BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11160_g1_i1 len=1608 path=[1:0-338 340:339-1607]

Length=1608
                                                                      Score     E

ref|XP_004229405.1|  PREDICTED: dnaJ protein ERDJ3B                     600   0.0      
ref|XP_009606137.1|  PREDICTED: dnaJ protein ERDJ3B-like                598   0.0      
ref|XP_009785213.1|  PREDICTED: dnaJ protein ERDJ3B-like                597   0.0      
ref|XP_006349203.1|  PREDICTED: dnaJ homolog subfamily B member 1...    596   0.0      
ref|XP_002275221.1|  PREDICTED: dnaJ protein ERDJ3B                     592   0.0      Vitis vinifera
emb|CDP17087.1|  unnamed protein product                                592   0.0      
ref|XP_009766352.1|  PREDICTED: dnaJ protein ERDJ3B-like                591   0.0      
gb|KHG25948.1|  DnaJ subfamily B member 11                              586   0.0      
ref|XP_003554541.1|  PREDICTED: dnaJ homolog subfamily B member 1...    586   0.0      
ref|XP_010268041.1|  PREDICTED: dnaJ protein ERDJ3B                     584   0.0      
ref|XP_009604699.1|  PREDICTED: dnaJ protein ERDJ3B-like                584   0.0      
gb|KHG17469.1|  DnaJ subfamily B member 11                              583   0.0      
ref|XP_003521587.1|  PREDICTED: dnaJ homolog subfamily B member 11      583   0.0      
ref|XP_010095300.1|  DnaJ homolog subfamily B member 11                 581   0.0      
gb|KHN19226.1|  DnaJ like subfamily B member 11                         580   0.0      
ref|XP_011079583.1|  PREDICTED: dnaJ protein ERDJ3B                     575   0.0      
ref|XP_008451505.1|  PREDICTED: dnaJ homolog subfamily B member 11      573   0.0      
ref|XP_004136000.1|  PREDICTED: dnaJ homolog subfamily B member 1...    573   0.0      
ref|XP_006444463.1|  hypothetical protein CICLE_v10020947mg             571   0.0      
ref|XP_003625951.1|  DnaJ homolog subfamily B member                    571   0.0      
ref|XP_008345236.1|  PREDICTED: dnaJ homolog subfamily B member 1...    570   0.0      
ref|XP_004494412.1|  PREDICTED: dnaJ homolog subfamily B member 1...    569   0.0      
gb|KDP28236.1|  hypothetical protein JCGZ_14007                         569   0.0      
ref|XP_010914541.1|  PREDICTED: dnaJ protein ERDJ3B                     568   0.0      
ref|XP_008797219.1|  PREDICTED: dnaJ homolog subfamily B member 1...    568   0.0      
ref|XP_009339791.1|  PREDICTED: dnaJ homolog subfamily B member 11      568   0.0      
ref|XP_009378691.1|  PREDICTED: dnaJ homolog subfamily B member 1...    567   0.0      
ref|XP_008386734.1|  PREDICTED: dnaJ homolog subfamily B member 11      566   0.0      
ref|XP_007200611.1|  hypothetical protein PRUPE_ppa007947mg             565   0.0      
ref|XP_002320981.2|  DNAJ heat shock family protein                     564   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008355501.1|  PREDICTED: dnaJ homolog subfamily B member 1...    563   0.0      
gb|ABK95286.1|  unknown                                                 563   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004300467.1|  PREDICTED: dnaJ homolog subfamily B member 1...    562   0.0      
ref|XP_008235186.1|  PREDICTED: dnaJ homolog subfamily B member 11      562   0.0      
ref|XP_009383732.1|  PREDICTED: dnaJ homolog subfamily B member 1...    562   0.0      
ref|XP_011042226.1|  PREDICTED: dnaJ protein ERDJ3B                     561   0.0      
ref|XP_011041488.1|  PREDICTED: dnaJ protein ERDJ3B-like                561   0.0      
ref|XP_002301501.1|  DNAJ heat shock family protein                     560   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002515306.1|  Chaperone protein dnaJ, putative                   558   0.0      Ricinus communis
gb|KHF99198.1|  DnaJ subfamily B member 11                              558   0.0      
ref|XP_010038274.1|  PREDICTED: dnaJ protein ERDJ3B                     558   0.0      
ref|XP_007163164.1|  hypothetical protein PHAVU_001G211800g             557   0.0      
ref|XP_010931736.1|  PREDICTED: dnaJ protein ERDJ3B-like                553   0.0      
ref|XP_006855308.1|  hypothetical protein AMTR_s00057p00065600          550   0.0      
ref|XP_007051070.1|  DNAJ heat shock family protein isoform 1           550   0.0      
ref|XP_009414445.1|  PREDICTED: dnaJ homolog subfamily B member 1...    548   0.0      
ref|XP_008797436.1|  PREDICTED: dnaJ homolog subfamily B member 1...    546   0.0      
ref|XP_002439322.1|  hypothetical protein SORBIDRAFT_09g004380          538   0.0      Sorghum bicolor [broomcorn]
ref|XP_003519751.1|  PREDICTED: dnaJ homolog subfamily B member 1...    536   0.0      
ref|XP_006293253.1|  hypothetical protein CARUB_v10019587mg             536   0.0      
ref|XP_008656126.1|  PREDICTED: dnaJ homolog subfamily B member 1...    536   0.0      
ref|XP_006402365.1|  hypothetical protein EUTSA_v10006078mg             535   0.0      
gb|KHN08649.1|  DnaJ like subfamily B member 11                         535   0.0      
gb|EEE62392.1|  hypothetical protein OsJ_17183                          535   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010544978.1|  PREDICTED: dnaJ protein ERDJ3B                     534   0.0      
ref|XP_010523978.1|  PREDICTED: dnaJ protein ERDJ3B-like                534   0.0      
ref|XP_002878466.1|  DNAJ heat shock family protein                     534   0.0      
gb|EMT15727.1|  DnaJ homolog subfamily B member 11                      534   0.0      
gb|EAY96619.1|  hypothetical protein OsI_18531                          533   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010468943.1|  PREDICTED: dnaJ protein ERDJ3B                     533   0.0      
ref|XP_010512648.1|  PREDICTED: dnaJ protein ERDJ3B-like                533   0.0      
ref|NP_191819.1|  DNAJ heat shock protein ATERDJ3B                      532   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679350.1|  PREDICTED: dnaJ protein ERDJ3B                     532   0.0      
dbj|BAK07410.1|  predicted protein                                      532   0.0      
ref|XP_010413269.1|  PREDICTED: dnaJ protein ERDJ3B-like                532   0.0      
emb|CDY59898.1|  BnaC06g43160D                                          529   0.0      
emb|CDX89142.1|  BnaA04g00440D                                          529   0.0      
emb|CDY63310.1|  BnaC04g54960D                                          529   0.0      
ref|XP_008649372.1|  PREDICTED: dnaJ homolog subfamily B member 1...    529   0.0      
emb|CDX76646.1|  BnaC08g32320D                                          528   0.0      
ref|XP_009116921.1|  PREDICTED: dnaJ homolog subfamily B member 11      527   0.0      
ref|XP_009138725.1|  PREDICTED: dnaJ homolog subfamily B member 1...    526   0.0      
ref|XP_004977083.1|  PREDICTED: dnaJ homolog subfamily B member 1...    526   0.0      
ref|XP_003568885.1|  PREDICTED: dnaJ protein ERDJ3B                     526   0.0      
gb|KFK35429.1|  hypothetical protein AALP_AA5G283300                    525   0.0      
ref|XP_006655011.1|  PREDICTED: dnaJ homolog subfamily B member 1...    516   1e-177   
gb|ACN40755.1|  unknown                                                 492   6e-168   Picea sitchensis
ref|XP_002457785.1|  hypothetical protein SORBIDRAFT_03g013590          470   1e-159   Sorghum bicolor [broomcorn]
emb|CDX67894.1|  BnaA07g19340D                                          467   2e-158   
ref|XP_007051071.1|  DNAJ heat shock family protein isoform 2           462   2e-157   
ref|XP_004971793.1|  PREDICTED: dnaJ homolog subfamily B member 1...    456   7e-154   
gb|AFW81378.1|  hypothetical protein ZEAMMB73_185883                    452   1e-152   
ref|XP_001767250.1|  predicted protein                                  445   1e-149   
ref|XP_002978653.1|  hypothetical protein SELMODRAFT_109399             426   2e-142   
ref|XP_008369059.1|  PREDICTED: dnaJ homolog subfamily B member 1...    422   6e-142   
ref|XP_001781245.1|  predicted protein                                  423   6e-141   
ref|NP_001167838.1|  hypothetical protein precursor                     407   3e-134   Zea mays [maize]
ref|XP_006444462.1|  hypothetical protein CICLE_v10020947mg             386   5e-128   
ref|XP_008797220.1|  PREDICTED: dnaJ homolog subfamily B member 1...    385   5e-127   
gb|EMS56867.1|  DnaJ homolog subfamily B member 11                      386   7e-127   
gb|KCW50098.1|  hypothetical protein EUGRSUZ_K03532                     372   9e-123   
gb|EPS66939.1|  hypothetical protein M569_07836                         364   1e-119   
gb|ACU21468.1|  unknown                                                 362   4e-119   Glycine max [soybeans]
gb|EYU46792.1|  hypothetical protein MIMGU_mgv1a0099882mg               350   2e-114   
ref|XP_005844504.1|  hypothetical protein CHLNCDRAFT_138873             343   2e-109   
ref|XP_002508960.1|  predicted protein                                  333   1e-105   Micromonas commoda
ref|XP_005649472.1|  DnaJ-domain-containing protein                     330   1e-104   
gb|KFM24199.1|  DnaJ-like protein subfamily B member 11                 322   2e-101   
ref|XP_001748783.1|  hypothetical protein                               315   9e-99    Monosiga brevicollis MX1
ref|XP_001701027.1|  ER DnaJ-like protein 1                             308   2e-96    Chlamydomonas reinhardtii
ref|XP_003737919.1|  PREDICTED: dnaJ homolog subfamily B member 1...    305   7e-95    
ref|XP_003079124.1|  Molecular chaperone (DnaJ superfamily) (ISS)       305   2e-94    
gb|KDO87051.1|  hypothetical protein CISIN_1g0191621mg                  291   5e-92    
ref|XP_007433587.1|  PREDICTED: dnaJ homolog subfamily B member 11      296   1e-91    
gb|KFM59418.1|  DnaJ-like protein subfamily B member 11                 296   1e-91    
ref|XP_005331061.1|  PREDICTED: dnaJ homolog subfamily B member 11      296   1e-91    
ref|XP_003218463.2|  PREDICTED: dnaJ homolog subfamily B member 11      295   4e-91    
ref|XP_004654356.1|  PREDICTED: dnaJ homolog subfamily B member 11      295   7e-91    
ref|XP_003056063.1|  predicted protein                                  295   1e-90    
ref|NP_001015021.1|  dnaJ homolog subfamily B member 11 precursor       293   2e-90    Rattus norvegicus [brown rat]
ref|NP_080676.3|  dnaJ homolog subfamily B member 11 precursor          293   2e-90    Mus musculus [mouse]
gb|AAH18282.1|  Dnajb11 protein                                         293   2e-90    Mus musculus [mouse]
ref|XP_004591308.1|  PREDICTED: dnaJ homolog subfamily B member 11      293   3e-90    
ref|XP_001417654.1|  predicted protein                                  293   3e-90    Ostreococcus lucimarinus CCE9901
ref|XP_005071674.1|  PREDICTED: dnaJ homolog subfamily B member 1...    293   3e-90    
ref|XP_003412955.1|  PREDICTED: dnaJ homolog subfamily B member 11      293   3e-90    
ref|XP_006884167.1|  PREDICTED: dnaJ homolog subfamily B member 11      293   4e-90    
ref|XP_004413468.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   4e-90    
ref|XP_006869808.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   4e-90    
ref|XP_004640941.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   4e-90    
ref|XP_005344802.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   4e-90    
ref|NP_057390.1|  dnaJ homolog subfamily B member 11 precursor          292   5e-90    Homo sapiens [man]
sp|P81999.2|DJB11_CANFA  RecName: Full=DnaJ homolog subfamily B m...    292   5e-90    Canis lupus familiaris [dogs]
ref|XP_002758202.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   5e-90    Callithrix jacchus [common marmoset]
gb|AAP36528.1|  Homo sapiens DnaJ (Hsp40) homolog, subfamily B, m...    292   6e-90    
ref|XP_002716504.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   6e-90    Oryctolagus cuniculus [domestic rabbit]
ref|XP_007934171.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   7e-90    
emb|CAG33377.1|  DNAJB11                                                292   7e-90    Homo sapiens [man]
ref|XP_003477123.1|  PREDICTED: dnaJ homolog subfamily B member 11      292   7e-90    
gb|AAK69110.1|AF277317_1  PWP1-interacting protein 4                    292   8e-90    Homo sapiens [man]
ref|XP_001153126.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   8e-90    Pan troglodytes
ref|XP_003792768.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   9e-90    
ref|XP_007647035.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   1e-89    
ref|XP_004899743.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   1e-89    
ref|XP_008589459.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   1e-89    
ref|XP_006171533.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   1e-89    
ref|XP_422682.1|  PREDICTED: dnaJ homolog subfamily B member 11         291   1e-89    Gallus gallus [bantam]
ref|XP_002597929.1|  hypothetical protein BRAFLDRAFT_79829              291   1e-89    Branchiostoma floridae
ref|XP_004745256.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   2e-89    
gb|AAL17676.1|  apobec-1 binding protein 2                              291   2e-89    Mus musculus [mouse]
ref|XP_005143133.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   2e-89    
ref|XP_006201050.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   2e-89    
ref|XP_006188901.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   2e-89    
ref|XP_004473768.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   2e-89    
ref|XP_004603082.1|  PREDICTED: dnaJ homolog subfamily B member 11      291   2e-89    
ref|XP_003209039.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   2e-89    
ref|XP_003927037.2|  PREDICTED: dnaJ homolog subfamily B member 11      293   2e-89    
ref|XP_007519831.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   2e-89    
dbj|BAC35956.1|  unnamed protein product                                290   3e-89    Mus musculus [mouse]
ref|XP_002914864.1|  PREDICTED: dnaJ homolog subfamily B member 1...    290   3e-89    
ref|XP_006985115.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   3e-89    
ref|XP_008953947.1|  PREDICTED: dnaJ homolog subfamily B member 11      293   4e-89    
ref|NP_001231275.1|  dnaJ homolog subfamily B member 11 precursor       290   4e-89    
gb|ELK00785.1|  DnaJ like protein subfamily B member 11                 290   4e-89    
ref|XP_010559480.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   5e-89    
ref|XP_008054549.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   5e-89    
ref|XP_008821858.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   5e-89    
ref|XP_003991867.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   5e-89    
ref|XP_004997094.1|  chaperone protein dnaJ                             290   5e-89    
ref|XP_004713474.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   5e-89    
ref|XP_004424661.1|  PREDICTED: dnaJ homolog subfamily B member 11      290   6e-89    
gb|EGW01989.1|  DnaJ-like subfamily B member 11                         290   6e-89    
ref|XP_009047397.1|  hypothetical protein LOTGIDRAFT_138864             289   6e-89    
ref|NP_001029440.1|  dnaJ homolog subfamily B member 11 precursor       289   7e-89    Bos taurus [bovine]
ref|XP_005050942.1|  PREDICTED: dnaJ homolog subfamily B member 11      289   8e-89    
ref|XP_010136350.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   8e-89    
ref|XP_009069360.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   9e-89    
ref|XP_008155792.1|  PREDICTED: dnaJ homolog subfamily B member 11      289   9e-89    
ref|XP_004382309.1|  PREDICTED: dnaJ homolog subfamily B member 11      289   1e-88    
ref|XP_001499286.1|  PREDICTED: dnaJ homolog subfamily B member 11      289   1e-88    Equus caballus [domestic horse]
ref|XP_004278514.1|  PREDICTED: dnaJ homolog subfamily B member 11      289   1e-88    
ref|XP_010622501.1|  PREDICTED: dnaJ homolog subfamily B member 1...    288   1e-88    
ref|XP_005639860.1|  PREDICTED: DnaJ (Hsp40) homolog, subfamily B...    288   1e-88    
ref|XP_005529587.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   1e-88    
ref|XP_006084876.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   1e-88    
ref|XP_006021054.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   1e-88    
ref|XP_010012669.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   2e-88    
ref|XP_007195315.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   2e-88    
ref|XP_005639859.1|  PREDICTED: DnaJ (Hsp40) homolog, subfamily B...    288   2e-88    
ref|XP_004675129.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   2e-88    
ref|XP_007451438.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   2e-88    
ref|XP_007116343.1|  PREDICTED: dnaJ homolog subfamily B member 11      288   2e-88    
ref|XP_009321182.1|  PREDICTED: dnaJ homolog subfamily B member 11      287   2e-88    
ref|XP_009663421.1|  PREDICTED: dnaJ homolog subfamily B member 11      287   2e-88    
ref|XP_007514172.1|  predicted protein                                  291   3e-88    
ref|XP_010119024.1|  PREDICTED: dnaJ homolog subfamily B member 11      287   3e-88    
ref|XP_006925878.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    290   3e-88    
gb|KFP90342.1|  DnaJ subfamily B member 11                              287   3e-88    
ref|XP_009870657.1|  PREDICTED: dnaJ homolog subfamily B member 11      287   3e-88    
ref|XP_005639861.1|  PREDICTED: DnaJ (Hsp40) homolog, subfamily B...    287   3e-88    
ref|XP_009951382.1|  PREDICTED: dnaJ homolog subfamily B member 11      286   4e-88    
ref|XP_009087536.1|  PREDICTED: dnaJ homolog subfamily B member 11      287   5e-88    
gb|KDO87047.1|  hypothetical protein CISIN_1g0191622mg                  280   5e-88    
gb|EFX89009.1|  hypothetical protein DAPPUDRAFT_206336                  287   5e-88    
ref|XP_009642766.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    286   5e-88    
ref|XP_008945154.1|  PREDICTED: dnaJ homolog subfamily B member 11      286   5e-88    
ref|XP_002411512.1|  molecular chaperone, putative                      287   5e-88    Ixodes scapularis [blacklegged tick]
ref|XP_005501678.1|  PREDICTED: dnaJ homolog subfamily B member 11      286   6e-88    
ref|XP_010072304.1|  PREDICTED: dnaJ homolog subfamily B member 11      286   6e-88    
ref|XP_005858487.1|  PREDICTED: dnaJ homolog subfamily B member 11      289   7e-88    
ref|XP_005303720.1|  PREDICTED: dnaJ homolog subfamily B member 11      286   8e-88    
ref|XP_006754221.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    289   9e-88    
ref|XP_010285722.1|  PREDICTED: dnaJ homolog subfamily B member 11      285   1e-87    
ref|XP_006746968.1|  PREDICTED: dnaJ homolog subfamily B member 1...    286   1e-87    
ref|XP_009568480.1|  PREDICTED: dnaJ homolog subfamily B member 11      286   2e-87    
ref|XP_004787533.1|  PREDICTED: dnaJ homolog subfamily B member 1...    286   2e-87    
ref|XP_008628266.1|  PREDICTED: dnaJ homolog subfamily B member 11      285   2e-87    
ref|XP_007227819.1|  PREDICTED: dnaJ homolog subfamily B member 1...    286   2e-87    
ref|XP_008489284.1|  PREDICTED: dnaJ homolog subfamily B member 11      285   2e-87    
gb|KFO90914.1|  DnaJ subfamily B member 11                              284   2e-87    
ref|XP_008917847.1|  PREDICTED: dnaJ homolog subfamily B member 11      285   2e-87    
ref|XP_005028153.1|  PREDICTED: dnaJ homolog subfamily B member 11      284   3e-87    
ref|XP_003770222.1|  PREDICTED: dnaJ homolog subfamily B member 11      285   3e-87    
ref|XP_001377387.2|  PREDICTED: dnaJ homolog subfamily B member 11      285   3e-87    Monodelphis domestica
gb|KFQ49396.1|  DnaJ subfamily B member 11                              284   3e-87    
ref|XP_010210799.1|  PREDICTED: dnaJ homolog subfamily B member 11      286   4e-87    
ref|XP_005489666.1|  PREDICTED: dnaJ homolog subfamily B member 11      284   5e-87    
gb|KFW66297.1|  DnaJ subfamily B member 11                              283   5e-87    
ref|XP_008536907.1|  PREDICTED: dnaJ homolog subfamily B member 11      284   6e-87    
gb|KFO70617.1|  DnaJ subfamily B member 11                              283   6e-87    
ref|XP_006636456.1|  PREDICTED: dnaJ homolog subfamily B member 1...    284   6e-87    
ref|NP_001091184.1|  uncharacterized protein LOC100036945               284   7e-87    Xenopus laevis [clawed frog]
ref|XP_793217.2|  PREDICTED: dnaJ homolog subfamily B member 11-like    284   7e-87    Strongylocentrotus purpuratus [purple urchin]
gb|KFP99322.1|  DnaJ subfamily B member 11                              283   7e-87    
ref|XP_008703434.1|  PREDICTED: dnaJ homolog subfamily B member 1...    285   8e-87    
gb|KFP36182.1|  DnaJ subfamily B member 11                              282   8e-87    
gb|KFV75587.1|  DnaJ subfamily B member 11                              282   1e-86    
ref|XP_010409501.1|  PREDICTED: dnaJ homolog subfamily B member 11      283   1e-86    
ref|XP_010006225.1|  PREDICTED: dnaJ homolog subfamily B member 11      285   1e-86    
ref|XP_010190443.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    283   1e-86    
ref|NP_001086343.1|  DnaJ (Hsp40) homolog, subfamily B, member 11       283   1e-86    Xenopus laevis [clawed frog]
ref|NP_989180.1|  DnaJ (Hsp40) homolog, subfamily B, member 11          283   1e-86    Xenopus tropicalis [western clawed frog]
gb|EFN87028.1|  DnaJ-like protein subfamily B member 11                 283   1e-86    
gb|KFQ22942.1|  DnaJ subfamily B member 11                              282   1e-86    
ref|XP_006111236.1|  PREDICTED: dnaJ homolog subfamily B member 11      283   1e-86    
gb|KFV03360.1|  DnaJ subfamily B member 11                              282   1e-86    
gb|KFV69168.1|  DnaJ subfamily B member 11                              282   1e-86    
ref|XP_009461097.1|  PREDICTED: dnaJ homolog subfamily B member 11      283   2e-86    
gb|KGL75809.1|  DnaJ subfamily B member 11                              282   2e-86    
ref|XP_009922315.1|  PREDICTED: dnaJ homolog subfamily B member 11      282   2e-86    
ref|XP_010622500.1|  PREDICTED: dnaJ homolog subfamily B member 1...    283   3e-86    
gb|KFO56319.1|  DnaJ subfamily B member 11                              281   3e-86    
ref|XP_009901203.1|  PREDICTED: dnaJ homolog subfamily B member 11      282   3e-86    
gb|KFW77412.1|  DnaJ subfamily B member 11                              281   3e-86    
gb|KFU83669.1|  DnaJ subfamily B member 11                              281   3e-86    
gb|KFO98736.1|  DnaJ subfamily B member 11                              281   4e-86    
gb|EZA59269.1|  DnaJ-like protein subfamily B member                    282   5e-86    
gb|EFB26307.1|  hypothetical protein PANDA_002804                       280   5e-86    Ailuropoda melanoleuca
ref|XP_004530311.1|  PREDICTED: dnaJ homolog subfamily B member 1...    281   5e-86    
ref|XP_007052710.1|  PREDICTED: dnaJ homolog subfamily B member 11      282   6e-86    
gb|AFW81377.1|  hypothetical protein ZEAMMB73_185883                    274   7e-86    
gb|EOA95328.1|  DnaJ-like protein subfamily B member 11                 280   9e-86    
gb|KDR20633.1|  DnaJ-like protein subfamily B member 11                 281   1e-85    
ref|XP_008703433.1|  PREDICTED: dnaJ homolog subfamily B member 1...    283   1e-85    
ref|XP_002192977.1|  PREDICTED: dnaJ homolog subfamily B member 11      281   2e-85    Taeniopygia guttata
ref|XP_008326238.1|  PREDICTED: dnaJ homolog subfamily B member 11      281   2e-85    
ref|XP_008436025.1|  PREDICTED: dnaJ homolog subfamily B member 11      280   3e-85    
ref|XP_009885679.1|  PREDICTED: dnaJ homolog subfamily B member 11      279   3e-85    
emb|CDQ76679.1|  unnamed protein product                                280   3e-85    
dbj|BAN20519.1|  conserved hypothetical protein                         280   3e-85    
ref|XP_010743168.1|  PREDICTED: dnaJ homolog subfamily B member 11      280   3e-85    
ref|XP_007578916.1|  PREDICTED: dnaJ homolog subfamily B member 11      280   4e-85    
ref|XP_003961678.1|  PREDICTED: dnaJ homolog subfamily B member 1...    280   4e-85    
gb|KFQ95197.1|  DnaJ subfamily B member 11                              278   4e-85    
gb|ETE66217.1|  DnaJ-like subfamily B member 11                         278   7e-85    
ref|XP_002154328.1|  PREDICTED: dnaJ homolog subfamily B member 1...    279   8e-85    
gb|EPY78118.1|  hypothetical protein CB1_001118013                      290   8e-85    
ref|XP_011049250.1|  PREDICTED: dnaJ homolog subfamily B member 11      279   8e-85    
ref|XP_010147787.1|  PREDICTED: dnaJ homolog subfamily B member 11      277   1e-84    
emb|CDQ81212.1|  unnamed protein product                                278   1e-84    
ref|XP_005815647.1|  PREDICTED: dnaJ homolog subfamily B member 1...    278   1e-84    
gb|AFV39801.1|  ER-associated Hsp40 co-chaperone                        278   1e-84    
ref|XP_002116502.1|  hypothetical protein TRIADDRAFT_60480              279   2e-84    Trichoplax adhaerens
ref|XP_005167735.1|  PREDICTED: dnaJ homolog subfamily B member 1...    278   2e-84    
ref|XP_007898281.1|  PREDICTED: dnaJ homolog subfamily B member 11      278   2e-84    
ref|NP_942116.1|  dnaJ homolog subfamily B member 11 precursor          278   2e-84    Danio rerio [leopard danio]
ref|XP_003456324.1|  PREDICTED: dnaJ homolog subfamily B member 1...    278   2e-84    
ref|XP_009283277.1|  PREDICTED: dnaJ homolog subfamily B member 11      276   2e-84    
ref|XP_004318277.1|  PREDICTED: dnaJ homolog subfamily B member 11      277   2e-84    
ref|XP_010878282.1|  PREDICTED: dnaJ homolog subfamily B member 11      278   2e-84    
ref|XP_001988552.1|  GH11226                                            277   3e-84    
gb|KFZ52874.1|  DnaJ subfamily B member 11                              276   3e-84    
gb|KFV92435.1|  DnaJ subfamily B member 11                              275   4e-84    
gb|KFQ40534.1|  DnaJ subfamily B member 11                              275   5e-84    
ref|XP_005167736.1|  PREDICTED: dnaJ homolog subfamily B member 1...    276   6e-84    
ref|XP_006805891.1|  PREDICTED: dnaJ homolog subfamily B member 1...    276   8e-84    
ref|XP_002066746.1|  GK24395                                            276   8e-84    
gb|ABA54278.1|  DnaJ-like subfamily B member 11                         276   9e-84    
ref|XP_004569902.1|  PREDICTED: dnaJ homolog subfamily B member 1...    276   9e-84    
gb|KGL95205.1|  DnaJ subfamily B member 11                              274   1e-83    
gb|EFZ21098.1|  hypothetical protein SINV_16186                         278   1e-83    
gb|KFP94864.1|  DnaJ subfamily B member 11                              275   1e-83    
ref|XP_001950907.1|  PREDICTED: dnaJ homolog subfamily B member 11      275   2e-83    
ref|XP_008293796.1|  PREDICTED: dnaJ homolog subfamily B member 11      275   2e-83    
ref|XP_002041584.1|  GM16745                                            275   3e-83    
ref|XP_002052836.1|  GJ17778                                            275   3e-83    
gb|ENN76197.1|  hypothetical protein YQE_07165                          274   4e-83    
ref|XP_002122089.1|  PREDICTED: dnaJ homolog subfamily B member 1...    274   4e-83    
ref|XP_002003656.1|  GI21690                                            274   5e-83    
ref|NP_608525.1|  CG4164                                                274   6e-83    
gb|KFM11396.1|  DnaJ subfamily B member 11                              272   6e-83    
ref|XP_001965366.1|  GF20662                                            273   7e-83    
gb|ELT87266.1|  hypothetical protein CAPTEDRAFT_207828                  273   8e-83    
gb|ACO12621.1|  DnaJ homolog subfamily B member 11 precursor            275   8e-83    
ref|XP_973727.1|  PREDICTED: dnaJ homolog subfamily B member 11         273   8e-83    
gb|ERG81404.1|  dnj-20-like protein                                     273   8e-83    
ref|XP_005100247.1|  PREDICTED: dnaJ homolog subfamily B member 1...    273   8e-83    
ref|XP_002014580.1|  GL18879                                            273   9e-83    
ref|XP_008475495.1|  PREDICTED: dnaJ homolog subfamily B member 1...    273   1e-82    
ref|XP_001356432.1|  GA17999                                            273   1e-82    
gb|EFN74160.1|  DnaJ-like protein subfamily B member 11                 273   2e-82    
ref|XP_009483440.1|  PREDICTED: dnaJ homolog subfamily B member 11      271   2e-82    
ref|XP_002087432.1|  GE16847                                            272   2e-82    
ref|XP_005188833.1|  PREDICTED: dnaJ homolog subfamily B member 1...    272   3e-82    
ref|XP_001968175.1|  GG24722                                            272   3e-82    
ref|XP_006569897.1|  PREDICTED: dnaJ homolog subfamily B member 1...    271   4e-82    
ref|XP_003493438.1|  PREDICTED: dnaJ homolog subfamily B member 1...    272   4e-82    
ref|XP_003397997.1|  PREDICTED: dnaJ homolog subfamily B member 1...    271   5e-82    
ref|XP_002424665.1|  conserved hypothetical protein                     271   6e-82    
ref|XP_008207340.1|  PREDICTED: dnaJ homolog subfamily B member 1...    270   8e-82    
gb|ACO14660.1|  DnaJ homolog subfamily B member 11 precursor            271   8e-82    
gb|KFQ62364.1|  DnaJ subfamily B member 11                              268   1e-81    
ref|XP_003695439.1|  PREDICTED: dnaJ homolog subfamily B member 1...    270   1e-81    
ref|XP_008207321.1|  PREDICTED: dnaJ homolog subfamily B member 1...    270   1e-81    
gb|ADD38735.1|  DnaJ homolog subfamily B member 11                      270   1e-81    
ref|XP_008475494.1|  PREDICTED: dnaJ homolog subfamily B member 1...    272   2e-81    
ref|XP_003389714.1|  PREDICTED: dnaJ homolog subfamily B member 1...    270   3e-81    
gb|EFA03492.1|  hypothetical protein TcasGA2_TC013491                   269   4e-81    
gb|ACO10834.1|  DnaJ homolog subfamily B member 11 precursor            269   6e-81    
ref|XP_001636828.1|  predicted protein                                  268   7e-81    
ref|XP_008545926.1|  PREDICTED: dnaJ homolog subfamily B member 11      268   8e-81    
ref|XP_003374051.1|  DnaJ protein subfamily B member 11                 270   1e-80    
gb|EJD74752.1|  DnaJ domain-containing protein                          268   1e-80    
emb|CDP95154.1|  Protein BM-DNJ-20                                      266   2e-80    
gb|ETN58210.1|  DNA-J/hsp40                                             266   4e-80    
ref|XP_001895730.1|  DnaJ homolog subfamily B member 11 precursor       266   5e-80    
emb|CEF65124.1|  DnaJ homolog subfamily B member 11                     266   6e-80    
ref|XP_001846985.1|  DNA-J/hsp40                                        266   9e-80    
gb|EKC30863.1|  DnaJ-like protein subfamily B member 11                 283   1e-79    
gb|ABF18320.1|  molecular chaperone                                     265   1e-79    
ref|XP_317136.4|  AGAP008327-PA                                         265   2e-79    
emb|CCD75048.1|  putative DNAj (hsp40) homolog, subfamily B, member     265   3e-79    
gb|KHN79228.1|  DnaJ -like protein dnj-20                               265   5e-79    
gb|KGB34047.1|  DnaJ subfamily B member 11                              263   2e-78    
ref|XP_003702621.1|  PREDICTED: dnaJ homolog subfamily B member 1...    262   3e-78    
ref|XP_003525969.2|  PREDICTED: dnaJ homolog subfamily B member 1...    254   3e-78    
ref|NP_001157381.1|  DnaJ (Hsp40) homolog 3                             260   7e-78    
ref|NP_741036.2|  Protein DNJ-20, isoform a                             260   1e-77    
gb|KHJ44383.1|  DnaJ domain protein                                     260   1e-77    
gb|KFB36319.1|  AGAP008327-PA-like protein                              259   2e-77    
gb|KDO45038.1|  hypothetical protein CISIN_1g039840mg                   253   4e-77    
emb|CEF59543.1|  DnaJ homolog subfamily B member 11                     258   7e-77    
ref|XP_006010587.1|  PREDICTED: dnaJ homolog subfamily B member 1...    256   8e-77    
emb|CDW56588.1|  CTDII and DnaJ domain containing protein               258   1e-76    
gb|EHJ64128.1|  DnaJ-like protein 3                                     256   2e-76    
ref|XP_009016475.1|  hypothetical protein HELRODRAFT_171496             255   7e-76    
dbj|BAM18277.1|  DNA-J/hsp40 protein                                    255   9e-76    
ref|XP_001091858.2|  PREDICTED: dnaJ homolog subfamily B member 11      254   1e-75    
ref|NP_001187774.1|  DnaJ-like protein subfamily b member 11 prec...    256   1e-75    
dbj|GAA51426.1|  DnaJ homolog subfamily B member 11                     266   1e-75    
gb|EIE78627.1|  hypothetical protein RO3G_03331                         255   2e-75    
ref|XP_009806963.1|  PREDICTED: dnaJ homolog subfamily B member 11      250   1e-74    
emb|CEI94658.1|  hypothetical protein RMCBS344292_08863                 253   2e-74    
gb|EPB86033.1|  hypothetical protein HMPREF1544_07193                   252   2e-74    
ref|NP_001054697.1|  Os05g0156500                                       243   4e-74    
emb|CDI98692.1|  dnaj protein subfamily b 1                             252   4e-74    
gb|EUB59836.1|  DnaJ subfamily B member                                 251   4e-74    
emb|CEJ04661.1|  hypothetical protein RMCBS344292_18616                 251   7e-74    
emb|CEG67475.1|  hypothetical protein RMATCC62417_03901                 249   2e-73    
emb|CDS31601.1|  dnaj protein subfamily b 1                             249   2e-73    
gb|KDD75759.1|  hypothetical protein H632_c512p1                        248   3e-73    
ref|XP_001663207.1|  DNA-J/hsp40                                        246   7e-73    
gb|KFZ45372.1|  DnaJ subfamily B member 11                              244   8e-73    
gb|EJW80498.1|  molecular chaperone                                     247   9e-73    
gb|AFW80711.1|  hypothetical protein ZEAMMB73_969717                    241   4e-72    
ref|XP_002951316.1|  hypothetical protein VOLCADRAFT_105068             262   6e-72    
ref|XP_010160918.1|  PREDICTED: dnaJ homolog subfamily B member 11      240   2e-71    
emb|CAF95988.1|  unnamed protein product                                246   5e-71    
ref|XP_002629733.1|  C. briggsae CBR-DNJ-20 protein                     243   5e-71    
ref|XP_002669360.1|  DnaJ heat shock family protein                     237   1e-68    
ref|XP_005839129.1|  hypothetical protein GUITHDRAFT_157105             236   3e-68    
gb|KDO34548.1|  hypothetical protein SPRG_00611                         236   3e-68    
emb|CBY12536.1|  unnamed protein product                                235   3e-68    
ref|XP_009503451.1|  PREDICTED: dnaJ homolog subfamily B member 11      232   8e-68    
emb|CDJ80641.1|  unnamed protein product                                232   9e-68    
ref|XP_010310209.1|  PREDICTED: dnaJ homolog subfamily B member 11      231   1e-67    
ref|XP_009577968.1|  PREDICTED: dnaJ homolog subfamily B member 11      231   1e-67    
ref|XP_009982958.1|  PREDICTED: dnaJ homolog subfamily B member 11      231   1e-67    
gb|EYB89076.1|  hypothetical protein Y032_0237g3271                     235   1e-67    
ref|XP_005241632.1|  PREDICTED: dnaJ homolog subfamily B member 11      231   2e-67    
ref|XP_010195327.1|  PREDICTED: dnaJ homolog subfamily B member 11      231   2e-67    
ref|XP_009939105.1|  PREDICTED: dnaJ homolog subfamily B member 11      231   2e-67    
ref|XP_005712993.1|  Heat Shock Protein 40, HSP40                       234   3e-67    
ref|XP_008621677.1|  hypothetical protein SDRG_17216                    232   6e-67    
gb|KFV16787.1|  DnaJ subfamily B member 11                              228   8e-67    
ref|XP_005707454.1|  molecular chaperone DnaJ isoform 1                 232   1e-66    
gb|KFO06746.1|  DnaJ subfamily B member 11                              228   2e-66    
gb|KFW06527.1|  DnaJ subfamily B member 11                              228   2e-66    
ref|XP_005707455.1|  molecular chaperone DnaJ isoform 2                 232   2e-66    
gb|KFV51182.1|  DnaJ subfamily B member 11                              227   2e-66    
gb|KFP49350.1|  DnaJ subfamily B member 11                              227   2e-66    
ref|XP_640251.1|  heat shock protein DnaJ family protein                230   3e-66    
gb|KFR15604.1|  DnaJ subfamily B member 11                              227   4e-66    
gb|KFP29759.1|  DnaJ subfamily B member 11                              227   4e-66    
ref|XP_006812668.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    228   5e-66    
gb|AFK35292.1|  unknown                                                 221   8e-66    
gb|KFD69594.1|  hypothetical protein M514_01959                         243   2e-65    
gb|ETK79363.1|  chaperone DnaJ                                          228   3e-65    
ref|XP_008879494.1|  chaperone DnaJ                                     227   4e-65    
gb|AIG55894.1|  secreted protein                                        227   4e-65    
gb|ETP37081.1|  chaperone DnaJ                                          228   5e-65    
gb|AAV32228.1|  unknown protein                                         218   1e-64    
gb|ETI39143.1|  chaperone DnaJ                                          226   1e-64    
ref|XP_008910987.1|  chaperone DnaJ                                     226   2e-64    
ref|XP_004359517.1|  heat shock protein DnaJ family protein             225   4e-64    
emb|CDS09433.1|  hypothetical protein LRAMOSA10793                      224   6e-64    
ref|XP_004346545.1|  DnaJ domain containing protein                     224   2e-63    
emb|CBJ27338.1|  Heat shock protein 40                                  224   2e-63    
ref|XP_008867579.1|  chaperone DnaJ                                     223   2e-63    
ref|XP_002900549.1|  conserved hypothetical protein                     222   4e-63    
ref|XP_009533175.1|  hypothetical protein PHYSODRAFT_520326             222   5e-63    
ref|XP_005335641.1|  PREDICTED: dnaJ homolog subfamily B member 1...    217   9e-63    
gb|KFH68266.1|  hypothetical protein MVEG_05084                         221   1e-62    
gb|EFA77749.1|  heat shock protein DnaJ family protein                  220   2e-62    
ref|XP_009177263.1|  hypothetical protein T265_15713                    223   4e-62    
ref|XP_002907801.1|  conserved hypothetical protein                     219   8e-62    
ref|XP_005425101.1|  PREDICTED: dnaJ homolog subfamily B member 11      214   1e-61    
ref|XP_007656317.1|  PREDICTED: dnaJ homolog subfamily B member 11      216   4e-61    
gb|ETI35413.1|  chaperone DnaJ                                          216   8e-61    
ref|XP_002077643.1|  GD23027                                            212   1e-60    
ref|XP_008912898.1|  chaperone DnaJ                                     216   1e-60    
gb|ERE75407.1|  putative dnaJ subfamily B member 11-like protein        212   1e-60    
emb|CBY12529.1|  unnamed protein product                                214   1e-60    
gb|EPB86017.1|  hypothetical protein HMPREF1544_07176                   215   3e-60    
ref|XP_009841740.1|  chaperone DnaJ                                     214   3e-60    
gb|EJY67543.1|  hypothetical protein OXYTRI_11946                       214   4e-60    
gb|AIG56267.1|  secreted protein                                        214   4e-60    
gb|ETL29097.1|  chaperone DnaJ                                          214   4e-60    
ref|XP_007262835.1|  DnaJ-domain-containing protein                     214   5e-60    
ref|XP_005383657.1|  PREDICTED: dnaJ homolog subfamily B member 11      211   6e-60    
ref|XP_009516819.1|  hypothetical protein PHYSODRAFT_294653             220   7e-60    
emb|CDH60313.1|  heat shock protein family protein                      213   9e-60    
ref|XP_009825346.1|  chaperone DnaJ                                     213   1e-59    
gb|ESA14569.1|  hypothetical protein GLOINDRAFT_346463                  213   1e-59    
ref|XP_007403894.1|  hypothetical protein MELLADRAFT_41574              213   2e-59    
gb|KGB80026.1|  chaperone regulator                                     211   4e-59    
ref|NP_001005841.1|  dnaJ homolog subfamily A member 2                  213   5e-59    
ref|XP_009545350.1|  molecular chaperone, DnaJ superfamily              211   7e-59    
ref|XP_002140380.1|  DnaJ domain-containing protein                     211   7e-59    
gb|EGI68683.1|  DnaJ-like protein subfamily B member 11                 207   7e-59    
ref|XP_004349810.1|  heat shock protein DnaJ family protein             211   7e-59    
ref|XP_010583355.1|  PREDICTED: dnaJ homolog subfamily A member 2...    210   8e-59    
ref|NP_001079686.1|  DnaJ (Hsp40) homolog, subfamily A, member 2        211   2e-58    
ref|XP_003196386.1|  chaperone regulator                                209   3e-58    
ref|XP_001507642.1|  PREDICTED: dnaJ homolog subfamily A member 2       210   4e-58    
ref|XP_005490145.1|  PREDICTED: dnaJ homolog subfamily A member 2       209   7e-58    
ref|XP_001363277.1|  PREDICTED: dnaJ homolog subfamily A member 2       209   9e-58    
ref|XP_005526438.1|  PREDICTED: dnaJ homolog subfamily A member 2       209   1e-57    
emb|CDS21532.1|  dnaJ subfamily A                                       208   1e-57    
ref|XP_567939.1|  chaperone regulator                                   207   1e-57    
ref|XP_001511550.1|  PREDICTED: dnaJ homolog subfamily A member 4       208   1e-57    
ref|XP_006027277.1|  PREDICTED: dnaJ homolog subfamily A member 4       208   1e-57    
ref|XP_625863.1|  DNAj domain protein having a signal peptide           207   1e-57    
ref|XP_004622750.1|  PREDICTED: dnaJ homolog subfamily B member 1...    204   2e-57    
ref|NP_001080625.1|  DnaJ subfamily A member 2                          208   2e-57    
ref|XP_001660492.1|  DnaJ subfamily B member 11 precursor, putative     203   2e-57    
ref|NP_001035581.1|  dnaJ homolog subfamily A member 2                  208   2e-57    
ref|XP_006261401.1|  PREDICTED: dnaJ homolog subfamily A member 4       207   3e-57    
gb|EHB17459.1|  DnaJ-like protein subfamily B member 11                 203   3e-57    
ref|XP_008467980.1|  PREDICTED: dnaJ homolog subfamily A member 2...    206   3e-57    
ref|XP_007441498.1|  PREDICTED: dnaJ homolog subfamily A member 4       208   3e-57    
ref|XP_007887604.1|  PREDICTED: dnaJ homolog subfamily A member 2       207   4e-57    
emb|CDI97251.1|  dnaJ subfamily A                                       207   4e-57    
gb|EUB57005.1|  DnaJ subfamily A member                                 207   4e-57    
ref|XP_003784609.1|  PREDICTED: dnaJ homolog subfamily A member 4       207   5e-57    
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         207   6e-57    
ref|XP_006589808.1|  PREDICTED: dnaJ homolog subfamily B member 1...    198   6e-57    
ref|XP_009909920.1|  PREDICTED: dnaJ homolog subfamily A member 4...    206   1e-56    
ref|XP_007393697.1|  hypothetical protein PHACADRAFT_252656             205   1e-56    
ref|XP_006675104.1|  hypothetical protein BATDEDRAFT_15261              206   1e-56    
gb|KDO34827.1|  hypothetical protein SPRG_00888                         204   1e-56    
gb|AFR94509.1|  chaperone regulator                                     204   2e-56    
gb|EJY78088.1|  DnaJ domain containing protein                          204   2e-56    
ref|XP_007342320.1|  DnaJ-domain-containing protein                     204   2e-56    
ref|XP_002177864.1|  predicted protein                                  205   2e-56    
gb|KDR14838.1|  DnaJ-like protein subfamily A member 2                  206   3e-56    
ref|XP_008605155.1|  hypothetical protein SDRG_01409                    203   3e-56    
emb|CDS28557.1|  dnaJ subfamily A                                       204   3e-56    
ref|XP_006261714.1|  PREDICTED: dnaJ homolog subfamily A member 2       204   4e-56    
ref|XP_005707432.1|  molecular chaperone DnaJ                           204   4e-56    
ref|XP_007068411.1|  PREDICTED: dnaJ homolog subfamily A member 4       204   5e-56    
ref|XP_007299587.1|  DnaJ-domain-containing protein                     203   5e-56    
ref|XP_003222964.1|  PREDICTED: dnaJ homolog subfamily A member 2       204   5e-56    
ref|XP_004387526.1|  PREDICTED: dnaJ homolog subfamily A member 4       204   5e-56    
ref|XP_005289904.1|  PREDICTED: dnaJ homolog subfamily A member 2       204   6e-56    
ref|XP_004647344.1|  PREDICTED: dnaJ homolog subfamily A member 2...    203   8e-56    
ref|XP_005069613.1|  PREDICTED: dnaJ homolog subfamily A member 4       203   8e-56    
ref|XP_005294547.1|  PREDICTED: dnaJ homolog subfamily A member 4       203   1e-55    
ref|XP_007895735.1|  PREDICTED: dnaJ homolog subfamily A member 1...    203   1e-55    
gb|KFO74151.1|  DnaJ subfamily A member 4                               202   1e-55    



>ref|XP_004229405.1| PREDICTED: dnaJ protein ERDJ3B [Solanum lycopersicum]
Length=345

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/326 (90%), Positives = 310/326 (95%), Gaps = 1/326 (0%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIAAKSYYDILQ+PKGAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEI+NAYEV+S
Sbjct  21    IAIAAKSYYDILQIPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEISNAYEVIS  80

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKRNIYDRYGEEGLKQHAASGG RG GMN+QDIFS FFGGG  EEEEEKI KGDDVI+
Sbjct  81    DSEKRNIYDRYGEEGLKQHAASGG-RGGGMNMQDIFSQFFGGGSMEEEEEKIVKGDDVIV  139

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DLDA+LEDLYMGGS+KVWREKNILKPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCD+C
Sbjct  140   DLDATLEDLYMGGSLKVWREKNILKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDKC  199

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY+ITVDIEKGMQDGQEVVFYEDGEPK+DGEPGDLKFRIRTAPHDQF RE N
Sbjct  200   PNVKFEREGYHITVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDQFTREVN  259

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DL TTVTITLVQALVGFEKTIKHLDDHLVDI SKGITKPKEV+KFKGEGMP H+SNKKGD
Sbjct  260   DLRTTVTITLVQALVGFEKTIKHLDDHLVDISSKGITKPKEVRKFKGEGMPLHYSNKKGD  319

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             LYV FEVLFPTSLT +QK +IKEVLG
Sbjct  320   LYVKFEVLFPTSLTEDQKKQIKEVLG  345



>ref|XP_009606137.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana tomentosiformis]
Length=343

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/325 (90%), Positives = 312/325 (96%), Gaps = 2/325 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIA+KSYYDILQVPKGAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEI+NAYEVLS
Sbjct  20    IAIASKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEISNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKRNIYDRYGEEGLKQHAASGG RG+GMN+QDIFS FFGGG + EEEEKI KGDDVI+
Sbjct  80    DSEKRNIYDRYGEEGLKQHAASGG-RGSGMNMQDIFSQFFGGG-SMEEEEKIIKGDDVIV  137

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DLDA+LEDLYMGGS+KVWREKN+LKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD+C
Sbjct  138   DLDATLEDLYMGGSLKVWREKNVLKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDKC  197

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY ITVDIEKGMQDGQEVVFYEDGEPK+DGEPGDLKFRIRTAPHD+FKREGN
Sbjct  198   PNVKFEREGYEITVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDRFKREGN  257

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLHTTVTITLVQALVGFEKTIKHLDDHLVDIG+KGITKPKEV+K KGEGMP HFSNKKGD
Sbjct  258   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGTKGITKPKEVRKIKGEGMPLHFSNKKGD  317

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVL  359
             LYV FEVLFPTSLT +QK +IK++L
Sbjct  318   LYVKFEVLFPTSLTEDQKKQIKQIL  342



>ref|XP_009785213.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana sylvestris]
Length=343

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/325 (90%), Positives = 312/325 (96%), Gaps = 2/325 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIA+KSYYDILQVPKGAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEINNAYEVLS
Sbjct  20    IAIASKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKRNIYDR+GEEGLKQHAA GGGRG+GMN+QDIFS FFGGG + EEEEKI KGDDVI+
Sbjct  80    DSEKRNIYDRHGEEGLKQHAA-GGGRGSGMNMQDIFSQFFGGG-SMEEEEKIVKGDDVIV  137

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DLDA+LEDLYMGGS+KVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD+C
Sbjct  138   DLDATLEDLYMGGSLKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDKC  197

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY ITVDIEKGMQDGQEVVFYEDGEPK+DGEPGDLKFRIRTAPHD+FKREGN
Sbjct  198   PNVKFEREGYEITVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDRFKREGN  257

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLHTTVTITLVQALVGFEKTIKHLDDHLVDIG+KGITKPKEV+K KG+GMP HFS+KKGD
Sbjct  258   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGTKGITKPKEVRKIKGKGMPLHFSDKKGD  317

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVL  359
             LYV FEVLFPTSLT +QK +IKE+L
Sbjct  318   LYVKFEVLFPTSLTEDQKKQIKEIL  342



>ref|XP_006349203.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Solanum tuberosum]
Length=345

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/326 (89%), Positives = 310/326 (95%), Gaps = 1/326 (0%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIAAKSYYDILQ+PKGAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEI+NAYEV+S
Sbjct  21    IAIAAKSYYDILQIPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEISNAYEVIS  80

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKRNIYDRYGEEGLKQHAASGG RG GMN+QDIFS FFGGG  EEEEEKI KGDDVI+
Sbjct  81    DSEKRNIYDRYGEEGLKQHAASGG-RGGGMNMQDIFSQFFGGGSMEEEEEKIVKGDDVIV  139

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DLDA+LEDLYMGGS+KVWREKN+LKPAPGKR+CNCRNEVYHRQIGPGM+QQMTEQVCD+C
Sbjct  140   DLDATLEDLYMGGSLKVWREKNVLKPAPGKRKCNCRNEVYHRQIGPGMYQQMTEQVCDKC  199

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY+ITVDIEKGMQDGQEVVFYEDGEPK+DGEPGDLKFRIRTAPH+QF RE N
Sbjct  200   PNVKFEREGYHITVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHEQFTREVN  259

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DL TTVTITLVQALVGFEKTIKHLDDHLVDI SKGITKPKEV+KFKGEGMP H+SNKKGD
Sbjct  260   DLRTTVTITLVQALVGFEKTIKHLDDHLVDISSKGITKPKEVRKFKGEGMPLHYSNKKGD  319

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             LYV FEVLFPTSLT +QK +IKEVLG
Sbjct  320   LYVKFEVLFPTSLTEDQKKQIKEVLG  345



>ref|XP_002275221.1| PREDICTED: dnaJ protein ERDJ3B [Vitis vinifera]
 emb|CAN72389.1| hypothetical protein VITISV_040417 [Vitis vinifera]
 emb|CBI36928.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/325 (89%), Positives = 312/325 (96%), Gaps = 1/325 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             +IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEINNAYEVLSD
Sbjct  22    SIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLSD  81

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKRNIYDRYGEEGLKQHAASGG  G GMNIQDIFSSFFGGGP  EEEE+I +GDDVI++
Sbjct  82    NEKRNIYDRYGEEGLKQHAASGGRGGGGMNIQDIFSSFFGGGP-AEEEERIVRGDDVIVE  140

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             LDA+LEDLYMGGS+KVWREKN+LKPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+QCP
Sbjct  141   LDATLEDLYMGGSLKVWREKNVLKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQCP  200

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVK+EREGY+ITVDIEKGMQDGQEVVFY+DGEP VDGEPGDLKFRIRTAPHDQF+REGND
Sbjct  201   NVKYEREGYFITVDIEKGMQDGQEVVFYDDGEPIVDGEPGDLKFRIRTAPHDQFRREGND  260

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LHTTVTITLVQALVGFEKTIKHLD+HLV+IGSKGITKPKEV+KFKGEGMP HFS KKGDL
Sbjct  261   LHTTVTITLVQALVGFEKTIKHLDEHLVNIGSKGITKPKEVRKFKGEGMPLHFSTKKGDL  320

Query  430   YVTFEVLFPTSLTAEQKTKIKEVLG  356
             YVTFEVLFP+SLT EQKTKI+E+LG
Sbjct  321   YVTFEVLFPSSLTEEQKTKIQEILG  345



>emb|CDP17087.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/326 (87%), Positives = 310/326 (95%), Gaps = 2/326 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIAAKSYYDILQVP+GAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEINNAYEVLS
Sbjct  21    IAIAAKSYYDILQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLS  80

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKR+IYDRYGEEGLKQHAASGG RG GMNIQDIFS FFGGGP  EEEEKI KGDDVI+
Sbjct  81    DSEKRSIYDRYGEEGLKQHAASGG-RGGGMNIQDIFSQFFGGGP-MEEEEKIVKGDDVIV  138

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+QC
Sbjct  139   ELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQC  198

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK+EREGY++TVDIEKGMQDGQEVVFYEDGE  +DGE GDL+FR+RTA HD F+REGN
Sbjct  199   PNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEAIIDGEAGDLRFRVRTASHDLFRREGN  258

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLHTTVTITLVQALVGFEKTIKHLDDHLVDIG+KG+TKPKEV+KFKGEGMP HFSNKKGD
Sbjct  259   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGTKGVTKPKEVRKFKGEGMPLHFSNKKGD  318

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             LYVTFEVLFPTSLT +QKT+IK +LG
Sbjct  319   LYVTFEVLFPTSLTEDQKTQIKAILG  344



>ref|XP_009766352.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana sylvestris]
Length=346

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/326 (92%), Positives = 313/326 (96%), Gaps = 0/326 (0%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIAAKSYYDILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEAN KFAEINNAYEVLS
Sbjct  21    IAIAAKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANTKFAEINNAYEVLS  80

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EK+NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS FFGGG  EEEEEKI KGDDVI+
Sbjct  81    DSEKKNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSQFFGGGSMEEEEEKIVKGDDVIV  140

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DLDA+LEDLY GGS+KVWREKNILKPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCDQC
Sbjct  141   DLDATLEDLYNGGSLKVWREKNILKPAPGKRQCNCRNEVYHRQIGPGMFQQMTEQVCDQC  200

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY+ITVDIEKGMQDGQEVVFYEDGEPK+DGEPGDLKFRIRTAPHDQFKREGN
Sbjct  201   PNVKFEREGYHITVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDQFKREGN  260

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DL TTVTITLVQALVGFEKTIKHLDDHLVDI SKGITKPKEV+KFKG+GMP HFSNKKGD
Sbjct  261   DLRTTVTITLVQALVGFEKTIKHLDDHLVDISSKGITKPKEVRKFKGKGMPLHFSNKKGD  320

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             LYV FEVLFPTSLT +QK +IKE+LG
Sbjct  321   LYVKFEVLFPTSLTEDQKKQIKEILG  346



>gb|KHG25948.1| DnaJ subfamily B member 11 [Gossypium arboreum]
Length=344

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/326 (87%), Positives = 308/326 (94%), Gaps = 1/326 (0%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLS
Sbjct  20    VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKR IYDRYGEEGLKQHAASGG  G G+NIQDIFSSFFGGGP  EEEEKI KGDDVI+
Sbjct  80    DSEKRGIYDRYGEEGLKQHAASGGRGGMGVNIQDIFSSFFGGGP-VEEEEKIVKGDDVIV  138

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +LDA+LEDLYMGG++KVWREKNILKPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+QC
Sbjct  139   ELDATLEDLYMGGTLKVWREKNILKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQC  198

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
              NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRI TAPHD+F+REGN
Sbjct  199   QNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIHTAPHDRFRREGN  258

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLHTTVTITLVQALVG +KTIKHLDDHLV+IGSKGITKPKEV+KFKGEGMP HFSNKKGD
Sbjct  259   DLHTTVTITLVQALVGLDKTIKHLDDHLVEIGSKGITKPKEVRKFKGEGMPLHFSNKKGD  318

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             L+VT+EVLFPTSL  +QK KIK +LG
Sbjct  319   LFVTYEVLFPTSLAEDQKAKIKSILG  344



>ref|XP_003554541.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max]
 gb|KHN43472.1| DnaJ like subfamily B member 11 [Glycine soja]
Length=343

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/345 (85%), Positives = 317/345 (92%), Gaps = 2/345 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHRG+ L  LL  + YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MAHRGATLFFLLFAICYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAASGG RG GMN QDIF SFFG
Sbjct  61    NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAASGG-RGGGMNFQDIFGSFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GG   EEEEKI KGDDV++DLDA+LEDLYMGG++KVWREKN+LKPA GKRRCNCRNEVYH
Sbjct  120   GG-QMEEEEKIVKGDDVVVDLDATLEDLYMGGTLKVWREKNVLKPASGKRRCNCRNEVYH  178

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             +QIGPGMFQQMTEQVC+QCPNVK+ REGY+ITVDIEKGMQDGQEV+FYEDGEP +DGE G
Sbjct  179   KQIGPGMFQQMTEQVCEQCPNVKYVREGYFITVDIEKGMQDGQEVLFYEDGEPIIDGESG  238

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRIRTAPHD F+REGNDLHTTVTITLVQALVGFEKTIKHLD+HLVDI +K ITKPK+
Sbjct  239   DLRFRIRTAPHDVFRREGNDLHTTVTITLVQALVGFEKTIKHLDEHLVDISTKEITKPKQ  298

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP H SNKKGDLYVTFEVLFPTSLT EQKTKIK +LG
Sbjct  299   VRKFKGEGMPLHMSNKKGDLYVTFEVLFPTSLTEEQKTKIKAILG  343



>ref|XP_010268041.1| PREDICTED: dnaJ protein ERDJ3B [Nelumbo nucifera]
Length=343

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/325 (88%), Positives = 305/325 (94%), Gaps = 2/325 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
               A KSYYDILQV KGAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEINNAYEVLSD
Sbjct  21    TFAGKSYYDILQVQKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKRNIYDRYGEEGLKQHAASGG RG GMNIQDIFS+FFGGGP  EEEEKI KGDDVI+D
Sbjct  81    REKRNIYDRYGEEGLKQHAASGG-RGGGMNIQDIFSTFFGGGP-AEEEEKIVKGDDVIVD  138

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             LDA+LEDLYMGG++KVWREKNILKPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+QCP
Sbjct  139   LDATLEDLYMGGTLKVWREKNILKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQCP  198

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGE GDLKFRIRTAPH++F+REGND
Sbjct  199   NVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGESGDLKFRIRTAPHERFRREGND  258

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LHTTVTITLVQALVGFEKTIKHLD+H VDIGSKGITKPKEV+KFKGEGMP H S KKGDL
Sbjct  259   LHTTVTITLVQALVGFEKTIKHLDEHQVDIGSKGITKPKEVRKFKGEGMPLHLSTKKGDL  318

Query  430   YVTFEVLFPTSLTAEQKTKIKEVLG  356
             YVTFEVLFP+SLT +QKTKIK  LG
Sbjct  319   YVTFEVLFPSSLTEDQKTKIKAALG  343



>ref|XP_009604699.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana tomentosiformis]
Length=347

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/326 (92%), Positives = 312/326 (96%), Gaps = 0/326 (0%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIAAKSYYDILQV KGAS++QIKRAYRKLALKYHPDKN GNEEANKKFAEINNAYEVLS
Sbjct  22    IAIAAKSYYDILQVSKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLS  81

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS FFGGG  EEEEEK+ KGDDVI+
Sbjct  82    DSEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSQFFGGGSMEEEEEKVVKGDDVIV  141

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DLDA+LEDLY GGS+KVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC
Sbjct  142   DLDATLEDLYNGGSLKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  201

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY+ITVDIEKGMQDGQEVVFYEDGEPK+DGEPGDLKFRIRTAPHDQFKREGN
Sbjct  202   PNVKFEREGYHITVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDQFKREGN  261

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DL TTVTITLVQALVGFEKTIKHLDDHLVDI SKGITKPKEV+KFKGEGMP HFS+KKGD
Sbjct  262   DLRTTVTITLVQALVGFEKTIKHLDDHLVDISSKGITKPKEVRKFKGEGMPLHFSDKKGD  321

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             LYV FEVLFPTSLT +QK +IKE+LG
Sbjct  322   LYVKFEVLFPTSLTEDQKKQIKEILG  347



>gb|KHG17469.1| DnaJ subfamily B member 11 [Gossypium arboreum]
Length=344

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/326 (86%), Positives = 307/326 (94%), Gaps = 1/326 (0%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLS
Sbjct  20    VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D EKR IYDRYGEEGLKQHAASGG  G G+NIQDIFSSFFGGGP  EEEEKI KGDDVI+
Sbjct  80    DSEKRGIYDRYGEEGLKQHAASGGRGGMGVNIQDIFSSFFGGGP-VEEEEKIVKGDDVIV  138

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +LDA+LEDLYMGG++KVWREKNILKPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+QC
Sbjct  139   ELDATLEDLYMGGTLKVWREKNILKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQC  198

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
              NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRI TAPHD+F+REGN
Sbjct  199   QNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIHTAPHDRFRREGN  258

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLHTTVTITLVQALVG +KTIKHLDDHLV+IGSKGITKPKEV+KFKGEGMP HFSNKKGD
Sbjct  259   DLHTTVTITLVQALVGLDKTIKHLDDHLVEIGSKGITKPKEVRKFKGEGMPLHFSNKKGD  318

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             L+VT+EVLFP SL  +QK KIK +LG
Sbjct  319   LFVTYEVLFPPSLAEDQKAKIKSILG  344



>ref|XP_003521587.1| PREDICTED: dnaJ homolog subfamily B member 11 [Glycine max]
Length=343

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/345 (85%), Positives = 319/345 (92%), Gaps = 2/345 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA RG+ LL LL  L YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAASGG RG GMN QDIFS+FFG
Sbjct  61    NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAASGG-RGGGMNFQDIFSTFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GGP  EEEEKI KGDD+++DLDA+LEDLYMGG++KVWREKN+LKPAPGKRRCNCRNEVYH
Sbjct  120   GGP-MEEEEKIVKGDDLVVDLDATLEDLYMGGTLKVWREKNVLKPAPGKRRCNCRNEVYH  178

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             +QIGPGMFQQMTEQVC+QCPNVK+ REGY+ITVDIEKGMQDGQEV+FYEDGEP +DGE G
Sbjct  179   KQIGPGMFQQMTEQVCEQCPNVKYVREGYFITVDIEKGMQDGQEVLFYEDGEPIIDGESG  238

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRIRTAPHD F+REGNDLH+TVTITLVQALVGFEKTIKHLD+HLVDI +K ITKPK+
Sbjct  239   DLRFRIRTAPHDVFRREGNDLHSTVTITLVQALVGFEKTIKHLDEHLVDISTKEITKPKQ  298

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP H SNKKGDLYVTFEVLFPTSL  EQKTKIK +LG
Sbjct  299   VRKFKGEGMPLHMSNKKGDLYVTFEVLFPTSLREEQKTKIKAILG  343



>ref|XP_010095300.1| DnaJ homolog subfamily B member 11 [Morus notabilis]
 gb|EXB59329.1| DnaJ homolog subfamily B member 11 [Morus notabilis]
Length=344

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/345 (85%), Positives = 321/345 (93%), Gaps = 1/345 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR SKLL L   L Y+L AIA KS+YD+LQVPKGAS++QIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRSKLLFLFCALCYALSAIAGKSFYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEINNAYEVLSD EKRNIYDRYGEEGLKQHAASGGGRG GMNI DIFS+ FG
Sbjct  61    NEEANKKFAEINNAYEVLSDSEKRNIYDRYGEEGLKQHAASGGGRGGGMNINDIFSNLFG  120

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GG   EEEE+IAKGDDV+++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH
Sbjct  121   GG-TAEEEERIAKGDDVVVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYH  179

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             RQIGPGMFQQMTEQVC+QC NVKFEREGY++TVDIEKGMQDGQEV+FYEDGEP +DGEPG
Sbjct  180   RQIGPGMFQQMTEQVCEQCQNVKFEREGYFVTVDIEKGMQDGQEVLFYEDGEPIIDGEPG  239

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DLKFRIRTAPHD F+REGNDLHT VTITLVQALVGFEKT+KHLDDHLVD+ SKG+T+PKE
Sbjct  240   DLKFRIRTAPHDVFRREGNDLHTIVTITLVQALVGFEKTLKHLDDHLVDVSSKGVTRPKE  299

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP HFS KKGDLYVTFEVLFPTSLT +QKTKIKE+LG
Sbjct  300   VRKFKGEGMPLHFSTKKGDLYVTFEVLFPTSLTEDQKTKIKEILG  344



>gb|KHN19226.1| DnaJ like subfamily B member 11 [Glycine soja]
Length=343

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/345 (84%), Positives = 318/345 (92%), Gaps = 2/345 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA RG+ LL LL  L YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAASGG RG GMN QDIFS+FFG
Sbjct  61    NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAASGG-RGGGMNFQDIFSTFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GGP  EEEEKI KGDD+++DLDA+LEDLYMGG++KVWREKN+LKPA GKRRCNCRNEVYH
Sbjct  120   GGP-MEEEEKIVKGDDLVVDLDATLEDLYMGGTLKVWREKNVLKPASGKRRCNCRNEVYH  178

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             +QIGPGMFQQMTEQVC+QCPNVK+ REGY+ITVDIEKGMQDGQEV+FYEDGEP +DGE G
Sbjct  179   KQIGPGMFQQMTEQVCEQCPNVKYVREGYFITVDIEKGMQDGQEVLFYEDGEPIIDGESG  238

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRIRTAPHD F+REGNDLH+TVTITLVQALVGFEKTIKHLD+HLVDI +K ITKPK+
Sbjct  239   DLRFRIRTAPHDVFRREGNDLHSTVTITLVQALVGFEKTIKHLDEHLVDISTKEITKPKQ  298

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP H SNKKGDLYVTFEVLFPTSL  EQKTKIK +LG
Sbjct  299   VRKFKGEGMPLHMSNKKGDLYVTFEVLFPTSLREEQKTKIKAILG  343



>ref|XP_011079583.1| PREDICTED: dnaJ protein ERDJ3B [Sesamum indicum]
Length=344

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/345 (85%), Positives = 319/345 (92%), Gaps = 1/345 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR SKLL+    +SY L A AAKSYYDILQVP+GAS++QIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRSKLLLFFCFVSYCLFAFAAKSYYDILQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEINNAYEVLSD EKR IYDRYGE+GLKQHAA+GG  G GMNIQDIFSSFFG
Sbjct  61    NEEANKKFAEINNAYEVLSDSEKRGIYDRYGEDGLKQHAANGGRGGGGMNIQDIFSSFFG  120

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GGP  EEEE++ KGDDVI++LDA+LEDLYMGGS+KVWR KN++KPAPGKRRCNCRNEVYH
Sbjct  121   GGP-MEEEERVVKGDDVIVELDATLEDLYMGGSLKVWRVKNVIKPAPGKRRCNCRNEVYH  179

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             +QIGPGMFQQMTEQVC+QCPNVK+EREG +ITVDIEKGMQDGQEVVFYEDGEP VDGE G
Sbjct  180   KQIGPGMFQQMTEQVCEQCPNVKYEREGDFITVDIEKGMQDGQEVVFYEDGEPIVDGEAG  239

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DLKFRIRTAPHD+F+R+GNDLHTTVTITLVQALVGFEKTIKHLD+HLVDI SKGITKPKE
Sbjct  240   DLKFRIRTAPHDRFRRDGNDLHTTVTITLVQALVGFEKTIKHLDEHLVDISSKGITKPKE  299

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KF GEGMP HFSNKKGDLYVTFEVLFPTSLT +QKTKIK +LG
Sbjct  300   VRKFVGEGMPLHFSNKKGDLYVTFEVLFPTSLTEDQKTKIKGILG  344



>ref|XP_008451505.1| PREDICTED: dnaJ homolog subfamily B member 11 [Cucumis melo]
Length=344

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/345 (83%), Positives = 317/345 (92%), Gaps = 1/345 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR +KLL ++  L Y + AIA KSYYDILQV KGASEDQIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRTKLLFVVCALCYVISAIAGKSYYDILQVQKGASEDQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEAN++FAEI+NAYEVLSDGEKRNIYDRYGEEGLKQHAASGG RG GMNIQDIFS FFG
Sbjct  61    NEEANRRFAEISNAYEVLSDGEKRNIYDRYGEEGLKQHAASGG-RGGGMNIQDIFSQFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GG   EEEEKI KGDDVI++LDASLEDLYMGGS++VWREKNILKPAPGKRRCNCRNEVYH
Sbjct  120   GGGGMEEEEKIPKGDDVIVELDASLEDLYMGGSLRVWREKNILKPAPGKRRCNCRNEVYH  179

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             +QIGPGMFQQMTEQVC+QCPNVKFEREGY++TVDIEKGMQDGQEV FYEDGEP +DGE G
Sbjct  180   KQIGPGMFQQMTEQVCEQCPNVKFEREGYFVTVDIEKGMQDGQEVTFYEDGEPMIDGEAG  239

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRI TAPHD F+R+GNDLH T+TITLVQALVGFEK++KHLD+HLV+IG+KGITKPKE
Sbjct  240   DLRFRIHTAPHDVFRRDGNDLHATITITLVQALVGFEKSLKHLDEHLVEIGTKGITKPKE  299

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP HFS KKGDLYVT+EVLFPTSLT +QK  I+++LG
Sbjct  300   VRKFKGEGMPLHFSTKKGDLYVTYEVLFPTSLTEDQKASIQKILG  344



>ref|XP_004136000.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus]
 ref|XP_004163147.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus]
 gb|KGN45000.1| hypothetical protein Csa_7G407530 [Cucumis sativus]
Length=344

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/345 (83%), Positives = 317/345 (92%), Gaps = 1/345 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR +KLL ++  L Y L AIA KSYYDILQV KGAS+DQIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRTKLLFVVCALCYVLSAIAGKSYYDILQVQKGASDDQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANK+FAEI+NAYEVLSDGEKRNIYDRYGEEGLKQHAASGG RG GMNIQDIFS FFG
Sbjct  61    NEEANKRFAEISNAYEVLSDGEKRNIYDRYGEEGLKQHAASGG-RGGGMNIQDIFSQFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GG   EEEEKI KGDDVI++LDASLEDLYMGGS++VWREKNILKPAPGKRRCNCRNEVYH
Sbjct  120   GGGGMEEEEKIPKGDDVIVELDASLEDLYMGGSLRVWREKNILKPAPGKRRCNCRNEVYH  179

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             +QIGPGMFQQMTEQVC+QCPNVKFEREGY++TVDIEKGMQDGQEV FYEDGEP +DGE G
Sbjct  180   KQIGPGMFQQMTEQVCEQCPNVKFEREGYFVTVDIEKGMQDGQEVTFYEDGEPMIDGEAG  239

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRI TAPHD F+R+GNDLH T+TITLVQALVGFEK++KHLD+HLV+IG+KGITKPKE
Sbjct  240   DLRFRIHTAPHDVFRRDGNDLHATITITLVQALVGFEKSLKHLDEHLVEIGTKGITKPKE  299

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP HFS KKGDLYVT+EVLFPTSLT +QK  I+++LG
Sbjct  300   VRKFKGEGMPLHFSTKKGDLYVTYEVLFPTSLTEDQKASIQKILG  344



>ref|XP_006444463.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
 ref|XP_006480056.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Citrus sinensis]
 gb|ESR57703.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
Length=345

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/346 (83%), Positives = 320/346 (92%), Gaps = 2/346 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR ++LL LL  L Y+L  IA KSYY++LQVP+GAS++QIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFF  1034
             NEEANK+FAEINNAYEVLSD E RNIYD YGEEGLKQHAA GG  G   +NIQDIFSSFF
Sbjct  61    NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF  120

Query  1033  GGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GGGP  EE+EKI KGDDVI++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVY
Sbjct  121   GGGP-MEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVY  179

Query  853   HRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEP  674
             H+QIGPGMFQQMTEQVCDQC NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEPK+DGEP
Sbjct  180   HKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDGEP  239

Query  673   GDLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPK  494
             GDLKFRIRTAPHD+F+REGN+LHTTVT+TLVQALVGFEKTI+HLD+HLVDI +KGITKPK
Sbjct  240   GDLKFRIRTAPHDRFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGITKPK  299

Query  493   EVKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             EV+KF GEGMP HFSNKKGDLY+TFEVLFPT+LT +QKT+IKEVLG
Sbjct  300   EVRKFGGEGMPLHFSNKKGDLYITFEVLFPTTLTEDQKTRIKEVLG  345



>ref|XP_003625951.1| DnaJ homolog subfamily B member [Medicago truncatula]
 gb|AES82169.1| DnaJ heat shock family protein [Medicago truncatula]
 gb|AFK39492.1| unknown [Medicago truncatula]
Length=344

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/345 (84%), Positives = 318/345 (92%), Gaps = 1/345 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAH+ +KLL+LL  L YSL AIA KSYYDILQV KGAS+DQIKRAYRKLALKYHPDKNPG
Sbjct  1     MAHQRAKLLLLLCALCYSLSAIAVKSYYDILQVSKGASDDQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEI+NAYEVLSD EKRNIYD+YGEEGLKQHAA GG  G  MN+QDIF+SFFG
Sbjct  61    NEEANKKFAEISNAYEVLSDNEKRNIYDKYGEEGLKQHAAGGGRGGG-MNMQDIFNSFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GG  EEEEEKIAKGDDVI+DLDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH
Sbjct  120   GGSMEEEEEKIAKGDDVIVDLDATLEDLYMGGSLKVWREKNVVKPAPGKRRCNCRNEVYH  179

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             RQIGPGMFQQMTEQVCDQC NVK+ REGY++TVDIEKGM+DGQEV+FYEDGEP +DGE G
Sbjct  180   RQIGPGMFQQMTEQVCDQCANVKYVREGYFVTVDIEKGMKDGQEVLFYEDGEPIIDGESG  239

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRIRTAPH+ FKREGNDLHTTVTITLVQALVGFEKTIKHLD+HLVDI SKGIT PK+
Sbjct  240   DLRFRIRTAPHELFKREGNDLHTTVTITLVQALVGFEKTIKHLDEHLVDISSKGITNPKQ  299

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP H S KKGDLYVTFEVLFPT+L+ EQKTKIK +LG
Sbjct  300   VRKFKGEGMPLHTSTKKGDLYVTFEVLFPTTLSEEQKTKIKSILG  344



>ref|XP_008345236.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Malus domestica]
Length=352

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/324 (86%), Positives = 302/324 (93%), Gaps = 3/324 (1%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29    KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  1138  NIYDRYGEEGLKQHAASGGGRGAGM---NIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDL  968
             +IYDRYGEEGLKQHAA+GG  G G    NI DIFS FFGGG   EEE++I KGDDV+++L
Sbjct  89    SIYDRYGEEGLKQHAATGGRGGGGGMGMNINDIFSEFFGGGRPSEEEDRIIKGDDVVVEL  148

Query  967   DASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  788
             DA+LEDLYMGGS+KVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN
Sbjct  149   DATLEDLYMGGSLKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  208

Query  787   VKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDL  608
             VK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTA HD FKREGNDL
Sbjct  209   VKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAAHDLFKREGNDL  268

Query  607   HTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLY  428
             HTT+TITLVQALVGFEKT+KHLDDHLVDI SKGIT+PKEV+KFKGEGMP HFSNKKGDLY
Sbjct  269   HTTITITLVQALVGFEKTVKHLDDHLVDISSKGITRPKEVRKFKGEGMPLHFSNKKGDLY  328

Query  427   VTFEVLFPTSLTAEQKTKIKEVLG  356
             VTFEVLFP SLT +QKTKIK VLG
Sbjct  329   VTFEVLFPNSLTEDQKTKIKAVLG  352



>ref|XP_004494412.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cicer arietinum]
Length=344

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/345 (85%), Positives = 316/345 (92%), Gaps = 1/345 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR +KLL LL  L YSL AIAAKSYYDILQV KGAS+DQIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRAKLLFLLCALCYSLHAIAAKSYYDILQVSKGASDDQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEINNAYEVLSD EKR+IYDRYGEEGLKQHAA GG  G  MN+QDIF+SFFG
Sbjct  61    NEEANKKFAEINNAYEVLSDSEKRSIYDRYGEEGLKQHAAGGGRGGG-MNMQDIFNSFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GG  EEEEEKI KGDDVI+DLDA+LEDLYMGGS+KVWREKN++K APGKRRCNCRNEVYH
Sbjct  120   GGSMEEEEEKIVKGDDVIVDLDATLEDLYMGGSLKVWREKNVVKSAPGKRRCNCRNEVYH  179

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             RQIGPGMFQQMTEQVCDQCPNVK+ REGY+ITVDIEKGMQDGQEV+FYEDGEP +DGE G
Sbjct  180   RQIGPGMFQQMTEQVCDQCPNVKYVREGYFITVDIEKGMQDGQEVLFYEDGEPIIDGESG  239

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRIRTAPH+ F+REG+DLHTTVTITLVQALVGFEKT+KHLD+HLVDI SKGITKPK+
Sbjct  240   DLRFRIRTAPHEIFRREGSDLHTTVTITLVQALVGFEKTVKHLDEHLVDISSKGITKPKQ  299

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
              +KFKGEGMP H S KKGDLYVTFEVLFPTSLT EQK KIK++LG
Sbjct  300   ERKFKGEGMPLHMSTKKGDLYVTFEVLFPTSLTDEQKIKIKDILG  344



>gb|KDP28236.1| hypothetical protein JCGZ_14007 [Jatropha curcas]
Length=346

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/327 (85%), Positives = 304/327 (93%), Gaps = 2/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIA KSYYDILQVPK AS+DQIKRAYRKLALKYHPDKNPGNEEANK+FAEINNAYEVLS
Sbjct  21    IAIAGKSYYDILQVPKAASDDQIKRAYRKLALKYHPDKNPGNEEANKRFAEINNAYEVLS  80

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGM-NIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
             DGEKRNIYD+YGEEGLKQH ASGG  G    NI D+F  FFGGG   EEEE+I KGDDVI
Sbjct  81    DGEKRNIYDKYGEEGLKQHMASGGRGGGMGMNINDLFRDFFGGG-QTEEEERIVKGDDVI  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             +++DA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+Q
Sbjct  140   VEMDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQ  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             C NVKFEREGY+ITVDIEKGM+DGQEVVFYEDGEP +DGEPGDLKFRIRTAPHD+F+REG
Sbjct  200   CQNVKFEREGYFITVDIEKGMEDGQEVVFYEDGEPVIDGEPGDLKFRIRTAPHDRFRREG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLHTTVTITLVQALVGFEKTIKHLD+HLV+IG+KGITKPKEV+KFKGEGMP HFS KKG
Sbjct  260   NDLHTTVTITLVQALVGFEKTIKHLDEHLVEIGTKGITKPKEVRKFKGEGMPLHFSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             DLYVT+EVLFP SLT +QKTKIK +LG
Sbjct  320   DLYVTYEVLFPMSLTEDQKTKIKAILG  346



>ref|XP_010914541.1| PREDICTED: dnaJ protein ERDJ3B [Elaeis guineensis]
Length=344

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/324 (83%), Positives = 302/324 (93%), Gaps = 1/324 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A   K+YYD+LQV KGASE+QIKRAYRKLALKYHPDKNPGNEEANK+F EINNAYEVLSD
Sbjct  21    AFGGKNYYDVLQVSKGASEEQIKRAYRKLALKYHPDKNPGNEEANKRFTEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKR+IYDRYGEEG+KQHA+SGG RG GMNIQDIF++ FGGG  EEEEE I KGDDV+++
Sbjct  81    REKRSIYDRYGEEGVKQHASSGG-RGGGMNIQDIFNNLFGGGMAEEEEEAIPKGDDVVVE  139

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC+QCP
Sbjct  140   LDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCEQCP  199

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVKFEREGY+ITVDIEKGMQDGQE++FYEDGEPKVDGE GDLKFRIRTAPH+ F+REGND
Sbjct  200   NVKFEREGYFITVDIEKGMQDGQELLFYEDGEPKVDGEAGDLKFRIRTAPHEHFRREGND  259

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LHTTVTI+LVQALVGFEKTIKHLD+HLV++G+KGITKPK V+KFKGEGMP H S +KGDL
Sbjct  260   LHTTVTISLVQALVGFEKTIKHLDEHLVELGTKGITKPKAVRKFKGEGMPSHLSTRKGDL  319

Query  430   YVTFEVLFPTSLTAEQKTKIKEVL  359
             YVT+EVLFP SLT +QKTKIK +L
Sbjct  320   YVTYEVLFPKSLTEDQKTKIKAIL  343



>ref|XP_008797219.1| PREDICTED: dnaJ homolog subfamily B member 11-like isoform X1 
[Phoenix dactylifera]
Length=344

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/323 (84%), Positives = 305/323 (94%), Gaps = 1/323 (0%)
 Frame = -3

Query  1327  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDG  1148
                K+YYD+LQVPKGASE+QIKR+YRKLALKYHPDKNPGNEEANK+FAEINNAYEVLSD 
Sbjct  22    FGGKNYYDVLQVPKGASEEQIKRSYRKLALKYHPDKNPGNEEANKRFAEINNAYEVLSDR  81

Query  1147  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDL  968
             EKR+IYDRYGEEG+KQHA SGG RG GMNIQDIF++FFGGG  EEEEE IAKGDDV+++L
Sbjct  82    EKRSIYDRYGEEGVKQHANSGG-RGGGMNIQDIFNNFFGGGMAEEEEEVIAKGDDVVVEL  140

Query  967   DASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  788
             DA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC+QC N
Sbjct  141   DATLEDLYMGGSLKVWREKNVVKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCEQCSN  200

Query  787   VKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDL  608
             VKFEREGY+ITVDIEKGMQDGQE++FYEDGEPKVDGE GDLKFRI+TAPH++F+REGNDL
Sbjct  201   VKFEREGYFITVDIEKGMQDGQELLFYEDGEPKVDGEAGDLKFRIQTAPHERFRREGNDL  260

Query  607   HTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLY  428
             HTTVTI+LVQALVGFEKTIKHLD+HLV+IG+KGITKPKEV+KFKGEGMP H S KKGDLY
Sbjct  261   HTTVTISLVQALVGFEKTIKHLDEHLVEIGTKGITKPKEVRKFKGEGMPLHLSTKKGDLY  320

Query  427   VTFEVLFPTSLTAEQKTKIKEVL  359
             VT+EVLFP SLT +QKT+IK +L
Sbjct  321   VTYEVLFPKSLTEDQKTRIKAIL  343



>ref|XP_009339791.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pyrus x bretschneideri]
Length=351

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/323 (87%), Positives = 303/323 (94%), Gaps = 2/323 (1%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29    KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  1138  NIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDLD  965
             NIYDRYGEEGLKQHAASGG  G GM  NI DIFS FFGGG   EEE++I KGDDVI++LD
Sbjct  89    NIYDRYGEEGLKQHAASGGRGGGGMGMNINDIFSEFFGGGRPTEEEDRIIKGDDVIVELD  148

Query  964   ASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNV  785
             A+LEDLYMGGS+KVWREKNILKPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCDQC NV
Sbjct  149   ATLEDLYMGGSLKVWREKNILKPAPGKRQCNCRNEVYHRQIGPGMFQQMTEQVCDQCSNV  208

Query  784   KFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLH  605
             K+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTA HD+FKREGN+LH
Sbjct  209   KYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAAHDRFKREGNNLH  268

Query  604   TTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLYV  425
             TT+TITLVQALVGFEKTIKHLDDHLVDI SKGIT+PKEV+KFKGEGMP HFSNKKGDLYV
Sbjct  269   TTITITLVQALVGFEKTIKHLDDHLVDISSKGITRPKEVRKFKGEGMPLHFSNKKGDLYV  328

Query  424   TFEVLFPTSLTAEQKTKIKEVLG  356
             TFEVLFP S+T +QKTKIK VLG
Sbjct  329   TFEVLFPNSVTDDQKTKIKAVLG  351



>ref|XP_009378691.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Pyrus x bretschneideri]
Length=352

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/324 (85%), Positives = 302/324 (93%), Gaps = 3/324 (1%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29    KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  1138  NIYDRYGEEGLKQHAASGGGRGAGM---NIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDL  968
             +IYDRYGEEGLKQHAA+GG  G G    NI DIFS FFGGG   EEE++I KGDDV+++L
Sbjct  89    SIYDRYGEEGLKQHAATGGRGGGGGMGMNINDIFSEFFGGGRPSEEEDRIIKGDDVVVEL  148

Query  967   DASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  788
             DA LEDLYMGGS+KVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN
Sbjct  149   DAILEDLYMGGSLKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  208

Query  787   VKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDL  608
             VK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTA HD+FKREGNDL
Sbjct  209   VKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAAHDRFKREGNDL  268

Query  607   HTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLY  428
             HTT+TITLVQALVGFEKT+KHLDDHLVDI S+GIT+PKEV+KFKGEGMP HFSNKKGDLY
Sbjct  269   HTTITITLVQALVGFEKTVKHLDDHLVDISSRGITRPKEVRKFKGEGMPLHFSNKKGDLY  328

Query  427   VTFEVLFPTSLTAEQKTKIKEVLG  356
             VTFEVLFP SLT +QKT+IK VLG
Sbjct  329   VTFEVLFPNSLTDDQKTRIKAVLG  352



>ref|XP_008386734.1| PREDICTED: dnaJ homolog subfamily B member 11 [Malus domestica]
Length=351

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/324 (86%), Positives = 302/324 (93%), Gaps = 2/324 (1%)
 Frame = -3

Query  1321  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEK  1142
              KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLSD EK
Sbjct  28    GKSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEK  87

Query  1141  RNIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDL  968
             RNIYDRYGE+GL QHAASGG  G GM  NI DIFS FFGGG   EEE++I KG+DV+++L
Sbjct  88    RNIYDRYGEDGLXQHAASGGRGGGGMGMNINDIFSEFFGGGRPTEEEDRIIKGEDVVVEL  147

Query  967   DASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  788
             DA+LEDLYMGGS+KVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC N
Sbjct  148   DATLEDLYMGGSLKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCSN  207

Query  787   VKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDL  608
             VK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTA HD+FKREGNDL
Sbjct  208   VKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAAHDRFKREGNDL  267

Query  607   HTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLY  428
             HTT+TITLVQALVGFEKT+KHLDDHLVDI SKGIT+PKEV+KFKGEGMP HFSNKKGDLY
Sbjct  268   HTTITITLVQALVGFEKTVKHLDDHLVDISSKGITRPKEVRKFKGEGMPLHFSNKKGDLY  327

Query  427   VTFEVLFPTSLTAEQKTKIKEVLG  356
             VTFEVLFP SLT +QKTKIK VLG
Sbjct  328   VTFEVLFPNSLTDDQKTKIKAVLG  351



>ref|XP_007200611.1| hypothetical protein PRUPE_ppa007947mg [Prunus persica]
 gb|EMJ01810.1| hypothetical protein PRUPE_ppa007947mg [Prunus persica]
Length=350

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/328 (85%), Positives = 304/328 (93%), Gaps = 4/328 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKN GNEEANKKFA+INNAYEVLSD
Sbjct  24    AIAGKSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFADINNAYEVLSD  83

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGM---NIQDIFSSFFGGGPNeeeeEKIAKGDDV  980
              EKR+IYDRYGEEGLKQHAASGG  G G    NI DIF+ FFGG  + E+EEKI KGDDV
Sbjct  84    SEKRSIYDRYGEEGLKQHAASGGRGGGGGMGMNINDIFADFFGG-RSMEDEEKIVKGDDV  142

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             +++LDA+LEDLY+GGS+ VWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE+VC+
Sbjct  143   VVELDATLEDLYLGGSLNVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEEVCE  202

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QC NVK+EREGY+ITVDIEKGMQDGQEVVFYEDGEP +DGE GDLKFRI TAPHD+F+RE
Sbjct  203   QCANVKYEREGYFITVDIEKGMQDGQEVVFYEDGEPIIDGEAGDLKFRIHTAPHDRFRRE  262

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLHTT+TITLVQALVGFEKTIKHLDDHLVDIGSKGIT+PKEV+KFKGEGMP HFSNKK
Sbjct  263   GNDLHTTITITLVQALVGFEKTIKHLDDHLVDIGSKGITRPKEVRKFKGEGMPLHFSNKK  322

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             GDLYVTFEVLFPTSLT EQKT+IK VLG
Sbjct  323   GDLYVTFEVLFPTSLTEEQKTRIKAVLG  350



>ref|XP_002320981.2| DNAJ heat shock family protein [Populus trichocarpa]
 gb|EEE99296.2| DNAJ heat shock family protein [Populus trichocarpa]
Length=349

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/327 (85%), Positives = 304/327 (93%), Gaps = 2/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIA KSYY++LQVPKGAS++QIK+AYRKLALKYHPDKN GNEEAN +FAEINNAYEVLS
Sbjct  24    IAIAGKSYYEVLQVPKGASDEQIKKAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  83

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
             D EKRNIYDRYGEEGLKQH ASGG  G G MN QDIFS FFGGG + EEEEKIA+GDDVI
Sbjct  84    DSEKRNIYDRYGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG-SMEEEEKIARGDDVI  142

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+Q
Sbjct  143   VELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQ  202

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             C NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTAPHD F+REG
Sbjct  203   CQNVKYEREGYFLTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAPHDIFRREG  262

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLHTTVTITLVQALVGFEK I+HLD+HLVDI SKGITKPKEV++FKGEGMP HFS K G
Sbjct  263   NDLHTTVTITLVQALVGFEKNIEHLDEHLVDISSKGITKPKEVRRFKGEGMPLHFSTKNG  322

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             DLYVTFEVLFPTSLT +QK +IKEVLG
Sbjct  323   DLYVTFEVLFPTSLTEDQKKRIKEVLG  349



>ref|XP_008355501.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Malus domestica]
Length=352

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/324 (85%), Positives = 299/324 (92%), Gaps = 3/324 (1%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29    KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  1138  NIYDRYGEEGLKQHAASGGGRGAGM---NIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDL  968
             +IYDRYG  GL QHAA+GG  G G    NI DIFS FFGGG   EEE++I KGDDV+++L
Sbjct  89    SIYDRYGXXGLXQHAATGGRGGGGGMGMNINDIFSEFFGGGRPSEEEDRIIKGDDVVVEL  148

Query  967   DASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  788
             DA+LEDLYMGGS+KVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN
Sbjct  149   DATLEDLYMGGSLKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  208

Query  787   VKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDL  608
             VK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTA HD FKREGNDL
Sbjct  209   VKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAAHDLFKREGNDL  268

Query  607   HTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLY  428
             HTT+TITLVQALVGFEKT+KHLDDHLVDI SKGIT+PKEV+KFKGEGMP HFSNKKGDLY
Sbjct  269   HTTITITLVQALVGFEKTVKHLDDHLVDISSKGITRPKEVRKFKGEGMPLHFSNKKGDLY  328

Query  427   VTFEVLFPTSLTAEQKTKIKEVLG  356
             VTFEVLFP SLT +QKTKIK VLG
Sbjct  329   VTFEVLFPNSLTEDQKTKIKAVLG  352



>gb|ABK95286.1| unknown [Populus trichocarpa]
Length=349

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/327 (84%), Positives = 303/327 (93%), Gaps = 2/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIA KSYY++LQVPKGAS++QIK+AYRKLALKYHPDKN GNEEAN +FAEINNAYEVLS
Sbjct  24    IAIAGKSYYEVLQVPKGASDEQIKKAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  83

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
             D EKRNIYDRYGEEGLKQH ASGG  G G MN QDIFS FFGGG + EEEEKIA+GDDVI
Sbjct  84    DSEKRNIYDRYGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG-SMEEEEKIARGDDVI  142

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+Q
Sbjct  143   VELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQ  202

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             C NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTAPHD F+REG
Sbjct  203   CQNVKYEREGYFLTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAPHDIFRREG  262

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLHTTVTITLVQALV FEK I+HLD+HLVDI SKGITKPKEV++FKGEGMP HFS K G
Sbjct  263   NDLHTTVTITLVQALVSFEKNIEHLDEHLVDISSKGITKPKEVRRFKGEGMPLHFSTKNG  322

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             DLYVTFEVLFPTSLT +QK +IKEVLG
Sbjct  323   DLYVTFEVLFPTSLTEDQKKRIKEVLG  349



>ref|XP_004300467.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Fragaria 
vesca subsp. vesca]
Length=342

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/328 (85%), Positives = 306/328 (93%), Gaps = 3/328 (1%)
 Frame = -3

Query  1330  AIAA-KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             AIAA KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKN GNEEAN++FA+INNAYEVLS
Sbjct  15    AIAAGKSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANQRFADINNAYEVLS  74

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGGPNeeeeEKIAKGDDV  980
             D EKR+IYDRYGE+GLKQHAASGG  G GM  NI DIF+ FFGGG + EEE+KI KGDDV
Sbjct  75    DSEKRSIYDRYGEDGLKQHAASGGRGGGGMGMNINDIFADFFGGGRSAEEEDKIIKGDDV  134

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             +I+LDASLEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC+
Sbjct  135   VIELDASLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCE  194

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QC NVK+EREGY+ITVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTAPHD+F+RE
Sbjct  195   QCNNVKYEREGYFITVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAPHDRFRRE  254

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLHTT+TITLVQALVGFEKTI+HLDDHLVDI S+ ITKPKEV+KFKGEGMP HF +KK
Sbjct  255   GNDLHTTITITLVQALVGFEKTIEHLDDHLVDISSQKITKPKEVRKFKGEGMPLHFHSKK  314

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             GDLYV FEVLFPTSLT EQKTKIK VLG
Sbjct  315   GDLYVKFEVLFPTSLTEEQKTKIKAVLG  342



>ref|XP_008235186.1| PREDICTED: dnaJ homolog subfamily B member 11 [Prunus mume]
Length=350

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/328 (85%), Positives = 303/328 (92%), Gaps = 4/328 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA KSYY+ILQVPKGAS++QIKRAYRKLALKYHPDKN GNEEANKKFA+INNAYEVLSD
Sbjct  24    AIAGKSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFADINNAYEVLSD  83

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGM---NIQDIFSSFFGGGPNeeeeEKIAKGDDV  980
              EKR IYDRYGEEGLKQHAASGG  G G    NI DIF+ FFGG  + E+EEKI KGDDV
Sbjct  84    SEKRGIYDRYGEEGLKQHAASGGRGGGGGMGMNINDIFADFFGG-RSMEDEEKIVKGDDV  142

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             +++LDA+LEDLY+GGS+KVWREKN+LKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE+VC+
Sbjct  143   VVELDATLEDLYLGGSLKVWREKNVLKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEEVCE  202

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QC NVK+EREGY+ITVDIEKGMQDGQEVVFYEDGEP +DGE GDLKFRI TAPHD+FKRE
Sbjct  203   QCANVKYEREGYFITVDIEKGMQDGQEVVFYEDGEPIIDGEAGDLKFRIHTAPHDRFKRE  262

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLHTT+TITLVQALVGFEKTIKHLDDHLV IGSKGIT+PKEV+KFKGEGMP HFSNKK
Sbjct  263   GNDLHTTITITLVQALVGFEKTIKHLDDHLVHIGSKGITRPKEVRKFKGEGMPLHFSNKK  322

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             GDLYVTFEVLFPT+LT EQKTKIK VLG
Sbjct  323   GDLYVTFEVLFPTTLTEEQKTKIKAVLG  350



>ref|XP_009383732.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Musa acuminata 
subsp. malaccensis]
Length=354

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/324 (83%), Positives = 300/324 (93%), Gaps = 1/324 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +  KSYYD+LQV KGAS++QIKRAYRKLALKYHPDKN GNEEANK+FAEINNAYEVLSD
Sbjct  31    VLGGKSYYDVLQVSKGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSD  90

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKRNIYDRYGEEGLKQHAA GGGRG GMNIQDIF+ FFG G  E++EE I KGDDVII+
Sbjct  91    SEKRNIYDRYGEEGLKQHAA-GGGRGPGMNIQDIFNEFFGTGHQEDQEESIPKGDDVIIE  149

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQI PGMFQQMTEQVC+QCP
Sbjct  150   LDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIAPGMFQQMTEQVCEQCP  209

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVK+EREGY+ITVDIEKGMQDGQ+V+FYEDGEPK+DGE GDLKFRIRTAPH++F+REGND
Sbjct  210   NVKYEREGYFITVDIEKGMQDGQDVLFYEDGEPKIDGEAGDLKFRIRTAPHERFRREGND  269

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LHTTVTI+L+QALVGFEKTI+HLD+H ++IG+KGITKPKEV+KFKGEGMP H S K+GDL
Sbjct  270   LHTTVTISLLQALVGFEKTIEHLDEHPLEIGTKGITKPKEVRKFKGEGMPLHLSTKRGDL  329

Query  430   YVTFEVLFPTSLTAEQKTKIKEVL  359
             YVTFEVLFP SLT +QK KIK VL
Sbjct  330   YVTFEVLFPKSLTEDQKNKIKSVL  353



>ref|XP_011042226.1| PREDICTED: dnaJ protein ERDJ3B [Populus euphratica]
Length=345

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/327 (84%), Positives = 302/327 (92%), Gaps = 2/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA KSYY++LQVP+GAS+ QIKRAYRKLALKYHPDKN GNEEAN +FAEINNAYEVLS
Sbjct  20    VAIAGKSYYEVLQVPRGASDVQIKRAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
             D EKRNIYDR+GEEGLKQH ASGG  G G MN QDIFS FFGGG   EEEEKI KGDDVI
Sbjct  80    DSEKRNIYDRHGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG-QMEEEEKIVKGDDVI  138

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+Q
Sbjct  139   VELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQ  198

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             C NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTAPHD F+REG
Sbjct  199   CQNVKYEREGYFLTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAPHDVFRREG  258

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TVTITLVQALVGF+KTIKHLD+HLVDI SKGITKPKEV++FKGEGMP HFS KKG
Sbjct  259   NDLHATVTITLVQALVGFKKTIKHLDEHLVDISSKGITKPKEVRRFKGEGMPLHFSTKKG  318

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             DLY+TFEVLFP SL+ +QKTKIKEVLG
Sbjct  319   DLYITFEVLFPASLSEDQKTKIKEVLG  345



>ref|XP_011041488.1| PREDICTED: dnaJ protein ERDJ3B-like [Populus euphratica]
Length=349

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/327 (84%), Positives = 303/327 (93%), Gaps = 2/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IAIA KSYY++LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEAN +FAEINNAYEVLS
Sbjct  24    IAIAGKSYYEVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  83

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
             D EKRNIYDRYGEEGLKQH ASGG  G G MN QDIFS FFGGG + EEEEKI +GDDVI
Sbjct  84    DSEKRNIYDRYGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG-SMEEEEKIVRGDDVI  142

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+Q
Sbjct  143   VELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQ  202

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             C NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTAPHD F+REG
Sbjct  203   CQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAPHDIFRREG  262

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLHTTVTITL QALVGFEK I+HLD+HLVDI SKGITKPKEV++FKGEGMP HFS KKG
Sbjct  263   NDLHTTVTITLFQALVGFEKNIEHLDEHLVDISSKGITKPKEVRRFKGEGMPLHFSTKKG  322

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +LYVTFEVLFPTSLT +QK +I+EVLG
Sbjct  323   NLYVTFEVLFPTSLTEDQKKRIEEVLG  349



>ref|XP_002301501.1| DNAJ heat shock family protein [Populus trichocarpa]
 gb|EEE80774.1| DNAJ heat shock family protein [Populus trichocarpa]
Length=345

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/327 (84%), Positives = 302/327 (92%), Gaps = 2/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA KSYY++LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEAN +FAEI+NAYEVLS
Sbjct  20    VAIAGKSYYEVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANLRFAEISNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
             D EKRNIYDR+GEEGLKQH ASGG  G G MN QDIFS FFGGG   EEEEKI KGDDVI
Sbjct  80    DSEKRNIYDRHGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG-QMEEEEKIVKGDDVI  138

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+Q
Sbjct  139   VELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQ  198

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             C NVK EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRTAPHD F+REG
Sbjct  199   CQNVKHEREGYFLTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTAPHDVFRREG  258

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLHTTVTITLVQALVGF+KT+KHLD+HLVDI SKGITKPKEV++FKGEGMP HFS K G
Sbjct  259   NDLHTTVTITLVQALVGFKKTVKHLDEHLVDISSKGITKPKEVRRFKGEGMPLHFSTKNG  318

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             DLY+TFEVLFP SL+ +QKTKIKEVLG
Sbjct  319   DLYITFEVLFPASLSEDQKTKIKEVLG  345



>ref|XP_002515306.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF47290.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=345

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/346 (84%), Positives = 316/346 (91%), Gaps = 2/346 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA+R +KLL LL  LSY L  I+AKSYYD+LQVPK AS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MAYRKAKLLFLLCALSYVLSVISAKSYYDVLQVPKSASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGM-NIQDIFSSFF  1034
             NEEANK+FAEINNAYEVLSD EKRNIYDRYGEEG+KQH A GG  G    NIQD+FS FF
Sbjct  61    NEEANKRFAEINNAYEVLSDSEKRNIYDRYGEEGIKQHMAGGGRGGGMGMNIQDLFS-FF  119

Query  1033  GGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GGG + EEEEKI KGDDVI+DLDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVY
Sbjct  120   GGGGSMEEEEKIVKGDDVIVDLDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVY  179

Query  853   HRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEP  674
             H+QIGPGMFQQMTEQVC+QC NVKFEREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEP
Sbjct  180   HKQIGPGMFQQMTEQVCEQCQNVKFEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEP  239

Query  673   GDLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPK  494
             GDLKFRIRTA HD+F+REGNDL TTVTITLVQALVGFEKTIKHLD+HLVDIG+KGITKPK
Sbjct  240   GDLKFRIRTAAHDRFRREGNDLRTTVTITLVQALVGFEKTIKHLDEHLVDIGTKGITKPK  299

Query  493   EVKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             EV+KFKGEGMP HFS KKGDLYVTFEVLFPTSLT +QKTKIK  LG
Sbjct  300   EVRKFKGEGMPLHFSTKKGDLYVTFEVLFPTSLTEDQKTKIKATLG  345



>gb|KHF99198.1| DnaJ subfamily B member 11 [Gossypium arboreum]
Length=342

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/326 (83%), Positives = 302/326 (93%), Gaps = 3/326 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA K+YY+ILQVPKGAS++QIKRAYRKLALKYHPDKNPGNEEANK+FA+INNAYEVLS
Sbjct  20    VAIAEKNYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
             D +KR+IYDRYGEEGLKQHAA  GG G G+N+ DIFSSFFGGGP   EEE+I KGDDV +
Sbjct  80    DSQKRSIYDRYGEEGLKQHAARAGG-GMGVNMHDIFSSFFGGGP--IEEERIVKGDDVTV  136

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +L+A+LEDLYMG ++KVWREKNILKPAPGKR CNCRNEVYHRQIGPGMFQQMTEQVC+QC
Sbjct  137   ELEATLEDLYMGSTLKVWREKNILKPAPGKRPCNCRNEVYHRQIGPGMFQQMTEQVCEQC  196

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
              NVKFEREG+ +++DIEKGMQDGQEVVFYEDGEP VDGEPGDLKFRIRTAPHD+F+REG+
Sbjct  197   QNVKFEREGFNVSIDIEKGMQDGQEVVFYEDGEPIVDGEPGDLKFRIRTAPHDRFRREGD  256

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH TVTITLVQALVGFEKTIKHLDDHLV++GSK ITK KEV+KFKGEGMP H S KKGD
Sbjct  257   DLHATVTITLVQALVGFEKTIKHLDDHLVNVGSKDITKHKEVRKFKGEGMPLHSSKKKGD  316

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             LYVT++VLFPTSLT +QK+KIKEVLG
Sbjct  317   LYVTYDVLFPTSLTEDQKSKIKEVLG  342



>ref|XP_010038274.1| PREDICTED: dnaJ protein ERDJ3B [Eucalyptus grandis]
 gb|KCW50097.1| hypothetical protein EUGRSUZ_K03532 [Eucalyptus grandis]
Length=346

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/346 (83%), Positives = 315/346 (91%), Gaps = 1/346 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA+ G KLL LL  L  + IAIA +SYYD+LQVPKGAS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MANPGHKLLFLLCALCSAAIAIAGQSYYDMLQVPKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGM-NIQDIFSSFF  1034
             NEEANKKFA+INNAYEVLSDGEKR IYDRYGEEGLKQHAASGG  G    NIQDIF S F
Sbjct  61    NEEANKKFADINNAYEVLSDGEKRGIYDRYGEEGLKQHAASGGRGGGMGMNIQDIFESMF  120

Query  1033  GGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GGG   EEEE+I KGDDVI++LDA+LEDLYMGGS+KVWREKN++KPAPGKR+CNCRNEVY
Sbjct  121   GGGGRGEEEEQIPKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRQCNCRNEVY  180

Query  853   HRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEP  674
             HRQIGPGMFQQMTEQVC+QC N+K+EREGY++TVDIEKGMQDGQEV F+EDGEPK+DGE 
Sbjct  181   HRQIGPGMFQQMTEQVCEQCQNIKYEREGYFLTVDIEKGMQDGQEVNFFEDGEPKIDGEA  240

Query  673   GDLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPK  494
             GDLKFRIRTAPHD F+REGNDLHTTVTITLVQALVGFEKTIKHLD+HLVDI SKGITKPK
Sbjct  241   GDLKFRIRTAPHDHFRREGNDLHTTVTITLVQALVGFEKTIKHLDEHLVDISSKGITKPK  300

Query  493   EVKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +V+KFKGEGMP +FS KKGDLYVTFEVLFPTSLT +QK+KIK VLG
Sbjct  301   QVRKFKGEGMPLYFSTKKGDLYVTFEVLFPTSLTEDQKSKIKAVLG  346



>ref|XP_007163164.1| hypothetical protein PHAVU_001G211800g [Phaseolus vulgaris]
 gb|ESW35158.1| hypothetical protein PHAVU_001G211800g [Phaseolus vulgaris]
Length=343

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/345 (83%), Positives = 313/345 (91%), Gaps = 2/345 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR  KL  LL  LSYSL AIA KSYYD+LQV KGAS++QIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRIKLFFLLCALSYSLSAIAGKSYYDVLQVSKGASDEQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEINNAYEVLSD EKR IYDRYGEEGLKQHAA GGG G  MN QDIFS+FFG
Sbjct  61    NEEANKKFAEINNAYEVLSDREKRGIYDRYGEEGLKQHAAGGGGGGG-MNFQDIFSTFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GG + EEEEKI KGDDVI++LDA+LEDLYMGG++KVWREKN+LK APGKRRCNCRNEVYH
Sbjct  120   GG-SMEEEEKIVKGDDVIVELDATLEDLYMGGTLKVWREKNVLKSAPGKRRCNCRNEVYH  178

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPG  671
             +QIGPGMFQQMTEQVC+QCPNVK+ REGY++TVDIEKGMQDGQEV+FYEDGEP +DGE G
Sbjct  179   KQIGPGMFQQMTEQVCEQCPNVKYVREGYFVTVDIEKGMQDGQEVLFYEDGEPIIDGESG  238

Query  670   DLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKE  491
             DL+FRIRTAPHD F+RE NDLH+TVTITLVQALVGFEKTIKHLD+HLV+I +K ITKPK+
Sbjct  239   DLRFRIRTAPHDVFRREANDLHSTVTITLVQALVGFEKTIKHLDEHLVNISTKEITKPKQ  298

Query  490   VKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             V+KFKGEGMP H SNKKGDLYVTFEVLFPTSLT EQKTKI+ +LG
Sbjct  299   VRKFKGEGMPLHMSNKKGDLYVTFEVLFPTSLTEEQKTKIQAILG  343



>ref|XP_010931736.1| PREDICTED: dnaJ protein ERDJ3B-like [Elaeis guineensis]
Length=346

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/324 (83%), Positives = 303/324 (94%), Gaps = 1/324 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A+  K+YYD+LQV KGASE+QIKRAYRKLALKYHPDKNPGNE+ANK+FAEINNAYEVLSD
Sbjct  21    ALGGKNYYDVLQVSKGASEEQIKRAYRKLALKYHPDKNPGNEDANKRFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKR+IYDRYGEEG+KQHA S GG G GMN+QDIF+SFFGGG  +EEEE IAKGDDV+++
Sbjct  81    REKRSIYDRYGEEGVKQHA-SRGGGGGGMNMQDIFNSFFGGGMAQEEEEVIAKGDDVVVE  139

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             LDA+LEDLYMGGS++VWREKN +KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC+QCP
Sbjct  140   LDATLEDLYMGGSLRVWREKNTIKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCEQCP  199

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVKFEREGY+ITVDIEKGMQDGQE++FYEDGEPK+DGE GDLKFRIRTAPH +F+REGND
Sbjct  200   NVKFEREGYFITVDIEKGMQDGQELLFYEDGEPKIDGEAGDLKFRIRTAPHVRFRREGND  259

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LH TVTI+LVQALVG EKTI+HLD+HLV+IG+KGITKPKEV+KFKGEGMP H S+KKGDL
Sbjct  260   LHATVTISLVQALVGLEKTIEHLDEHLVEIGTKGITKPKEVRKFKGEGMPLHLSSKKGDL  319

Query  430   YVTFEVLFPTSLTAEQKTKIKEVL  359
             YVT+EVLFP SLT +QKTKIK +L
Sbjct  320   YVTYEVLFPKSLTEDQKTKIKAIL  343



>ref|XP_006855308.1| hypothetical protein AMTR_s00057p00065600 [Amborella trichopoda]
 gb|ERN16775.1| hypothetical protein AMTR_s00057p00065600 [Amborella trichopoda]
Length=343

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 298/325 (92%), Gaps = 2/325 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A+  KS+YDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFA+INNAYEVLSD
Sbjct  21    ALPGKSFYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFADINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKR IYDRYGEEGLKQ  A GG  G  MN QDIF SFFGGGP  EE+E+IAKGDDVI++
Sbjct  81    REKREIYDRYGEEGLKQSQAGGGRGGG-MNFQDIFGSFFGGGP-AEEDERIAKGDDVIVE  138

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             L+A+LEDLYMGGS+K+WREKN+LKPAPGKRRCNCRNEVYH+QIGPGMFQQ+TEQVC+QCP
Sbjct  139   LEATLEDLYMGGSLKIWREKNVLKPAPGKRRCNCRNEVYHKQIGPGMFQQITEQVCEQCP  198

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVK+EREGY+ITVDIEKGM+DGQEV+FYEDGEP +DGE GDLKFRIRTAPHD F REGND
Sbjct  199   NVKYEREGYFITVDIEKGMKDGQEVLFYEDGEPIIDGEAGDLKFRIRTAPHDLFGREGND  258

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LHTTVTITL+QALVGFEKTI+HLD+H VDI SKGITKPKEV+KFKGEGMP + S+KKGDL
Sbjct  259   LHTTVTITLLQALVGFEKTIQHLDEHPVDISSKGITKPKEVRKFKGEGMPWYMSSKKGDL  318

Query  430   YVTFEVLFPTSLTAEQKTKIKEVLG  356
             YV FEV+FPTSLT EQKTKIKEV  
Sbjct  319   YVAFEVIFPTSLTEEQKTKIKEVFA  343



>ref|XP_007051070.1| DNAJ heat shock family protein isoform 1 [Theobroma cacao]
 gb|EOX95227.1| DNAJ heat shock family protein isoform 1 [Theobroma cacao]
Length=344

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 298/325 (92%), Gaps = 1/325 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A KSYY+ILQVP+GAS++QIKRAYRKLALKYHPDKNPGNEEA+K+FAEINNAYEVLSD
Sbjct  21    AFAGKSYYEILQVPRGASDEQIKRAYRKLALKYHPDKNPGNEEADKRFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKR IYDRYGE+GLKQHAASGG  G G N++D F  F  GG   EEEEKI KGDDVI++
Sbjct  81    SEKRGIYDRYGEDGLKQHAASGGRGGMGSNLEDFFGMF-FGGGQAEEEEKIVKGDDVIVE  139

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             LDA+LEDLYMGG++KVWREKNILKPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQVC+QC 
Sbjct  140   LDATLEDLYMGGTLKVWREKNILKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQCQ  199

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRI TAPHD F+REGND
Sbjct  200   NVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIHTAPHDHFRREGND  259

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LHTTVTITLVQALVGFEKTIKHLDDHLVDI SKGITKPKEV+KFKGEGMP + S+KKG+L
Sbjct  260   LHTTVTITLVQALVGFEKTIKHLDDHLVDISSKGITKPKEVRKFKGEGMPLYSSDKKGNL  319

Query  430   YVTFEVLFPTSLTAEQKTKIKEVLG  356
             YVTFEVLFPTSLT +QK KIK VLG
Sbjct  320   YVTFEVLFPTSLTEDQKAKIKAVLG  344



>ref|XP_009414445.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Musa acuminata 
subsp. malaccensis]
Length=344

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/323 (82%), Positives = 295/323 (91%), Gaps = 1/323 (0%)
 Frame = -3

Query  1324  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGE  1145
               KSYYD+LQVPKGASEDQIKRAYRKLALKYHPDKN GNEEANK+FAEINNAYEVLSD E
Sbjct  23    GGKSYYDVLQVPKGASEDQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSE  82

Query  1144  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDLD  965
             KR IYDRYGEEGLKQ+A  GG     MNIQDIF+SFFG G N+EEEE   KGDDV+++LD
Sbjct  83    KRKIYDRYGEEGLKQYAGGGGRGSG-MNIQDIFNSFFGNGQNDEEEEVTPKGDDVVVELD  141

Query  964   ASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNV  785
             A+LEDLYMGG++KVWREKN++KPAPGKRRCNCRNEVYHRQI PGMFQQMTE VC+QCPNV
Sbjct  142   ATLEDLYMGGTLKVWREKNVIKPAPGKRRCNCRNEVYHRQIAPGMFQQMTEMVCEQCPNV  201

Query  784   KFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLH  605
             KFEREGY+ITVDIEKGMQDGQEV+FYEDGEPK+DGE GDLKFRI+TAPH++F+REGNDLH
Sbjct  202   KFEREGYFITVDIEKGMQDGQEVLFYEDGEPKIDGEAGDLKFRIQTAPHERFRREGNDLH  261

Query  604   TTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLYV  425
              TVTI+L+QALVGFEKTIKHLD+HLV+IG+KGITKPKE++KFKGEGMP H S KKGDLY+
Sbjct  262   MTVTISLLQALVGFEKTIKHLDEHLVEIGTKGITKPKEIRKFKGEGMPIHMSTKKGDLYL  321

Query  424   TFEVLFPTSLTAEQKTKIKEVLG  356
             T+EVLFP SLT +QKTKIK VL 
Sbjct  322   TYEVLFPKSLTEDQKTKIKAVLS  344



>ref|XP_008797436.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Phoenix dactylifera]
Length=344

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/324 (82%), Positives = 300/324 (93%), Gaps = 1/324 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A+  K+YYD+LQV  GASE+QIKRAYRKLALKYHPDKNPGNEEANK+FAEI+NAYEVLSD
Sbjct  21    ALGGKNYYDVLQVSTGASEEQIKRAYRKLALKYHPDKNPGNEEANKRFAEISNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKR+IYDRYGEEG+KQHA+SGG  G   NIQDIF+SFFGGG  +EEEE IAKGDDV+++
Sbjct  81    REKRSIYDRYGEEGVKQHASSGGRGGG-RNIQDIFNSFFGGGVAQEEEEVIAKGDDVVVE  139

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             LDA+LEDLYMGGS+ VWREKN++KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC+QCP
Sbjct  140   LDATLEDLYMGGSLGVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCEQCP  199

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVKFEREGY ITVDIEKGMQDGQE++FYEDGEPK+DGE GDLKFRIRTAPH +F+REGND
Sbjct  200   NVKFEREGYSITVDIEKGMQDGQELLFYEDGEPKIDGEAGDLKFRIRTAPHGRFRREGND  259

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LH TVTI+LVQALVGFEK IKHLD+HLV+IG++GITKPKEV+KFKGEGMP H S+KKGDL
Sbjct  260   LHITVTISLVQALVGFEKAIKHLDEHLVEIGTEGITKPKEVRKFKGEGMPLHLSSKKGDL  319

Query  430   YVTFEVLFPTSLTAEQKTKIKEVL  359
             YVT+EVLFP SLT +QKTKIK +L
Sbjct  320   YVTYEVLFPKSLTEDQKTKIKAIL  343



>ref|XP_002439322.1| hypothetical protein SORBIDRAFT_09g004380 [Sorghum bicolor]
 gb|EES17752.1| hypothetical protein SORBIDRAFT_09g004380 [Sorghum bicolor]
Length=350

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/327 (81%), Positives = 299/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEANK+FAEINNAYEVL+
Sbjct  24    VAIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLT  83

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE--KIAKGDDV  980
             D EKR IYDRYGEEGLKQ     GG G  MNIQDIFSSFFGGG    EEE  +I KGD+V
Sbjct  84    DQEKRKIYDRYGEEGLKQFQGGRGGGGG-MNIQDIFSSFFGGGGGGMEEEEEQIVKGDEV  142

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++LDASLEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCD
Sbjct  143   IVELDASLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCD  202

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QCPNVKF REG ++TVDIEKGM+DGQEV+F+E+GEPK+DGEPGDLKFRIRTAPH +F+RE
Sbjct  203   QCPNVKFVREGEFLTVDIEKGMKDGQEVLFFEEGEPKIDGEPGDLKFRIRTAPHSRFRRE  262

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLH TVTI+LVQALVGFEKTIKHLD+HLV+IG+KGITKPKE++KFKGEGMP + SNKK
Sbjct  263   GNDLHATVTISLVQALVGFEKTIKHLDNHLVEIGTKGITKPKEIRKFKGEGMPLYQSNKK  322

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVL  359
             GDLYVTFEVLFP +LT +QK K+K+VL
Sbjct  323   GDLYVTFEVLFPKTLTDDQKAKLKDVL  349



>ref|XP_003519751.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max]
Length=346

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/326 (80%), Positives = 296/326 (91%), Gaps = 3/326 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA KSYYD+L++PKGASE+QIKRAYRKLALKYHPDKNPGN+EANK+FAEINNAYEVLSD
Sbjct  21    AIAGKSYYDVLEIPKGASEEQIKRAYRKLALKYHPDKNPGNQEANKRFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              E+R+IYDRYGEEGLKQHAA GG  G GM    QDIF+SFFGGGP  EEEE+I KGDDV+
Sbjct  81    SERRSIYDRYGEEGLKQHAAGGGRGGGGMGMEFQDIFASFFGGGP-MEEEERIVKGDDVL  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDA+LEDLYMGGS+KVWREKN+LKPA GKR CNCRNE+YH+QIGPGMFQQ TEQVCD+
Sbjct  140   VELDATLEDLYMGGSLKVWREKNVLKPASGKRLCNCRNELYHKQIGPGMFQQFTEQVCDK  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+ER+G++ITVDIEKGMQDGQEV+F+EDGEP +DGE GDL+ RIRTAPHD F+REG
Sbjct  200   CPNVKYERDGHFITVDIEKGMQDGQEVLFFEDGEPIIDGESGDLRIRIRTAPHDLFRREG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLHTTVTITLVQALVGFEKT+KHLD+HLVDI +KGIT PK+V+KFKGEGMP H S KKG
Sbjct  260   NDLHTTVTITLVQALVGFEKTVKHLDEHLVDISTKGITNPKQVRKFKGEGMPLHMSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVL  359
             DLYVTFEVLFP SLT EQKT I  ++
Sbjct  320   DLYVTFEVLFPNSLTEEQKTNIIAII  345



>ref|XP_006293253.1| hypothetical protein CARUB_v10019587mg [Capsella rubella]
 gb|EOA26151.1| hypothetical protein CARUB_v10019587mg [Capsella rubella]
Length=345

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/326 (80%), Positives = 299/326 (92%), Gaps = 2/326 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR IY++YGEEGLKQ +A+GG  G G MN+QDIFSSFFGGG + EEEEK+ KGDDVI+
Sbjct  81    EEKREIYNKYGEEGLKQFSANGGRGGGGGMNMQDIFSSFFGGG-SMEEEEKVVKGDDVIV  139

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCD+C
Sbjct  140   ELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDKC  199

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DGEPGDLKFRIRTAPH++F+R+GN
Sbjct  200   PNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGEPGDLKFRIRTAPHNRFRRDGN  259

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH TV ITLV+ALVGFEK+ KHLDDH VDI SKGITKPKEVKKFKGEGMP H+S KKG+
Sbjct  260   DLHMTVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKGN  319

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             L+VTFEVLFP++LT +QK KIKEV  
Sbjct  320   LFVTFEVLFPSTLTDDQKKKIKEVFA  345



>ref|XP_008656126.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Zea mays]
 gb|AFW81379.1| hypothetical protein ZEAMMB73_185883 [Zea mays]
Length=350

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/327 (80%), Positives = 297/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEANK+FAEINNAYEVL+
Sbjct  24    VAIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLT  83

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeee--EKIAKGDDV  980
             D EK+ IYDRYGEEGLKQ     G  G  MNIQDIFSSFFGGG    EE  ++I KGD+V
Sbjct  84    DQEKKKIYDRYGEEGLKQFQGGRGSGGG-MNIQDIFSSFFGGGGGGMEEEEQQILKGDEV  142

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++LDASLEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCD
Sbjct  143   IVELDASLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCD  202

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QCPNVKF REG ++TVDIEKGM+DGQEV+F+E+GEPK+DGEPGDLKFRIRTA H  FKRE
Sbjct  203   QCPNVKFVREGEFLTVDIEKGMKDGQEVLFFEEGEPKIDGEPGDLKFRIRTALHSHFKRE  262

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLH TVTI+L+QALVGFEKTIKHLD+HLV+IG+KGITKPKE++KFKGEGMP + SNKK
Sbjct  263   GNDLHATVTISLLQALVGFEKTIKHLDNHLVEIGTKGITKPKEIRKFKGEGMPLYQSNKK  322

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVL  359
             GDLYVTFEVLFP +LTA+QK K+K+VL
Sbjct  323   GDLYVTFEVLFPKTLTADQKAKLKDVL  349



>ref|XP_006402365.1| hypothetical protein EUTSA_v10006078mg [Eutrema salsugineum]
 gb|ESQ43818.1| hypothetical protein EUTSA_v10006078mg [Eutrema salsugineum]
Length=346

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/327 (80%), Positives = 298/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              ++ KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEAN+KFAEINNAYEVLSD
Sbjct  21    VLSGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQ AA+GG  G G  MN+QDIFS FFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQFAANGGRGGGGGGMNMQDIFSQFFGGG-SMEEEEKVVKGDDVI  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGS+KVWREKN++KPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCDQ
Sbjct  140   VELEATLEDLYMGGSVKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDQ  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DGEPGDLKFRI+TAPH +F+R+G
Sbjct  200   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGEPGDLKFRIKTAPHARFRRDG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV ITLV+ALVGFEK+ KHLDDH VDI SKGITKPKEVKKFKGEGMP H+S KKG
Sbjct  260   NDLHMTVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIKEV  
Sbjct  320   NLFVTFEVLFPSSLTEDQKKKIKEVFA  346



>gb|KHN08649.1| DnaJ like subfamily B member 11 [Glycine soja]
Length=346

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/326 (80%), Positives = 296/326 (91%), Gaps = 3/326 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA KSYYD+L++PKGASE+QIKRAYRKLALKYHPDKNPGN+EANK+FAEINNAYEVLSD
Sbjct  21    AIAGKSYYDVLEIPKGASEEQIKRAYRKLALKYHPDKNPGNQEANKRFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              E+R+IYDRYGEEGLKQHAA GG  G GM    QDIF+SFFGGGP  EEEE+I KGDDV+
Sbjct  81    SERRSIYDRYGEEGLKQHAAGGGRGGGGMGMEFQDIFASFFGGGP-MEEEERIVKGDDVL  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDA+LEDLYMGGS+KVWREKN+LKPA GKR CNCRNE+YH+QIGPGMFQQ TEQVCD+
Sbjct  140   VELDATLEDLYMGGSLKVWREKNVLKPASGKRLCNCRNELYHKQIGPGMFQQFTEQVCDK  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+ER+G++ITVDIEKGMQDGQEV+F+EDGEP +DGE GDL+ RIRTAPHD F+REG
Sbjct  200   CPNVKYERDGHFITVDIEKGMQDGQEVLFFEDGEPIIDGESGDLRIRIRTAPHDLFRREG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLHTTVTITLVQALVGFEKT+KHLD+HLVDI +KGIT PK+V+KFKGEGMP H S KKG
Sbjct  260   NDLHTTVTITLVQALVGFEKTVKHLDEHLVDIRTKGITNPKQVRKFKGEGMPLHMSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVL  359
             DLYVTFEVLFP SLT EQKT I  ++
Sbjct  320   DLYVTFEVLFPNSLTEEQKTNIIAII  345



>gb|EEE62392.1| hypothetical protein OsJ_17183 [Oryza sativa Japonica Group]
Length=347

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/327 (81%), Positives = 300/327 (92%), Gaps = 3/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A+A KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEANK+FAEINNAYE+L+D
Sbjct  20    AVAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEANKRFAEINNAYEILTD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE--KIAKGDDV  980
              EKR IYDRYGEEGLKQ  A  G G G GMNIQDIFSSFFGGG    EEE  +I KGDDV
Sbjct  80    QEKRKIYDRYGEEGLKQFQAQGGRGGGGGMNIQDIFSSFFGGGGGGMEEEEEQIIKGDDV  139

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++LDASLEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCD
Sbjct  140   IVELDASLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCD  199

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QC NVK+ REG ++TVDIEKGMQDGQEV F+E+GEPK+DGEPGDLKFRIRTAPH++F+RE
Sbjct  200   QCANVKYVREGDFLTVDIEKGMQDGQEVSFFEEGEPKIDGEPGDLKFRIRTAPHERFRRE  259

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLHTTVTI+L+QALVGFEKTIKHLD+H+V+IG+KGITKPKEV+KFKGEGMP + SNKK
Sbjct  260   GNDLHTTVTISLLQALVGFEKTIKHLDNHMVEIGTKGITKPKEVRKFKGEGMPLYQSNKK  319

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVL  359
             GDLYVTFEVLFP +LT +QK+K+K +L
Sbjct  320   GDLYVTFEVLFPKTLTDDQKSKLKSIL  346



>ref|XP_010544978.1| PREDICTED: dnaJ protein ERDJ3B [Tarenaya hassleriana]
Length=346

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/328 (79%), Positives = 299/328 (91%), Gaps = 3/328 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             IA+A KSYYD+LQVP+GAS++QIKRAYRKLALKYHPDKN GNEEAN+KFAEINNAYEVLS
Sbjct  20    IALAGKSYYDVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANRKFAEINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDV  980
             D EKR IY++YGEEGLKQ AA+GG  G    +NI+DIF  FFGGG + EEEEKI KGDDV
Sbjct  80    DSEKREIYNKYGEEGLKQFAANGGRGGGTGGINIEDIFGQFFGGG-SMEEEEKIVKGDDV  138

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++L+ASLEDLYMGGS+KVWREKN+LKPAPGKR+CNCRNE+YHRQIGPGMFQQMTE+VC+
Sbjct  139   IVELEASLEDLYMGGSVKVWREKNVLKPAPGKRKCNCRNEIYHRQIGPGMFQQMTEKVCE  198

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QCPNVK EREGY++TVDIEKGMQDGQEV FYEDGEPK+DGEPGDLKFRI TAPHD+F+R+
Sbjct  199   QCPNVKHEREGYFVTVDIEKGMQDGQEVAFYEDGEPKIDGEPGDLKFRIHTAPHDRFRRD  258

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLH TV I+LV+ALVGF+K+IKHLDD  VDI SKGITKPKEV+K +GEGMP ++SNKK
Sbjct  259   GNDLHMTVNISLVEALVGFQKSIKHLDDRDVDISSKGITKPKEVRKIEGEGMPVYYSNKK  318

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             GDLYVTFEV+FP+SL+ +QK KIKEVL 
Sbjct  319   GDLYVTFEVIFPSSLSDDQKKKIKEVLS  346



>ref|XP_010523978.1| PREDICTED: dnaJ protein ERDJ3B-like [Tarenaya hassleriana]
Length=346

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/326 (81%), Positives = 295/326 (90%), Gaps = 3/326 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVP+GAS++QIKRAYRKLALKYHPDKN GNEEAN+KFAEINNAYEVLSD
Sbjct  21    VLAGKSYYDMLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
             GEKR IYD+YGEEGLKQ AA+GG  G    +NIQDIF  FFGGG + EEEEKI KGDDVI
Sbjct  81    GEKREIYDKYGEEGLKQFAANGGRGGGMGGINIQDIFGQFFGGG-SMEEEEKIVKGDDVI  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDASLEDLYMGGS+KVWREKN+LKPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVC+Q
Sbjct  140   VELDASLEDLYMGGSVKVWREKNVLKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCEQ  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK EREG ++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRIRT PH +F+R+G
Sbjct  200   CPNVKHEREGNFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIRTEPHSRFRRDG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV I+LV+ALVGF+KTIKHLDDH VDI SKGITKPKEV+K KGEGMP ++S KKG
Sbjct  260   NDLHMTVDISLVEALVGFQKTIKHLDDHDVDISSKGITKPKEVRKIKGEGMPVYYSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVL  359
             D+YVTFEV FP+SLT +Q+ KIKEVL
Sbjct  320   DMYVTFEVTFPSSLTDDQRKKIKEVL  345



>ref|XP_002878466.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54725.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/327 (80%), Positives = 298/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQ +A+GG  G G  MN+QDIFSSFFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQFSANGGRGGGGGGMNMQDIFSSFFGGG-SMEEEEKVVKGDDVI  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGS+KVWREKN++KPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCD+
Sbjct  140   VELEATLEDLYMGGSIKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDK  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DGEPGDLKFRIRTAPH +F+R+G
Sbjct  200   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGEPGDLKFRIRTAPHARFRRDG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV ITLV+ALVGFEK+ KHLDDH VDI SKGITKPKEVKKFKGEGMP H+S KKG
Sbjct  260   NDLHMTVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIKEV  
Sbjct  320   NLFVTFEVLFPSSLTDDQKKKIKEVFA  346



>gb|EMT15727.1| DnaJ homolog subfamily B member 11 [Aegilops tauschii]
Length=350

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/327 (81%), Positives = 294/327 (90%), Gaps = 2/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              I  KS+YD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEA K+FAEINNAYEVL+D
Sbjct  24    VIEGKSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTD  83

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE--KIAKGDDVI  977
              EKR IYDRYGEEGLKQ     GG G GMN+QDIFSSFFGGG    EEE  +I KGDDVI
Sbjct  84    QEKRKIYDRYGEEGLKQFQGGRGGGGGGMNMQDIFSSFFGGGGGGMEEEEEQIIKGDDVI  143

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDASLEDLYMGGS+KVWREKNI+KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCDQ
Sbjct  144   VELDASLEDLYMGGSLKVWREKNIIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCDQ  203

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+ REG ++TVDIEKGMQDGQEV F+E+GEPK+DGEPGDLKFRIRTAPHD+F+REG
Sbjct  204   CPNVKYVREGDFLTVDIEKGMQDGQEVSFFEEGEPKIDGEPGDLKFRIRTAPHDRFRREG  263

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TVTI+L+QALVGFEK +KHLD+HLV IGS+G+TKPKEV+KFKGEGMP H SNKKG
Sbjct  264   NDLHATVTISLLQALVGFEKNLKHLDNHLVQIGSQGVTKPKEVRKFKGEGMPLHQSNKKG  323

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             DLYVTFEVLFP +LT +QK K+KEVL 
Sbjct  324   DLYVTFEVLFPKTLTDDQKAKLKEVLA  350



>gb|EAY96619.1| hypothetical protein OsI_18531 [Oryza sativa Indica Group]
Length=347

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/327 (81%), Positives = 299/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEANK+FAEINNAYE+L+D
Sbjct  20    TVAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEANKRFAEINNAYEILTD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE--KIAKGDDV  980
              EKR IYDRYGEEGLKQ  A  G G G GMNIQDIFSSFFGGG    EEE  +I KGDDV
Sbjct  80    QEKRKIYDRYGEEGLKQFQAQGGRGGGGGMNIQDIFSSFFGGGGGGMEEEEEQIIKGDDV  139

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++LDASLEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCD
Sbjct  140   IVELDASLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCD  199

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QC NVK+ REG ++TVDIEKGMQDGQEV F+E+GEPK+DGEPGDLKFRIRTAPH++F+RE
Sbjct  200   QCANVKYVREGDFLTVDIEKGMQDGQEVSFFEEGEPKIDGEPGDLKFRIRTAPHERFRRE  259

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLHTTVTI+L+QALVGFEKTIKHLD+H+V+IG+KGITKPKEV+KFKGEGMP + SNKK
Sbjct  260   GNDLHTTVTISLLQALVGFEKTIKHLDNHMVEIGTKGITKPKEVRKFKGEGMPLYQSNKK  319

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVL  359
             GDLYVTFEVLFP +LT +QK+K+K +L
Sbjct  320   GDLYVTFEVLFPKTLTDDQKSKLKSIL  346



>ref|XP_010468943.1| PREDICTED: dnaJ protein ERDJ3B [Camelina sativa]
Length=346

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/327 (80%), Positives = 297/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQ AA+GG  G G  MN+QDIFSSFFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQFAANGGRGGGGGGMNMQDIFSSFFGGG-SMEEEEKVVKGDDVI  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCD+
Sbjct  140   VELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDK  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DGEPGDLKF+IRTAPH +F+R+G
Sbjct  200   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGEPGDLKFKIRTAPHARFRRDG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV ITLV+ALVGFEK+ KHLDDH VDI S GITKPKEVKKFKGEGMP H+S KKG
Sbjct  260   NDLHMTVNITLVEALVGFEKSFKHLDDHEVDISSTGITKPKEVKKFKGEGMPLHYSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIKEV  
Sbjct  320   NLFVTFEVLFPSSLTDDQKKKIKEVFA  346



>ref|XP_010512648.1| PREDICTED: dnaJ protein ERDJ3B-like [Camelina sativa]
Length=347

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/328 (80%), Positives = 297/328 (91%), Gaps = 4/328 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG---MNIQDIFSSFFGGGPNeeeeEKIAKGDDV  980
              EKR IY++YGEEGLKQ AA+GG  G G   MN+QDIFSSFFGGG + EEEEK+ KGDDV
Sbjct  81    EEKREIYNKYGEEGLKQFAANGGRGGGGGGGMNMQDIFSSFFGGG-SMEEEEKVVKGDDV  139

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCD
Sbjct  140   IVELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCD  199

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DGEPGDLKF+IRTAPH +F+R+
Sbjct  200   KCPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGEPGDLKFKIRTAPHARFRRD  259

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLH TV ITLV+ALVGFEK+ KHLDDH VDI S GITKPKEVKKFKGEGMP H+S KK
Sbjct  260   GNDLHMTVNITLVEALVGFEKSFKHLDDHEVDISSTGITKPKEVKKFKGEGMPLHYSTKK  319

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             G+L+VTFEVLFP+SLT +QK KIKEV  
Sbjct  320   GNLFVTFEVLFPSSLTDDQKKKIKEVFA  347



>ref|NP_191819.1| DNAJ heat shock protein ATERDJ3B [Arabidopsis thaliana]
 sp|Q9LZK5.1|DNJ19_ARATH RecName: Full=DnaJ protein ERDJ3B; AltName: Full=Chaperone protein 
dnaJ 19; Short=AtDjB19; Short=AtJ19; AltName: Full=Endoplasmic 
reticulum dnaJ domain-containing protein 3B; Short=AtERdj3B; 
AltName: Full=Protein SCJ1 homolog ERDJ3B; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB83110.1| putative protein [Arabidopsis thaliana]
 gb|AAM19802.1| AT3g62600/F26K9_30 [Arabidopsis thaliana]
 gb|AAM65179.1| unknown [Arabidopsis thaliana]
 gb|AAM78044.1| At3g62600/F26K9_30 [Arabidopsis thaliana]
 gb|AEE80368.1| DNAJ heat shock family protein [Arabidopsis thaliana]
Length=346

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/327 (80%), Positives = 297/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQ +A+GG  G G  MN+QDIFSSFFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQFSANGGRGGGGGGMNMQDIFSSFFGGG-SMEEEEKVVKGDDVI  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCD+
Sbjct  140   VELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDK  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DG+PGDLKFRIRTAPH +F+R+G
Sbjct  200   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIRTAPHARFRRDG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH  V ITLV+ALVGFEK+ KHLDDH VDI SKGITKPKEVKKFKGEGMP H+S KKG
Sbjct  260   NDLHMNVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIKEV  
Sbjct  320   NLFVTFEVLFPSSLTDDQKKKIKEVFA  346



>ref|XP_010679350.1| PREDICTED: dnaJ protein ERDJ3B [Beta vulgaris subsp. vulgaris]
Length=348

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/328 (83%), Positives = 297/328 (91%), Gaps = 3/328 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
              AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKN GNEEANKKFAEINNAYEVL+
Sbjct  22    FAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLT  81

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMN--IQDIFSSFFGGGPNeeeeEKIAKGDDV  980
             DGEKR IYDRYGEEGLKQ+AASGG  G+G     QDIFS FFGGG  EEEE+   KGDDV
Sbjct  82    DGEKRKIYDRYGEEGLKQYAASGGRGGSGGGMGFQDIFSQFFGGGMEEEEEKV-VKGDDV  140

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ASLEDLYMGG++KVWREKN++KPA GKR CNCRNEVYHRQIGPGM+QQ+TEQVCD
Sbjct  141   IVDLEASLEDLYMGGTLKVWREKNVIKPASGKRDCNCRNEVYHRQIGPGMYQQITEQVCD  200

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +C NVKFEREGY +TVDIEKGM+DGQE+ F+EDGEPK+DGE GDLKFRIRTAPHD F R+
Sbjct  201   KCANVKFEREGYSLTVDIEKGMKDGQEITFWEDGEPKIDGEAGDLKFRIRTAPHDVFNRD  260

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDL TTVTITLVQALVGFEKTIKHLD HLVDI S+G+TKPKEVKKFKGEGMP H SNKK
Sbjct  261   GNDLRTTVTITLVQALVGFEKTIKHLDGHLVDISSEGVTKPKEVKKFKGEGMPLHLSNKK  320

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             GDLYVTFEVLFP+SLT +QK KIKE+LG
Sbjct  321   GDLYVTFEVLFPSSLTKDQKVKIKEILG  348



>dbj|BAK07410.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/327 (80%), Positives = 294/327 (90%), Gaps = 2/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              I  KS+YD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEA K+FAEINNAYEVL+D
Sbjct  24    VIEGKSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTD  83

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE--KIAKGDDVI  977
              EKR +YDRYGEEGLKQ     GG G GMN+QDIFSSFFGGG    EEE  +I KGDDVI
Sbjct  84    QEKRKVYDRYGEEGLKQFQGGRGGGGGGMNMQDIFSSFFGGGGGGMEEEEEQIIKGDDVI  143

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDASLEDLYMGGS+KVWREKNI+KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCDQ
Sbjct  144   VELDASLEDLYMGGSLKVWREKNIIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCDQ  203

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+ REG ++TVDIEKGMQDGQEV F+E+GEPK+DGEPGDLKFRIRTAPHD+F+REG
Sbjct  204   CPNVKYVREGDFLTVDIEKGMQDGQEVSFFEEGEPKIDGEPGDLKFRIRTAPHDRFRREG  263

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TVTI+L+QALVGFEK +KHLD+HLV IGS+G+TKPKEV+KFKGEGMP H SNKKG
Sbjct  264   NDLHATVTISLLQALVGFEKNLKHLDNHLVQIGSQGVTKPKEVRKFKGEGMPLHQSNKKG  323

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             DLYVTFEVLFP +LT +QK K+K+VL 
Sbjct  324   DLYVTFEVLFPKTLTDDQKAKLKDVLA  350



>ref|XP_010413269.1| PREDICTED: dnaJ protein ERDJ3B-like [Camelina sativa]
Length=346

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/327 (80%), Positives = 297/327 (91%), Gaps = 3/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQ AA+GG  G G  MN+QDIF SFFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQFAANGGRGGGGGGMNMQDIFGSFFGGG-SMEEEEKVVKGDDVI  139

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCRNEVYHRQIGPGMFQQMTEQVCD+
Sbjct  140   VELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDK  199

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DGEPGDLKF+IRTAPH +F+R+G
Sbjct  200   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGEPGDLKFKIRTAPHARFRRDG  259

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV +TLV+ALVGFEK+ KHLDDH VDI S GITKPKEVKKFKGEGMP H+S KKG
Sbjct  260   NDLHMTVNVTLVEALVGFEKSFKHLDDHEVDISSTGITKPKEVKKFKGEGMPLHYSTKKG  319

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIKEVL 
Sbjct  320   NLFVTFEVLFPSSLTDDQKKKIKEVLA  346



>emb|CDY59898.1| BnaC06g43160D [Brassica napus]
Length=347

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/327 (80%), Positives = 297/327 (91%), Gaps = 2/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              I   SYYD+LQVPKGAS++ IKRAYRKLALKYHPDKNPGN+EA +KFA+INNAYEVLSD
Sbjct  21    VIRVFSYYDVLQVPKGASDEHIKRAYRKLALKYHPDKNPGNDEATRKFADINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQHAA+GG  G G  MN+QDIFS FFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQHAANGGRGGGGGGMNMQDIFSQFFGGGGSTEEEEKVVKGDDVI  140

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCR+EVYHRQIGPGMFQQMTEQVCD+
Sbjct  141   VELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRDEVYHRQIGPGMFQQMTEQVCDK  200

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVKFEREGY++TVDIEKGM+DG+EV FYEDGEP +DGEPGDLKFRI+TAPH +F+R+G
Sbjct  201   CPNVKFEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGEPGDLKFRIKTAPHARFRRDG  260

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV ITLV+ALVGFEK+ KHLDDH VDI SKGITKPKEVKKFKGEGMP HFS KKG
Sbjct  261   NDLHMTVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEVKKFKGEGMPLHFSTKKG  320

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIKEVL 
Sbjct  321   NLFVTFEVLFPSSLTEDQKKKIKEVLA  347



>emb|CDX89142.1| BnaA04g00440D [Brassica napus]
Length=347

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/327 (80%), Positives = 300/327 (92%), Gaps = 2/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFA+INNAYEVLSD
Sbjct  21    VIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFADINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQHAA+GG  G G  MN+QDIFS FFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQHAANGGRGGGGGGMNMQDIFSQFFGGGGSREEEEKVVKGDDVI  140

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGS+KVWREKN++KPAPGKR+CNCRNEVYHRQ+GPGMFQQMTEQVCD+
Sbjct  141   VELEATLEDLYMGGSVKVWREKNVIKPAPGKRKCNCRNEVYHRQVGPGMFQQMTEQVCDK  200

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DG+PGDLKFRI+TAPH +F+R+G
Sbjct  201   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIKTAPHARFQRDG  260

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV ITLV+ALVGFEK+ KHLDDH VDIGSKGITKPKEVKKFKGEGMP H+S KKG
Sbjct  261   NDLHMTVNITLVEALVGFEKSFKHLDDHEVDIGSKGITKPKEVKKFKGEGMPLHYSTKKG  320

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIK+VL 
Sbjct  321   NLFVTFEVLFPSSLTDDQKKKIKQVLA  347



>emb|CDY63310.1| BnaC04g54960D [Brassica napus]
Length=347

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/327 (80%), Positives = 299/327 (91%), Gaps = 2/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFA+INNAYEVLSD
Sbjct  21    VIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFADINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQHAASGG  G G  MN+QDIFS FFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQHAASGGRGGGGGGMNMQDIFSQFFGGGGSREEEEKVVKGDDVI  140

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGS+KVWREKN++KPAPGKR+CNCRNEVYHRQ+GPGMFQQMTEQVCD+
Sbjct  141   VELEATLEDLYMGGSVKVWREKNVIKPAPGKRKCNCRNEVYHRQVGPGMFQQMTEQVCDK  200

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DG+PGDLKFRI+TAPH +F+R+G
Sbjct  201   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIKTAPHARFRRDG  260

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV ITLV+ALVGFEK+ K LDDH VDIGSKGITKPKEVKKFKGEGMP H+S KKG
Sbjct  261   NDLHMTVNITLVEALVGFEKSFKQLDDHEVDIGSKGITKPKEVKKFKGEGMPLHYSTKKG  320

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIK+VL 
Sbjct  321   NLFVTFEVLFPSSLTDDQKKKIKQVLA  347



>ref|XP_008649372.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Zea mays]
 gb|AFW77262.1| hypothetical protein ZEAMMB73_740805 [Zea mays]
Length=350

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/326 (81%), Positives = 297/326 (91%), Gaps = 3/326 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEANK+FAEINNAYEVL+D
Sbjct  25    AIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLTD  84

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE--KIAKGDDVI  977
              EKR IYD+YGEEGLKQ    GGG G  MNIQDIF +FFGGG    EEE  +I KGD+VI
Sbjct  85    QEKRKIYDQYGEEGLKQFQGGGGGGGG-MNIQDIFRNFFGGGGGGMEEEEEQILKGDEVI  143

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++LDASLEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCDQ
Sbjct  144   VELDASLEDLYMGGSVKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCDQ  203

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVKF REG ++TVDIEKGM+D QEV+F+E+GEPK+DGEPGDLKFRIRTAPHD+F+R+G
Sbjct  204   CPNVKFVREGEFLTVDIEKGMKDAQEVLFFEEGEPKIDGEPGDLKFRIRTAPHDRFRRDG  263

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TVTITL+QALVGFEKTI HLD+HLV+IG+KGITKPKE++KFKGEGMP + SNKKG
Sbjct  264   NDLHATVTITLLQALVGFEKTINHLDNHLVEIGTKGITKPKEIRKFKGEGMPLYQSNKKG  323

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVL  359
             DLYVTFEVLFP +LT EQK K+K+VL
Sbjct  324   DLYVTFEVLFPKTLTDEQKGKLKDVL  349



>emb|CDX76646.1| BnaC08g32320D [Brassica napus]
Length=346

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/326 (80%), Positives = 295/326 (90%), Gaps = 1/326 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
               A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VFAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR +Y+RYGEEGLKQHAA+GG  G G MN+QDIFS FFGGG + EEEEK+ KGDDVI+
Sbjct  81    EEKREVYNRYGEEGLKQHAANGGRGGGGGMNMQDIFSQFFGGGGSMEEEEKVVKGDDVIV  140

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +L+A+LEDLYMGGSMKVWREKN++KPAPGKR CNCR+EVYHRQIGPGMFQQMTEQVCD+C
Sbjct  141   ELEATLEDLYMGGSMKVWREKNVIKPAPGKRNCNCRDEVYHRQIGPGMFQQMTEQVCDKC  200

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY++TVDIEKGM+DG+EV FYEDGEP +DG+PGDLKFRI+TAPH +F+R+GN
Sbjct  201   PNVKFEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIKTAPHARFRRDGN  260

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH  V ITLV+ALVGFEK+ KHLD+H VDI SKGITKPKEVKKFKGEGMP H+S KKG 
Sbjct  261   DLHMNVNITLVEALVGFEKSFKHLDEHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKGS  320

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             L+VTFEVLFP+SLT +QK KIKEVL 
Sbjct  321   LFVTFEVLFPSSLTEDQKKKIKEVLA  346



>ref|XP_009116921.1| PREDICTED: dnaJ homolog subfamily B member 11 [Brassica rapa]
 emb|CDY11430.1| BnaA09g39960D [Brassica napus]
Length=346

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/326 (80%), Positives = 295/326 (90%), Gaps = 1/326 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
               A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFAEINNAYEVLSD
Sbjct  21    VFAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR +Y+RYGEEGLKQHAA+GG  G G MN+QDIFS FFGGG + EEEEK+ KGDDVI+
Sbjct  81    EEKREVYNRYGEEGLKQHAANGGRGGGGGMNMQDIFSQFFGGGGSMEEEEKVVKGDDVIV  140

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +L+A+LEDLYMGGSMKVWREKN++KPAPGKR CNCR+EVYHRQIGPGMFQQMTEQVCD+C
Sbjct  141   ELEATLEDLYMGGSMKVWREKNVIKPAPGKRNCNCRDEVYHRQIGPGMFQQMTEQVCDKC  200

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKFEREGY++TVDIEKGM+DG+EV FYEDGEP +DG+PGDLKFRI+TAPH +F+R+GN
Sbjct  201   PNVKFEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIKTAPHARFRRDGN  260

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH  V ITLV+ALVGFEK+ KHLD+H VDI SKGITKPKEVKKFKGEGMP H+S KKG 
Sbjct  261   DLHMNVNITLVEALVGFEKSFKHLDEHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKGS  320

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             L+VTFEVLFP+SLT +QK KIKEVL 
Sbjct  321   LFVTFEVLFPSSLTEDQKKKIKEVLA  346



>ref|XP_009138725.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Brassica 
rapa]
Length=347

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/327 (80%), Positives = 299/327 (91%), Gaps = 2/327 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKN GNEEA +KFA+INNAYEVLSD
Sbjct  21    VIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFADINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG--MNIQDIFSSFFGGGPNeeeeEKIAKGDDVI  977
              EKR IY++YGEEGLKQHAA+GG  G G  MN+QDIFS FFGGG + EEEEK+ KGDDVI
Sbjct  81    EEKREIYNKYGEEGLKQHAANGGRGGGGGGMNMQDIFSQFFGGGGSREEEEKVVKGDDVI  140

Query  976   IDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQ  797
             ++L+A+LEDLYMGGS+KVWREKN +KPAPGKR+CNCRNEVYHRQ+GPGMFQQMTEQVCD+
Sbjct  141   VELEATLEDLYMGGSVKVWREKNEIKPAPGKRKCNCRNEVYHRQVGPGMFQQMTEQVCDK  200

Query  796   CPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREG  617
             CPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DG+PGDLKFRI+TAPH +F+R+G
Sbjct  201   CPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIKTAPHARFRRDG  260

Query  616   NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKG  437
             NDLH TV ITLV+ALVGFEK+ KHLDDH VDIGSKGITKPKEVKKFKGEGMP H+S KKG
Sbjct  261   NDLHMTVNITLVEALVGFEKSFKHLDDHDVDIGSKGITKPKEVKKFKGEGMPLHYSTKKG  320

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +L+VTFEVLFP+SLT +QK KIK+VL 
Sbjct  321   NLFVTFEVLFPSSLTDDQKKKIKQVLA  347



>ref|XP_004977083.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Setaria italica]
Length=349

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/325 (80%), Positives = 296/325 (91%), Gaps = 2/325 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEA K+FAEINNAYEVL+D
Sbjct  25    AIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEATKRFAEINNAYEVLTD  84

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE-KIAKGDDVII  974
              EKR IYDRYGEEGLKQ    GGG G  MNIQDIFSSFFGGG   EEEE +I KGD+V++
Sbjct  85    QEKRKIYDRYGEEGLKQFQGRGGGGGG-MNIQDIFSSFFGGGGGMEEEEEQILKGDEVVV  143

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +LDASLEDLYMGGS+KVWREKN++KPA GKR+CNCRNEVYHRQIGPGM+QQMTEQVCDQC
Sbjct  144   ELDASLEDLYMGGSLKVWREKNVIKPAAGKRQCNCRNEVYHRQIGPGMYQQMTEQVCDQC  203

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVKF REG ++TVDIEKGMQDGQEV+F+E+GEPK+DGEPGDLKFRIRTAPH +F+REGN
Sbjct  204   PNVKFVREGEFLTVDIEKGMQDGQEVLFFEEGEPKIDGEPGDLKFRIRTAPHGRFRREGN  263

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH T TI+L+QALVGFEKTIKHLD+HLV+IG+K ITKPKE++KFKGEGMP + SNKKGD
Sbjct  264   DLHATATISLLQALVGFEKTIKHLDNHLVEIGTKSITKPKEIRKFKGEGMPLYQSNKKGD  323

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVL  359
             LYVTFEVLFP +LT +QK K+K++L
Sbjct  324   LYVTFEVLFPKTLTDDQKAKLKDIL  348



>ref|XP_003568885.1| PREDICTED: dnaJ protein ERDJ3B [Brachypodium distachyon]
Length=350

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/326 (80%), Positives = 295/326 (90%), Gaps = 2/326 (1%)
 Frame = -3

Query  1327  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDG  1148
             I  KS+YD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEA K+FAEINNAYEVL+D 
Sbjct  25    IEGKSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTDQ  84

Query  1147  EKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE-KIAKGDDVII  974
             EKR IYDRYGEEGLKQ      GG G GMN+QDIFSSFFGGG   EEEE +I KGDDVI+
Sbjct  85    EKRKIYDRYGEEGLKQFQGGGRGGGGGGMNMQDIFSSFFGGGGGMEEEEEQIIKGDDVIV  144

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +LDASLEDLYMGGS+KVWREKNI+KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCDQC
Sbjct  145   ELDASLEDLYMGGSLKVWREKNIIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCDQC  204

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
              NVK+ R+G ++TVDIEKGMQDGQEV F+E+GEPK+DGEPGDLKFRIRTAPH++F+REGN
Sbjct  205   ANVKYVRDGEFLTVDIEKGMQDGQEVSFFEEGEPKIDGEPGDLKFRIRTAPHERFRREGN  264

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH TVTI+L+QALVGFEKT+KHLD+HLV IG+KG+TKPKEV+KFKGEGMP H SNKKGD
Sbjct  265   DLHATVTISLLQALVGFEKTLKHLDNHLVQIGTKGVTKPKEVRKFKGEGMPLHQSNKKGD  324

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             LYV FEVLFP +LT +QKTK+K+VL 
Sbjct  325   LYVAFEVLFPKTLTEDQKTKLKDVLA  350



>gb|KFK35429.1| hypothetical protein AALP_AA5G283300 [Arabis alpina]
Length=348

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/348 (77%), Positives = 308/348 (89%), Gaps = 3/348 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA R SKL   L  LSY++  +A KSYYD+LQVPKGA+++QIKRAYRKLALKYHPDKN G
Sbjct  1     MAIRSSKLCFALFALSYAICVLAGKSYYDVLQVPKGATDEQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAG---MNIQDIFSS  1040
             NEEA +KFA+INNAYEVLSD EKR IY++YGEEGLKQ AA+GG  G G   MN+QDIFS 
Sbjct  61    NEEATRKFADINNAYEVLSDEEKREIYNKYGEEGLKQFAANGGRGGGGGGGMNMQDIFSQ  120

Query  1039  FFGGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNE  860
             FFGGG + EEEEK+ KGDDVI++L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCRNE
Sbjct  121   FFGGGGSMEEEEKVVKGDDVIVELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNE  180

Query  859   VYHRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDG  680
             VYHRQIGPGMFQQMTEQVCDQCPNVK+EREGY++TVDIEKGM+DG+EV FYEDGEP +DG
Sbjct  181   VYHRQIGPGMFQQMTEQVCDQCPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDG  240

Query  679   EPGDLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITK  500
             EPGDLKF+I+TAPH  F+R+ NDLH TV ITLV+ALVGFEK+ KHLD+H VDIGSKGITK
Sbjct  241   EPGDLKFKIKTAPHALFRRDANDLHMTVNITLVEALVGFEKSFKHLDEHEVDIGSKGITK  300

Query  499   PKEVKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             PKEVKKFKGEGMP H+S KKG+L+VTFEVLFP+SLT +QK KIKEV  
Sbjct  301   PKEVKKFKGEGMPLHYSTKKGNLFVTFEVLFPSSLTDDQKKKIKEVFA  348



>ref|XP_006655011.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Oryza brachyantha]
Length=346

 Score =   516 bits (1330),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 261/328 (80%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A+A KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEA K+FAEINNAYEVL+D
Sbjct  19    AVAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEATKRFAEINNAYEVLTD  78

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGP--NeeeeEKIAKGDDV  980
              EKR IYDRYGEEGLKQ  A  G G G GMNIQDIFSSFFGGG    E+EEE+I KGDDV
Sbjct  79    QEKRKIYDRYGEEGLKQFQAQGGRGGGGGMNIQDIFSSFFGGGGGGTEDEEEQIIKGDDV  138

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++LDASLEDLYMGGS+K+WREKN++KPAPG RRCNCRNEVYHRQIGPGM+QQMTEQVCD
Sbjct  139   IVELDASLEDLYMGGSLKIWREKNVIKPAPGNRRCNCRNEVYHRQIGPGMYQQMTEQVCD  198

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QC NVK+ REG ++TVDIEKGMQDGQEV F+E+GEPK+DGEPGDLKFRIRTAPH++F+RE
Sbjct  199   QCANVKYVREGDFLTVDIEKGMQDGQEVSFFEEGEPKIDGEPGDLKFRIRTAPHERFRRE  258

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLHTTVTI+L+QALVGFEKTIKHLD+H+V++G+KG+TKPKEV+KFKGEGMP + SNKK
Sbjct  259   GNDLHTTVTISLLQALVGFEKTIKHLDNHMVEVGTKGVTKPKEVRKFKGEGMPLYQSNKK  318

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             GDLY+TFEVLFP +LT +QKT++K +L 
Sbjct  319   GDLYITFEVLFPKTLTDDQKTELKGILA  346



>gb|ACN40755.1| unknown [Picea sitchensis]
Length=349

 Score =   492 bits (1266),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 252/328 (77%), Positives = 291/328 (89%), Gaps = 3/328 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             +IA K+ YD+LQVPKGASEDQ+K+AYRKLALKYHPDKNPGNEEA K+FAEINNAYEVL+D
Sbjct  21    SIAGKNLYDVLQVPKGASEDQMKKAYRKLALKYHPDKNPGNEEATKRFAEINNAYEVLTD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeE--KIAKGDDV  980
              EKR IYDRYGEEGLKQHAASGGGRG G MN QDIFSSFFGGG  + EEE  K  KG DV
Sbjct  81    REKREIYDRYGEEGLKQHAASGGGRGGGGMNFQDIFSSFFGGGGGQSEEEEEKTVKGHDV  140

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL A+LEDLYMG S+KVWREKN++KPAPGKR+CNCRNEVYH+QIGPGMFQQ+T+QVC+
Sbjct  141   IVDLHATLEDLYMGSSLKVWREKNVVKPAPGKRQCNCRNEVYHKQIGPGMFQQITQQVCE  200

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK+EREG ++TVDIEKGM+DGQE+VFYEDGEP VDGE GDLKF+I TAPH++F+RE
Sbjct  201   ECPNVKYEREGEFVTVDIEKGMRDGQEIVFYEDGEPTVDGEAGDLKFKIYTAPHERFRRE  260

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLHTTVTI+L  +LVGFEK+I HLD H V +GSKGITKPKEV++ +GEGMP H S  K
Sbjct  261   GNDLHTTVTISLRDSLVGFEKSIPHLDGHSVAVGSKGITKPKEVRRIRGEGMPVHLSTNK  320

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             G+L+VT+EVLFP+SLT EQK KIKEV  
Sbjct  321   GNLFVTYEVLFPSSLTEEQKRKIKEVFA  348



>ref|XP_002457785.1| hypothetical protein SORBIDRAFT_03g013590 [Sorghum bicolor]
 gb|EES02905.1| hypothetical protein SORBIDRAFT_03g013590 [Sorghum bicolor]
Length=343

 Score =   470 bits (1210),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/325 (70%), Positives = 272/325 (84%), Gaps = 4/325 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A+A KSYY+ILQV KGASED+IKRAYRKLALKYHPDKNP NEEA+++F EINNAYEVL++
Sbjct  21    ALAGKSYYEILQVSKGASEDKIKRAYRKLALKYHPDKNPNNEEADRQFTEINNAYEVLTN  80

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR +YD YGEEGL+Q H     G G  MNI+ +FS+   GG  EEEEE+  KGDDVI+
Sbjct  81    QEKRKVYDWYGEEGLEQSHGRHSDGDGHAMNIEHVFSN---GGSMEEEEERTLKGDDVIV  137

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +LDASLEDLYMGGS+K+WREKN++KPAPG RRC CRNE+  R+I PG+F QM+EQVCD C
Sbjct  138   ELDASLEDLYMGGSLKIWREKNVIKPAPGNRRCKCRNEIRQREIAPGVFYQMSEQVCDTC  197

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK+ REG +I VDIEKGMQDGQE++FYEDGEPK+DGE GDLKF IRTA H++F+REGN
Sbjct  198   PNVKYVREGDFINVDIEKGMQDGQEILFYEDGEPKIDGESGDLKFNIRTARHERFRREGN  257

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLHTTV I+L +ALVGFEK IKHLD+H V+IG+K ITKPKEV+K +GEGMP + SN+KGD
Sbjct  258   DLHTTVEISLSEALVGFEKNIKHLDNHAVEIGTKVITKPKEVRKSEGEGMPLYHSNEKGD  317

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVL  359
             LYV FEV+FP  LT +QK K+  + 
Sbjct  318   LYVIFEVVFPKDLTDDQKAKLMNIF  342



>emb|CDX67894.1| BnaA07g19340D [Brassica napus]
Length=327

 Score =   467 bits (1201),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 239/326 (73%), Positives = 274/326 (84%), Gaps = 20/326 (6%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPDKNPGN+EA +KFA+INNAYEVLSD
Sbjct  21    VIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNPGNDEATRKFADINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR IY++YGEEGLKQHAA+GG  G G MN+QDIFS FFGGG + EEEEK+ KGDDVI+
Sbjct  81    EEKREIYNKYGEEGLKQHAANGGRGGGGGMNMQDIFSQFFGGGGSTEEEEKVVKGDDVIV  140

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +L+A+LEDLYMGGSMKVWREKN++KPAPGKR+CNCR+EVYHRQIGPGMFQQMTEQVCD+C
Sbjct  141   ELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRDEVYHRQIGPGMFQQMTEQVCDKC  200

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PN K            +K +      +F        DGEPGDLKFRI+TAPH +F+R+GN
Sbjct  201   PNTK------------KKCLSTKMVNLF-------SDGEPGDLKFRIKTAPHARFRRDGN  241

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH TV ITLV+ALVGFEK+ KHLD+H VDI SKGITKPKEVKKFKGEGMP HFS KKG+
Sbjct  242   DLHMTVNITLVEALVGFEKSFKHLDEHEVDISSKGITKPKEVKKFKGEGMPLHFSTKKGN  301

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVLG  356
             L+VTFEVLFP+SLT +QK KIKEVL 
Sbjct  302   LFVTFEVLFPSSLTEDQKKKIKEVLA  327



>ref|XP_007051071.1| DNAJ heat shock family protein isoform 2 [Theobroma cacao]
 gb|EOX95228.1| DNAJ heat shock family protein isoform 2 [Theobroma cacao]
Length=296

 Score =   462 bits (1190),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/275 (84%), Positives = 252/275 (92%), Gaps = 2/275 (1%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A KSYY+ILQVP+GAS++QIKRAYRKLALKYHPDKNPGNEEA+K+FAEINNAYEVLSD
Sbjct  21    AFAGKSYYEILQVPRGASDEQIKRAYRKLALKYHPDKNPGNEEADKRFAEINNAYEVLSD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKR IYDRYGE+GLKQHAASGG  G G N++D F  F  GG   EEEEKI KGDDVI++
Sbjct  81    SEKRGIYDRYGEDGLKQHAASGGRGGMGSNLEDFFGMF-FGGGQAEEEEKIVKGDDVIVE  139

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQ-VCDQC  794
             LDA+LEDLYMGG++KVWREKNILKPAPGKRRCNCRNEVYH+QIGPGMFQQMTEQ VC+QC
Sbjct  140   LDATLEDLYMGGTLKVWREKNILKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQQVCEQC  199

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
              NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEP +DGEPGDLKFRI TAPHD F+REGN
Sbjct  200   QNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPIIDGEPGDLKFRIHTAPHDHFRREGN  259

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKG  509
             DLHTTVTITLVQALVGFEKTIKHLDDHLVDI SKG
Sbjct  260   DLHTTVTITLVQALVGFEKTIKHLDDHLVDISSKG  294



>ref|XP_004971793.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Setaria italica]
Length=349

 Score =   456 bits (1173),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 217/325 (67%), Positives = 267/325 (82%), Gaps = 1/325 (0%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A  SYYDILQV K ASE+QIKRAYRKLALKYHPDKNP NEEA+ +FAEINNAYEVL D
Sbjct  22    TLAGTSYYDILQVSKDASEEQIKRAYRKLALKYHPDKNPNNEEADTRFAEINNAYEVLMD  81

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR +YD YGE+GLKQ      GG G  MN + +FS+FFGG   E+E E+I KGDDVI+
Sbjct  82    QEKRKVYDWYGEDGLKQFQGERSGGGGRTMNFKHVFSNFFGGRGMEKEGEQITKGDDVIV  141

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +LDASLEDLYMGGS+KVWREKN++K APGKRRC CRNE+  R+I PG+F Q++EQVC+ C
Sbjct  142   ELDASLEDLYMGGSVKVWREKNMIKQAPGKRRCKCRNEIRQREIAPGVFYQISEQVCETC  201

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK+ REG  I VDIEKGM DGQE++F E+GEPK+DGEP DLKF+IRT  H++F+REGN
Sbjct  202   PNVKYVREGDSINVDIEKGMPDGQEILFCEEGEPKIDGEPSDLKFKIRTTQHERFRREGN  261

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
             DLH  +TI+L++ALVGF+K   HLD+H V+IG++GITKPKEV+KF+GEGMP + S+ KGD
Sbjct  262   DLHAAMTISLLKALVGFKKNFNHLDNHSVEIGTEGITKPKEVRKFEGEGMPLYQSSSKGD  321

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVL  359
             LY+TF+V+FP  LT +QK K+  +L
Sbjct  322   LYITFDVVFPEHLTDDQKAKLTSIL  346



>gb|AFW81378.1| hypothetical protein ZEAMMB73_185883 [Zea mays]
Length=321

 Score =   452 bits (1162),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 223/276 (81%), Positives = 250/276 (91%), Gaps = 3/276 (1%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPDKNP NEEANK+FAEINNAYEVL+
Sbjct  24    VAIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLT  83

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeee--EKIAKGDDV  980
             D EK+ IYDRYGEEGLKQ     G  G  MNIQDIFSSFFGGG    EE  ++I KGD+V
Sbjct  84    DQEKKKIYDRYGEEGLKQFQGGRGSGGG-MNIQDIFSSFFGGGGGGMEEEEQQILKGDEV  142

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I++LDASLEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGM+QQMTEQVCD
Sbjct  143   IVELDASLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHRQIGPGMYQQMTEQVCD  202

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             QCPNVKF REG ++TVDIEKGM+DGQEV+F+E+GEPK+DGEPGDLKFRIRTA H  FKRE
Sbjct  203   QCPNVKFVREGEFLTVDIEKGMKDGQEVLFFEEGEPKIDGEPGDLKFRIRTALHSHFKRE  262

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSK  512
             GNDLH TVTI+L+QALVGFEKTIKHLD+HLV+IG+K
Sbjct  263   GNDLHATVTISLLQALVGFEKTIKHLDNHLVEIGTK  298



>ref|XP_001767250.1| predicted protein [Physcomitrella patens]
 gb|EDQ67931.1| predicted protein [Physcomitrella patens]
Length=349

 Score =   445 bits (1144),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/330 (68%), Positives = 273/330 (83%), Gaps = 5/330 (2%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +  A KSYYDILQV + AS+DQIKR+YRKLALK+HPDKNPGNEEA KKFAEINNAYEVLS
Sbjct  20    LVSAGKSYYDILQVSRQASDDQIKRSYRKLALKFHPDKNPGNEEATKKFAEINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEK----IAKGD  986
             D EKR IYD+YGEEGL++H   GG  G G   QDIFS FFGGG     EE+      KG+
Sbjct  80    DKEKRGIYDQYGEEGLREHQQGGGRGGGGFG-QDIFSQFFGGGFRFGGEEEEEERTPKGE  138

Query  985   DVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQV  806
             DV++++ A+LEDLY+G S +VWR+KN++KPA GKRRCNC+N+V HRQIGPGM+QQ TEQV
Sbjct  139   DVLVEIYATLEDLYVGNSYQVWRDKNVVKPASGKRRCNCKNKVVHRQIGPGMYQQYTEQV  198

Query  805   CDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFK  626
             C +CPNVKFER G ++TVDIEKGM+DGQE++FYEDGEP +DGEPGDLKF +RT PH +F+
Sbjct  199   CQECPNVKFERVGQFLTVDIEKGMRDGQEIIFYEDGEPIIDGEPGDLKFIVRTKPHSRFR  258

Query  625   REGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSN  446
             REGNDLH TVT+TL+++LVGF+K I HLD H VD+GS  +TKPKEV+KF GEGMP   SN
Sbjct  259   REGNDLHVTVTLTLLESLVGFKKNIDHLDGHKVDVGSNLVTKPKEVRKFPGEGMPLFESN  318

Query  445   KKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             KKG+L+VTFEV+FP+SL+ EQK+ I + LG
Sbjct  319   KKGNLFVTFEVVFPSSLSDEQKSVISKTLG  348



>ref|XP_002978653.1| hypothetical protein SELMODRAFT_109399, partial [Selaginella 
moellendorffii]
 ref|XP_002984588.1| hypothetical protein SELMODRAFT_120820, partial [Selaginella 
moellendorffii]
 gb|EFJ14233.1| hypothetical protein SELMODRAFT_120820, partial [Selaginella 
moellendorffii]
 gb|EFJ20100.1| hypothetical protein SELMODRAFT_109399, partial [Selaginella 
moellendorffii]
Length=320

 Score =   426 bits (1095),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 262/322 (81%), Gaps = 3/322 (1%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             KSYY+IL+V K ASE QIKRAYRKLALKYHPDKNPGNEEANKKF E+ NAYEVL D EKR
Sbjct  1     KSYYEILEVSKSASESQIKRAYRKLALKYHPDKNPGNEEANKKFTELTNAYEVLIDEEKR  60

Query  1138  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE-KIAKGDDVIIDLDA  962
              IYD++GEEGLKQ+   G G G     +DIFS FFGGG  EEE E K  KGDDVI++L A
Sbjct  61    QIYDKFGEEGLKQNGGGGRGGGNFA--RDIFSQFFGGGGFEEESEEKTPKGDDVIVELYA  118

Query  961   SLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVK  782
             +LEDLYMG + ++WREKN+LKPAPGKR+CNC+NEV HRQ+GPGM+QQ T+QVC+QCPNVK
Sbjct  119   TLEDLYMGNTFEMWREKNVLKPAPGKRQCNCKNEVVHRQLGPGMYQQFTQQVCEQCPNVK  178

Query  781   FEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLHT  602
             F REGY+ITVDIEKGM+DG E+ F+EDGEP +DG+PGDLKF +RT  HD+F+R GN+LHT
Sbjct  179   FAREGYHITVDIEKGMKDGHEITFHEDGEPIIDGDPGDLKFVVRTEKHDRFERHGNNLHT  238

Query  601   TVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLYVT  422
              VTI+L++ALVGFEK IKHLD H V IGS G+TKPKEV++F+ +GMP   S   GDL VT
Sbjct  239   AVTISLLEALVGFEKEIKHLDGHAVSIGSTGVTKPKEVRRFRSQGMPIFESVNSGDLLVT  298

Query  421   FEVLFPTSLTAEQKTKIKEVLG  356
             +EV FP +LT  QK  IK+V  
Sbjct  299   YEVDFPKTLTDAQKEAIKKVFS  320



>ref|XP_008369059.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Malus domestica]
Length=249

 Score =   422 bits (1084),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 220/242 (91%), Gaps = 3/242 (1%)
 Frame = -3

Query  1072  AGMNIQDIF---SSFFGGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNIL  902
               + I  +F     FFGGG   EEE++I KGDDV+++LDA+LEDLYMGGS+KVWREKNIL
Sbjct  8     VALFIHSLFFVSCRFFGGGRPSEEEDRIIKGDDVVVELDATLEDLYMGGSLKVWREKNIL  67

Query  901   KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQ  722
             KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVK+EREGY++TVDIEKGMQDGQ
Sbjct  68    KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVKYEREGYFVTVDIEKGMQDGQ  127

Query  721   EVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLHTTVTITLVQALVGFEKTIKHL  542
             EVVFYEDGEP +DGEPGDLKFRIRTA HD FKREGNDLHTT+TITLVQALVGFEKT+KHL
Sbjct  128   EVVFYEDGEPIIDGEPGDLKFRIRTAAHDLFKREGNDLHTTITITLVQALVGFEKTVKHL  187

Query  541   DDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEV  362
             DDHLVDI SKGIT+PKEV+KFKGEGMP HFSNKKGDLYVTFEVLFP SLT +QKTKIK V
Sbjct  188   DDHLVDISSKGITRPKEVRKFKGEGMPLHFSNKKGDLYVTFEVLFPNSLTEDQKTKIKAV  247

Query  361   LG  356
             LG
Sbjct  248   LG  249



>ref|XP_001781245.1| predicted protein [Physcomitrella patens]
 gb|EDQ53943.1| predicted protein [Physcomitrella patens]
Length=349

 Score =   423 bits (1087),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 266/329 (81%), Gaps = 5/329 (2%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +  A KSYYDILQV K A++DQIKRAYRKLALK+HPDKNPGNEEA KKFAEINNAYEVLS
Sbjct  20    VVSAGKSYYDILQVSKQATDDQIKRAYRKLALKFHPDKNPGNEEATKKFAEINNAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP----NeeeeEKIAKGD  986
             D EKR +YD+YGEEGLKQ    GG  G G   QDIFS FFGGG      E+EEEK  KGD
Sbjct  80    DREKRGVYDQYGEEGLKQQQQGGGRGGGGFG-QDIFSQFFGGGFRFGGEEDEEEKTLKGD  138

Query  985   DVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQV  806
             DV +++ A+L+DLY+G S ++WR+KN++KPA GKR+CNC+N+V HRQIGPGM+QQ TEQV
Sbjct  139   DVTVEIYATLKDLYVGNSYQIWRDKNVVKPAAGKRKCNCKNKVVHRQIGPGMYQQYTEQV  198

Query  805   CDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFK  626
             C +CPNVKFER    +TVDIEKGM+DGQE+VFYEDGEP +DGEPGDLKF IRT P  +F+
Sbjct  199   CQECPNVKFERVTQSLTVDIEKGMRDGQEIVFYEDGEPVIDGEPGDLKFIIRTKPDSRFR  258

Query  625   REGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSN  446
             REGNDLH TVTITL+ ALVGF+K I HLD H V +GS  +TKPKE +KF  EGMP   S+
Sbjct  259   REGNDLHITVTITLLDALVGFKKDIAHLDGHKVAVGSALVTKPKETRKFPREGMPLFDSD  318

Query  445   KKGDLYVTFEVLFPTSLTAEQKTKIKEVL  359
             KKGDL+VTFEV+FP+SLT EQK+ I + L
Sbjct  319   KKGDLFVTFEVVFPSSLTDEQKSVISKTL  347



>ref|NP_001167838.1| hypothetical protein precursor [Zea mays]
 gb|ACN26252.1| unknown [Zea mays]
 gb|AFW80710.1| hypothetical protein ZEAMMB73_969717 [Zea mays]
Length=377

 Score =   407 bits (1045),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 263/324 (81%), Gaps = 7/324 (2%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             ++A KSYY+ILQVPKGASE+QIKRAYRKLALKYHPDKNP NEEA ++FAEIN+AYEVL+D
Sbjct  21    SLAGKSYYEILQVPKGASEEQIKRAYRKLALKYHPDKNPNNEEAGRRFAEINDAYEVLTD  80

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              +KR   D +GEE L ++     GR   ++++ +FS+   GG  ++EEE+I KGDDV ++
Sbjct  81    RKKRKADDWHGEEDLAKYM----GRAMKVDVEYVFSN---GGSPKQEEEQILKGDDVTVE  133

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             L+ASLEDLYMGGS+K+WREKN++KPAPG RRC CRN V  R++ PG+   ++ Q CD CP
Sbjct  134   LEASLEDLYMGGSLKIWREKNVIKPAPGVRRCRCRNVVRKREVAPGVILNLSHQECDTCP  193

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVK+ REG +I VDIEKGMQDGQE++FYEDGEPK+DG PGDLK +IRTA H++++R+GND
Sbjct  194   NVKYVREGAFINVDIEKGMQDGQEILFYEDGEPKIDGVPGDLKIKIRTARHERYRRDGND  253

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGDL  431
             LHTTV I+L +AL GFEK + HLD+H V+IG+K IT+P+EV+KF+GEGMP + SN+KGDL
Sbjct  254   LHTTVEISLAEALGGFEKKVTHLDNHEVEIGTKEITRPEEVRKFQGEGMPLYRSNEKGDL  313

Query  430   YVTFEVLFPTSLTAEQKTKIKEVL  359
             YV FEV+FP  L  +QKT++  + 
Sbjct  314   YVVFEVVFPEDLADDQKTELNSIF  337



>ref|XP_006444462.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
 gb|ESR57702.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
Length=259

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 222/244 (91%), Gaps = 2/244 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR ++LL LL  L Y+L  IA KSYY++LQVP+GAS++QIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFF  1034
             NEEANK+FAEINNAYEVLSD E RNIYD YGEEGLKQHAA GG  G   +NIQDIFSSFF
Sbjct  61    NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF  120

Query  1033  GGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GGGP  EE+EKI KGDDVI++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVY
Sbjct  121   GGGP-MEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVY  179

Query  853   HRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEP  674
             H+QIGPGMFQQMTEQVCDQC NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEPK+DGEP
Sbjct  180   HKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDGEP  239

Query  673   GDLK  662
             GDLK
Sbjct  240   GDLK  243



>ref|XP_008797220.1| PREDICTED: dnaJ homolog subfamily B member 11-like isoform X2 
[Phoenix dactylifera]
Length=298

 Score =   385 bits (990),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 237/327 (72%), Gaps = 55/327 (17%)
 Frame = -3

Query  1327  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDG  1148
                K+YYD+LQVPKGASE+QIKR+YRKLALKYHPDKNPGNEEANK+FAEINNAYEVLSD 
Sbjct  22    FGGKNYYDVLQVPKGASEEQIKRSYRKLALKYHPDKNPGNEEANKRFAEINNAYEVLSDR  81

Query  1147  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDL  968
             EKR+IYDRYGEEG+KQHA SGG RG GMNIQDIF++FFGGG  EEEEE IAKGDDV+++L
Sbjct  82    EKRSIYDRYGEEGVKQHANSGG-RGGGMNIQDIFNNFFGGGMAEEEEEVIAKGDDVVVEL  140

Query  967   DASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  788
             DA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC+QC N
Sbjct  141   DATLEDLYMGGSLKVWREKNVVKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCEQCSN  200

Query  787   VKFEREGYYITVDIEKGMQDG--QEVVFYEDGEPKVDGEPGDLKFRIRTAPHD--QFKRE  620
             VKFEREGY+ITVDIEKGMQDG  Q +V +E     +D    ++  +  T P +  +FK E
Sbjct  201   VKFEREGYFITVDIEKGMQDGQVQALVGFEKTIKHLDEHLVEIGTKGITKPKEVRKFKGE  260

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             G  LH                                                   S KK
Sbjct  261   GMPLH--------------------------------------------------LSTKK  270

Query  439   GDLYVTFEVLFPTSLTAEQKTKIKEVL  359
             GDLYVT+EVLFP SLT +QKT+IK +L
Sbjct  271   GDLYVTYEVLFPKSLTEDQKTRIKAIL  297



>gb|EMS56867.1| DnaJ homolog subfamily B member 11 [Triticum urartu]
Length=337

 Score =   386 bits (992),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -3

Query  1003  KIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQ  824
             +I KGDDVI++LDASLEDLYMGGS+KVWREKNI+KPAPGKRRCNCRNEVYHRQIGPGM+Q
Sbjct  122   QIIKGDDVIVELDASLEDLYMGGSLKVWREKNIIKPAPGKRRCNCRNEVYHRQIGPGMYQ  181

Query  823   QMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTA  644
             QMTEQVCDQCPNVK+ REG ++TVDIEKGMQDGQEV F+E+GEPK+DGEPGDLKF+IRTA
Sbjct  182   QMTEQVCDQCPNVKYVREGDFLTVDIEKGMQDGQEVSFFEEGEPKIDGEPGDLKFKIRTA  241

Query  643   PHDQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGM  464
             PHD+F+REGNDLH TVTI+L+QALVGFEK +KHLD+HLV IGS+G+TKPKEV+KFKGEGM
Sbjct  242   PHDRFRREGNDLHATVTISLLQALVGFEKNLKHLDNHLVQIGSQGVTKPKEVRKFKGEGM  301

Query  463   PHHFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             P H SNKKGDLYVTFEVLFP +LT +QK K+K+VL 
Sbjct  302   PLHQSNKKGDLYVTFEVLFPKTLTDDQKAKLKDVLA  337



>gb|KCW50098.1| hypothetical protein EUGRSUZ_K03532 [Eucalyptus grandis]
Length=247

 Score =   372 bits (956),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 219/244 (90%), Gaps = 1/244 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA+ G KLL LL  L  + IAIA +SYYD+LQVPKGAS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MANPGHKLLFLLCALCSAAIAIAGQSYYDMLQVPKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGM-NIQDIFSSFF  1034
             NEEANKKFA+INNAYEVLSDGEKR IYDRYGEEGLKQHAASGG  G    NIQDIF S F
Sbjct  61    NEEANKKFADINNAYEVLSDGEKRGIYDRYGEEGLKQHAASGGRGGGMGMNIQDIFESMF  120

Query  1033  GGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GGG   EEEE+I KGDDVI++LDA+LEDLYMGGS+KVWREKN++KPAPGKR+CNCRNEVY
Sbjct  121   GGGGRGEEEEQIPKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRQCNCRNEVY  180

Query  853   HRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEP  674
             HRQIGPGMFQQMTEQVC+QC N+K+EREGY++TVDIEKGMQDGQEV F+EDGEPK+DGE 
Sbjct  181   HRQIGPGMFQQMTEQVCEQCQNIKYEREGYFLTVDIEKGMQDGQEVNFFEDGEPKIDGEA  240

Query  673   GDLK  662
             GDLK
Sbjct  241   GDLK  244



>gb|EPS66939.1| hypothetical protein M569_07836, partial [Genlisea aurea]
Length=244

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 221/244 (91%), Gaps = 1/244 (0%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR S LL+LL  LS  L AIAAKSYYDILQV +GASEDQIKR+YRKLAL+YHPDKNPG
Sbjct  1     MAHRRSTLLLLLCALSCYLGAIAAKSYYDILQVSRGASEDQIKRSYRKLALQYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEINNAYEVL D EKR IYD YGEEGLKQHAA GG  G GMNIQDIFSSFFG
Sbjct  61    NEEANKKFAEINNAYEVLIDSEKRQIYDSYGEEGLKQHAAGGGRAGGGMNIQDIFSSFFG  120

Query  1030  GGP-NeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GG  N EEEEK+ KGDDVI+DLDASLEDLYMGG++KVWR KN++KPAPGKRRCNCRNEVY
Sbjct  121   GGGGNMEEEEKVVKGDDVIVDLDASLEDLYMGGTLKVWRVKNVIKPAPGKRRCNCRNEVY  180

Query  853   HRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEP  674
             HRQIGPGMFQQMTEQVC+QCPNVK+EREG +I+VDIEKGMQDGQEVVF+EDGEPK+DGE 
Sbjct  181   HRQIGPGMFQQMTEQVCEQCPNVKYEREGEFISVDIEKGMQDGQEVVFFEDGEPKIDGEA  240

Query  673   GDLK  662
             GDL+
Sbjct  241   GDLR  244



>gb|ACU21468.1| unknown [Glycine max]
Length=217

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 203/219 (93%), Gaps = 2/219 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA RG+ LL LL  L YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  1031
             NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAASGG RG GMN QDIFS+FFG
Sbjct  61    NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAASGG-RGGGMNFQDIFSTFFG  119

Query  1030  GGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYH  851
             GGP  EEEEKI KGDD+++DLDA+LEDLYMGG++KVWREKN+LKPAPGKRRCNCRNEVYH
Sbjct  120   GGP-MEEEEKIVKGDDLVVDLDATLEDLYMGGTLKVWREKNVLKPAPGKRRCNCRNEVYH  178

Query  850   RQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGM  734
             +QIGPGMFQQMTEQVC+QCPNVK+ REGY+ITVDIEKGM
Sbjct  179   KQIGPGMFQQMTEQVCEQCPNVKYVREGYFITVDIEKGM  217



>gb|EYU46792.1| hypothetical protein MIMGU_mgv1a0099882mg, partial [Erythranthe 
guttata]
Length=223

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/224 (83%), Positives = 207/224 (92%), Gaps = 2/224 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MA R SKLL+L+  LSY LIAIAAKSYYDILQV KGAS++QIKRAYRKLALKYHPDKNPG
Sbjct  1     MAQRRSKLLLLVCFLSYYLIAIAAKSYYDILQVQKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFF  1034
             NEEANKKFAEINNAYEVLSD EKR IYDRYGEEGLKQHAASGG  G G MNIQDIFSSFF
Sbjct  61    NEEANKKFAEINNAYEVLSDSEKRGIYDRYGEEGLKQHAASGGRGGGGGMNIQDIFSSFF  120

Query  1033  GGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GGG + EEEE++ KGDDV+++LDA+LEDLYMGG++KVWR KN++KPAPGKRRCNCRNEVY
Sbjct  121   GGG-SMEEEERVIKGDDVVVELDATLEDLYMGGTLKVWRVKNVIKPAPGKRRCNCRNEVY  179

Query  853   HRQIGPGMFQQMTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQ  722
             H+QIGPGMFQQMTEQVC+QCPNVK+EREG ++TVDIEKGMQDGQ
Sbjct  180   HKQIGPGMFQQMTEQVCEQCPNVKYEREGDFVTVDIEKGMQDGQ  223



>ref|XP_005844504.1| hypothetical protein CHLNCDRAFT_138873 [Chlorella variabilis]
 gb|EFN52402.1| hypothetical protein CHLNCDRAFT_138873 [Chlorella variabilis]
Length=364

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 243/334 (73%), Gaps = 15/334 (4%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEE----ANKKFAEINNAYEVLSD  1151
             + YYDILQVP+ A++ QIKRAYRKLALK HPDK  G+EE    A +KFA++++AYEVL+D
Sbjct  22    RDYYDILQVPRSATDAQIKRAYRKLALKMHPDKVQGSEEEKKAAAQKFADVSHAYEVLTD  81

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN---------eeeeEKI  998
              EKR +YDRYGEEGLKQ    G   G G + QDIFS FFGGG           ++EEE+ 
Sbjct  82    AEKRKVYDRYGEEGLKQMGNGG--GGGGGSAQDIFSQFFGGGFGGFGGFGFGGQQEEEET  139

Query  997   AKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQM  818
              KG +V+++L+ +L+DLY+G   KV R+KN++KPAPG R+CNC+ +V  +QIGPGM+QQ 
Sbjct  140   PKGHNVVVELEVTLKDLYLGNHFKVVRDKNVVKPAPGTRKCNCKQKVVTQQIGPGMYQQY  199

Query  817   TEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPH  638
              +QVC+ CPNVK+ERE   +TV +E GM DG  + F+E+GEP +DGE GDL   +RT PH
Sbjct  200   HKQVCEDCPNVKYERESESLTVSVEPGMPDGHTITFFEEGEPILDGEHGDLHVVLRTLPH  259

Query  637   DQFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPH  458
               F+R G+ L    TI+L++ALVGFE+ I+HLD H V IG++G+T+P EV+ ++GEGMP 
Sbjct  260   PSFERRGDGLMYNATISLLEALVGFERQIEHLDGHKVQIGTQGVTRPGEVRWYQGEGMPQ  319

Query  457   HFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
                  +GD++VTF + FP +++ EQK +++E+ G
Sbjct  320   FEKTTRGDMWVTFSIAFPRAISDEQKQQLRELFG  353



>ref|XP_002508960.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70218.1| predicted protein [Micromonas sp. RCC299]
Length=355

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/329 (54%), Positives = 227/329 (69%), Gaps = 6/329 (2%)
 Frame = -3

Query  1324  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGE  1145
             +A  YY  L + +GAS+DQIKRAYRKLALKYHPDKNPGNEEA  KFA+I NAYEVLSD E
Sbjct  24    SAADYYKTLGLNRGASDDQIKRAYRKLALKYHPDKNPGNEEAASKFADIGNAYEVLSDAE  83

Query  1144  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQ-DIFSSFFGGGPNeeeeE----KIAKGDDV  980
             KR IYDR+GEEG+KQHA  GG  G G     DIFS FFG G           +  KG+ +
Sbjct  84    KRQIYDRHGEEGVKQHAQQGGRGGGGGFGGGDIFSQFFGHGFGGFGGGPQEPETPKGNSL  143

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             +IDLD S+ DLY+G  ++V R+K+++KPA G R+CNC+  +  RQIGPGM+QQ  ++ C+
Sbjct  144   VIDLDVSIRDLYLGRVIRVARDKSVIKPAKGTRKCNCKQRMVTRQIGPGMYQQFAKEECE  203

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK  RE   I V+IE G  DG E++F+E+GEP VDGEPGDL FR+RTA  D+F+R 
Sbjct  204   ECPNVKLGRESETIAVEIEPGAPDGHEMLFFEEGEPIVDGEPGDLTFRVRTARDDRFERR  263

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK  440
             GNDLH T  + LV+AL GF+K   H D   V +   GIT P  V+    EGMP    ++K
Sbjct  264   GNDLHMTFRVDLVEALAGFDKAFTHFDGREVRLKRLGITTPGLVETIAKEGMPVFNQHQK  323

Query  439   -GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
              G+L VT++V FP  LT +QK ++K++  
Sbjct  324   FGNLVVTYQVDFPKKLTEKQKGEVKKLFA  352



>ref|XP_005649472.1| DnaJ-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24928.1| DnaJ-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=341

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 231/333 (69%), Gaps = 17/333 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEE----ANKKFAEINNAYEVLSD  1151
             K +YD+LQVPKGAS+  IKR+YRKLAL+YHPDK  G EE    A KKFAEI+ AYEVLSD
Sbjct  6     KDFYDVLQVPKGASDSLIKRSYRKLALQYHPDKVKGTEEEKTAAAKKFAEISYAYEVLSD  65

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE--------KIA  995
              EKR IYDRYGEEGLKQ    GGG GA     DIFS FFGGG               +  
Sbjct  66    DEKRRIYDRYGEEGLKQRDQGGGGGGAA----DIFSQFFGGGFPGFGGFGGMGEEEEQTP  121

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             KGDDV +DL+ +L+DLY+G   KV R+K + KPAPGKR+CNCRN+V  RQ+GPGMFQQ  
Sbjct  122   KGDDVRVDLEVTLKDLYLGHQFKVMRDKPVAKPAPGKRKCNCRNKVVTRQLGPGMFQQFQ  181

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
             +Q C +C N+KFERE   +T+ +E GM+DGQE+VF+E+GEP +DGEPGDL+F +RT PH 
Sbjct  182   QQECQECQNIKFERETETLTISVESGMRDGQEIVFFEEGEPLLDGEPGDLRFIVRTLPHK  241

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMP-H  458
             +F+REG+DL   +TI+LV AL GF    +HLD H V + S G+T P +V K KGEGMP  
Sbjct  242   RFEREGHDLKYNLTISLVDALTGFTTEFEHLDGHKVKVDSAGVTIPGQVFKLKGEGMPLF  301

Query  457   HFSNKKGDLYVTFEVLFPTSLTAEQKTKIKEVL  359
                NK GDLY T  V FP  L+  QK  ++ V 
Sbjct  302   DHPNKAGDLYATITVAFPAKLSESQKDAVRNVF  334



>gb|KFM24199.1| DnaJ-like protein subfamily B member 11 [Auxenochlorella protothecoides]
Length=356

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 220/325 (68%), Gaps = 5/325 (2%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEE----ANKKFAEINNAYEVLSD  1151
             K YYD+L V + A    IKRAYRK+ALKYHPDK  G EE    A K FAEI +AYEVL+D
Sbjct  23    KDYYDLLHVSRHADAAAIKRAYRKVALKYHPDKVQGTEEEKQAAAKTFAEIGHAYEVLTD  82

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE-KIAKGDDVII  974
              +KR IYD+YGEEGLKQ   SGGG     +I   F   FG G + ++EE +  KGDDV+I
Sbjct  83    EKKRQIYDQYGEEGLKQMGNSGGGHHNPNDIFAQFFGGFGFGGHGQQEEPQTPKGDDVVI  142

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             +L+ SLEDLY+G   KV R+K +LKPA G R+CNC+N V   Q+GPGM+QQ T QVC+ C
Sbjct  143   NLEVSLEDLYLGRQFKVVRDKGVLKPASGTRKCNCKNRVVTNQVGPGMYQQYTTQVCEDC  202

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK  RE   +TV +E G  DG  + F+E+GEP+VDGE GDL  ++ T  H  F+R  +
Sbjct  203   PNVKIVREREEVTVSVEPGTPDGHRITFFEEGEPRVDGEHGDLIIQLVTTKHPVFERRQS  262

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKKGD  434
              L   + ITL++AL GF + +KHLD H V +GSK + +P E + FKGEGMP     K+GD
Sbjct  263   GLLAEMNITLLEALTGFTRELKHLDGHAVAVGSKTVVRPGEQRWFKGEGMPIMDEVKRGD  322

Query  433   LYVTFEVLFPTSLTAEQKTKIKEVL  359
             L+VT+ V+FP  LT  Q+  IKEVL
Sbjct  323   LWVTYRVIFPKMLTQAQQDIIKEVL  347



>ref|XP_001748783.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86393.1| predicted protein [Monosiga brevicollis MX1]
Length=362

 Score =   315 bits (807),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 216/335 (64%), Gaps = 16/335 (5%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +  A + +Y IL V + A++ +IK+AYRKLA+++HPDKN GN+EA K F +I  AYEVLS
Sbjct  16    LVAAGRDFYKILGVARTATKKEIKKAYRKLAMEHHPDKNQGNDEAAKIFQDIGAAYEVLS  75

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG-------GPNeeeeEKIA  995
             D +KR IYDR+GEEGLK         G G +  DIFSS FGG       G N   E+++ 
Sbjct  76    DDDKRKIYDRHGEEGLKD-------GGQGHDASDIFSSMFGGSFFNMHFGGNGRGEKQVP  128

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             +G DV IDLD +L DLY G  ++V   K + + APG R+CNCR E+  +Q+GPG F    
Sbjct  129   RGSDVHIDLDVTLSDLYKGAFIEVLHTKGVFREAPGTRKCNCRTEMRTQQVGPGQFSMAN  188

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
              +VCD CPNVK   E   + ++IE GM  GQE+ F+ +GEP  DGEPGDL F I T  H 
Sbjct  189   VKVCDDCPNVKLTHEHVELDLEIEPGMVQGQELKFHAEGEPHADGEPGDLIFHINTLKHS  248

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
             +F+R GNDL T +TITL  AL GFE  +KHLD H V +  +GIT P  + K  GEGM   
Sbjct  249   RFQRAGNDLLTNITITLEDALTGFEMEVKHLDGHKVQVKREGITAPNSIVKVAGEGMKSF  308

Query  454   FSN-KKGDLYVTFEVLFPT-SLTAEQKTKIKEVLG  356
              +N ++GDLY+TF+V FPT +  +E    +KE+LG
Sbjct  309   DNNLERGDLYITFDVEFPTLNFPSEAVESLKELLG  343



>ref|XP_001701027.1| ER DnaJ-like protein 1 [Chlamydomonas reinhardtii]
 gb|EDP07281.1| ER DnaJ-like protein 1 [Chlamydomonas reinhardtii]
Length=350

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 225/329 (68%), Gaps = 8/329 (2%)
 Frame = -3

Query  1327  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEE----ANKKFAEINNAYEV  1160
             ++AK YY++LQVPKGASE Q+KRAYRKLAL+YHPDK  G E+    A+++FA+IN+AYEV
Sbjct  25    VSAKDYYELLQVPKGASEAQLKRAYRKLALQYHPDKVTGTEDEKKVASQRFADINHAYEV  84

Query  1159  LSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDV  980
             LSD EKR IYD+YGE+GLKQ        G      D+F+ FFGG    ++EE++ KG  +
Sbjct  85    LSDPEKRKIYDQYGEDGLKQAQQQ---GGGHGGGNDLFNFFFGGFGGGQQEEEVRKGHTI  141

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
              +DL  +L DLY+G  ++V R+K ++K   G R+CNC+ ++  RQ+GPGMFQQ   Q C 
Sbjct  142   YVDLYVTLRDLYVGKELQVVRDKAVIKETSGTRKCNCKTKIMTRQLGPGMFQQFQTQECG  201

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
              CP +K ERE   ITV +E GM +G ++ F+E+GEP VDGEPGDL F +R A   +F+R 
Sbjct  202   TCPAIKLEREQEPITVHVEPGMVNGHQITFFEEGEPLVDGEPGDLVFVVRQALDARFERR  261

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSN-K  443
             G+DL    TI+LV AL GF  TI HLD H V + + G+T+P +  + KGEGMP H    K
Sbjct  262   GHDLMHNYTISLVDALTGFSHTIDHLDGHKVTLSATGVTRPGDYHQIKGEGMPVHSQEPK  321

Query  442   KGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             +GD++V + V FP SLT EQK  ++ + G
Sbjct  322   RGDMWVQYTVAFPPSLTEEQKAAVRTLFG  350



>ref|XP_003737919.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Metaseiulus 
occidentalis]
Length=352

 Score =   305 bits (780),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 219/329 (67%), Gaps = 14/329 (4%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +  + +YDIL VP+ A+ +QIK+AYRKLA + HPDKN  +  A  KF ++  AYEVL D
Sbjct  17    VLGGRDFYDILGVPRSANVNQIKKAYRKLAKELHPDKNKDDPAAQDKFQDLGAAYEVLVD  76

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEK---IAKGDDV  980
              EKR  YDRYGEEGLK       GRG G    D F+SFFG       +++     KG DV
Sbjct  77    AEKRKQYDRYGEEGLKDI-----GRGGG----DPFASFFGDFGFFGGDDRPRETPKGSDV  127

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             ++DL  +LE+LY G  +++ R+K + K + G R+CNCR+E+  RQIGPG FQ + +QVCD
Sbjct  128   VMDLWVTLEELYNGNFVEIVRKKPVYKQSSGTRKCNCRSEMVTRQIGPGRFQMLQQQVCD  187

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPN+K E E   + V+IE GM+DGQE +F  +GEP +DG+PGDLK RIRTAPH  F+R+
Sbjct  188   ECPNLKLETEERTLEVEIEVGMRDGQEQLFTAEGEPHIDGDPGDLKLRIRTAPHPVFQRK  247

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH-FSNK  443
             G+DL T +TI+L  ALVGFE  I HLD H V +   GIT P    +   EGMP++  +N+
Sbjct  248   GDDLFTNITISLDDALVGFETEITHLDGHKVKVSRDGITWPGARMRKPNEGMPNYENNNR  307

Query  442   KGDLYVTFEVLFPTS-LTAEQKTKIKEVL  359
             KG LYVTF+V FP S  T EQK  I+ +L
Sbjct  308   KGTLYVTFDVKFPKSPFTEEQKQTIRSLL  336



>ref|XP_003079124.1| Molecular chaperone (DnaJ superfamily) (ISS) [Ostreococcus tauri]
 emb|CAL53782.1| HSP40/DnaJ peptide-binding [Ostreococcus tauri]
Length=383

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 223/350 (64%), Gaps = 26/350 (7%)
 Frame = -3

Query  1312  YYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKRNI  1133
             +Y  L V + A E QIKRAYRKLALKYHPDKNP +E A KKF EI +AYE LSD EKR I
Sbjct  35    HYATLGVSRHADESQIKRAYRKLALKYHPDKNPNDETAKKKFTEIGHAYETLSDQEKRKI  94

Query  1132  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNe----------eeeEKIAKGDD  983
             YDRYGEEG+KQH ASGG RG G   QDIFS FFGGG             EEE++  K   
Sbjct  95    YDRYGEEGVKQHEASGG-RGGGHAAQDIFSQFFGGGGFGGFGGFGGMGGEEEQETPKAPT  153

Query  982   VIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC  803
             + IDL A+ E++Y+G S+ V R K + K A G R+CNCR ++  RQ+GPGM+QQ TEQ C
Sbjct  154   IKIDLRATCEEIYLGASVPVSRAKLVTKSAKGTRKCNCRQKLVTRQVGPGMYQQYTEQTC  213

Query  802   DQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTA--PHDQF  629
             + CPNVK  RE   +TV+IE G  +G E++F+E+G+  +DG+PGDL F I T     +  
Sbjct  214   EDCPNVKLVREDVDLTVEIEAGAPEGHEILFFEEGDAMIDGDPGDLLFVIHTVEDAKNGI  273

Query  628   KREG-NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             KR G +DLH T  ITLV+AL GF K  KH D H V I   G+T+P +    KGEG+P H 
Sbjct  274   KRVGKSDLHMTYEITLVEALNGFSKVFKHYDGHDVVIARTGVTRPFDKMTVKGEGLPKHN  333

Query  451   SNKK-GDLYVTFEVLFPTSLTAEQKTKIKEVLG*AAVFCLSSFATMSFIR  305
               K+ GD+++TF+V FP  L  +Q+    +           +FA  SF++
Sbjct  334   QFKQFGDMHITFQVQFPDELDQKQRDATSK-----------AFAKSSFVK  372



>gb|KDO87051.1| hypothetical protein CISIN_1g0191621mg, partial [Citrus sinensis]
 gb|KDO87052.1| hypothetical protein CISIN_1g0191621mg, partial [Citrus sinensis]
 gb|KDO87053.1| hypothetical protein CISIN_1g0191621mg, partial [Citrus sinensis]
Length=194

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = -3

Query  1390  MAHRGskllvlllclsysLIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPG  1211
             MAHR ++LL LL  L Y+L  IA KSYY++LQVP+GAS++QIKRAYRKLALKYHPDKN G
Sbjct  1     MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  1210  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAA-SGGGRGAGMNIQDIFSSFF  1034
             NEEANK+FAEINNAYEVLSD E RNIYD YGEEGLKQHAA  G G G G+NIQDIFSSFF
Sbjct  61    NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF  120

Query  1033  GGGPNeeeeEKIAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVY  854
             GGGP  EE+EKI KGDDVI++LDA+LEDLYMGGS+KVWREKN++KPAPGKRRCNCRNEVY
Sbjct  121   GGGP-MEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVY  179

Query  853   HRQIGPGMFQQMTEQ  809
             H+QIGPGMFQQMTEQ
Sbjct  180   HKQIGPGMFQQMTEQ  194



>ref|XP_007433587.1| PREDICTED: dnaJ homolog subfamily B member 11 [Python bivittatus]
Length=358

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 219/338 (65%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    TIAGRDFYKILGVPRSASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK+ H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKEGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVIRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+ALVGFE  I HLD H V I    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALVGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF++ FP   LT EQ+  +K++L  A+V
Sbjct  311   NNNIKGSLIITFDIDFPKEQLTGEQREGLKQLLKQASV  348



>gb|KFM59418.1| DnaJ-like protein subfamily B member 11, partial [Stegodyphus 
mimosarum]
Length=361

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 210/326 (64%), Gaps = 5/326 (2%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +  + +Y IL VP+ A+ +QIK+AYRKLA + HPDKNP N  A +KF ++  AYEVLSD
Sbjct  24    VLGGRDFYSILGVPRSATLNQIKKAYRKLAKELHPDKNPDNPHAQEKFQDLGAAYEVLSD  83

Query  1150  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIID  971
              EKR  YD++GEEGLK  A  GG         D      G   +     +I +G D+I+D
Sbjct  84    EEKRRTYDQFGEEGLKNDAFGGGSDPFASFFGDFGFFTGG---SRTGAREIPRGGDLIMD  140

Query  970   LDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCP  791
             L  +LE+LY G  ++V R K +++PA G R+CNCR E+  RQ+GPG FQ   + VCD+CP
Sbjct  141   LWVTLEELYSGNFVEVVRNKPVMQPAKGTRQCNCRQEMVTRQLGPGRFQMTQQTVCDECP  200

Query  790   NVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGND  611
             NVK+  +   + ++IE GM+DGQE  F  +GEP +DGEPGDL+ RI+T PH  F+R G+D
Sbjct  201   NVKYVNQEKVLEIEIEPGMKDGQEQKFVAEGEPHIDGEPGDLRIRIQTLPHPIFERRGDD  260

Query  610   LHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-KGD  434
             L+T +TI+L  AL GF   I HLD H V+I    IT P    + K EGMP++ +N  KG 
Sbjct  261   LYTNITISLTDALCGFTMEIIHLDGHKVEITRDKITFPGARIRKKNEGMPNYENNNLKGT  320

Query  433   LYVTFEVLFPT-SLTAEQKTKIKEVL  359
             LYVTF+V FP   L AE + KIKE+L
Sbjct  321   LYVTFDVDFPKGELNAEHREKIKEIL  346



>ref|XP_005331061.1| PREDICTED: dnaJ homolog subfamily B member 11 [Ictidomys tridecemlineatus]
Length=357

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 215/332 (65%), Gaps = 17/332 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPTSLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP  LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKQLTEEAREGIKQLL  342



>ref|XP_003218463.2| PREDICTED: dnaJ homolog subfamily B member 11 [Anolis carolinensis]
Length=358

 Score =   295 bits (755),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 222/338 (66%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    AIAGRDFYKILGVPRSASVKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK+ H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKEGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVIRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  + HLD H V +    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDVAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   LT+E++  +K++L  ++V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTSEEREGLKQLLKQSSV  348



>ref|XP_004654356.1| PREDICTED: dnaJ homolog subfamily B member 11 [Jaculus jaculus]
Length=358

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 218/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALVGFEMDIIHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   LT E +  IK++L  A+V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQASV  348



>ref|XP_003056063.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59439.1| predicted protein [Micromonas pusilla CCMP1545]
Length=373

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 213/320 (67%), Gaps = 5/320 (2%)
 Frame = -3

Query  1312  YYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKRNI  1133
             YY  L V +GAS+ QIKRAYRKLALKYHPDKN G+++A   FAEI+NAYEVLS+ EKR +
Sbjct  55    YYKTLAVDRGASDIQIKRAYRKLALKYHPDKNKGDQKAAGNFAEISNAYEVLSNKEKRRV  114

Query  1132  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN-eeeeEKIAKGDDVIIDLDASL  956
             YD+YGE+G++QH    G    G +  DIFS FFG     + EE  I  GDDV++DL+ SL
Sbjct  115   YDQYGEDGVRQHDTRSG---QGRHQHDIFSQFFGNNFGFDNEEADIRHGDDVVLDLELSL  171

Query  955   EDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVKFE  776
             EDLY G S+KV R+K + KPA GKR+C C   +  RQ+ PGMFQQ  ++ C++C N+K  
Sbjct  172   EDLYTGCSLKVGRDKGVHKPAKGKRKCRCMQRMVTRQVAPGMFQQYAKEECEECDNIKIV  231

Query  775   REGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLHTTV  596
             R    IT+DIE G  DG E+  Y+DGE  VDG+ G+L+ RIR+A + + KR GNDLH   
Sbjct  232   RGFEIITIDIEAGTPDGHEITLYDDGETLVDGDSGELRVRIRSANNTKRKRFGNDLHILY  291

Query  595   TITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMP-HHFSNKKGDLYVTF  419
              I L +AL GF     H D H++++ +  +T P ++     EG P +   N +GDL +TF
Sbjct  292   EIDLAEALAGFTHEFIHFDGHIIELQNTEVTMPGQILSIPSEGFPIYDVPNSRGDLVITF  351

Query  418   EVLFPTSLTAEQKTKIKEVL  359
             +V+FP  L+  QK K+K++L
Sbjct  352   QVIFPEILSLSQKVKVKDIL  371



>ref|NP_001015021.1| dnaJ homolog subfamily B member 11 precursor [Rattus norvegicus]
 sp|Q6TUG0.1|DJB11_RAT RecName: Full=DnaJ homolog subfamily B member 11; AltName: Full=ER-associated 
DNAJ; AltName: Full=ER-associated Hsp40 co-chaperone; 
AltName: Full=Endoplasmic reticulum DNA J domain-containing 
protein 3; Short=ER-resident protein ERdj3; Short=ERdj3; 
Short=ERj3p; AltName: Full=Liver regeneration-related 
protein LRRGT00084; Flags: Precursor [Rattus norvegicus]
 gb|AAQ91040.1| LRRGT00084 [Rattus norvegicus]
 gb|AAH93384.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Rattus norvegicus]
 gb|EDL78055.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Rattus norvegicus]
Length=358

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGAPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLL  343



>ref|NP_080676.3| dnaJ homolog subfamily B member 11 precursor [Mus musculus]
 ref|NP_001177733.1| dnaJ homolog subfamily B member 11 precursor [Mus musculus]
 ref|NP_001177734.1| dnaJ homolog subfamily B member 11 precursor [Mus musculus]
 sp|Q99KV1.1|DJB11_MOUSE RecName: Full=DnaJ homolog subfamily B member 11; AltName: Full=APOBEC1-binding 
protein 2; Short=ABBP-2; AltName: Full=ER-associated 
DNAJ; AltName: Full=ER-associated Hsp40 co-chaperone; 
AltName: Full=Endoplasmic reticulum DNA J domain-containing 
protein 3; Short=ER-resident protein ERdj3; Short=ERdj3; 
Short=ERj3p; Flags: Precursor [Mus musculus]
 gb|AAH03999.1| Dnajb11 protein [Mus musculus]
 gb|AAH40747.1| Dnajb11 protein [Mus musculus]
 dbj|BAC34293.1| unnamed protein product [Mus musculus]
 dbj|BAC36079.1| unnamed protein product [Mus musculus]
 dbj|BAE28593.1| unnamed protein product [Mus musculus]
 dbj|BAE38977.1| unnamed protein product [Mus musculus]
 gb|EDK97635.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Mus musculus]
Length=358

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLL  343



>gb|AAH18282.1| Dnajb11 protein [Mus musculus]
Length=358

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLL  343



>ref|XP_004591308.1| PREDICTED: dnaJ homolog subfamily B member 11 [Ochotona princeps]
Length=358

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 217/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   LT E +  IK++L  A+V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEETREGIKQLLKQASV  348



>ref|XP_001417654.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95947.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=372

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/339 (48%), Positives = 214/339 (63%), Gaps = 15/339 (4%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +   A  YY  L V +GA E QIKRAYRKLALKYHPDKNP +E A KKF EI+ AYEVLS
Sbjct  24    VCARASDYYAALGVSRGAEESQIKRAYRKLALKYHPDKNPNDERAKKKFTEISQAYEVLS  83

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeE---------K  1001
             D EKR+IYDRYGE+G+KQH  SG     G   QDIFS FFGGG                +
Sbjct  84    DKEKRSIYDRYGEDGVKQHEQSG--GRGGGGAQDIFSQFFGGGGPFGGFGGFGGEQEEPE  141

Query  1000  IAKGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQ  821
               KG  + +DL  +++++Y+G +  V REK + K A G R+CNCR ++  RQ+GPGM+QQ
Sbjct  142   TPKGTTIKVDLGMTVKEIYLGATAPVTREKLVTKSARGTRKCNCRQKLVTRQVGPGMYQQ  201

Query  820   MTEQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTA-  644
              TEQ C+ CPNVK  RE   + V+++ G   G E++F+E+G+  +DG+PGDL F ++T  
Sbjct  202   YTEQTCEDCPNVKLVRERADLKVEVDAGAPVGHEILFFEEGDAMIDGDPGDLLFVVQTLE  261

Query  643   -PHDQFKREG-NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGE  470
                ++  R G +DLH T  ITLV+AL GF K  KH D H V I   G+T P +    KGE
Sbjct  262   DKENRITRVGKSDLHMTYEITLVEALNGFSKIFKHYDGHDVVIARTGVTVPFDKMTLKGE  321

Query  469   GMPHHFSNKK-GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
             G+P H   KK GD+++TF+V FP SL  +Q+  + +   
Sbjct  322   GLPKHNQFKKFGDMFITFQVQFPASLDQKQRDVVSKTFA  360



>ref|XP_005071674.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X1 [Mesocricetus 
auratus]
 ref|XP_005071675.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X2 [Mesocricetus 
auratus]
Length=358

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VMAGRDFYKILGVPRSASVKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGAPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  +K++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGVKQLL  343



>ref|XP_003412955.1| PREDICTED: dnaJ homolog subfamily B member 11 [Loxodonta africana]
Length=358

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRIR   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIRVVKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDIPHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_006884167.1| PREDICTED: dnaJ homolog subfamily B member 11 [Elephantulus edwardii]
Length=358

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  80    SEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGAPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRIR   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIRVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_004413468.1| PREDICTED: dnaJ homolog subfamily B member 11 [Odobenus rosmarus 
divergens]
 ref|XP_006746967.1| PREDICTED: dnaJ homolog subfamily B member 11-like isoform X1 
[Leptonychotes weddellii]
Length=358

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 217/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   LT E +  IK++L  A+V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLNQASV  348



>ref|XP_006869808.1| PREDICTED: dnaJ homolog subfamily B member 11 [Chrysochloris 
asiatica]
Length=358

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRIR   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIRVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P   
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDIPHLDGHKVHISRDKITRPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_004640941.1| PREDICTED: dnaJ homolog subfamily B member 11 [Octodon degus]
Length=358

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    NEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_005344802.1| PREDICTED: dnaJ homolog subfamily B member 11 [Microtus ochrogaster]
Length=358

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VMAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLL  343



>ref|NP_057390.1| dnaJ homolog subfamily B member 11 precursor [Homo sapiens]
 ref|XP_002814428.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pongo abelii]
 ref|XP_003256658.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform 2 [Nomascus 
leucogenys]
 ref|XP_003894748.1| PREDICTED: dnaJ homolog subfamily B member 11 [Papio anubis]
 ref|XP_004038211.1| PREDICTED: dnaJ homolog subfamily B member 11 [Gorilla gorilla 
gorilla]
 ref|XP_004089754.1| PREDICTED: dnaJ homolog subfamily B member 11 [Nomascus leucogenys]
 ref|XP_005546672.1| PREDICTED: dnaJ homolog subfamily B member 11 [Macaca fascicularis]
 ref|XP_007970013.1| PREDICTED: dnaJ homolog subfamily B member 11 [Chlorocebus sabaeus]
 ref|XP_010374912.1| PREDICTED: dnaJ homolog subfamily B member 11 [Rhinopithecus 
roxellana]
 sp|Q9UBS4.1|DJB11_HUMAN RecName: Full=DnaJ homolog subfamily B member 11; AltName: Full=APOBEC1-binding 
protein 2; Short=ABBP-2; AltName: Full=DnaJ 
protein homolog 9; AltName: Full=ER-associated DNAJ; AltName: 
Full=ER-associated Hsp40 co-chaperone; AltName: Full=Endoplasmic 
reticulum DNA J domain-containing protein 3; Short=ER-resident 
protein ERdj3; Short=ERdj3; Short=ERj3p; AltName: 
Full=HEDJ; AltName: Full=Human DnaJ protein 9; Short=hDj-9; 
AltName: Full=PWP1-interacting protein 4; Flags: Precursor 
[Homo sapiens]
 sp|Q5RAJ6.1|DJB11_PONAB RecName: Full=DnaJ homolog subfamily B member 11; AltName: Full=ER-associated 
DNAJ; AltName: Full=ER-associated Hsp40 co-chaperone; 
AltName: Full=Endoplasmic reticulum DNA J domain-containing 
protein 3; Short=ER-resident protein ERdj3; Short=ERdj3; 
Short=ERj3p; Flags: Precursor [Pongo abelii]
 gb|AAF61711.1|AF228505_1 ER-associated Hsp40 co-chaperone [Homo sapiens]
 dbj|BAA88307.1| hDj9 [Homo sapiens]
 emb|CAB65118.1| ERj3 protein [Homo sapiens]
 gb|AAH01144.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Homo sapiens]
 dbj|BAC11617.1| unnamed protein product [Homo sapiens]
 gb|AAP35712.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Homo sapiens]
 gb|AAQ89402.1| DNAJB11 [Homo sapiens]
 emb|CAH91214.1| hypothetical protein [Pongo abelii]
 gb|AAX32316.1| DnaJ-like subfamily B member 11 [synthetic construct]
 gb|AAX32317.1| DnaJ-like subfamily B member 11 [synthetic construct]
 gb|EAW78190.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Homo sapiens]
 gb|ABM84795.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [synthetic construct]
 gb|ABM92218.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [synthetic construct]
 gb|EHH16523.1| hypothetical protein EGK_11812 [Macaca mulatta]
 gb|EHH51440.1| hypothetical protein EGM_10808 [Macaca fascicularis]
 gb|AIC51564.1| DNAJB11, partial [synthetic construct]
Length=358

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>sp|P81999.2|DJB11_CANFA RecName: Full=DnaJ homolog subfamily B member 11; AltName: Full=ER-associated 
DNAJ; AltName: Full=ER-associated Hsp40 co-chaperone; 
AltName: Full=Endoplasmic reticulum DNA J domain-containing 
protein 3; Short=ER-resident protein ERdj3; Short=ERdj3; 
Short=ERj3p; Flags: Precursor [Canis lupus familiaris]
Length=358

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 217/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             AIA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   LT E +  IK++L   +V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLNQGSV  348



>ref|XP_002758202.1| PREDICTED: dnaJ homolog subfamily B member 11 [Callithrix jacchus]
Length=358

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMAITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK +L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKRLL  343



>gb|AAP36528.1| Homo sapiens DnaJ (Hsp40) homolog, subfamily B, member 11 [synthetic 
construct]
 gb|AAX43912.1| DnaJ-like subfamily B member 11 [synthetic construct]
Length=359

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_002716504.1| PREDICTED: dnaJ homolog subfamily B member 11 [Oryctolagus cuniculus]
Length=358

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 217/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGFE  I HLD H V I    +T+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFEMDITHLDGHKVHISRDKVTRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   LT E +  IK++L  A+V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTQETREGIKQLLKQASV  348



>ref|XP_007934171.1| PREDICTED: dnaJ homolog subfamily B member 11 [Orycteropus afer 
afer]
Length=358

 Score =   292 bits (747),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRIR   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIRVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDIPHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  +K++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGVKQLL  343



>emb|CAG33377.1| DNAJB11 [Homo sapiens]
Length=358

 Score =   292 bits (747),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVRHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_003477123.1| PREDICTED: dnaJ homolog subfamily B member 11 [Cavia porcellus]
Length=358

 Score =   292 bits (747),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A ++F ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQERFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+++DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIVVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>gb|AAK69110.1|AF277317_1 PWP1-interacting protein 4 [Homo sapiens]
 dbj|BAC11533.1| unnamed protein product [Homo sapiens]
 dbj|BAG73087.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [synthetic construct]
Length=358

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_001153126.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pan troglodytes]
Length=358

 Score =   291 bits (746),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEVREGIKQLL  343



>ref|XP_003792768.1| PREDICTED: dnaJ homolog subfamily B member 11 [Otolemur garnettii]
Length=358

 Score =   291 bits (746),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    NEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_007647035.1| PREDICTED: dnaJ homolog subfamily B member 11 [Cricetulus griseus]
 ref|XP_007635481.1| PREDICTED: dnaJ homolog subfamily B member 11 [Cricetulus griseus]
Length=358

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VMAGRDFYKILGVPRSASVKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGAPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    +T+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKVTRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  +K++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGVKQLL  343



>ref|XP_004899743.1| PREDICTED: dnaJ homolog subfamily B member 11 [Heterocephalus 
glaber]
 ref|XP_004834889.1| PREDICTED: dnaJ homolog subfamily B member 11 [Heterocephalus 
glaber]
 gb|EHB12512.1| DnaJ-like protein subfamily B member 11 [Heterocephalus glaber]
Length=358

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEHPFIGEGEPHVDGEPGDLRFRIKVVKHRT  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  + HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDVTHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_008589459.1| PREDICTED: dnaJ homolog subfamily B member 11 [Galeopterus variegatus]
Length=358

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYE+LSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEILSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P   
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVRISRDKITRPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_006171533.1| PREDICTED: dnaJ homolog subfamily B member 11 [Tupaia chinensis]
 gb|ELV09451.1| DnaJ like protein subfamily B member 11 [Tupaia chinensis]
Length=358

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_422682.1| PREDICTED: dnaJ homolog subfamily B member 11 [Gallus gallus]
Length=358

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AAAGRDFYKILGVSRGASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALTGFEMDITHLDGHKVHVARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT+EQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTSEQREGLKQLL  343



>ref|XP_002597929.1| hypothetical protein BRAFLDRAFT_79829 [Branchiostoma floridae]
 gb|EEN53941.1| hypothetical protein BRAFLDRAFT_79829 [Branchiostoma floridae]
Length=363

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/325 (49%), Positives = 214/325 (66%), Gaps = 2/325 (1%)
 Frame = -3

Query  1327  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDG  1148
             +A + +Y IL VPK A+ +QIKRAYRKLA++YHPDKNP + EA++KF +I  AYEVLSD 
Sbjct  24    LAGRDFYKILGVPKDATTNQIKRAYRKLAMQYHPDKNPDDPEADEKFHDIGAAYEVLSDA  83

Query  1147  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDL  968
             +KR  YDR+GEEGLK+ +             D   SF GGG    + + I KG DV++DL
Sbjct  84    DKRKTYDRHGEEGLKEGSNFDPFGSFSSFFGDFGFSFGGGGRRGHDHQDIPKGGDVLVDL  143

Query  967   DASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPN  788
             + +LE+LY G  +++ R K + K   G R+CNCR E+   Q+GPG FQ M E VCD+CP 
Sbjct  144   EVTLEELYTGNFVEIIRYKPVAKTTKGMRKCNCRQEMKTTQLGPGRFQMMQETVCDECPA  203

Query  787   VKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDL  608
             VK   E   + V+IE+GM+DG E  F  +GEP +DGEPGDLKFRI    H++F+R G+DL
Sbjct  204   VKMVTEEKVLEVEIEQGMRDGHEYPFLSEGEPHIDGEPGDLKFRIIQLKHEKFERRGDDL  263

Query  607   HTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH-FSNKKGDL  431
             +T VTI+L  AL GFE  I+HLD H V I    +T P    + K EGMP++  +N +G L
Sbjct  264   YTNVTISLEDALTGFEMDIEHLDGHKVHIVRDKVTWPGSKIRKKDEGMPNYENNNSRGVL  323

Query  430   YVTFEVLFPT-SLTAEQKTKIKEVL  359
              +TF+V FP  S+T E K  +++VL
Sbjct  324   VITFDVEFPKGSITEENKEALRKVL  348



>ref|XP_004745256.1| PREDICTED: dnaJ homolog subfamily B member 11 [Mustela putorius 
furo]
 ref|XP_004787534.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X2 [Mustela 
putorius furo]
Length=358

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 216/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   LT E +  IK++L   +V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLNQGSV  348



>gb|AAL17676.1| apobec-1 binding protein 2 [Mus musculus]
Length=358

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G+ DG E  F  +GEP VDGEPGDL FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVLDGMEYPFIGEGEPHVDGEPGDLPFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLL  343



>ref|XP_005143133.1| PREDICTED: dnaJ homolog subfamily B member 11 [Melopsittacus 
undulatus]
Length=358

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AAAGRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALTGFEMDITHLDGHRVHIARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTNEQREGLKQLL  343



>ref|XP_006201050.1| PREDICTED: dnaJ homolog subfamily B member 11 [Vicugna pacos]
 ref|XP_010974449.1| PREDICTED: dnaJ homolog subfamily B member 11 [Camelus dromedarius]
Length=358

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DLD +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLDVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK +L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKHLL  343



>ref|XP_006188901.1| PREDICTED: dnaJ homolog subfamily B member 11 [Camelus ferus]
 ref|XP_010957509.1| PREDICTED: dnaJ homolog subfamily B member 11 [Camelus bactrianus]
Length=358

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DLD +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLDVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK +L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKHLL  343



>ref|XP_004473768.1| PREDICTED: dnaJ homolog subfamily B member 11 [Dasypus novemcinctus]
Length=358

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHLI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_004603082.1| PREDICTED: dnaJ homolog subfamily B member 11 [Sorex araneus]
Length=358

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VLAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDIAHLDGHKVHISRDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_003209039.1| PREDICTED: dnaJ homolog subfamily B member 11 [Meleagris gallopavo]
Length=358

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AAAGRDFYKILGVSRGASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  + HLD H V +    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALTGFEMDVTHLDGHKVHVARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT+EQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTSEQREGLKQLL  343



>ref|XP_003927037.2| PREDICTED: dnaJ homolog subfamily B member 11 [Saimiri boliviensis 
boliviensis]
Length=443

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  105   VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  164

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  165   SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  215

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  216   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  275

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  276   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  335

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  336   FERRGDDLYTNVTISLVESLVGFEMAITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  395

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  396   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  428



>ref|XP_007519831.1| PREDICTED: dnaJ homolog subfamily B member 11 [Erinaceus europaeus]
Length=358

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    ITKP      KGEG+P   
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITKPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>dbj|BAC35956.1| unnamed protein product [Mus musculus]
Length=358

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R  +DL+T VT++LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERREDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E K  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLL  343



>ref|XP_002914864.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Ailuropoda 
melanoleuca]
Length=358

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/338 (48%), Positives = 216/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDIPHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  +G L +TF+V FP   LT E +  IK++L   +V
Sbjct  311   NNNIRGSLIITFDVDFPKEQLTEEAREGIKQLLNQGSV  348



>ref|XP_006985115.1| PREDICTED: dnaJ homolog subfamily B member 11 [Peromyscus maniculatus 
bairdii]
Length=358

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VMAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT + K  +K +L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEDAKEGVKHLL  343



>ref|XP_008953947.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pan paniscus]
Length=437

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 215/333 (65%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  99    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  158

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  159   SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  209

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  210   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  269

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  270   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  329

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  330   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  389

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  390   NNNIKGSLIITFDVDFPKEQLTEEVREGIKQLL  422



>ref|NP_001231275.1| dnaJ homolog subfamily B member 11 precursor [Sus scrofa]
 ref|XP_005652418.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X1 [Sus 
scrofa]
Length=358

 Score =   290 bits (742),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>gb|ELK00785.1| DnaJ like protein subfamily B member 11 [Pteropus alecto]
Length=358

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_010559480.1| PREDICTED: dnaJ homolog subfamily B member 11 [Haliaeetus leucocephalus]
Length=358

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AAAGRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTNEQREGLKQLL  343



>ref|XP_008054549.1| PREDICTED: dnaJ homolog subfamily B member 11 [Tarsius syrichta]
Length=358

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I     T+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKTTRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  +K++L
Sbjct  311   NNNVKGSLIITFDVDFPKEQLTEEAREGVKQLL  343



>ref|XP_008821858.1| PREDICTED: dnaJ homolog subfamily B member 11 [Nannospalax galili]
Length=358

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              +KR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SDKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRT  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+ALVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   L  E K  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLAEEAKEGIKQLL  343



>ref|XP_003991867.1| PREDICTED: dnaJ homolog subfamily B member 11 [Felis catus]
 ref|XP_007083657.1| PREDICTED: dnaJ homolog subfamily B member 11 [Panthera tigris 
altaica]
Length=358

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_004997094.1| chaperone protein dnaJ [Salpingoeca rosetta]
 gb|EGD80533.1| chaperone protein dnaJ [Salpingoeca rosetta]
Length=361

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 212/322 (66%), Gaps = 3/322 (1%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V + AS+  IK+AYRKLA++YHPDKNP NEEA +KF +I  AYEVLSD EKR
Sbjct  22    RDFYKILGVKRSASKRDIKKAYRKLAIQYHPDKNPDNEEAAQKFQDIGAAYEVLSDEEKR  81

Query  1138  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDLDAS  959
              IYD++GEEGLK +AA        M       SFFG G N+  E +  KG DV++DL  S
Sbjct  82    KIYDKHGEEGLK-NAAGQQHDPFDMFSSMFGGSFFGFGGNQRRERETPKGADVVLDLAVS  140

Query  958   LEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVKF  779
             LEDLY G   ++   K + KP  G R+CNCR E+  +QI PG FQ M  QVCD+C NVK 
Sbjct  141   LEDLYNGQFFEILHAKPVPKPTSGTRKCNCRMEMKTQQIAPGQFQMMNAQVCDECQNVKM  200

Query  778   EREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLHTT  599
               E   + V++E GM +GQE+VF  +GEP +DG+PGDLKFRIRT  H +F+R GN+L T 
Sbjct  201   VIEHVELDVEVEPGMVEGQELVFTAEGEPHIDGDPGDLKFRIRTQKHPRFQRSGNNLLTN  260

Query  598   VTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNKK-GDLYVT  422
             VTI+L  +LVGF   I+HLD H V +  KGIT    V + KGEGM  + +N   GDLY+T
Sbjct  261   VTISLRDSLVGFSMEIEHLDGHKVTVERKGITPHGTVHRIKGEGMMQYDNNLVIGDLYIT  320

Query  421   FEVLFP-TSLTAEQKTKIKEVL  359
             F+V +P    T ++  ++ E+L
Sbjct  321   FDVHYPERQFTEDEADRLIELL  342



>ref|XP_004713474.1| PREDICTED: dnaJ homolog subfamily B member 11 [Echinops telfairi]
Length=358

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK+ H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDAYGEEGLKEGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+ L+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVALEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRIR   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIRVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   L+ E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLSEEAREGIKQLL  343



>ref|XP_004424661.1| PREDICTED: dnaJ homolog subfamily B member 11 [Ceratotherium 
simum simum]
Length=358

 Score =   290 bits (741),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P   
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>gb|EGW01989.1| DnaJ-like subfamily B member 11 [Cricetulus griseus]
Length=359

 Score =   290 bits (741),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 214/334 (64%), Gaps = 18/334 (5%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +    + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLS
Sbjct  20    VMAGGRDFYKILGVPRSASVKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIA  995
             D EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I 
Sbjct  80    DSEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGAPRQQDRNIP  130

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             +G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   
Sbjct  131   RGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQ  190

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
             E VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H 
Sbjct  191   EVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHR  250

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
              F+R G+DL+T VT++LV+ALVGFE  I HLD H V I    +T+P      KGEG+P+ 
Sbjct  251   IFERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKVTRPGAKLWKKGEGLPNF  310

Query  454   FSNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              +N  KG L +TF+V FP   LT E K  +K++L
Sbjct  311   DNNNIKGSLIITFDVDFPKEQLTEEAKEGVKQLL  344



>ref|XP_009047397.1| hypothetical protein LOTGIDRAFT_138864 [Lottia gigantea]
 gb|ESP01907.1| hypothetical protein LOTGIDRAFT_138864 [Lottia gigantea]
Length=341

 Score =   289 bits (739),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 215/324 (66%), Gaps = 9/324 (3%)
 Frame = -3

Query  1321  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEK  1142
             ++ +Y IL V K A+ +QIKRAYRKLA ++HPDKN  + +A ++F ++  AYEVLSD +K
Sbjct  11    SRDFYSILGVSKSANTNQIKRAYRKLAKEHHPDKNKDDPDAERRFQDLGAAYEVLSDADK  70

Query  1141  RNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDLDA  962
             R IYDR+GEEGL +    G    +                   +E++  +G DV++DL+ 
Sbjct  71    RKIYDRHGEEGLSKSDTHGDPFSSFFGDFGFGFG-------GNQEQETPRGGDVLMDLEV  123

Query  961   SLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVK  782
             +LE+LY G  ++V R K + KPA G R+CNCRNE+   Q+GPG FQ   +QVCD+CPNV+
Sbjct  124   TLEELYSGNFVEVIRYKPVAKPAKGTRKCNCRNEMVTTQLGPGRFQMSQQQVCDECPNVR  183

Query  781   FEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLHT  602
             F  E   + ++IE GM+DGQ   F  +GEP +DGEPGDLKF+I+ A H +F+R G+DL+T
Sbjct  184   FVPEERILEIEIEPGMRDGQIYPFVAEGEPHIDGEPGDLKFKIKQAKHKKFERRGDDLYT  243

Query  601   TVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-KGDLYV  425
              VTI+LV A+VGFE  I HLD+H V +    IT P    +  GEGMP++ +N  KG LY+
Sbjct  244   NVTISLVDAMVGFEMEINHLDNHRVHVSRDKITWPGARLRKSGEGMPNYENNNVKGALYI  303

Query  424   TFEVLFPT-SLTAEQKTKIKEVLG  356
             TF+V FP  SLT EQ+  +KE+LG
Sbjct  304   TFDVEFPKGSLTEEQRQALKELLG  327



>ref|NP_001029440.1| dnaJ homolog subfamily B member 11 precursor [Bos taurus]
 ref|XP_004003111.1| PREDICTED: dnaJ homolog subfamily B member 11 [Ovis aries]
 ref|XP_005201525.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X1 [Bos 
taurus]
 ref|XP_005675219.1| PREDICTED: dnaJ homolog subfamily B member 11 [Capra hircus]
 ref|XP_005910819.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X1 [Bos 
mutus]
 ref|XP_005910820.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X2 [Bos 
mutus]
 ref|XP_005981576.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pantholops hodgsonii]
 ref|XP_006058686.1| PREDICTED: dnaJ homolog subfamily B member 11 [Bubalus bubalis]
 ref|XP_010852195.1| PREDICTED: dnaJ homolog subfamily B member 11 [Bison bison bison]
 sp|Q3ZBA6.1|DJB11_BOVIN RecName: Full=DnaJ homolog subfamily B member 11; AltName: Full=ER-associated 
DNAJ; AltName: Full=ER-associated Hsp40 co-chaperone; 
AltName: Full=Endoplasmic reticulum DNA J domain-containing 
protein 3; Short=ER-resident protein ERdj3; Short=ERdj3; 
Short=ERj3p; Flags: Precursor [Bos taurus]
 gb|AAI03471.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Bos taurus]
 tpg|DAA33354.1| TPA: dnaJ homolog subfamily B member 11 precursor [Bos taurus]
 gb|ELR45246.1| DnaJ-like protein subfamily B member 11 [Bos mutus]
Length=358

 Score =   289 bits (740),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHSI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   L+ E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLSEEAREGIKQLL  343



>ref|XP_005050942.1| PREDICTED: dnaJ homolog subfamily B member 11 [Ficedula albicollis]
Length=358

 Score =   289 bits (740),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AAAGRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I     TKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIVRDKTTKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LTAEQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTAEQREGLKQLL  343



>ref|XP_010136350.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Buceros 
rhinoceros silvestris]
Length=342

 Score =   288 bits (738),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 213/329 (65%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  8     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  67

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  68    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  118

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  119   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  178

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  179   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  238

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VT++LV+AL GFE  I HLD H V I    ITKP+     KGEG+P+  +N  
Sbjct  239   GDDLYTNVTVSLVEALTGFEMNIVHLDGHKVHIARDTITKPRAKLWKKGEGLPNFDNNNI  298

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  299   KGSLVITFDVEFPKEQLTNEQREGLKQLL  327



>ref|XP_009069360.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Acanthisitta 
chloris]
Length=338

 Score =   288 bits (738),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 213/329 (65%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  4     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  63

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  64    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  114

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  115   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  174

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  175   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  234

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  235   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  294

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LTAEQ+  +K++L
Sbjct  295   KGSLIITFDVEFPKEQLTAEQREGLKQLL  323



>ref|XP_008155792.1| PREDICTED: dnaJ homolog subfamily B member 11 [Eptesicus fuscus]
 gb|ELK37405.1| DnaJ like protein subfamily B member 11 [Myotis davidii]
Length=358

 Score =   289 bits (739),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK+ H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKEGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDAMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_004382309.1| PREDICTED: dnaJ homolog subfamily B member 11 [Trichechus manatus 
latirostris]
Length=358

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 212/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRIR   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHVDGEPGDLRFRIRVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGFE  I HLD H V I     T+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKTTRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_001499286.1| PREDICTED: dnaJ homolog subfamily B member 11 [Equus caballus]
Length=358

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGF+  I HLD H V I    IT+P      KGEG+P   
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  343



>ref|XP_004278514.1| PREDICTED: dnaJ homolog subfamily B member 11 [Orcinus orca]
Length=358

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 216/338 (64%), Gaps = 18/338 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFDMDIAHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             +N  KG L +TF+V FP   L+ E +  IK++L   +V
Sbjct  311   NNNIKGSLIITFDVDFPKEQLSEEAREGIKQLLNQGSV  348



>ref|XP_010622501.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X2 [Fukomys 
damarensis]
Length=337

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 213/330 (65%), Gaps = 18/330 (5%)
 Frame = -3

Query  1321  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEK  1142
              + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD EK
Sbjct  2     VRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEK  61

Query  1141  RNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDD  983
             R  YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D
Sbjct  62    RKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSD  112

Query  982   VIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC  803
             +I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VC
Sbjct  113   IIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVC  172

Query  802   DQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKR  623
             D+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R
Sbjct  173   DECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRIFER  232

Query  622   EGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK  443
              G+DL+T VT++LV++LVGFE  I HLD H V I    ITKP      KGEG+P+  +N 
Sbjct  233   RGDDLYTNVTVSLVESLVGFEMDIIHLDGHKVHISRDKITKPGAKLWKKGEGLPNFDNNN  292

Query  442   -KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              KG L +TF+V FP   LT E +  IK++L
Sbjct  293   IKGSLIITFDVDFPKEQLTEEAREGIKQLL  322



>ref|XP_005639860.1| PREDICTED: DnaJ (Hsp40) homolog, subfamily B, member 11 isoform 
X2 [Canis lupus familiaris]
Length=345

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 215/337 (64%), Gaps = 18/337 (5%)
 Frame = -3

Query  1327  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDG  1148
             +  + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD 
Sbjct  8     VTRRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDS  67

Query  1147  EKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKG  989
             EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +G
Sbjct  68    EKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPRG  118

Query  988   DDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQ  809
              D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E 
Sbjct  119   SDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEV  178

Query  808   VCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQF  629
             VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F
Sbjct  179   VCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIF  238

Query  628   KREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFS  449
             +R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  +
Sbjct  239   ERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFDN  298

Query  448   NK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             N  KG L +TF+V FP   LT E +  IK++L   +V
Sbjct  299   NNIKGSLIITFDVDFPKEQLTEEAREGIKQLLNQGSV  335



>ref|XP_005529587.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pseudopodoces 
humilis]
Length=358

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AAAGRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I     TKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKTTKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTPEQREGLKQLL  343



>ref|XP_006084876.1| PREDICTED: dnaJ homolog subfamily B member 11 [Myotis lucifugus]
Length=358

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK+ H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKEGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDAMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  +K++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGVKQLL  343



>ref|XP_006021054.1| PREDICTED: dnaJ homolog subfamily B member 11 [Alligator sinensis]
 ref|XP_006272102.1| PREDICTED: dnaJ homolog subfamily B member 11 [Alligator mississippiensis]
Length=358

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    ATAGRDFYKILGVSRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+ALVGFE  I HLD H V +    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALVGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT EQ+  ++++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTDEQREGLQQLL  343



>ref|XP_010012669.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Nestor 
notabilis]
Length=352

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  14    AAAGRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  73

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  74    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  124

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  125   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  184

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  185   VVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  244

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  
Sbjct  245   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFD  304

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  305   NNNIKGSLIITFDVEFPKEQLTNEQREGLKQLL  337



>ref|XP_007195315.1| PREDICTED: dnaJ homolog subfamily B member 11 [Balaenoptera acutorostrata 
scammoni]
Length=358

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFDMDIAHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   L+ E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLSEEAREGIKQLL  343



>ref|XP_005639859.1| PREDICTED: DnaJ (Hsp40) homolog, subfamily B, member 11 isoform 
X1 [Canis lupus familiaris]
Length=359

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/339 (48%), Positives = 216/339 (64%), Gaps = 18/339 (5%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             + I  + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLS
Sbjct  20    VNIYWRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIA  995
             D EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I 
Sbjct  80    DSEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIP  130

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             +G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   
Sbjct  131   RGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQ  190

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
             E VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H 
Sbjct  191   EVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHP  250

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
              F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+ 
Sbjct  251   IFERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNF  310

Query  454   FSNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
              +N  KG L +TF+V FP   LT E +  IK++L   +V
Sbjct  311   DNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLNQGSV  349



>ref|XP_004675129.1| PREDICTED: dnaJ homolog subfamily B member 11 [Condylura cristata]
Length=358

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              I  + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD
Sbjct  20    VIGGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDIAHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  +K++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGVKQLL  343



>ref|XP_007451438.1| PREDICTED: dnaJ homolog subfamily B member 11 [Lipotes vexillifer]
Length=358

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDIAHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   L+ E +  +K++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLSEEAREGVKQLL  343



>ref|XP_007116343.1| PREDICTED: dnaJ homolog subfamily B member 11 [Physeter catodon]
Length=358

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFDMDIAHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   L+ E +  IK++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLSEEAREGIKQLL  343



>ref|XP_009321182.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Pygoscelis 
adeliae]
Length=338

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  4     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  63

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  64    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  114

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  115   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  174

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  175   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  234

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  235   GDDLYTNVTISLVEALTGFEMDITHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  294

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L VTF+V FP   LT EQ+  +K++L
Sbjct  295   KGSLIVTFDVEFPKEQLTNEQREGLKQLL  323



>ref|XP_009663421.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Struthio 
camelus australis]
Length=340

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A   + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  2     APTRRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  61

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  62    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  112

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  113   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  172

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  173   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  232

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  
Sbjct  233   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFD  292

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L VTF+V FP   LT EQ+  +K++L
Sbjct  293   NNNIKGSLIVTFDVEFPREQLTDEQREGLKQLL  325



>ref|XP_007514172.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15609.1| predicted protein [Bathycoccus prasinos]
Length=475

 Score =   291 bits (746),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 223/334 (67%), Gaps = 13/334 (4%)
 Frame = -3

Query  1321  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEK  1142
             AK YY IL V +GA E QIKRAYRKLALKYHPDKNPG+++A  KF E++NAYEVL+D EK
Sbjct  137   AKDYYSILGVARGAPESQIKRAYRKLALKYHPDKNPGDDKAKSKFEELSNAYEVLTDEEK  196

Query  1141  RNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN-------eeeeEKIAKGDD  983
             R IYDR+GEEGLKQH   GGG G   +  DIFS FFGGG           +E +  KG+ 
Sbjct  197   RQIYDRHGEEGLKQHQQGGGGGGG-GHPGDIFSQFFGGGFGGFGGFGGMNQEPETPKGEP  255

Query  982   VIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC  803
             V +DL  SL+DLY+G ++KV R+K++LKPA G R+CNCR ++  RQ+GPGMFQQ  +  C
Sbjct  256   VQMDLYVSLKDLYLGNTIKVIRDKDVLKPAKGTRKCNCRQKMVTRQVGPGMFQQYAQNEC  315

Query  802   DQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFK-  626
             ++CPNVK  RE   +  +IE GM+DG+E++F+E+G+  +DGEPGDLK  ++     + K 
Sbjct  316   EECPNVKLAREKSTLMCEIEPGMEDGKEILFFEEGDVLIDGEPGDLKMIVKAQYDKEMKW  375

Query  625   REG---NDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
             R G   N+L+    ITLV AL GFE  I H D   + + ++ +T P  V+ +KGEGMP  
Sbjct  376   RRGASDNNLYMDKEITLVMALNGFETEITHYDGRKIVLKNEEVTTPGFVQTYKGEGMPRF  435

Query  454   FSNKK-GDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
              S+ K GDL VT+ + FP  +    K  +K++  
Sbjct  436   GSSGKFGDLVVTYSIKFPKKVPNGSKQIVKDIFS  469



>ref|XP_010119024.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Chlamydotis 
macqueenii]
Length=335

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  292   KGSLIITFDVEFPKEQLTNEQREGLKQLL  320



>ref|XP_006925878.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 
11 [Pteropus alecto]
Length=437

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  99    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  158

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  159   SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  209

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  210   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  269

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  270   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  329

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  330   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  389

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  390   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  422



>gb|KFP90342.1| DnaJ subfamily B member 11, partial [Apaloderma vittatum]
Length=335

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDITHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  292   KGSLIITFDVEFPKEQLTNEQREGLKQLL  320



>ref|XP_009870657.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Apaloderma 
vittatum]
Length=339

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  5     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  64

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  65    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  115

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  116   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  175

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  176   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  235

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  236   GDDLYTNVTISLVEALTGFEMDITHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  295

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  296   KGSLIITFDVEFPKEQLTNEQREGLKQLL  324



>ref|XP_005639861.1| PREDICTED: DnaJ (Hsp40) homolog, subfamily B, member 11 isoform 
X3 [Canis lupus familiaris]
Length=345

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 214/334 (64%), Gaps = 18/334 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  11    RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDSEKR  70

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  71    KQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDI  121

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  122   IVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  181

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  182   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERR  241

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  +N  
Sbjct  242   GDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNI  301

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             KG L +TF+V FP   LT E +  IK++L   +V
Sbjct  302   KGSLIITFDVDFPKEQLTEEAREGIKQLLNQGSV  335



>ref|XP_009951382.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Leptosomus 
discolor]
Length=339

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  5     RDFYRILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  64

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  65    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  115

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  116   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  175

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  176   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  235

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  236   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  295

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  296   KGSLIITFDVEFPKEQLTNEQREGLKQLL  324



>ref|XP_009087536.1| PREDICTED: dnaJ homolog subfamily B member 11 [Serinus canaria]
Length=358

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    AAAGRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I     TKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIVRDKTTKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVEFPKEQLTPEQREGLKQLL  343



>gb|KDO87047.1| hypothetical protein CISIN_1g0191622mg, partial [Citrus sinensis]
 gb|KDO87048.1| hypothetical protein CISIN_1g0191622mg, partial [Citrus sinensis]
Length=151

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -3

Query  808  VCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQF  629
            VCDQC NVK+EREGY++TVDIEKGMQDGQEVVFYEDGEPK+DGEPGDLKFRIRTAPHD+F
Sbjct  1    VCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDRF  60

Query  628  KREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFS  449
            +REGN+LHTTVT+TLVQALVGFEKTI+HLD+HLVDI +KGITKPKEV+KF GEGMP HFS
Sbjct  61   RREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGITKPKEVRKFGGEGMPLHFS  120

Query  448  NKKGDLYVTFEVLFPTSLTAEQKTKIKEVLG  356
            NKKGDLY+TFEVLFPT+LT +QKT+IKEVLG
Sbjct  121  NKKGDLYITFEVLFPTTLTEDQKTRIKEVLG  151



>gb|EFX89009.1| hypothetical protein DAPPUDRAFT_206336 [Daphnia pulex]
Length=357

 Score =   287 bits (734),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 214/333 (64%), Gaps = 16/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGN-EEANKKFAEINNAYEVLS  1154
              +A + +Y IL + K A+ +QIK+AYRKLA + HPD+N  + E+A+ +F ++  AYE LS
Sbjct  17    VLAGRDFYKILGIQKSANTNQIKKAYRKLAKELHPDRNKEDPEKASAQFQDLGAAYETLS  76

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeee------EKIAK  992
             D EKR +YDR GEE + +  A GGG        D F+SFFG               ++AK
Sbjct  77    DPEKRELYDRCGEECVSKEGAGGGG-------MDPFASFFGDFGFGFGGNGNQGQREVAK  129

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+++DL  SLE+LY G  +++   K +LKPA G R+CNCR E+  RQ+GPG FQ M +
Sbjct  130   GADIVMDLFVSLEELYSGNFVEITHNKPVLKPAKGTRKCNCRQEMVTRQLGPGRFQMMQQ  189

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE+GM DG E  F  +GEP  DGEPGDL+ RI+TAPH  
Sbjct  190   AVCDECPNVKLVNEERVLEVEIEQGMTDGLEQRFTAEGEPHTDGEPGDLRLRIQTAPHSI  249

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+L  AL GFE  I+HLD H V I    +T P    + KGEGMP++ 
Sbjct  250   FERRGDDLYTNVTISLADALAGFELDIEHLDGHKVHIVRDKVTWPGARIRKKGEGMPNYD  309

Query  451   SNKK-GDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N   G LYVTF+V FP   L+ E K K++++L
Sbjct  310   NNNLFGMLYVTFDVQFPKDELSTEVKEKLRQLL  342



>ref|XP_009642766.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 
11 [Egretta garzetta]
Length=337

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 212/330 (64%), Gaps = 18/330 (5%)
 Frame = -3

Query  1321  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEK  1142
              + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EK
Sbjct  2     GRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEK  61

Query  1141  RNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDD  983
             R  YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D
Sbjct  62    RKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSD  112

Query  982   VIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC  803
             +I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VC
Sbjct  113   IIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVC  172

Query  802   DQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKR  623
             D+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R
Sbjct  173   DECPNVKXVSETRTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFER  232

Query  622   EGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK  443
              G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N 
Sbjct  233   RGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNN  292

Query  442   -KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              KG L +TF+V FP   LT EQ+  +K++L
Sbjct  293   IKGSLIITFDVEFPKEQLTNEQREGLKQLL  322



>ref|XP_008945154.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Merops 
nubicus]
Length=336

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  2     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  61

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  62    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  112

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  113   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  172

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  173   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  232

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  233   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  292

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  293   KGSLIITFDVEFPKEQLTNEQREGLKQLL  321



>ref|XP_002411512.1| molecular chaperone, putative [Ixodes scapularis]
 gb|EEC13694.1| molecular chaperone, putative [Ixodes scapularis]
Length=357

 Score =   287 bits (734),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 213/322 (66%), Gaps = 6/322 (2%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V + A+ +QIK+AYRKLA + HPDKN  +  A +KF ++  AYEVLSD +KR
Sbjct  25    RDFYKILGVSRSANVNQIKKAYRKLAKELHPDKNKDDPHAQEKFQDLGAAYEVLSDSDKR  84

Query  1138  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVIIDLDAS  959
             + YD++GEEGLK H A GG   +           F G  +  E+ +  +G DV++DL  +
Sbjct  85    SAYDKHGEEGLK-HDAFGG---SDPFASFFGDFGFFGEGSRNEQRETPRGSDVVMDLWVT  140

Query  958   LEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQCPNVKF  779
             LE+LY G  ++V R K  +KPA G RRCNCR E+  RQ+GPG FQ M + VCD+CPNVK 
Sbjct  141   LEELYSGNFVEVVRNKPTVKPAKGTRRCNCRQEMVTRQLGPGRFQMMQQSVCDECPNVKL  200

Query  778   EREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGNDLHTT  599
               E   + V++E GM+DGQE VF  +GEP +DGEPGDLK RIRT PH  F+R+G+DL+T 
Sbjct  201   VSEEKLLEVEVEAGMRDGQEQVFVAEGEPHIDGEPGDLKLRIRTMPHPVFERKGDDLYTN  260

Query  598   VTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-KGDLYVT  422
             +TI+L  A+VGFE  I HLD H V I  + +T P    + K EGMP++ +N  KG LYVT
Sbjct  261   ITISLTDAMVGFETEITHLDGHKVTITREKVTWPGARLRKKNEGMPNYENNNLKGTLYVT  320

Query  421   FEVLFPT-SLTAEQKTKIKEVL  359
             F+V FP   L+AE K  +K +L
Sbjct  321   FDVDFPKGDLSAENKEALKNIL  342



>ref|XP_005501678.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Columba 
livia]
 gb|EMC77952.1| DnaJ like protein subfamily B member 11, partial [Columba livia]
Length=335

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 213/329 (65%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDITHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT++Q+  +K++L
Sbjct  292   KGSLIITFDVEFPKEQLTSDQREGLKQLL  320



>ref|XP_010072304.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Pterocles 
gutturalis]
Length=338

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  4     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  63

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  64    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  114

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  115   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  174

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  175   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  234

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  235   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  294

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  295   KGSLIITFDVEFPKEQLTNEQREGLKQLL  323



>ref|XP_005858487.1| PREDICTED: dnaJ homolog subfamily B member 11 [Myotis brandtii]
 gb|EPQ02836.1| DnaJ like protein subfamily B member 11 [Myotis brandtii]
Length=437

 Score =   289 bits (740),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  99    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  158

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK+ H +S G         DIFS       F  GG   +++  I +
Sbjct  159   SEKRKQYDTYGEEGLKEGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  209

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  210   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  269

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  270   VVCDECPNVKLVNEERTLEVEIEPGVRDAMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  329

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  330   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  389

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  390   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  422



>ref|XP_005303720.1| PREDICTED: dnaJ homolog subfamily B member 11 [Chrysemys picta 
bellii]
Length=358

 Score =   286 bits (733),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    ASAGRDFYKILGVSRSASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H  S G         DIFS       F  GG   +++  I +
Sbjct  80    EEKRKQYDTYGEEGLKDGHQGSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T +TI+LV+AL+GFE  I HLD H V +    ITKP      KGEG+P+  
Sbjct  251   FERRGDDLYTNITISLVEALIGFEIDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTDEQREGLKQLL  343



>ref|XP_006754221.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 
11 [Myotis davidii]
Length=438

 Score =   289 bits (740),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  100   VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  159

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK+ H +S G         DIFS       F  GG   +++  I +
Sbjct  160   SEKRKQYDTYGEEGLKEGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  210

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  211   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  270

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  271   VVCDECPNVKLVNEERTLEVEIEPGVRDAMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  330

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  331   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  390

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  KG L +TF+V FP   LT E +  IK++L
Sbjct  391   NNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL  423



>ref|XP_010285722.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Phaethon 
lepturus]
Length=339

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 211/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  5     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  64

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  65    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  115

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  116   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  175

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  176   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  235

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  236   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  295

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K +L
Sbjct  296   KGSLIITFDVEFPKEQLTNEQREGLKRLL  324



>ref|XP_006746968.1| PREDICTED: dnaJ homolog subfamily B member 11-like isoform X2 
[Leptonychotes weddellii]
Length=356

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 211/330 (64%), Gaps = 18/330 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIK  368
             +N  KG L +TF+V FP   LT E +  I+
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEEAREGIQ  340



>ref|XP_009568480.1| PREDICTED: dnaJ homolog subfamily B member 11 [Cuculus canorus]
Length=379

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 213/329 (65%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD EKR
Sbjct  45    RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDEEKR  104

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  105   KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  155

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  156   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  215

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+F+I+   H  F+R 
Sbjct  216   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFKIKVLKHPVFERR  275

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  276   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  335

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT+EQ+  +K +L
Sbjct  336   KGSLIITFDVEFPKEQLTSEQREGLKRLL  364



>ref|XP_004787533.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X1 [Mustela 
putorius furo]
Length=386

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 214/334 (64%), Gaps = 18/334 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  52    RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDSEKR  111

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  112   KQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDI  162

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  163   IVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  222

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  223   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERR  282

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  +N  
Sbjct  283   GDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNI  342

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVLG*AAV  344
             KG L +TF+V FP   LT E +  IK++L   +V
Sbjct  343   KGSLIITFDVDFPKEQLTEEAREGIKQLLNQGSV  376



>ref|XP_008628266.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Corvus 
brachyrhynchos]
Length=338

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 211/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  4     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  63

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  64    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  114

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  115   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  174

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  175   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  234

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I     TKP      KGEG+P+  +N  
Sbjct  235   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKTTKPGAKLWKKGEGLPNFDNNNI  294

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  295   KGSLIITFDVEFPKEQLTPEQREGLKQLL  323



>ref|XP_007227819.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Astyanax 
mexicanus]
Length=360

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 211/327 (65%), Gaps = 6/327 (2%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL V K AS   IK+AYRKLAL+ HPD+NP +  A  KFA++  AYEVLSD
Sbjct  22    VLAGRDFYKILGVSKSASIKDIKKAYRKLALQLHPDRNPDDPSAQDKFADLGAAYEVLSD  81

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR  YD YGEEGLK+ H +S G   +       F         ++++  I +G+D+I+
Sbjct  82    EEKRKQYDAYGEEGLKEGHHSSHGDIFSSFFGDFGFMFGGN---RQQQDRNIPRGNDIIL  138

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DL+ +LE++Y G  ++V R K I K APGKR+CNCR E+   Q+GPG FQ   E VCD+C
Sbjct  139   DLEVTLEEVYSGNFVEVVRNKPIAKEAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDEC  198

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PN+K   E   + V+IE+G++D  E  F  +GEP +DGEPGDL+FRI+   H  F+R G+
Sbjct  199   PNIKLVNEERTLEVEIEQGVRDEMEYPFIGEGEPHIDGEPGDLRFRIKVLKHPLFERRGD  258

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-KG  437
             DL+T VTI+LV+ALVGFE  I HLD H V I    ITKP      KGEG+P+  +N  +G
Sbjct  259   DLYTNVTISLVEALVGFEMQITHLDGHKVHIARDKITKPGSRLWKKGEGLPNFDNNNIRG  318

Query  436   DLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              L +TF+V FP   L  +QK  IK++L
Sbjct  319   SLIITFDVDFPKEQLDDQQKDGIKQLL  345



>ref|XP_008489284.1| PREDICTED: dnaJ homolog subfamily B member 11 [Calypte anna]
Length=350

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 213/334 (64%), Gaps = 18/334 (5%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +    + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLS
Sbjct  11    VPAPQRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLS  70

Query  1153  DGEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIA  995
             D EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I 
Sbjct  71    DEEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIP  121

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             +G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   
Sbjct  122   RGSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQ  181

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
             E VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H 
Sbjct  182   EVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHP  241

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
              F+R G+DL+T VTI+LV+AL GFE  + HLD H V +    ITKP      KGEG+P+ 
Sbjct  242   VFERRGDDLYTNVTISLVEALTGFEMDVAHLDGHKVHVTRDKITKPGAKLWKKGEGLPNF  301

Query  454   FSNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  302   DNNNIKGSLIITFDVEFPKEQLTNEQREGLKQLL  335



>gb|KFO90914.1| DnaJ subfamily B member 11, partial [Buceros rhinoceros silvestris]
Length=315

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 208/322 (65%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VT++LV+AL GFE  I HLD H V I    ITKP+     KGEG+P+  +N  
Sbjct  232   GDDLYTNVTVSLVEALTGFEMNIVHLDGHKVHIARDTITKPRAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  292   KGSLVITFDVEFPKEQLTNEQR  313



>ref|XP_008917847.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Manacus 
vitellinus]
Length=333

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/327 (49%), Positives = 211/327 (65%), Gaps = 18/327 (6%)
 Frame = -3

Query  1312  YYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKRNI  1133
             +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR  
Sbjct  1     FYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKRKQ  60

Query  1132  YDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDVII  974
             YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+I+
Sbjct  61    YDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDIIV  111

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD+C
Sbjct  112   DLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDEC  171

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R G+
Sbjct  172   PNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERRGD  231

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-KG  437
             DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  KG
Sbjct  232   DLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNIKG  291

Query  436   DLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              L +TF+V FP   LT +Q+  +K++L
Sbjct  292   SLIITFDVEFPKEQLTPDQREGLKQLL  318



>ref|XP_005028153.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Anas 
platyrhynchos]
Length=333

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 160/327 (49%), Positives = 210/327 (64%), Gaps = 18/327 (6%)
 Frame = -3

Query  1312  YYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKRNI  1133
             +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR  
Sbjct  1     FYKILGVSRSASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKRKQ  60

Query  1132  YDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDVII  974
             YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+I+
Sbjct  61    YDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDIIV  111

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD+C
Sbjct  112   DLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDEC  171

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R G+
Sbjct  172   PNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERRGD  231

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-KG  437
             DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  KG
Sbjct  232   DLYTNVTISLVEALTGFEMDITHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNIKG  291

Query  436   DLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              L +TF+V FP   LT EQ+  +K++L
Sbjct  292   SLIITFDVEFPKEQLTNEQREGLKQLL  318



>ref|XP_003770222.1| PREDICTED: dnaJ homolog subfamily B member 11 [Sarcophilus harrisii]
Length=358

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VMAGRDFYKILGVPRSASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G+D+++DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GNDIVVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPL  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++L+GFE  I+HLD H V +    IT+P      KGEG+P   
Sbjct  251   FERRGDDLYTNVTISLVESLIGFEMDIQHLDGHKVHVARDKITRPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  +G L +TF+V FP    T  Q+  IK++L
Sbjct  311   NNNIRGSLIITFDVEFPKEQFTEHQREGIKQLL  343



>ref|XP_001377387.2| PREDICTED: dnaJ homolog subfamily B member 11 [Monodelphis domestica]
Length=358

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 213/333 (64%), Gaps = 18/333 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VMAGRDFYKILGVPRSASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+++DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIVVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++L+GFE  I+HLD H V +    IT+P      KGEG+P   
Sbjct  251   FERRGDDLYTNVTISLVESLIGFEMDIQHLDGHKVHVARDKITRPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             +N  +G L +TF+V FP    T +Q+  IK++L
Sbjct  311   NNNIRGSLIITFDVEFPKEQFTEQQREGIKQLL  343



>gb|KFQ49396.1| DnaJ subfamily B member 11, partial [Nestor notabilis]
Length=333

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 208/326 (64%), Gaps = 18/326 (6%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  15    AAAGRDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  74

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  75    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPR  125

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  126   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  185

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  186   VVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  245

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  
Sbjct  246   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFD  305

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQK  380
             +N  KG L +TF+V FP   LT EQ+
Sbjct  306   NNNIKGSLIITFDVEFPKEQLTNEQR  331



>ref|XP_010210799.1| PREDICTED: dnaJ homolog subfamily B member 11 [Tinamus guttatus]
Length=404

 Score =   286 bits (732),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  70    RDFYKILGVSRGASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  129

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  130   KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  180

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  181   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  240

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  241   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  300

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VT++LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  301   GDDLYTNVTVSLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKVWKKGEGLPNFDNNNI  360

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  361   KGSLIITFDVEFPKEQLTNEQREGLKQLL  389


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  1324  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGE  1145
             A + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYE     E
Sbjct  12    ALRDFYKILGVSRGASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYE---PAE  68

Query  1144  KRNIYDRYG  1118
             +R+ Y   G
Sbjct  69    RRDFYKILG  77



>ref|XP_005489666.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Zonotrichia 
albicollis]
Length=338

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 211/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  4     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  63

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +G D+
Sbjct  64    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPRGSDI  114

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  115   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  174

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  175   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  234

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I     TKP      KGEG+P+  +N  
Sbjct  235   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIVRDKTTKPGAKLWKKGEGLPNFDNNNI  294

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  295   KGSLIITFDVEFPKEQLTPEQREGLKQLL  323



>gb|KFW66297.1| DnaJ subfamily B member 11, partial [Pygoscelis adeliae]
Length=315

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDITHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L VTF+V FP   LT EQ+
Sbjct  292   KGSLIVTFDVEFPKEQLTNEQR  313



>ref|XP_008536907.1| PREDICTED: dnaJ homolog subfamily B member 11 [Equus przewalskii]
Length=351

 Score =   284 bits (727),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 206/324 (64%), Gaps = 17/324 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VT++LV++LVGF+  I HLD H V I    IT+P      KGEG+P   
Sbjct  251   FERRGDDLYTNVTVSLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPSFD  310

Query  451   SNK-KGDLYVTFEVLFPTSLTAEQ  383
             +N  KG L +TF+V FP     E+
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEE  334



>gb|KFO70617.1| DnaJ subfamily B member 11, partial [Cuculus canorus]
Length=315

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 209/322 (65%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+F+I+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFKIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT+EQ+
Sbjct  292   KGSLIITFDVEFPKEQLTSEQR  313



>ref|XP_006636456.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Lepisosteus 
oculatus]
Length=362

 Score =   284 bits (727),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 212/326 (65%), Gaps = 5/326 (2%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              +A + +Y IL V + AS   IK+AYRKLAL+ HPD+NP + +A  KF ++  AYEVLSD
Sbjct  22    VLAGRDFYKILGVSRSASIKDIKKAYRKLALQLHPDRNPDDPQAQDKFQDLGAAYEVLSD  81

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPNeeeeEKIAKGDDVII  974
              EKR  YD YGEEGLK+ H +S G      +    F   FGG P +++   I +G+D+++
Sbjct  82    EEKRKQYDAYGEEGLKEGHHSSHGD--IFSSFFGDFGFMFGGNPRQQDR-NIPRGNDIVL  138

Query  973   DLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCDQC  794
             DLD +LE++Y G  ++V R K + K APGKR+CNCR E+   Q+GPG FQ   E VCD+C
Sbjct  139   DLDVTLEEVYSGNFVEVIRNKPVAKEAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDEC  198

Query  793   PNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKREGN  614
             PNVK   E   + V+IE+G++D  E  F  +GEP +DGEPGDL+FRI+   H  F+R G+
Sbjct  199   PNVKLVNEERTLEVEIEQGVRDDMEYPFIGEGEPHIDGEPGDLRFRIKVMKHPVFERRGD  258

Query  613   DLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-KG  437
             DL+T VTI+LV+ALVGFE  I HLD H V I    ITKP      KGEG+P+  +N  +G
Sbjct  259   DLYTNVTISLVEALVGFEMDITHLDGHKVHIVRDKITKPGAKLWKKGEGLPNFDNNNIRG  318

Query  436   DLYVTFEVLFPTSLTAEQKTKIKEVL  359
              L VTF+V FP     EQ+ +++  L
Sbjct  319   SLIVTFDVEFPREQLTEQQREVERAL  344



>ref|NP_001091184.1| uncharacterized protein LOC100036945 [Xenopus laevis]
 gb|AAI29700.1| LOC100036945 protein [Xenopus laevis]
Length=358

 Score =   284 bits (727),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 212/334 (63%), Gaps = 18/334 (5%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +    + +Y IL V +GA+  +IK+AYRKLAL+ HPD+NP +  A  KF ++  AYEVLS
Sbjct  19    VVSGGRDFYKILGVSRGATVKEIKKAYRKLALQLHPDRNPDDPNAQDKFQDLGAAYEVLS  78

Query  1153  DGEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIA  995
             D EKR  YD YGEEGLK  H  S G         DIFS FFG           +++  I 
Sbjct  79    DEEKRKQYDTYGEEGLKDGHQGSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIP  129

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             +G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   
Sbjct  130   RGSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQ  189

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
             E VCD+CPNVK   E   + V+IE G++DG E  F  +GEP +DGEPGDL+FRI+   H 
Sbjct  190   EVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHIDGEPGDLRFRIKVLKHP  249

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
              F+R G+DL+T V+I+LV+AL+GFE  I HLD H V I    ITKP      KGEG+P+ 
Sbjct  250   IFERRGDDLYTNVSISLVEALIGFEMDITHLDSHKVHIMRDKITKPGAKLWKKGEGLPNF  309

Query  454   FSNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              +N  KG L +TF+V FP   LT EQ+  +K+ +
Sbjct  310   DNNNIKGSLIITFDVEFPKEQLTEEQRQGVKQFM  343



>ref|XP_793217.2| PREDICTED: dnaJ homolog subfamily B member 11-like [Strongylocentrotus 
purpuratus]
Length=358

 Score =   284 bits (727),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 213/331 (64%), Gaps = 17/331 (5%)
 Frame = -3

Query  1324  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGE  1145
             A + +Y IL VP+ A+ +QIK+AYRKLA++YHPDKN  + EA++KF ++  AYEVLSD +
Sbjct  21    AGRDFYKILGVPRDATTNQIKKAYRKLAMQYHPDKNIDDPEASEKFQDLGAAYEVLSDED  80

Query  1144  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG-------GGPNeeeeEKIAKGD  986
             +R  YD  GEEGLK       G        D FSSFFG       G   +   + I +GD
Sbjct  81    QRKTYDARGEEGLKDMGHGHHG--------DPFSSFFGDFNFAFGGNGGQRRGQDIPRGD  132

Query  985   DVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQV  806
             D+ +DLD +LE+LY G  ++V R K +   APG R+CNCR E+   Q+GPG FQ   ++V
Sbjct  133   DITVDLDVTLEELYSGNFVEVVRYKPVATEAPGTRKCNCRQEMQTVQLGPGRFQMTQKEV  192

Query  805   CDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFK  626
             CD CPNVKF  E   + ++IE GM+DGQE  F  +GEP +DGEPGDL+F+I    H  F+
Sbjct  193   CDACPNVKFVSEEKLLEIEIEPGMRDGQEYPFVAEGEPHIDGEPGDLRFQIIALKHAIFE  252

Query  625   REGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSN  446
             R+G+DL+T +TI+LV AL GFE  IKHLD H V I    +T P    + KGEGMP++ +N
Sbjct  253   RKGDDLYTNITISLVDALTGFEMDIKHLDGHKVHIMRDKVTWPGAKMRKKGEGMPNYDNN  312

Query  445   K-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
               KG L VTF+V FP   +T EQK  ++ +L
Sbjct  313   NVKGTLIVTFDVDFPKGDMTQEQKDSLQSLL  343



>gb|KFP99322.1| DnaJ subfamily B member 11, partial [Leptosomus discolor]
Length=328

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYRILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  292   KGSLIITFDVEFPKEQLTNEQR  313



>ref|XP_008703434.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X2 [Ursus 
maritimus]
Length=386

 Score =   285 bits (729),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 207/324 (64%), Gaps = 17/324 (5%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
              IA + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  20    VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  79

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I +
Sbjct  80    SEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPR  130

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  131   GSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  190

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  191   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPI  250

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  
Sbjct  251   FERRGDDLYTNVTISLVESLVGFDMDIPHLDGHKVHISRDKITRPGAKLWKKGEGLPNFD  310

Query  451   SNK-KGDLYVTFEVLFPTSLTAEQ  383
             +N  KG L +TF+V FP     E+
Sbjct  311   NNNIKGSLIITFDVDFPKEQLTEE  334



>gb|KFP36182.1| DnaJ subfamily B member 11, partial [Chlamydotis macqueenii]
Length=315

 Score =   282 bits (722),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  292   KGSLIITFDVEFPKEQLTNEQR  313



>gb|KFV75587.1| DnaJ subfamily B member 11, partial [Struthio camelus australis]
Length=316

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L VTF+V FP   LT EQ+
Sbjct  292   KGSLIVTFDVEFPREQLTDEQR  313



>ref|XP_010409501.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Corvus 
cornix cornix]
Length=351

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 211/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  17    RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  76

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  77    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  127

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VC+
Sbjct  128   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCE  187

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  188   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  247

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I     TKP      KGEG+P+  +N  
Sbjct  248   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKTTKPGAKLWKKGEGLPNFDNNNI  307

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  308   KGSLIITFDVEFPKEQLTPEQREGLKQLL  336



>ref|XP_010006225.1| PREDICTED: dnaJ homolog subfamily B member 11 [Chaetura pelagica]
Length=389

 Score =   285 bits (728),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 212/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  55    RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  114

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  115   KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  165

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  166   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  225

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  226   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  285

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  286   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  345

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT +Q+  +K++L
Sbjct  346   KGSLIITFDVEFPKEQLTNQQREGLKQLL  374



>ref|XP_010190443.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 
11, partial [Mesitornis unicolor]
Length=335

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 211/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKXVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   L+ EQ+  +K++L
Sbjct  292   KGSLIITFDVEFPKEQLSNEQREGLKQLL  320



>ref|NP_001086343.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Xenopus laevis]
 gb|AAH75137.1| MGC81924 protein [Xenopus laevis]
Length=360

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 213/334 (64%), Gaps = 18/334 (5%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             +    + +Y IL V +GA+  +IK+AYRKLAL+ HPD+NP +  A  KF ++  AYEVLS
Sbjct  21    VVSGGRDFYKILGVSRGATVKEIKKAYRKLALQLHPDRNPDDPNAQDKFQDLGAAYEVLS  80

Query  1153  DGEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIA  995
             D EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I 
Sbjct  81    DEEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIP  131

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             +G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   
Sbjct  132   RGSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQ  191

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
             E VCD+CPNVK   E   + V+IE G++D  E  F  +GEP +DGEPGDL+FRI+   H 
Sbjct  192   EVVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHIDGEPGDLRFRIKVLKHP  251

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
              F+R G+DL+T V+I+LV+AL+GFE  I HLD H V I    ITKP      KGEG+P+ 
Sbjct  252   IFERRGDDLYTNVSISLVEALIGFEMDITHLDGHKVHIMRDKITKPGAKLWKKGEGLPNF  311

Query  454   FSNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              +N  KG L +TF+V FP   LT EQ+  +K++L
Sbjct  312   DNNNIKGSLIITFDVEFPKEQLTEEQRQGVKQLL  345



>ref|NP_989180.1| DnaJ (Hsp40) homolog, subfamily B, member 11 [Xenopus (Silurana) 
tropicalis]
 gb|AAH63341.1| hypothetical protein MGC75796 [Xenopus (Silurana) tropicalis]
Length=360

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 213/334 (64%), Gaps = 18/334 (5%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             I    + +Y IL V KGA+  +IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLS
Sbjct  21    IVSGGRDFYKILGVSKGATVKEIKKAYRKLALQLHPDRNPDDPNAQEKFQDLGAAYEVLS  80

Query  1153  DGEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIA  995
             D EKR  YD YGEEGLK  H +S G         DIFS FFG           +++  I 
Sbjct  81    DEEKRKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIP  131

Query  994   KGDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMT  815
             +G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   
Sbjct  132   RGSDIIVDLEVTLEEVYSGNFVEVIRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQ  191

Query  814   EQVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHD  635
             E VCD+CPNVK   E   + V+IE G++D  E  F  +GEP +DGEPGDL+FRI+   H 
Sbjct  192   EVVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHIDGEPGDLRFRIKVLKHP  251

Query  634   QFKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHH  455
              F+R G+DL+T V+I+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+ 
Sbjct  252   IFERRGDDLYTNVSISLVEALTGFEMDIAHLDGHKVHILRDKITKPGAKLWKKGEGLPNF  311

Query  454   FSNK-KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              +N  KG L +TF+V FP   LT EQ+  +K+++
Sbjct  312   DNNNIKGSLIITFDVEFPKEQLTMEQRQGVKQLM  345



>gb|EFN87028.1| DnaJ-like protein subfamily B member 11 [Harpegnathos saltator]
 gb|EFN87030.1| DnaJ-like protein subfamily B member 11 [Harpegnathos saltator]
Length=359

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/337 (46%), Positives = 213/337 (63%), Gaps = 14/337 (4%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             ++IA + +Y+IL + + AS   IK+AYR+LA + HPDKN  + +A++KF ++  AYEVLS
Sbjct  20    LSIAGRDFYNILGLSRSASTHAIKKAYRQLAKELHPDKNKDDPDASRKFQDLGAAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG-----GPNeeeeEKIAKG  989
             D EKR +YDR GEE LK+        G   N  D F+SFFG      G     + +  +G
Sbjct  80    DPEKREMYDRCGEECLKRD-------GMMNNNVDPFASFFGDFSFHFGGESHHQHETPRG  132

Query  988   DDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQ  809
              + I+DL  +LE+LY G  +++ R K ++K A G R+CNCR E+  R +G G FQ M + 
Sbjct  133   ANTIMDLPVTLEELYSGNFIEITRNKLVVKAAKGTRKCNCRQELVTRNLGNGRFQMMQQS  192

Query  808   VCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQF  629
             VC +CPNVK   E   + V+IE GM DGQE  F  +GEP +DGEPGDL  +IRT PH  F
Sbjct  193   VCSECPNVKLVNEDRVLEVEIEPGMVDGQETKFTAEGEPHIDGEPGDLILKIRTLPHPVF  252

Query  628   KREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFS  449
             +R+G+DL+T +TI+L  AL+GF   IKHLD H V I    ITK     + KGEGMP++ +
Sbjct  253   ERKGDDLYTNITISLQDALLGFTVDIKHLDGHTVTIQRDKITKHGARIRKKGEGMPNYDN  312

Query  448   NK-KGDLYVTFEVLFP-TSLTAEQKTKIKEVLG*AAV  344
             N   G L+VTF+V FP    T EQK  I+++L  ++V
Sbjct  313   NNLHGTLFVTFDVAFPDNEFTNEQKEDIRKLLQQSSV  349



>gb|KFQ22942.1| DnaJ subfamily B member 11, partial [Merops nubicus]
 gb|KFQ67384.1| DnaJ subfamily B member 11, partial [Phaethon lepturus]
Length=315

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  292   KGSLIITFDVEFPKEQLTNEQR  313



>ref|XP_006111236.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pelodiscus sinensis]
Length=347

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 211/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  13    RDFYKILGVSRSASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  72

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAKGDDV  980
               YD YGEEGLK  H  S G         DIFS       F  GG   +++  I +G D+
Sbjct  73    KQYDTYGEEGLKDGHQGSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPRGSDI  123

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  124   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  183

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  184   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  243

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+ALVGFE  I HLD H V +    ITKP      KG+G+P+  +N  
Sbjct  244   GDDLYTNVTISLVEALVGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGDGLPNFDNNNI  303

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  ++++L
Sbjct  304   KGSLIITFDVDFPKEQLTDEQREGLRQLL  332



>gb|KFV03360.1| DnaJ subfamily B member 11, partial [Pterocles gutturalis]
Length=316

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  292   KGSLIITFDVEFPKEQLTNEQR  313



>gb|KFV69168.1| DnaJ subfamily B member 11, partial [Picoides pubescens]
Length=326

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 207/326 (63%), Gaps = 18/326 (6%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A   + +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  8     APTRRDFYKILGVSRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  67

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  68    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPR  118

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  119   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  178

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  179   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  238

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  
Sbjct  239   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFD  298

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQK  380
             +N  KG L +TF+V FP   LT EQ+
Sbjct  299   NNNIKGSLIITFDVEFPREQLTGEQR  324



>ref|XP_009461097.1| PREDICTED: dnaJ homolog subfamily B member 11 [Nipponia nippon]
Length=351

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 211/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +  IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  17    RDFSKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  76

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  77    KQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  127

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  128   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  187

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  188   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  247

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  +N  
Sbjct  248   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFDNNNI  307

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT +Q+  +K++L
Sbjct  308   KGSLIITFDVEFPKEQLTNKQREGLKQLL  336



>gb|KGL75809.1| DnaJ subfamily B member 11, partial [Tinamus guttatus]
Length=323

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  8     RDFYKILGVSRGASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  67

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  68    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  118

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  119   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  178

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  179   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  238

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VT++LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  239   GDDLYTNVTVSLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKVWKKGEGLPNFDNNNI  298

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  299   KGSLIITFDVEFPKEQLTNEQR  320



>ref|XP_009922315.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Haliaeetus 
albicilla]
Length=339

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  4     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  63

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  64    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  114

Query  979   IIDLDASLEDLYMGGSMKVWREKN-ILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC  803
             I+DL+ +LE++Y G  ++V R K  + + APGKR+CNCR E+   Q+GPG FQ   E VC
Sbjct  115   IVDLEVTLEEVYSGNFVEVVRRKKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVC  174

Query  802   DQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKR  623
             D+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R
Sbjct  175   DECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFER  234

Query  622   EGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK  443
              G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N 
Sbjct  235   RGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNN  294

Query  442   -KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
              KG L +TF+V FP   LT EQ+  +K++L
Sbjct  295   IKGSLIITFDVEFPKEQLTNEQREGLKQLL  324



>ref|XP_010622500.1| PREDICTED: dnaJ homolog subfamily B member 11 isoform X1 [Fukomys 
damarensis]
Length=366

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 206/321 (64%), Gaps = 17/321 (5%)
 Frame = -3

Query  1321  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEK  1142
              + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP + +A +KF ++  AYEVLSD EK
Sbjct  2     VRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEK  61

Query  1141  RNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDD  983
             R  YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D
Sbjct  62    RKQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSD  112

Query  982   VIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVC  803
             +I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VC
Sbjct  113   IIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVC  172

Query  802   DQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKR  623
             D+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R
Sbjct  173   DECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRIFER  232

Query  622   EGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK  443
              G+DL+T VT++LV++LVGFE  I HLD H V I    ITKP      KGEG+P+  +N 
Sbjct  233   RGDDLYTNVTVSLVESLVGFEMDIIHLDGHKVHISRDKITKPGAKLWKKGEGLPNFDNNN  292

Query  442   -KGDLYVTFEVLFPTSLTAEQ  383
              KG L +TF+V FP     E+
Sbjct  293   IKGSLIITFDVDFPKEQLTEE  313



>gb|KFO56319.1| DnaJ subfamily B member 11, partial [Corvus brachyrhynchos]
Length=315

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 206/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V I     TKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKTTKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  292   KGSLIITFDVEFPKEQLTPEQR  313



>ref|XP_009901203.1| PREDICTED: dnaJ homolog subfamily B member 11, partial [Picoides 
pubescens]
Length=342

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 207/326 (63%), Gaps = 18/326 (6%)
 Frame = -3

Query  1330  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSD  1151
             A   + +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD
Sbjct  2     APTRRDFYKILGVSRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSD  61

Query  1150  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAK  992
              EKR  YD YGEEGLK  H +S G         DIFS       F  GG   +++  I +
Sbjct  62    EEKRKQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPR  112

Query  991   GDDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTE  812
             G D+I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E
Sbjct  113   GSDIIVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQE  172

Query  811   QVCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQ  632
              VCD+CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  
Sbjct  173   VVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPV  232

Query  631   FKREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHF  452
             F+R G+DL+T VTI+LV+AL GFE  I HLD H V I    ITKP      KGEG+P+  
Sbjct  233   FERRGDDLYTNVTISLVEALTGFEMDIAHLDGHKVHIARDKITKPGAKLWKKGEGLPNFD  292

Query  451   SNK-KGDLYVTFEVLFPT-SLTAEQK  380
             +N  KG L +TF+V FP   LT EQ+
Sbjct  293   NNNIKGSLIITFDVEFPREQLTGEQR  318



>gb|KFW77412.1| DnaJ subfamily B member 11, partial [Manacus vitellinus]
Length=315

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT +Q+
Sbjct  292   KGSLIITFDVEFPKEQLTPDQR  313



>gb|KFU83669.1| DnaJ subfamily B member 11, partial [Chaetura pelagica]
Length=315

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT +Q+
Sbjct  292   KGSLIITFDVEFPKEQLTNQQR  313



>gb|KFO98736.1| DnaJ subfamily B member 11, partial [Calypte anna]
Length=315

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 207/322 (64%), Gaps = 18/322 (6%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V +GAS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVSRGASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDAYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL GFE  + HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVEALTGFEMDVAHLDGHKVHVTRDKITKPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPT-SLTAEQK  380
             KG L +TF+V FP   LT EQ+
Sbjct  292   KGSLIITFDVEFPKEQLTNEQR  313



>gb|EZA59269.1| DnaJ-like protein subfamily B member [Cerapachys biroi]
Length=359

 Score =   282 bits (721),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 207/332 (62%), Gaps = 14/332 (4%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
             ++IA + +Y+IL + + AS   IK+AYR+LA + HPDKN  + +A++KF ++  AYEVLS
Sbjct  20    LSIAGRDFYNILGLSRSASTHAIKKAYRQLAKELHPDKNKDDPDASQKFQDLGAAYEVLS  79

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG-----GPNeeeeEKIAKG  989
             D EKR +YDR GEE LK+     G         D F+SFFG      G     + +  KG
Sbjct  80    DPEKREMYDRCGEECLKKDGMMNGN-------MDPFASFFGDFSFHFGGESHHQHETPKG  132

Query  988   DDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQ  809
              +V+IDL  +LE+LY G  +++ R K ++K A G R+CNCR E+  R +G G FQ   + 
Sbjct  133   SNVVIDLHVTLEELYSGNFIEITRNKAVIKAAKGTRKCNCRQELVTRNLGNGRFQMTQQA  192

Query  808   VCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQF  629
             VC +CPNVK   E   + V++E GM DGQE  F  +GEP +DGEPGDL  +I T PH  F
Sbjct  193   VCSECPNVKLVNEERTLEVEVEPGMVDGQETKFTAEGEPHLDGEPGDLILKICTIPHPVF  252

Query  628   KREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFS  449
             +R G+DL+T +TI++  AL GF   IKHLD H V I    ITK     + KGEGMP++ +
Sbjct  253   ERRGDDLYTNITISMQDALTGFTIDIKHLDGHKVAIQRDKITKHGARIRKKGEGMPNYEN  312

Query  448   NK-KGDLYVTFEVLFP-TSLTAEQKTKIKEVL  359
             N   G LYVTF+V FP T  T EQK  IK++L
Sbjct  313   NNLHGTLYVTFDVAFPDTEFTDEQKEDIKKLL  344



>gb|EFB26307.1| hypothetical protein PANDA_002804 [Ailuropoda melanoleuca]
Length=315

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 205/320 (64%), Gaps = 17/320 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL VP+ AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  1     RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDSEKR  60

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGGGPN------eeeeEKIAKGDDV  980
               YD YGEEGLK  H +S G         DIFS FFG           +++  I +G D+
Sbjct  61    KQYDTYGEEGLKDGHQSSHG---------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDI  111

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  112   IVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  171

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++DG E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  172   ECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERR  231

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV++LVGF+  I HLD H V I    IT+P      KGEG+P+  +N  
Sbjct  232   GDDLYTNVTISLVESLVGFDMDIPHLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNI  291

Query  442   KGDLYVTFEVLFPTSLTAEQ  383
             +G L +TF+V FP     E+
Sbjct  292   RGSLIITFDVDFPKEQLTEE  311



>ref|XP_004530311.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Ceratitis 
capitata]
Length=355

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 215/332 (65%), Gaps = 14/332 (4%)
 Frame = -3

Query  1333  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLS  1154
                A + +Y+IL+V K AS ++IK+AYRKLA + HPDKN  +  A++KF ++  AYEVLS
Sbjct  19    FVFAGRDFYNILKVRKSASTNEIKKAYRKLAKELHPDKNKDDPSASEKFQDLGAAYEVLS  78

Query  1153  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeee-----eEKIAKG  989
             D +KR  YDR GEE LK+      G        D F+SFFG            E++ A+G
Sbjct  79    DSDKRKTYDRCGEECLKKDGMMDHG-------ADPFASFFGDFGFHFGNGDPHEQQAARG  131

Query  988   DDVIIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQ  809
              +++++L  +LE+LY G  +++ R K +LKPA G R+CNCR E+  R +GPG FQ + + 
Sbjct  132   ANIVMNLYVTLEELYSGNFVEIVRNKPVLKPASGTRKCNCRQEMVTRNLGPGRFQMIQQT  191

Query  808   VCDQCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQF  629
             VCD+CPNVK   E   + V+IE GM DGQE  F  +GEP +DGEPGDL  ++   PH++F
Sbjct  192   VCDECPNVKLVNEERTLEVEIEAGMVDGQETRFVAEGEPHLDGEPGDLIIKVLQTPHNRF  251

Query  628   KREGNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFS  449
             +R+G+DL+T VTI+L  +L+GF   I HLD H V I  + IT P    + KGEGMP++ +
Sbjct  252   QRKGDDLYTNVTISLQDSLIGFTMNITHLDGHSVSITREKITWPGARIRKKGEGMPNYEN  311

Query  448   NK-KGDLYVTFEVLFP-TSLTAEQKTKIKEVL  359
             N  +G+LY+TF+V FP T L+ E+K  +K +L
Sbjct  312   NNLQGNLYITFDVEFPKTDLSDEEKQDLKRIL  343



>ref|XP_007052710.1| PREDICTED: dnaJ homolog subfamily B member 11 [Chelonia mydas]
Length=376

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 210/329 (64%), Gaps = 18/329 (5%)
 Frame = -3

Query  1318  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFAEINNAYEVLSDGEKR  1139
             + +Y IL V + AS   IK+AYRKLAL+ HPD+NP +  A +KF ++  AYEVLSD EKR
Sbjct  42    RDFYKILGVSRSASVKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDEEKR  101

Query  1138  NIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFS------SFFGGGPNeeeeEKIAKGDDV  980
               YD YGEEGLK  H  S G         DIFS       F  GG   +++  I +G D+
Sbjct  102   KQYDTYGEEGLKDGHQGSHG---------DIFSHFFGDFGFMFGGSPRQQDRNIPRGSDI  152

Query  979   IIDLDASLEDLYMGGSMKVWREKNILKPAPGKRRCNCRNEVYHRQIGPGMFQQMTEQVCD  800
             I+DL+ +LE++Y G  ++V R K + + APGKR+CNCR E+   Q+GPG FQ   E VCD
Sbjct  153   IVDLEVTLEEVYSGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCD  212

Query  799   QCPNVKFEREGYYITVDIEKGMQDGQEVVFYEDGEPKVDGEPGDLKFRIRTAPHDQFKRE  620
             +CPNVK   E   + V+IE G++D  E  F  +GEP VDGEPGDL+FRI+   H  F+R 
Sbjct  213   ECPNVKLVNEERTLEVEIEPGVRDDMEYPFIGEGEPHVDGEPGDLRFRIKVLKHPVFERR  272

Query  619   GNDLHTTVTITLVQALVGFEKTIKHLDDHLVDIGSKGITKPKEVKKFKGEGMPHHFSNK-  443
             G+DL+T VTI+LV+AL+GFE  I HLD H V +    ITKP      KGEG+P+  +N  
Sbjct  273   GDDLYTNVTISLVEALIGFEMDIAHLDGHKVHVARDKITKPGAKLWKKGEGLPNFDNNNI  332

Query  442   KGDLYVTFEVLFPT-SLTAEQKTKIKEVL  359
             KG L +TF+V FP   LT EQ+  +K++L
Sbjct  333   KGSLIITFDVDFPKEQLTDEQREGLKQLL  361



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4519421289488