BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c111703_g1_i1 len=149 path=[1:0-148]

Length=149
                                                                      Score     E

dbj|BAF37781.1|  hypothetical protein                                 44.7    3e-04   Ipomoea trifida



>dbj|BAF37781.1| hypothetical protein [Ipomoea trifida]
Length=166

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = +3

Query  15   DGESTLIWDHPWLHDDNQPTIQTEKPPQLAQAVVMGLMDQQTGTW  149
            +G  TL+W HPWL DD  P IQT     L  + V+GL+D +   W
Sbjct  17   NGAFTLVWGHPWLLDDLNPMIQTVMAHHLCGSRVLGLIDWEIQFW  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525616678368