverse transcriptase homolog - human transposon L1.1    45.1    9e-04
gb|AAL50637.1|  unknown                                               45.1    9e-04   Homo sapiens [man]
gb|AAC51267.1|  putative p150                                         45.1    9e-04   Homo sapiens [man]
gb|AAB59368.1|  ORF2 contains a reverse transcriptase domain          45.1    0.001   
gb|AAD39215.1|AF148856_2  unknown                                     45.1    0.001   
gb|AER41895.1|  unknown                                               45.1    0.001   
gb|AAC51263.1|  putative p150                                         45.1    0.001   Homo sapiens [man]
gb|AAC51276.1|  putative p150                                         45.1    0.001   Homo sapiens [man]
gb|AAC51279.1|  putative p150                                         45.1    0.001   Homo sapiens [man]
gb|AAD38785.1|AF149422_2  unknown                                     45.1    0.001   
gb|ABE73456.1|  endonuclease/reverse transcriptase                    45.1    0.001   Pan troglodytes
gb|AAC51269.1|  putative p150                                         45.1    0.001   Homo sapiens [man]
gb|ABE73458.1|  endonuclease/reverse transcriptase                    45.1    0.001   Pan troglodytes



>ref|WP_029759554.1| hypothetical protein, partial [Fusobacterium nucleatum]
Length=135

 Score = 48.9 bits (115),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTLNK+ I+G  LN +KA  DK
Sbjct  7    AEKAFDKIQHPFMIKTLNKMGIEGKYLNIIKAIYDK  42



>gb|KHK14003.1| RNA-directed DNA polymerase, partial [Listeria monocytogenes 
SHL006]
Length=117

 Score = 48.5 bits (114),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  7    AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  42



>gb|EDN65341.1| conserved hypothetical protein [Beggiatoa sp. PS]
Length=95

 Score = 47.8 bits (112),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  7    AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  42



>ref|WP_032529179.1| hypothetical protein, partial [Bacteroides fragilis]
 gb|KER51590.1| hypothetical protein HR50_13590, partial [Bacteroides fragilis]
Length=176

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+P+  KTLNKL I GT L  ++A  DK
Sbjct  3    AEKAFDKIQQPYMLKTLNKLGIDGTYLKIIRAIYDK  38



>ref|WP_032525483.1| hypothetical protein, partial [Prochlorococcus sp. scB241_526K3]
Length=104

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  4    AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  39



>ref|WP_032631627.1| endonuclease, partial [Pseudomonas syringae]
Length=253

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  66   AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  101



>gb|EAX05005.1| hCG1820778 [Homo sapiens]
Length=160

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  66   AEKAFAKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  101



>gb|KHK25500.1| recombinase, partial [Listeria monocytogenes SHL009]
Length=507

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  26   AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  61



>ref|WP_029549493.1| endonuclease, partial [Staphylococcus aureus]
Length=229

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  89   AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  124



>gb|KAK51372.1| PF08333 family protein [Bordetella bronchiseptica OSU054]
Length=681

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  7    AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  42



>gb|ETO03995.1| hypothetical protein RFI_33407, partial [Reticulomyxa filosa]
Length=774

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  259  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  294



>gb|AIE45854.1| ORF2 [synthetic construct]
Length=1276

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTLNK+ I+G  LN +KA  DK
Sbjct  601  AEKAFDKIQHPFMIKTLNKIGIEGKYLNIIKAIYDK  636



>gb|EPT52249.1| hypothetical protein SAG0051_02725, partial [Streptococcus agalactiae 
CCUG 19094]
Length=830

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  156  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  191



>ref|WP_008930570.1| RNA-directed DNA polymerase, partial [Alcanivorax hongdengensis]
 gb|EKF72771.1| RNA-directed DNA polymerase, partial [Alcanivorax hongdengensis 
A-11-3]
Length=991

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  317  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  352



>ref|WP_029550595.1| endonuclease, partial [Staphylococcus aureus]
Length=284

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  63   AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  98



>ref|WP_039678096.1| endonuclease [Enterobacter cloacae]
 gb|KHM13631.1| endonuclease [Enterobacter cloacae]
Length=1108

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  434  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  469



>ref|WP_001897351.1| endonuclease [Helicobacter pylori]
 gb|EJB99260.1| retrovirus-related Pol polyprotein LINE-1 [Helicobacter pylori 
Hp P-4]
Length=1108

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  434  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  469



>gb|KHM23816.1| endonuclease [Enterobacter aerogenes]
Length=1275

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  636



>ref|WP_032459752.1| endonuclease [Streptococcus agalactiae]
Length=1108

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  434  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  469



>gb|EPT66614.1| endonuclease [Streptococcus agalactiae CCUG 37742]
Length=1275

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  636



>pir||B34087 hypothetical protein (L1H 3' region) - human
Length=1280

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT L  ++A  DK
Sbjct  606  AEKAFDKIQQPFMLKTLNKLGIDGTYLKIIRAIYDK  641



>gb|ELR54311.1| hypothetical protein M91_18376, partial [Bos mutus]
Length=731

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  66   AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  101



>gb|ELR58139.1| hypothetical protein M91_02702, partial [Bos mutus]
Length=729

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  66   AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  101



>gb|ELR57077.1| hypothetical protein M91_12176, partial [Bos mutus]
Length=728

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  66   AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  101



>gb|ELR53834.1| hypothetical protein M91_03393, partial [Bos mutus]
Length=722

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  66   AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  101



>gb|ELR50830.1| hypothetical protein M91_07955 [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR62772.1| hypothetical protein M91_11495, partial [Bos mutus]
Length=722

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  66   AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  101



>gb|ELR57783.1| hypothetical protein M91_04059 [Bos mutus]
Length=1266

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR58001.1| hypothetical protein M91_20110 [Bos mutus]
Length=1245

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR47881.1| hypothetical protein M91_03766 [Bos mutus]
Length=1260

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  599  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  634



>gb|ELR59242.1| hypothetical protein M91_06506 [Bos mutus]
Length=1264

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR60383.1| hypothetical protein M91_04365 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|KHK05566.1| groupII intron-encoded protein [Listeria monocytogenes SHL001]
Length=348

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTLNKL I GT    ++A  DK
Sbjct  7    AEKAFDKIQHPFMLKTLNKLGIDGTYFKIIRAIYDK  42



>gb|ELR56608.1| hypothetical protein M91_06993, partial [Bos mutus]
Length=1267

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR46636.1| hypothetical protein M91_20043 [Bos mutus]
Length=1258

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR47131.1| hypothetical protein M91_12925 [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  599  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  634



>gb|ELR54602.1| LINE-1 reverse transcriptase-like protein [Bos mutus]
Length=1206

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR58543.1| hypothetical protein M91_01925 [Bos mutus]
Length=1215

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR59187.1| hypothetical protein M91_00785, partial [Bos mutus]
Length=1233

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  561  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  596



>gb|ELR48604.1| hypothetical protein M91_19605 [Bos mutus]
Length=1256

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  601  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  636



>gb|ELR47876.1| hypothetical protein M91_20604 [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  599  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  634



>gb|ELR48591.1| hypothetical protein M91_17934 [Bos mutus]
Length=1273

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  599  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  634



>gb|ELR54609.1| hypothetical protein M91_07551 [Bos mutus]
Length=1142

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  470  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  505



>gb|ELR55211.1| hypothetical protein M91_18560, partial [Bos mutus]
Length=910

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  282  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  317



>gb|ELR61551.1| hypothetical protein M91_14419, partial [Bos mutus]
Length=1264

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR56451.1| hypothetical protein M91_09901 [Bos mutus]
Length=1268

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR50258.1| hypothetical protein M91_08673 [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR45185.1| hypothetical protein M91_00772 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR44776.1| hypothetical protein M91_14132 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR57788.1| hypothetical protein M91_08672 [Bos mutus]
Length=1265

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR60459.1| hypothetical protein M91_06316 [Bos mutus]
Length=1270

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR46271.1| hypothetical protein M91_17975 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR62420.1| hypothetical protein M91_10472 [Bos mutus]
Length=1273

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR62244.1| hypothetical protein M91_20933 [Bos mutus]
Length=1273

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR60873.1| hypothetical protein M91_12677 [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  599  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  634



>gb|ELR59055.1| hypothetical protein M91_11778 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR54676.1| hypothetical protein M91_15199 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR58510.1| hypothetical protein M91_05513, partial [Bos mutus]
Length=1170

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR51705.1| hypothetical protein M91_10420, partial [Bos mutus]
Length=1179

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR53960.1| hypothetical protein M91_16134, partial [Bos mutus]
Length=1251

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  579  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  614



>gb|ELR48539.1| hypothetical protein M91_08335 [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  599  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  634



>gb|ELR55746.1| hypothetical protein M91_14620 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR55573.1| hypothetical protein M91_15722 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|AAY53484.1| endonuclease reverse transcriptase [Bos taurus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR58330.1| hypothetical protein M91_20393 [Bos mutus]
Length=1273

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR49012.1| hypothetical protein M91_01141 [Bos mutus]
Length=1273

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  601  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  636



>gb|ELR50089.1| hypothetical protein M91_20222, partial [Bos mutus]
Length=1182

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR57344.1| hypothetical protein M91_03782 [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  599  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  634



>gb|ELR48628.1| hypothetical protein M91_07595, partial [Bos mutus]
Length=1271

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR61814.1| hypothetical protein M91_08065 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR58410.1| Retrovirus-related Pol polyprotein LINE-1 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR48978.1| hypothetical protein M91_07252 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR48937.1| hypothetical protein M91_02115 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR48758.1| hypothetical protein M91_16623 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR50540.1| hypothetical protein M91_05014, partial [Bos mutus]
Length=1234

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR48316.1| hypothetical protein M91_13338 [Bos mutus]
Length=1269

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR59381.1| hypothetical protein M91_14726 [Bos mutus]
Length=1272

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR59648.1| hypothetical protein M91_01704 [Bos mutus]
Length=1230

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>gb|ELR61175.1| hypothetical protein M91_01570 [Bos mutus]
Length=1270

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ PF  KTL K  I+GT LN +KA  DK
Sbjct  600  AEKAFDKIQHPFMIKTLQKAGIEGTYLNIIKAIYDK  635



>emb|CAA36480.1| unnamed protein product [Homo sapiens]
Length=712

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  38   AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  73



>ref|WP_029666940.1| endonuclease [Streptococcus agalactiae]
Length=1108

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  434  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  469



>gb|AAA88037.1| unknown protein, partial [Homo sapiens]
Length=1192

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  518  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  553



>pir||I38588 reverse transcriptase homolog - human retrotransposon L1
 gb|AAB60345.1| ORF2 [Homo sapiens]
Length=1275

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|EPT69641.1| endonuclease, partial [Streptococcus agalactiae CCUG 38383]
Length=1130

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  456  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  491



>pir||S65824 reverse transcriptase homolog - human transposon L1.1
 gb|AAA51622.1| ORF2 [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAL50637.1| unknown [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAC51267.1| putative p150 [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAB59368.1| ORF2 contains a reverse transcriptase domain [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAD39215.1|AF148856_2 unknown [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AER41895.1| unknown [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAC51263.1| putative p150 [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAC51276.1| putative p150 [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAC51279.1| putative p150 [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|AAD38785.1|AF149422_2 unknown [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|ABE73456.1| endonuclease/reverse transcriptase [Pan troglodytes]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  602  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  637



>gb|AAC51269.1| putative p150 [Homo sapiens]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK  636



>gb|ABE73458.1| endonuclease/reverse transcriptase [Pan troglodytes]
Length=1275

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    AEKAFNKIQRPFTTKTLNKLHIKGTCLNTVKAT*DK  108
            AEKAF+KIQ+PF  KTLNKL I GT    ++A  DK
Sbjct  601  AEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIHDK  636



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684