BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11157_g1_i1 len=1065 path=[1:0-1064]

Length=1065
                                                                      Score     E

ref|XP_009767328.1|  PREDICTED: ethylene-responsive transcription...    128   6e-32   
ref|XP_009617210.1|  PREDICTED: ethylene-responsive transcription...    122   6e-30   
gb|AID51418.1|  ethylene response factor 13                             120   3e-29   
ref|XP_007019844.1|  Integrase-type DNA-binding superfamily prote...    121   6e-29   
ref|XP_006376167.1|  hypothetical protein POPTR_0013s10420g             119   1e-28   
gb|KDP44735.1|  hypothetical protein JCGZ_01235                         117   9e-28   
ref|XP_011009999.1|  PREDICTED: ethylene-responsive transcription...    117   9e-28   
ref|XP_002325945.2|  hypothetical protein POPTR_0019s10220g             116   3e-27   Populus trichocarpa [western balsam poplar]
emb|CDP00864.1|  unnamed protein product                                113   8e-27   
ref|XP_011036246.1|  PREDICTED: ethylene-responsive transcription...    115   1e-26   
gb|ABQ62994.1|  RAP2-like protein                                       114   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006337962.1|  PREDICTED: ethylene-responsive transcription...    112   1e-26   
gb|KDO51723.1|  hypothetical protein CISIN_1g045327mg                   113   2e-26   
ref|XP_006478270.1|  PREDICTED: ethylene-responsive transcription...    113   2e-26   
ref|XP_010064855.1|  PREDICTED: ethylene-responsive transcription...    112   3e-26   
ref|XP_004229130.1|  PREDICTED: ethylene-responsive transcription...    110   6e-26   
ref|XP_006441635.1|  hypothetical protein CICLE_v10023345mg             110   2e-25   
gb|EYU22737.1|  hypothetical protein MIMGU_mgv1a015981mg                109   4e-25   
gb|EPS67960.1|  hypothetical protein M569_06819                         107   2e-24   
ref|XP_008339079.1|  PREDICTED: ethylene-responsive transcription...    107   3e-24   
ref|XP_008219092.1|  PREDICTED: ethylene-responsive transcription...    107   4e-24   
ref|XP_007226695.1|  hypothetical protein PRUPE_ppa020605mg             107   4e-24   
ref|XP_003610945.1|  Ethylene-responsive transcription factor ERF019    106   5e-24   
ref|XP_002528041.1|  Transcriptional factor TINY, putative              106   8e-24   Ricinus communis
ref|XP_009378898.1|  PREDICTED: ethylene-responsive transcription...    106   8e-24   
ref|XP_004299862.1|  PREDICTED: ethylene-responsive transcription...    106   8e-24   
ref|XP_009378943.1|  PREDICTED: ethylene-responsive transcription...    106   9e-24   
ref|XP_009335464.1|  PREDICTED: ethylene-responsive transcription...    105   2e-23   
ref|XP_009357194.1|  PREDICTED: ethylene-responsive transcription...    104   4e-23   
emb|CDY25755.1|  BnaA07g10270D                                          103   4e-23   
emb|CDY04784.1|  BnaC05g18050D                                          102   5e-23   
ref|XP_009103218.1|  PREDICTED: ethylene-responsive transcription...    103   6e-23   
ref|XP_009115599.1|  PREDICTED: ethylene-responsive transcription...    102   7e-23   
emb|CDY12507.1|  BnaC07g13470D                                          103   7e-23   
ref|XP_009115598.1|  PREDICTED: ethylene-responsive transcription...    102   7e-23   
ref|XP_009115597.1|  PREDICTED: ethylene-responsive transcription...    102   9e-23   
ref|XP_008365260.1|  PREDICTED: ethylene-responsive transcription...    103   1e-22   
ref|XP_011095709.1|  PREDICTED: ethylene-responsive transcription...    102   2e-22   
ref|XP_008441160.1|  PREDICTED: ethylene-responsive transcription...    101   2e-22   
ref|XP_004138829.1|  PREDICTED: ethylene-responsive transcription...    100   4e-22   
ref|NP_173695.1|  ethylene-responsive transcription factor ERF019       100   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416153.1|  hypothetical protein EUTSA_v10009842mg             100   6e-22   
gb|KFK44371.1|  hypothetical protein AALP_AA1G248600                    100   8e-22   
ref|XP_009357258.1|  PREDICTED: ethylene-responsive transcription...    100   2e-21   
ref|XP_006304697.1|  hypothetical protein CARUB_v10011955mg           98.6    2e-21   
ref|XP_002893249.1|  hypothetical protein ARALYDRAFT_889793           98.6    2e-21   
ref|XP_010498767.1|  PREDICTED: ethylene-responsive transcription...  98.2    4e-21   
ref|XP_010477551.1|  PREDICTED: ethylene-responsive transcription...  97.4    6e-21   
ref|XP_010460046.1|  PREDICTED: ethylene-responsive transcription...  97.4    7e-21   
ref|XP_002887377.1|  hypothetical protein ARALYDRAFT_476281           97.1    8e-21   
ref|XP_007156998.1|  hypothetical protein PHAVU_002G035100g           97.8    1e-20   
ref|XP_010100093.1|  Ethylene-responsive transcription factor         97.1    1e-20   
emb|CDX96329.1|  BnaA07g29400D                                        95.1    3e-20   
ref|XP_006301935.1|  hypothetical protein CARUB_v10022408mg           95.5    3e-20   
ref|XP_002276994.2|  PREDICTED: ethylene-responsive transcription...  95.9    4e-20   Vitis vinifera
emb|CDX72812.1|  BnaC06g32600D                                        94.7    4e-20   
ref|XP_010427986.1|  PREDICTED: ethylene-responsive transcription...  94.4    9e-20   
ref|XP_003538667.2|  PREDICTED: ethylene-responsive transcription...  94.7    1e-19   
ref|NP_177307.1|  ERF/AP2 transcription factor family protein DRE...  93.2    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471164.1|  PREDICTED: ethylene-responsive transcription...  92.8    3e-19   
emb|CAN76087.1|  hypothetical protein VITISV_028805                   95.1    3e-19   Vitis vinifera
ref|XP_009105818.1|  PREDICTED: ethylene-responsive transcription...  92.4    4e-19   
ref|XP_010415862.1|  PREDICTED: ethylene-responsive transcription...  92.0    5e-19   
ref|XP_003516746.1|  PREDICTED: ethylene-responsive transcription...  92.8    6e-19   
ref|XP_006390762.1|  hypothetical protein EUTSA_v10019510mg           91.7    8e-19   
emb|CDY03696.1|  BnaA02g15410D                                        91.3    1e-18   
ref|XP_010927841.1|  PREDICTED: ethylene-responsive transcription...  90.9    2e-18   
ref|XP_010910416.1|  PREDICTED: ethylene-responsive transcription...  90.1    4e-18   
ref|XP_004511495.1|  PREDICTED: ethylene-responsive transcription...  89.7    6e-18   
ref|XP_010521099.1|  PREDICTED: ethylene-responsive transcription...  88.6    7e-18   
ref|XP_008807007.1|  PREDICTED: ethylene-responsive transcription...  88.2    1e-17   
ref|XP_009127864.1|  PREDICTED: ethylene-responsive transcription...  87.8    2e-17   
ref|XP_008778360.1|  PREDICTED: ethylene-responsive transcription...  87.8    3e-17   
ref|XP_010930475.1|  PREDICTED: ethylene-responsive transcription...  86.3    4e-17   
ref|XP_010242028.1|  PREDICTED: ethylene-responsive transcription...  86.3    8e-17   
ref|XP_009394039.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-16   
tpg|DAA56474.1|  TPA: putative AP2/EREBP transcription factor sup...  84.3    6e-16   
ref|NP_001147298.1|  transcriptional factor TINY                      84.3    6e-16   Zea mays [maize]
gb|EAY76748.1|  hypothetical protein OsI_04704                        84.3    7e-16   Oryza sativa Indica Group [Indian rice]
dbj|BAB90166.1|  AP2 domain-containing transcription factor-like ...  84.3    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970828.1|  PREDICTED: ethylene-responsive transcription...  82.0    5e-15   
ref|XP_009420162.1|  PREDICTED: ethylene-responsive transcription...  79.3    3e-14   
ref|XP_002456757.1|  hypothetical protein SORBIDRAFT_03g042060        79.7    4e-14   Sorghum bicolor [broomcorn]
ref|XP_008786563.1|  PREDICTED: ethylene-responsive transcription...  77.8    5e-14   
ref|XP_003567341.1|  PREDICTED: ethylene-responsive transcription...  68.2    5e-10   
ref|XP_006404817.1|  hypothetical protein EUTSA_v10000354mg           67.4    6e-10   
gb|AFV60734.1|  ethylene-responsive transcription factor 2            67.4    9e-10   
gb|AGC51783.1|  ERF/AP2 domain-containing transcription factor        66.2    1e-09   
gb|ABR17626.1|  unknown                                               66.6    1e-09   Picea sitchensis
ref|XP_002308508.1|  hypothetical protein POPTR_0006s23480g           66.6    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011019312.1|  PREDICTED: ethylene-responsive transcription...  66.6    2e-09   
ref|XP_004287662.1|  PREDICTED: ethylene-responsive transcription...  66.2    2e-09   
ref|XP_008649655.1|  PREDICTED: ethylene-responsive transcription...  65.9    2e-09   
ref|XP_002284933.1|  PREDICTED: ethylene-responsive transcription...  65.1    3e-09   Vitis vinifera
ref|XP_004291085.1|  PREDICTED: ethylene-responsive transcription...  64.7    5e-09   
gb|EEC80179.1|  hypothetical protein OsI_22034                        65.1    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_003525804.1|  PREDICTED: ethylene-responsive transcription...  64.3    5e-09   
ref|XP_004966650.1|  PREDICTED: ethylene-responsive transcription...  65.1    6e-09   
dbj|BAD36633.1|  AP2 domain transcription factor-like                 65.1    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008440304.1|  PREDICTED: ethylene-responsive transcription...  64.3    6e-09   
ref|XP_004966651.1|  PREDICTED: ethylene-responsive transcription...  64.7    6e-09   
ref|XP_009337182.1|  PREDICTED: ethylene-responsive transcription...  65.1    7e-09   
gb|KDP34005.1|  hypothetical protein JCGZ_07576                       64.7    7e-09   
ref|XP_003551002.1|  PREDICTED: ethylene-responsive transcription...  63.5    9e-09   
gb|ADE41099.1|  AP2 domain class transcription factor                 64.7    9e-09   
ref|NP_001238164.1|  uncharacterized protein LOC100527066             63.9    1e-08   
ref|XP_010515388.1|  PREDICTED: ethylene-responsive transcription...  63.5    1e-08   
gb|AFU07644.1|  ethylene-responsive element binding factor 2          63.9    1e-08   
ref|XP_010426571.1|  PREDICTED: ethylene-responsive transcription...  63.5    1e-08   
ref|XP_010444682.1|  PREDICTED: ethylene-responsive transcription...  63.5    1e-08   
ref|XP_006345254.1|  PREDICTED: ethylene-responsive transcription...  64.7    1e-08   
ref|XP_010484534.1|  PREDICTED: ethylene-responsive transcription...  63.5    2e-08   
ref|XP_010503696.1|  PREDICTED: ethylene-responsive transcription...  63.2    2e-08   
ref|XP_008344047.1|  PREDICTED: ethylene-responsive transcription...  64.3    2e-08   
ref|XP_004251702.1|  PREDICTED: ethylene-responsive transcription...  64.3    2e-08   
ref|XP_006393917.1|  hypothetical protein EUTSA_v10004985mg           63.2    2e-08   
ref|XP_007156777.1|  hypothetical protein PHAVU_002G016700g           63.2    2e-08   
ref|XP_002991098.1|  hypothetical protein SELMODRAFT_71661            62.8    2e-08   
gb|ABX58043.1|  dehydration responsive element-binding protein 1      62.8    2e-08   Glycine soja [wild soybean]
gb|ABX58051.1|  dehydration responsive element-binding protein 1      62.8    2e-08   Glycine soja [wild soybean]
ref|XP_002865019.1|  hypothetical protein ARALYDRAFT_919990           63.2    2e-08   
ref|XP_010464369.1|  PREDICTED: ethylene-responsive transcription...  63.2    2e-08   
gb|ABK22932.1|  unknown                                               62.8    2e-08   Picea sitchensis
ref|NP_201520.1|  ethylene-responsive transcription factor ERF010     63.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAT44927.1|  putative AP2/EREBP transcription factor               62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28777.1|  unknown                                               62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687541.1|  PREDICTED: ethylene-responsive transcription...  63.5    2e-08   
ref|XP_002991657.1|  hypothetical protein SELMODRAFT_71659            62.4    2e-08   
ref|XP_010550358.1|  PREDICTED: ethylene-responsive transcription...  62.8    3e-08   
ref|XP_004503470.1|  PREDICTED: dehydration-responsive element-bi...  63.2    3e-08   
gb|KFK30311.1|  hypothetical protein AALP_AA7G245400                  62.0    3e-08   
ref|XP_006279808.1|  hypothetical protein CARUB_v10027999mg           62.8    3e-08   
ref|XP_011002827.1|  PREDICTED: ethylene-responsive transcription...  62.8    3e-08   
ref|XP_004966649.1|  PREDICTED: ethylene-responsive transcription...  62.8    3e-08   
gb|ABU84809.1|  putative dehydration-responsive element binding p...  62.8    3e-08   Broussonetia papyrifera [aka]
emb|CDY45406.1|  BnaA07g31860D                                        62.8    3e-08   
ref|XP_010910716.1|  PREDICTED: ethylene-responsive transcription...  62.4    4e-08   
ref|XP_011039944.1|  PREDICTED: ethylene-responsive transcription...  62.8    4e-08   
ref|XP_009106149.1|  PREDICTED: ethylene-responsive transcription...  62.4    4e-08   
ref|XP_009133086.1|  PREDICTED: ethylene-responsive transcription...  62.0    4e-08   
ref|XP_007202464.1|  hypothetical protein PRUPE_ppa010130mg           63.2    5e-08   
ref|XP_009776195.1|  PREDICTED: dehydration-responsive element-bi...  62.4    5e-08   
ref|XP_002876019.1|  ATERF#011/CEJ1                                   61.6    5e-08   
ref|NP_190595.1|  ethylene-responsive transcription factor ERF011     61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34079.1|  unnamed protein product                              62.0    5e-08   
ref|XP_006374902.1|  dehydration responsive element binding famil...  61.6    5e-08   
emb|CDX96673.1|  BnaA08g22160D                                        61.6    6e-08   
ref|XP_006291976.1|  hypothetical protein CARUB_v10018162mg           61.2    6e-08   
ref|XP_006306071.1|  hypothetical protein CARUB_v10011394mg           61.6    6e-08   
gb|KFK34280.1|  hypothetical protein AALP_AA5G124800                  61.2    6e-08   
gb|EYU25826.1|  hypothetical protein MIMGU_mgv1a026977mg              61.2    6e-08   
gb|KFK28412.1|  hypothetical protein AALP_AA8G511500                  61.6    6e-08   
ref|XP_011029523.1|  PREDICTED: ethylene-responsive transcription...  61.2    6e-08   
ref|XP_006340419.1|  PREDICTED: ethylene-responsive transcription...  61.6    6e-08   
ref|XP_008242523.1|  PREDICTED: dehydration-responsive element-bi...  63.2    6e-08   
ref|XP_009359712.1|  PREDICTED: ethylene-responsive transcription...  62.0    7e-08   
ref|XP_008784342.1|  PREDICTED: ethylene-responsive transcription...  61.6    7e-08   
ref|XP_006390369.1|  hypothetical protein EUTSA_v10019652mg           61.6    7e-08   
ref|XP_009596664.1|  PREDICTED: dehydration-responsive element-bi...  61.6    7e-08   
ref|XP_007017175.1|  AP2/ERF domain-containing transcription factor   60.8    7e-08   
ref|XP_002510182.1|  Dehydration-responsive element-binding prote...  61.2    7e-08   Ricinus communis
ref|XP_009599928.1|  PREDICTED: ethylene-responsive transcription...  61.2    7e-08   
ref|XP_003539348.1|  PREDICTED: ethylene-responsive transcription...  61.2    8e-08   
ref|XP_004141907.1|  PREDICTED: ethylene-responsive transcription...  61.2    8e-08   
ref|XP_004252501.1|  PREDICTED: dehydration-responsive element-bi...  60.8    8e-08   
ref|XP_008452588.1|  PREDICTED: ethylene-responsive transcription...  60.8    8e-08   
ref|XP_004141277.1|  PREDICTED: ethylene-responsive transcription...  60.8    8e-08   
emb|CDX73125.1|  BnaC06g35730D                                        61.6    9e-08   
ref|XP_009791248.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  61.2    9e-08   
ref|XP_006416528.1|  hypothetical protein EUTSA_v10009812mg           61.2    9e-08   
gb|AAQ08000.1|  dehydration responsive element binding protein        60.5    1e-07   Gossypium hirsutum [American cotton]
ref|XP_008647233.1|  PREDICTED: ethylene-responsive transcription...  60.8    1e-07   
gb|EYU28310.1|  hypothetical protein MIMGU_mgv1a014932mg              60.8    1e-07   
ref|XP_004501158.1|  PREDICTED: dehydration-responsive element-bi...  60.8    1e-07   
ref|NP_001238500.1|  dehydration-responsive element binding prote...  61.2    1e-07   
gb|AET99100.1|  dehydration-responsive element-binding protein DREB3  60.8    1e-07   
ref|XP_009624342.1|  PREDICTED: ethylene-responsive transcription...  61.2    1e-07   
ref|XP_002516233.1|  conserved hypothetical protein                   60.5    1e-07   Ricinus communis
gb|KFK44061.1|  hypothetical protein AALP_AA1G210800                  60.8    1e-07   
ref|XP_010477124.1|  PREDICTED: ethylene-responsive transcription...  60.8    1e-07   
emb|CDM87237.1|  unnamed protein product                              60.8    1e-07   
ref|XP_002893033.1|  hypothetical protein ARALYDRAFT_472144           60.8    1e-07   
emb|CAW30731.1|  TINY transcription factor                            61.2    1e-07   
ref|XP_006474695.1|  PREDICTED: ethylene-responsive transcription...  60.8    1e-07   
ref|XP_010459580.1|  PREDICTED: ethylene-responsive transcription...  60.8    1e-07   
gb|AAF82238.1|AC069143_14  Contains similarity to an AP2 domain c...  60.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDP03051.1|  unnamed protein product                              61.2    1e-07   
gb|KFK41931.1|  hypothetical protein AALP_AA2G190400                  60.8    1e-07   
emb|CDY30598.1|  BnaAnng03730D                                        60.5    1e-07   
gb|KDO73836.1|  hypothetical protein CISIN_1g029068mg                 60.8    1e-07   
ref|XP_006452855.1|  hypothetical protein CICLE_v10009540mg           60.8    1e-07   
ref|XP_009367373.1|  PREDICTED: ethylene-responsive transcription...  60.5    1e-07   
ref|XP_008340308.1|  PREDICTED: ethylene-responsive transcription...  60.5    1e-07   
gb|EAZ00036.1|  hypothetical protein OsI_22036                        60.8    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010099089.1|  Ethylene-responsive transcription factor         60.8    1e-07   
emb|CDY38938.1|  BnaA04g13590D                                        60.5    1e-07   
ref|XP_009115697.1|  PREDICTED: ethylene-responsive transcription...  60.5    1e-07   
ref|XP_010315978.1|  PREDICTED: ethylene-responsive transcription...  60.5    1e-07   
ref|NP_173355.3|  ethylene-responsive transcription factor ERF017     60.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006339868.1|  PREDICTED: ethylene-responsive transcription...  60.5    1e-07   
ref|XP_009613570.1|  PREDICTED: ethylene-responsive transcription...  61.2    1e-07   
ref|XP_001779499.1|  predicted protein                                58.9    2e-07   
ref|XP_010428490.1|  PREDICTED: ethylene-responsive transcription...  60.8    2e-07   
ref|XP_010098396.1|  Ethylene-responsive transcription factor         62.0    2e-07   
dbj|BAD36632.1|  AP2 domain transcription factor-like                 59.7    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010498649.1|  PREDICTED: ethylene-responsive transcription...  61.2    2e-07   
gb|AFK45531.1|  unknown                                               60.8    2e-07   
ref|XP_006434725.1|  hypothetical protein CICLE_v10002733mg           60.1    2e-07   
ref|XP_007012474.1|  Integrase-type DNA-binding superfamily prote...  61.2    2e-07   
ref|XP_009600167.1|  PREDICTED: ethylene-responsive transcription...  60.5    2e-07   
ref|XP_010498330.1|  PREDICTED: ethylene-responsive transcription...  60.5    2e-07   
ref|XP_006303331.1|  hypothetical protein CARUB_v10010179mg           61.2    2e-07   
ref|XP_004966648.1|  PREDICTED: ethylene-responsive transcription...  60.8    2e-07   
ref|XP_010471592.1|  PREDICTED: ethylene-responsive transcription...  60.5    2e-07   
gb|EEC80171.1|  hypothetical protein OsI_22020                        59.7    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010477440.1|  PREDICTED: ethylene-responsive transcription...  61.2    2e-07   
ref|XP_006381587.1|  AP2 domain-containing transcription factor f...  60.5    2e-07   
ref|XP_002887566.1|  hypothetical protein ARALYDRAFT_476631           60.5    2e-07   
ref|XP_009780503.1|  PREDICTED: ethylene-responsive transcription...  60.1    2e-07   
gb|ABQ62995.1|  RAP2-like protein                                     60.5    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006473291.1|  PREDICTED: ethylene-responsive transcription...  60.1    2e-07   
ref|XP_010691437.1|  PREDICTED: ethylene-responsive transcription...  60.8    2e-07   
gb|KDP41701.1|  hypothetical protein JCGZ_16108                       59.7    2e-07   
gb|KFK44293.1|  hypothetical protein AALP_AA1G239300                  60.8    2e-07   
ref|XP_006494469.1|  PREDICTED: ethylene-responsive transcription...  59.7    2e-07   
ref|XP_007138631.1|  hypothetical protein PHAVU_009G225000g           60.5    2e-07   
ref|XP_010270594.1|  PREDICTED: ethylene-responsive transcription...  59.7    2e-07   
ref|NP_179915.1|  ERF/AP2 transcription factor DEAR3                  60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008807523.1|  PREDICTED: dehydration-responsive element-bi...  60.5    2e-07   
ref|XP_011078266.1|  PREDICTED: ethylene-responsive transcription...  61.2    2e-07   
gb|ABX58045.1|  dehydration responsive element-binding protein 1      59.7    2e-07   Glycine soja [wild soybean]
ref|XP_008807522.1|  PREDICTED: dehydration-responsive element-bi...  60.1    2e-07   
gb|AFH56409.1|  ethylene response factor 2                            60.1    2e-07   
ref|XP_010558753.1|  PREDICTED: ethylene-responsive transcription...  59.7    2e-07   
emb|CDY12817.1|  BnaC07g16160D                                        59.7    2e-07   
gb|ABR17111.1|  unknown                                               59.7    3e-07   Picea sitchensis
emb|CDY01431.1|  BnaA07g12040D                                        59.3    3e-07   
ref|NP_177631.1|  ethylene-responsive transcription factor ERF018     60.1    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27280.1|  hypothetical protein MIMGU_mgv1a026082mg              59.3    3e-07   
ref|XP_003546516.1|  PREDICTED: ethylene-responsive transcription...  60.1    3e-07   
emb|CDY17756.1|  BnaC08g21640D                                        59.3    3e-07   
ref|XP_009372427.1|  PREDICTED: ethylene-responsive transcription...  59.3    3e-07   
gb|ACJ84469.1|  unknown                                               59.7    3e-07   Medicago truncatula
ref|XP_004241075.1|  PREDICTED: ethylene-responsive transcription...  60.5    3e-07   
emb|CDX81337.1|  BnaC09g07480D                                        58.9    4e-07   
ref|XP_004291182.1|  PREDICTED: dehydration-responsive element-bi...  60.5    4e-07   
ref|XP_002277621.2|  PREDICTED: ethylene-responsive transcription...  58.9    4e-07   Vitis vinifera
ref|XP_009112363.1|  PREDICTED: ethylene-responsive transcription...  59.3    4e-07   
gb|KDP33947.1|  hypothetical protein JCGZ_07518                       59.7    4e-07   
ref|XP_008776525.1|  PREDICTED: ethylene-responsive transcription...  59.3    4e-07   
emb|CDP17886.1|  unnamed protein product                              60.1    4e-07   
gb|KFK32751.1|  hypothetical protein AALP_AA6G284000                  58.9    4e-07   
gb|KEH36063.1|  AP2 domain class transcription factor                 59.3    4e-07   
emb|CDY18641.1|  BnaA09g07540D                                        58.9    4e-07   
ref|XP_008648850.1|  PREDICTED: ethylene-responsive transcription...  59.3    4e-07   
ref|NP_196720.1|  dehydration-responsive element-binding protein 3    60.1    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AET05216.2|  ethylene response factor                              60.1    4e-07   
gb|ABK26476.1|  unknown                                               59.7    4e-07   Picea sitchensis
ref|XP_007012584.1|  AP2/ERF domain-containing transcription factor   59.3    4e-07   
ref|XP_008352509.1|  PREDICTED: ethylene-responsive transcription...  58.9    4e-07   
ref|XP_006356706.1|  PREDICTED: ethylene-responsive transcription...  60.1    5e-07   
emb|CAW30732.1|  TINY transcription factor                            59.3    5e-07   
ref|XP_002324785.1|  hypothetical protein POPTR_0018s08320g           59.3    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006653443.1|  PREDICTED: dehydration-responsive element-bi...  58.5    5e-07   
gb|ADE41138.1|  AP2 domain class transcription factor                 58.5    5e-07   
gb|ACF74280.1|  DREB-like protein                                     59.3    5e-07   Arachis hypogaea [goober]
ref|XP_009138039.1|  PREDICTED: ethylene-responsive transcription...  58.9    5e-07   
dbj|BAD36635.1|  AP2 domain transcription factor-like                 59.3    5e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDX75631.1|  BnaA01g00710D                                        58.9    5e-07   
ref|XP_003597699.1|  Ethylene-responsive transcription factor TINY    59.3    5e-07   
ref|XP_009104737.1|  PREDICTED: ethylene-responsive transcription...  58.9    6e-07   
ref|XP_009149397.1|  PREDICTED: ethylene-responsive transcription...  58.5    6e-07   
emb|CDX68158.1|  BnaA07g21980D                                        58.9    6e-07   
ref|XP_006855217.1|  hypothetical protein AMTR_s00051p00204250        58.9    6e-07   
ref|XP_006359467.1|  PREDICTED: dehydration-responsive element-bi...  59.3    6e-07   
emb|CDX83779.1|  BnaC08g18660D                                        58.5    6e-07   
gb|EPS59347.1|  hypothetical protein M569_15461                       57.4    6e-07   
gb|EYU25827.1|  hypothetical protein MIMGU_mgv1a020481mg              57.4    6e-07   
gb|AEM63548.1|  dehydration-responsive element-binding protein DREB1  59.3    7e-07   
ref|XP_009138483.1|  PREDICTED: ethylene-responsive transcription...  58.5    7e-07   
ref|XP_010049108.1|  PREDICTED: ethylene-responsive transcription...  59.7    7e-07   
gb|ACU24203.1|  unknown                                               58.5    7e-07   
gb|EYU38617.1|  hypothetical protein MIMGU_mgv1a021879mg              58.9    7e-07   
emb|CDY62224.1|  BnaCnng39660D                                        58.5    7e-07   
emb|CDY29540.1|  BnaA03g53850D                                        58.5    7e-07   
emb|CDX69283.1|  BnaC01g01700D                                        58.5    7e-07   
gb|EYU21967.1|  hypothetical protein MIMGU_mgv1a023084mg              58.5    7e-07   
ref|XP_008452799.1|  PREDICTED: ethylene-responsive transcription...  58.5    7e-07   
gb|EAY87759.1|  hypothetical protein OsI_09177                        58.5    7e-07   
ref|XP_009117558.1|  PREDICTED: ethylene-responsive transcription...  58.5    8e-07   
dbj|BAJ53197.1|  JHL03K20.6                                           58.5    8e-07   
emb|CDX81918.1|  BnaC08g36830D                                        58.5    8e-07   
emb|CDY27827.1|  BnaC09g28540D                                        58.9    8e-07   
ref|XP_004241746.1|  PREDICTED: dehydration-responsive element-bi...  58.5    8e-07   
ref|XP_002873522.1|  hypothetical protein ARALYDRAFT_487996           59.3    8e-07   
emb|CDX79682.1|  BnaC03g20180D                                        58.5    8e-07   
ref|XP_009125819.1|  PREDICTED: dehydration-responsive element-bi...  58.9    8e-07   
ref|XP_010535748.1|  PREDICTED: ethylene-responsive transcription...  58.9    8e-07   
emb|CDY04682.1|  BnaC05g17200D                                        58.5    8e-07   
ref|XP_010509470.1|  PREDICTED: ethylene-responsive transcription...  58.2    9e-07   
ref|XP_010263467.1|  PREDICTED: ethylene-responsive transcription...  57.8    9e-07   
emb|CDX85705.1|  BnaA02g01080D                                        58.9    9e-07   
ref|XP_010261769.1|  PREDICTED: ethylene-responsive transcription...  58.5    9e-07   
ref|XP_010516867.1|  PREDICTED: ethylene-responsive transcription...  58.2    9e-07   
ref|XP_010505192.1|  PREDICTED: ethylene-responsive transcription...  58.2    9e-07   
dbj|BAD19440.1|  AP2 domain transcription factor-like                 58.5    9e-07   
ref|XP_009359912.1|  PREDICTED: ethylene-responsive transcription...  57.8    9e-07   
ref|XP_003630740.1|  Ethylene-responsive transcription factor TINY    59.7    9e-07   
ref|XP_003542371.2|  PREDICTED: ethylene-responsive transcription...  59.7    9e-07   
ref|XP_010419734.1|  PREDICTED: dehydration-responsive element-bi...  58.9    9e-07   
ref|XP_003611687.1|  Ethylene-responsive transcription factor RAP...  58.2    9e-07   
ref|XP_006289586.1|  hypothetical protein CARUB_v10003136mg           58.9    9e-07   
ref|XP_006425956.1|  hypothetical protein CICLE_v10026687mg           57.8    9e-07   
ref|XP_002890471.1|  AP2 domain-containing transcription factor f...  58.9    9e-07   
ref|XP_004141440.1|  PREDICTED: ethylene-responsive transcription...  58.2    9e-07   
ref|XP_008242271.1|  PREDICTED: ethylene-responsive transcription...  58.5    1e-06   
gb|AFK44949.1|  unknown                                               58.2    1e-06   
ref|XP_011026594.1|  PREDICTED: ethylene-responsive transcription...  57.8    1e-06   
ref|XP_006295828.1|  hypothetical protein CARUB_v10024954mg           58.2    1e-06   
ref|XP_002280370.1|  PREDICTED: ethylene-responsive transcription...  58.2    1e-06   
ref|XP_006302833.1|  hypothetical protein CARUB_v10020965mg           58.2    1e-06   
emb|CDY01307.1|  BnaA07g10800D                                        58.5    1e-06   
gb|AEM63544.1|  dehydration-responsive element-binding protein DREB2  57.4    1e-06   
ref|XP_010273875.1|  PREDICTED: ethylene-responsive transcription...  58.2    1e-06   
emb|CAN64037.1|  hypothetical protein VITISV_021556                   57.8    1e-06   
ref|XP_009126865.1|  PREDICTED: ethylene-responsive transcription...  57.4    1e-06   
ref|NP_001268123.1|  drought responsive element binding protein       57.4    1e-06   
gb|AHJ08576.1|  DREB5-like protein                                    57.4    1e-06   
ref|XP_006339312.1|  PREDICTED: ethylene-responsive transcription...  58.2    1e-06   
ref|XP_004148719.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...  58.9    1e-06   
ref|NP_680184.1|  ethylene-responsive transcription factor ERF016     58.5    1e-06   
gb|KCW79144.1|  hypothetical protein EUGRSUZ_C00590                   57.8    1e-06   
ref|XP_008337827.1|  PREDICTED: ethylene-responsive transcription...  58.5    1e-06   
ref|XP_009110164.1|  PREDICTED: ethylene-responsive transcription...  58.2    1e-06   
gb|AFJ14637.1|  dehydration-responsive element-binding protein (D...  58.5    1e-06   
ref|XP_006416252.1|  hypothetical protein EUTSA_v10008639mg           58.5    1e-06   
ref|XP_008462760.1|  PREDICTED: ethylene-responsive transcription...  58.9    1e-06   
ref|NP_173609.1|  ethylene-responsive transcription factor ERF012     58.5    1e-06   
gb|AAM63137.1|  TINY-like protein                                     58.5    1e-06   
ref|XP_006354856.1|  PREDICTED: ethylene-responsive transcription...  57.4    1e-06   
gb|AHI96435.1|  DREB group protein                                    57.4    1e-06   
ref|XP_010416351.1|  PREDICTED: ethylene-responsive transcription...  58.2    1e-06   
ref|XP_009365379.1|  PREDICTED: ethylene-responsive transcription...  58.2    1e-06   
ref|XP_010687542.1|  PREDICTED: ethylene-responsive transcription...  58.5    1e-06   
ref|XP_004161329.1|  PREDICTED: dehydration-responsive element-bi...  58.9    1e-06   
ref|XP_007225774.1|  hypothetical protein PRUPE_ppa009533mg           59.3    1e-06   
ref|XP_011081953.1|  PREDICTED: ethylene-responsive transcription...  58.5    1e-06   
gb|AFG62418.1|  hypothetical protein UMN_5771_02                      56.2    1e-06   
ref|XP_010273874.1|  PREDICTED: ethylene-responsive transcription...  57.8    1e-06   
ref|XP_009780019.1|  PREDICTED: ethylene-responsive transcription...  58.9    1e-06   
gb|KCW81819.1|  hypothetical protein EUGRSUZ_C03175                   58.2    1e-06   
ref|XP_008220077.1|  PREDICTED: dehydration-responsive element-bi...  58.9    1e-06   
gb|EAY80480.1|  hypothetical protein OsI_35658                        57.4    1e-06   
ref|XP_002878679.1|  hypothetical protein ARALYDRAFT_481204           57.4    1e-06   
ref|XP_004249787.1|  PREDICTED: ethylene-responsive transcription...  57.8    1e-06   
gb|KDP42687.1|  hypothetical protein JCGZ_23627                       58.2    2e-06   
ref|XP_009115658.1|  PREDICTED: ethylene-responsive transcription...  58.5    2e-06   
ref|XP_008378086.1|  PREDICTED: ethylene-responsive transcription...  58.5    2e-06   
ref|XP_010548425.1|  PREDICTED: ethylene-responsive transcription...  57.4    2e-06   
ref|XP_010688291.1|  PREDICTED: ethylene-responsive transcription...  58.9    2e-06   
ref|XP_009141595.1|  PREDICTED: ethylene-responsive transcription...  57.4    2e-06   
ref|XP_006410822.1|  hypothetical protein EUTSA_v10017537mg           57.4    2e-06   
ref|XP_010496785.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-06   
ref|XP_009126515.1|  PREDICTED: ethylene-responsive transcription...  57.8    2e-06   
ref|XP_008680656.1|  PREDICTED: dehydration-responsive element-bi...  58.2    2e-06   
ref|XP_004287458.1|  PREDICTED: dehydration-responsive element-bi...  58.5    2e-06   
ref|XP_006353483.1|  PREDICTED: ethylene-responsive transcription...  58.9    2e-06   
gb|KFK25419.1|  hypothetical protein AALP_AA8G112500                  58.2    2e-06   
ref|XP_001780289.1|  predicted protein                                56.6    2e-06   
ref|NP_001288046.1|  ethylene-responsive transcription factor ERF...  57.0    2e-06   
ref|XP_007140279.1|  hypothetical protein PHAVU_008G098900g           57.0    2e-06   
ref|XP_006399666.1|  hypothetical protein EUTSA_v10015895mg           58.2    2e-06   
ref|XP_004136219.1|  PREDICTED: ethylene-responsive transcription...  57.8    2e-06   
ref|XP_004165656.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-06   
gb|AHA84148.1|  ethylene-responsive transcription factor RAP2         57.0    2e-06   
emb|CDY21678.1|  BnaA09g44290D                                        57.4    2e-06   
ref|XP_009617333.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-06   
ref|XP_008378018.1|  PREDICTED: ethylene-responsive transcription...  57.0    2e-06   
ref|XP_004510113.1|  PREDICTED: ethylene-responsive transcription...  57.8    2e-06   
ref|XP_009777029.1|  PREDICTED: dehydration-responsive element-bi...  58.2    2e-06   
ref|XP_009615403.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-06   
ref|XP_011048337.1|  PREDICTED: ethylene-responsive transcription...  58.5    2e-06   
emb|CDY19794.1|  BnaA09g04470D                                        57.8    2e-06   
ref|XP_008458661.1|  PREDICTED: dehydration-responsive element-bi...  58.2    2e-06   
gb|KCW79102.1|  hypothetical protein EUGRSUZ_C00546                   58.2    2e-06   
emb|CDY66961.1|  BnaC09g50850D                                        57.8    2e-06   
ref|XP_009404533.1|  PREDICTED: ethylene-responsive transcription...  57.8    2e-06   
ref|XP_010051344.1|  PREDICTED: ethylene-responsive transcription...  58.2    2e-06   
ref|XP_010242644.1|  PREDICTED: ethylene-responsive transcription...  57.4    2e-06   
emb|CDX84123.1|  BnaC04g08850D                                        57.0    2e-06   
ref|XP_006400701.1|  hypothetical protein EUTSA_v10015465mg           57.8    2e-06   
ref|XP_006843906.1|  hypothetical protein AMTR_s00007p00268460        57.4    2e-06   
ref|XP_010047241.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...  58.2    2e-06   
ref|XP_004488104.1|  PREDICTED: ethylene-responsive transcription...  57.4    2e-06   
ref|XP_009111677.1|  PREDICTED: ethylene-responsive transcription...  57.4    2e-06   
emb|CDY38828.1|  BnaC08g20020D                                        57.4    2e-06   
ref|XP_004488106.1|  PREDICTED: ethylene-responsive transcription...  57.4    2e-06   
ref|XP_011017174.1|  PREDICTED: ethylene-responsive transcription...  56.6    2e-06   
ref|XP_002301169.1|  dehydration responsive element binding famil...  56.6    2e-06   
gb|EYU20436.1|  hypothetical protein MIMGU_mgv1a024757mg              57.8    2e-06   
ref|XP_004511898.1|  PREDICTED: ethylene-responsive transcription...  56.6    2e-06   
ref|XP_003566226.1|  PREDICTED: ethylene-responsive transcription...  57.0    2e-06   
ref|XP_010420984.1|  PREDICTED: ethylene-responsive transcription...  57.4    2e-06   
ref|XP_010254012.1|  PREDICTED: ethylene-responsive transcription...  57.8    2e-06   
ref|XP_004139438.1|  PREDICTED: dehydration-responsive element-bi...  58.2    2e-06   
ref|XP_006836806.1|  hypothetical protein AMTR_s00099p00029210        57.0    2e-06   
ref|XP_010940895.1|  PREDICTED: ethylene-responsive transcription...  57.0    2e-06   
gb|KDP33726.1|  hypothetical protein JCGZ_07297                       57.8    3e-06   
ref|XP_011016480.1|  PREDICTED: ethylene-responsive transcription...  56.6    3e-06   
ref|XP_006474529.1|  PREDICTED: ethylene-responsive transcription...  57.4    3e-06   
ref|XP_009759846.1|  PREDICTED: ethylene-responsive transcription...  57.4    3e-06   
ref|XP_010459913.1|  PREDICTED: ethylene-responsive transcription...  57.8    3e-06   
ref|XP_006450687.1|  hypothetical protein CICLE_v10009370mg           57.4    3e-06   
ref|XP_008359485.1|  PREDICTED: ethylene-responsive transcription...  57.0    3e-06   
ref|XP_010050434.1|  PREDICTED: ethylene-responsive transcription...  56.6    3e-06   
ref|XP_008792845.1|  PREDICTED: ethylene-responsive transcription...  56.6    3e-06   
gb|AEQ61578.1|  dehydration-responsive element binding protein 2      56.2    3e-06   
ref|XP_006356143.1|  PREDICTED: ethylene-responsive transcription...  57.0    3e-06   
emb|CDP01305.1|  unnamed protein product                              56.2    3e-06   
ref|XP_004488105.1|  PREDICTED: ethylene-responsive transcription...  57.0    3e-06   
ref|XP_002324813.1|  hypothetical protein POPTR_0018s00700g           56.2    3e-06   
dbj|BAD35230.1|  AP2 domain transcription factor-like                 57.0    3e-06   
ref|NP_001234759.1|  dehydration responsive element binding protein   58.2    3e-06   
ref|XP_007150657.1|  hypothetical protein PHAVU_005G170600g           57.0    3e-06   
ref|XP_011093871.1|  PREDICTED: ethylene-responsive transcription...  57.4    3e-06   
gb|KEH27173.1|  AP2 domain class transcription factor                 57.0    3e-06   
ref|XP_006476039.1|  PREDICTED: dehydration-responsive element-bi...  57.4    3e-06   
gb|AFG62416.1|  hypothetical protein UMN_5771_02                      55.1    3e-06   
gb|EYU36331.1|  hypothetical protein MIMGU_mgv1a015479mg              56.2    4e-06   
ref|XP_006452945.1|  hypothetical protein CICLE_v10010348mg           57.0    4e-06   
ref|NP_001235779.1|  dehydration responsive element binding protein   56.2    4e-06   
ref|XP_002449280.1|  hypothetical protein SORBIDRAFT_05g007135        56.6    4e-06   
ref|XP_003523959.1|  PREDICTED: ethylene-responsive transcription...  55.8    4e-06   
gb|EPS67314.1|  hypothetical protein M569_07461                       55.8    4e-06   
ref|XP_002303301.1|  hypothetical protein POPTR_0003s04920g           57.0    4e-06   
emb|CDU32445.1|  DREB2 factor                                         55.8    4e-06   
ref|XP_009388688.1|  PREDICTED: ethylene-responsive transcription...  57.8    4e-06   
ref|XP_004979006.1|  PREDICTED: ethylene-responsive transcription...  56.2    4e-06   
ref|XP_011012511.1|  PREDICTED: ethylene-responsive transcription...  57.0    4e-06   
ref|XP_004954129.1|  PREDICTED: ethylene-responsive transcription...  56.6    4e-06   
gb|ACR44231.1|  drought responsive element binding protein 2          55.8    4e-06   
ref|XP_009367456.1|  PREDICTED: ethylene-responsive transcription...  57.0    4e-06   
gb|ACI95260.1|  dehydration-responsive element binding protein        56.2    4e-06   
ref|XP_006578035.1|  PREDICTED: ethylene-responsive transcription...  55.8    4e-06   
gb|AEQ61580.1|  dehydration-responsive element binding protein 2      55.5    4e-06   
ref|XP_010249578.1|  PREDICTED: dehydration-responsive element-bi...  57.0    5e-06   
ref|XP_002516502.1|  Transcriptional factor TINY, putative            57.4    5e-06   
emb|CDU32446.1|  DREB2 factor                                         55.8    5e-06   
emb|CDO19441.1|  transcription factor DREB2 protein                   55.8    5e-06   
ref|XP_008810659.1|  PREDICTED: ethylene-responsive transcription...  56.6    5e-06   
ref|XP_004288012.1|  PREDICTED: ethylene-responsive transcription...  55.5    5e-06   
ref|XP_009380474.1|  PREDICTED: ethylene-responsive transcription...  57.0    5e-06   
ref|XP_006832877.1|  hypothetical protein AMTR_s00095p00094910        56.2    5e-06   
emb|CDP02517.1|  unnamed protein product                              55.8    5e-06   
gb|EPS69379.1|  hypothetical protein M569_05389                       55.1    5e-06   
ref|XP_007013070.1|  Integrase-type DNA-binding superfamily protein   57.0    5e-06   
ref|XP_002874038.1|  hypothetical protein ARALYDRAFT_910177           56.6    5e-06   
emb|CDX72808.1|  BnaC06g32560D                                        55.8    5e-06   
ref|XP_011009351.1|  PREDICTED: ethylene-responsive transcription...  57.4    5e-06   
ref|XP_002324441.2|  hypothetical protein POPTR_0018s09270g           57.4    5e-06   
gb|ABO48369.1|  TINY-like protein 2                                   57.4    5e-06   
ref|XP_004962047.1|  PREDICTED: ethylene-responsive transcription...  56.6    5e-06   
emb|CDX97125.1|  BnaC09g45000D                                        57.0    5e-06   
ref|XP_010099090.1|  Ethylene-responsive transcription factor         55.8    5e-06   
ref|XP_002514246.1|  Transcriptional factor TINY, putative            57.4    5e-06   
gb|KFK27825.1|  hypothetical protein AALP_AA8G434600                  56.2    5e-06   
ref|XP_009105814.1|  PREDICTED: ethylene-responsive transcription...  55.8    5e-06   
gb|ACU23160.1|  unknown                                               55.8    6e-06   
ref|XP_010684005.1|  PREDICTED: ethylene-responsive transcription...  56.2    6e-06   
ref|XP_009399816.1|  PREDICTED: ethylene-responsive transcription...  56.6    6e-06   
emb|CDY03695.1|  BnaA02g15420D                                        55.8    6e-06   
ref|XP_002307277.1|  AP2 domain-containing transcription factor f...  55.8    6e-06   
gb|KDO56992.1|  hypothetical protein CISIN_1g038538mg                 56.6    6e-06   
ref|XP_008659247.1|  PREDICTED: ethylene-responsive transcription...  55.8    6e-06   
emb|CDP08151.1|  unnamed protein product                              57.4    6e-06   
ref|XP_006426907.1|  hypothetical protein CICLE_v10027587mg           56.6    6e-06   
gb|AGB05623.1|  DREB4A family transcription factor 2                  56.2    6e-06   
ref|XP_009131845.1|  PREDICTED: ethylene-responsive transcription...  56.2    6e-06   
ref|XP_010940400.1|  PREDICTED: dehydration-responsive element-bi...  56.2    6e-06   
ref|NP_001241356.1|  dehydration-responsive element-binding prote...  55.8    6e-06   
gb|KHN34916.1|  Dehydration-responsive element-binding protein 3      56.2    6e-06   
ref|XP_010531255.1|  PREDICTED: ethylene-responsive transcription...  55.5    6e-06   
ref|XP_006282466.1|  hypothetical protein CARUB_v10005767mg           55.8    6e-06   
ref|XP_003576119.1|  PREDICTED: ethylene-responsive transcription...  55.8    6e-06   
ref|XP_006465666.1|  PREDICTED: ethylene-responsive transcription...  56.6    6e-06   
ref|XP_009121933.1|  PREDICTED: dehydration-responsive element-bi...  56.6    6e-06   
ref|XP_006288608.1|  hypothetical protein CARUB_v10001903mg           56.2    6e-06   
ref|XP_008444599.1|  PREDICTED: ethylene-responsive transcription...  55.1    7e-06   
emb|CDX69746.1|  BnaA10g20950D                                        56.6    7e-06   
ref|XP_002881444.1|  AP2 domain-containing protein                    55.5    7e-06   
gb|EYU29281.1|  hypothetical protein MIMGU_mgv1a024895mg              56.6    7e-06   
gb|KHN15832.1|  Dehydration-responsive element-binding protein 3      56.2    7e-06   
gb|KHN04233.1|  Dehydration-responsive element-binding protein 3      55.8    7e-06   
ref|XP_010095372.1|  Dehydration-responsive element-binding prote...  57.0    7e-06   
ref|XP_006381752.1|  hypothetical protein POPTR_0006s17670g           57.0    7e-06   
ref|NP_001239694.1|  dehydration-responsive element-binding prote...  55.5    7e-06   
ref|XP_002976414.1|  hypothetical protein SELMODRAFT_104978           55.5    7e-06   
gb|EYU34565.1|  hypothetical protein MIMGU_mgv1a015596mg              55.1    7e-06   
ref|XP_010093506.1|  Ethylene-responsive transcription factor         55.5    7e-06   
ref|XP_009801170.1|  PREDICTED: dehydration-responsive element-bi...  55.5    7e-06   



>ref|XP_009767328.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Nicotiana sylvestris]
Length=148

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG+ +RLWLGTYATPEAAAVAHDIA  CLRE++SLDKLNFP  M P  V RGMSP
Sbjct  31   SEIRVPGSSERLWLGTYATPEAAAVAHDIAYYCLRESSSLDKLNFP-FMLPVNVDRGMSP  89

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQKVASDAGMA+DA+
Sbjct  90   RSVQKVASDAGMAIDAK  106



>ref|XP_009617210.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Nicotiana 
tomentosiformis]
Length=148

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETA-SLDKLNFPTLMPPAGVGRGMS  494
            SEIRVPG+ +RLWLGTY T EAAAVAHDIA  CLRE++ SLDKLNFP ++P   V RGMS
Sbjct  28   SEIRVPGSSERLWLGTYTTQEAAAVAHDIAYYCLRESSLSLDKLNFPFMLPAVNVERGMS  87

Query  493  PRSVQKVASDAGMAVDAQ  440
            PRSVQKVASDAGMA+DA+
Sbjct  88   PRSVQKVASDAGMAIDAK  105



>gb|AID51418.1| ethylene response factor 13 [Diospyros kaki]
Length=154

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQ+RLWLG+Y+TPEAAAVAHDIAS CLR  ASL KLNFP L  PAG   GMSP
Sbjct  33   SEIRVPGTQERLWLGSYSTPEAAAVAHDIASYCLRGPASLQKLNFP-LTLPAGARPGMSP  91

Query  490  RSVQKVASDAGMAVDAQ  440
            +SVQK ASDAGMAVDAQ
Sbjct  92   KSVQKAASDAGMAVDAQ  108



>ref|XP_007019844.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY17069.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=204

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 12/164 (7%)
 Frame = -3

Query  745  MSSAGGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR  566
            MS+A  EES R+Y+GVRRR+WGKWVSEIRVPGTQ+RLWLG+Y+TPE AA+AHDIA  CLR
Sbjct  52   MSAAAVEESSRKYKGVRRRRWGKWVSEIRVPGTQERLWLGSYSTPEGAAIAHDIAHYCLR  111

Query  565  ETASLDKLNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDAQQHLLLHPPQAVEFSggge  386
              +SL+ LNFP+++PP  +   MSP+SVQK ASDAGMAVDAQ  ++ +  +A E SG   
Sbjct  112  RPSSLNGLNFPSMVPP-NLNVNMSPKSVQKAASDAGMAVDAQMIVISNETKASENSGVIV  170

Query  385  nrwgggeaaeEVFRWAERPCCsssregsgiseEAQALSISVDDY  254
                     +    W              + +E +ALSISV+DY
Sbjct  171  GMETESWENDSSGSW-----------EGSVGKEGEALSISVEDY  203



>ref|XP_006376167.1| hypothetical protein POPTR_0013s10420g [Populus trichocarpa]
 gb|ABQ62993.1| RAP2-like protein [Populus trichocarpa]
 gb|ERP53964.1| hypothetical protein POPTR_0013s10420g [Populus trichocarpa]
Length=168

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+PG QDRLWLG+Y+TPEAAAVAHDIAS CLR  +S++ LNFP LM PA V   MSP
Sbjct  35   SEIRIPGKQDRLWLGSYSTPEAAAVAHDIASYCLRGPSSIESLNFP-LMLPASVREDMSP  93

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQAVEF  401
            +S+QK ASDAGMA+DAQ  L   P   V+F
Sbjct  94   KSIQKAASDAGMAIDAQMILNRVPENEVKF  123



>gb|KDP44735.1| hypothetical protein JCGZ_01235 [Jatropha curcas]
Length=173

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQ RLWLG+Y++PEAAAVAHDIAS CLR  +S+D LNFP LM PA V   +SP
Sbjct  28   SEIRVPGTQGRLWLGSYSSPEAAAVAHDIASYCLRGHSSIDSLNFPDLMLPASVRGDISP  87

Query  490  RSVQKVASDAGMAVDAQ  440
             S+QK ASDAGMAVDAQ
Sbjct  88   TSIQKAASDAGMAVDAQ  104



>ref|XP_011009999.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Populus euphratica]
Length=170

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG QDRLWLG+Y+TPEAAAVA+DIAS CLR  +S++ LNFP LM PA V   MSP
Sbjct  36   SEIRVPGKQDRLWLGSYSTPEAAAVAYDIASYCLRGPSSIESLNFP-LMLPASVREDMSP  94

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQAVEF  401
            +S+QK ASDAGMA+DAQ  +   P   V+F
Sbjct  95   KSIQKAASDAGMAIDAQMIMNRVPENEVKF  124



>ref|XP_002325945.2| hypothetical protein POPTR_0019s10220g [Populus trichocarpa]
 gb|EEF00327.2| hypothetical protein POPTR_0019s10220g [Populus trichocarpa]
Length=185

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = -3

Query  736  AGGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETA  557
            +G  ESQR+++G RRRKWGKWVSEIR+PG Q+RLWLG+Y+TPEAAAVAHDIAS CLR  +
Sbjct  20   SGASESQRKFKGARRRKWGKWVSEIRIPGKQERLWLGSYSTPEAAAVAHDIASYCLRGPS  79

Query  556  SLDKLNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDAQQHL  431
            SL+ LNFP LM PA V   MSP+S+QK ASDAGMA+DAQ  L
Sbjct  80   SLESLNFP-LMLPASVREDMSPKSIQKAASDAGMAIDAQMIL  120



>emb|CDP00864.1| unnamed protein product [Coffea canephora]
Length=137

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG+YA PEAAA+AHD+A  CLRE ASLD  NFP LM PAGV RGMSP
Sbjct  31   SEIRVPGTQDRLWLGSYAAPEAAAMAHDVAYYCLRENASLDDFNFP-LMLPAGVQRGMSP  89

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQK A+DAGMAVDAQ
Sbjct  90   RSVQKAATDAGMAVDAQ  106



>ref|XP_011036246.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Populus 
euphratica]
Length=184

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+PG Q+RLWLG+Y+TPEAAAVAHDIAS CLR  +SL+ LNFP LM PA V   MSP
Sbjct  41   SEIRIPGKQERLWLGSYSTPEAAAVAHDIASYCLRGPSSLESLNFP-LMLPASVREDMSP  99

Query  490  RSVQKVASDAGMAVDAQQHL  431
            +S+QK ASDAGMA+DAQ  L
Sbjct  100  KSIQKAASDAGMAIDAQMIL  119



>gb|ABQ62994.1| RAP2-like protein [Populus trichocarpa]
Length=185

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+PG Q+RLWLG+Y+TPEAAAVAHDIAS CLR  +SL+ LNFP LM PA V   MSP
Sbjct  42   SEIRIPGKQERLWLGSYSTPEAAAVAHDIASYCLRGPSSLESLNFP-LMLPASVREDMSP  100

Query  490  RSVQKVASDAGMAVDAQQHL  431
            +S+QK ASDAGMA+DAQ  L
Sbjct  101  KSIQKAASDAGMAIDAQMIL  120



>ref|XP_006337962.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Solanum tuberosum]
Length=129

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR-ETASLDKLNFPTLMPPAGVGRGMS  494
            SEIRVPG+ +RLWLGTY +PEAAA+AHDIA  CLR E++SL KLNFP+++PP  V  GMS
Sbjct  20   SEIRVPGSSERLWLGTYTSPEAAAIAHDIAYYCLRPESSSLHKLNFPSMLPP-NVQPGMS  78

Query  493  PRSVQKVASDAGMAVDAQ  440
            P SVQKVASDA MA+DAQ
Sbjct  79   PTSVQKVASDAAMAIDAQ  96



>gb|KDO51723.1| hypothetical protein CISIN_1g045327mg, partial [Citrus sinensis]
Length=162

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG+Q+RLWLG+YATPEAAA+AHD+A  CLR   SLD LNFP+++P + V   +SP
Sbjct  40   SEIRVPGSQERLWLGSYATPEAAAMAHDVAFYCLRRPRSLDGLNFPSMLPASVVHAELSP  99

Query  490  RSVQKVASDAGMAVDAQQHL  431
            +SVQK ASDAGM VDAQ  L
Sbjct  100  KSVQKAASDAGMGVDAQMVL  119



>ref|XP_006478270.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Citrus sinensis]
Length=163

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG+Q+RLWLG+YATPEAAA+AHD+A  CLR   SLD LNFP+++P + V   +SP
Sbjct  28   SEIRVPGSQERLWLGSYATPEAAAMAHDVAFYCLRRPRSLDGLNFPSMLPASVVHAELSP  87

Query  490  RSVQKVASDAGMAVDAQ  440
            +SVQK ASDAGM VDAQ
Sbjct  88   KSVQKAASDAGMGVDAQ  104



>ref|XP_010064855.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Eucalyptus 
grandis]
 gb|KCW69529.1| hypothetical protein EUGRSUZ_F02967 [Eucalyptus grandis]
Length=155

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQ+RLWLG+Y +PE AAVAHD+AS CLR  + LDKLNFP+L+PP+    G+SP
Sbjct  27   SEIRVPGTQERLWLGSYTSPEGAAVAHDVASYCLRGPSCLDKLNFPSLLPPSARP-GVSP  85

Query  490  RSVQKVASDAGMAVDAQ  440
            RS Q+ ASDAGMAVDA+
Sbjct  86   RSAQRAASDAGMAVDAR  102



>ref|XP_004229130.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Solanum lycopersicum]
Length=113

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR--ETASLDKLNFPTLMPPAGVGRGM  497
            SEIRVPG+ +RLWLGTY +PEAAAVAHDIA  CLR   ++SL KLNFP+++PP  V  GM
Sbjct  20   SEIRVPGSSERLWLGTYTSPEAAAVAHDIAYYCLRPESSSSLHKLNFPSMLPP-NVQPGM  78

Query  496  SPRSVQKVASDAGMAVDAQ  440
            SP SVQKVASDA MA+DAQ
Sbjct  79   SPTSVQKVASDAAMAIDAQ  97



>ref|XP_006441635.1| hypothetical protein CICLE_v10023345mg [Citrus clementina]
 gb|ESR54875.1| hypothetical protein CICLE_v10023345mg [Citrus clementina]
Length=163

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG+Q+RLWLG+YAT EAAA+AHD+A  CLR   SLD LNFP+++P + V   +SP
Sbjct  28   SEIRVPGSQERLWLGSYATQEAAAMAHDVAFYCLRRPRSLDGLNFPSMLPASVVHAELSP  87

Query  490  RSVQKVASDAGMAVDAQ  440
            +SVQK ASDAGM VDAQ
Sbjct  88   KSVQKAASDAGMGVDAQ  104



>gb|EYU22737.1| hypothetical protein MIMGU_mgv1a015981mg [Erythranthe guttata]
Length=139

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT +RLWLG+YATPEAAAVAHD+A  CLR  +S   LNFP L+ PAG   GMSP
Sbjct  40   SEIRVPGTPERLWLGSYATPEAAAVAHDVAFYCLRGNSSPKNLNFP-LVLPAGARVGMSP  98

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQK ASDAG+A+DA+
Sbjct  99   RSVQKAASDAGLAIDAR  115



>gb|EPS67960.1| hypothetical protein M569_06819 [Genlisea aurea]
Length=147

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT DRLWLG+YATP+AAAVAHD+A  CLR  +S   LNFP ++ PAG   GMSP
Sbjct  32   SEIRVPGTPDRLWLGSYATPQAAAVAHDVAYYCLRGNSSPQNLNFPAVV-PAGARIGMSP  90

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQK ASDAG+ VDA+
Sbjct  91   RSVQKAASDAGLGVDAR  107



>ref|XP_008339079.1| PREDICTED: ethylene-responsive transcription factor ERF019 [Malus 
domestica]
Length=176

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG+++T EAAAVA D+A  CLR  ++L+ LNFP  +PP      MSP
Sbjct  32   SEIRVPGTQDRLWLGSFSTAEAAAVARDVAYYCLRRPSTLEGLNFPLELPPCARD-DMSP  90

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
            RSVQK ASDAGMAVDAQ      PPQ
Sbjct  91   RSVQKAASDAGMAVDAQLIANKSPPQ  116



>ref|XP_008219092.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Prunus 
mume]
Length=166

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG++++PEAAAVA D+A  CLR  ++L+ LNFP ++P + V   MSP
Sbjct  32   SEIRVPGTQDRLWLGSFSSPEAAAVARDVAYYCLRRPSTLEGLNFPLVLPSS-VHADMSP  90

Query  490  RSVQKVASDAGMAVDAQ  440
            RS+QK ASDAGMAVDAQ
Sbjct  91   RSIQKAASDAGMAVDAQ  107



>ref|XP_007226695.1| hypothetical protein PRUPE_ppa020605mg [Prunus persica]
 gb|EMJ27894.1| hypothetical protein PRUPE_ppa020605mg [Prunus persica]
Length=166

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG++++PEAAAVA D+A  CLR  ++L+ LNFP ++P + V   MSP
Sbjct  32   SEIRVPGTQDRLWLGSFSSPEAAAVARDVAYYCLRRPSTLEGLNFPLVLPSS-VHADMSP  90

Query  490  RSVQKVASDAGMAVDAQ  440
            RS+QK ASDAGMAVDAQ
Sbjct  91   RSIQKAASDAGMAVDAQ  107



>ref|XP_003610945.1| Ethylene-responsive transcription factor ERF019 [Medicago truncatula]
 gb|AES93903.1| AP2 domain class transcription factor [Medicago truncatula]
Length=162

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 63/81 (78%), Gaps = 3/81 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRG---  500
            SEIRVPGTQ+RLWLGTYATPEAAAVAHD+A  CL+  ++LDKLNFP ++    + +    
Sbjct  31   SEIRVPGTQERLWLGTYATPEAAAVAHDVAFYCLKRPSTLDKLNFPDILSSYCIQQRDNL  90

Query  499  MSPRSVQKVASDAGMAVDAQQ  437
            MSPRSVQKVASD  M VDA+ 
Sbjct  91   MSPRSVQKVASDVAMDVDARN  111



>ref|XP_002528041.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF34359.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=166

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 3/80 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQ+RLWLG+Y+T EAAAVAHD+AS CLR  A   +LNFP LM PA V   MSP
Sbjct  28   SEIRVPGTQERLWLGSYSTAEAAAVAHDVASYCLR--AGDGRLNFP-LMLPASVKADMSP  84

Query  490  RSVQKVASDAGMAVDAQQHL  431
            +S+QK ASDAGMA+DAQ  L
Sbjct  85   KSIQKSASDAGMAIDAQMIL  104



>ref|XP_009378898.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Pyrus x bretschneideri]
 ref|XP_009335462.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Pyrus x bretschneideri]
Length=179

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLGT++T EAAAVA D+   CLR  ++L+ LNFP LM P+ V   MSP
Sbjct  33   SEIRVPGTRDRLWLGTFSTAEAAAVARDVGYYCLRRPSTLEGLNFP-LMLPSCVSDDMSP  91

Query  490  RSVQKVASDAGMAVDAQQHLLLHPP  416
            RSVQK ASDAGMAVDAQ      PP
Sbjct  92   RSVQKAASDAGMAVDAQLIANKSPP  116



>ref|XP_004299862.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Fragaria vesca subsp. vesca]
Length=165

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP-PAGVGRGMS  494
            SEIRVPGTQDRLWLG+++T EAAAVA D+A  CLR+ ++L+ LNFPT++P        MS
Sbjct  32   SEIRVPGTQDRLWLGSFSTAEAAAVARDVAYYCLRKPSTLEGLNFPTILPCSVNQAADMS  91

Query  493  PRSVQKVASDAGMAVDAQ  440
            PRS+QK ASDAGMAVDAQ
Sbjct  92   PRSIQKAASDAGMAVDAQ  109



>ref|XP_009378943.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Pyrus x bretschneideri]
Length=176

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLGT++T EAAAVA D+   CLR  ++L+ LNFP LM P+ V   MSP
Sbjct  33   SEIRVPGTRDRLWLGTFSTAEAAAVARDVGYYCLRRPSTLEGLNFP-LMLPSCVSDDMSP  91

Query  490  RSVQKVASDAGMAVDAQQHLLLHPP  416
            RSVQK ASDAGMAVDAQ      PP
Sbjct  92   RSVQKAASDAGMAVDAQLIANKSPP  116



>ref|XP_009335464.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Pyrus x bretschneideri]
Length=176

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLGT++T EAAAVA D+   CLR  ++L+ LNFP LM P+ V   MSP
Sbjct  33   SEIRVPGTRDRLWLGTFSTAEAAAVARDVGYYCLRRPSTLEGLNFP-LMLPSCVRDDMSP  91

Query  490  RSVQKVASDAGMAVDAQQHLLLHPP  416
            RSVQK ASDAGMAVDAQ      PP
Sbjct  92   RSVQKAASDAGMAVDAQLIANKSPP  116



>ref|XP_009357194.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Pyrus x bretschneideri]
Length=176

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG+++T EAAAVA D+A  CLR  ++L+ LNFP  +PP      MSP
Sbjct  32   SEIRVPGTQDRLWLGSFSTAEAAAVARDVAYYCLRRPSTLEGLNFPLELPPCAR-DDMSP  90

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQK ASDAGMAVDAQ
Sbjct  91   RSVQKAASDAGMAVDAQ  107



>emb|CDY25755.1| BnaA07g10270D [Brassica napus]
Length=151

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP       SP
Sbjct  26   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPPYIASNNTSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMAVDA
Sbjct  86   RSIQQAASNAGMAVDA  101



>emb|CDY04784.1| BnaC05g18050D [Brassica napus]
Length=134

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP+ V +  SP
Sbjct  27   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPPSIVSK-TSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMAVDA
Sbjct  86   RSIQQAASNAGMAVDA  101



>ref|XP_009103218.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Brassica rapa]
Length=148

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP       SP
Sbjct  23   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPPYIASNNTSP  82

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMAVDA
Sbjct  83   RSIQQAASNAGMAVDA  98



>ref|XP_009115599.1| PREDICTED: ethylene-responsive transcription factor ERF019 isoform 
X3 [Brassica rapa]
Length=133

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP+ V +  SP
Sbjct  27   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPPSIVSK-TSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMAVDA
Sbjct  86   RSIQQAASNAGMAVDA  101



>emb|CDY12507.1| BnaC07g13470D [Brassica napus]
Length=151

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP       SP
Sbjct  26   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPPYIASSNTSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMAVDA
Sbjct  86   RSIQQAASNAGMAVDA  101



>ref|XP_009115598.1| PREDICTED: ethylene-responsive transcription factor ERF019 isoform 
X2 [Brassica rapa]
 emb|CDY21391.1| BnaA09g30360D [Brassica napus]
Length=135

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP+ V +  SP
Sbjct  27   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPPSIVSK-TSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMAVDA
Sbjct  86   RSIQQAASNAGMAVDA  101



>ref|XP_009115597.1| PREDICTED: ethylene-responsive transcription factor ERF019 isoform 
X1 [Brassica rapa]
Length=144

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP+ V +  SP
Sbjct  27   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPPSIVSK-TSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMAVDA
Sbjct  86   RSIQQAASNAGMAVDA  101



>ref|XP_008365260.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Malus domestica]
Length=177

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLGT+ T EAAAVA D+   CLR  ++L+ LNFP L  P+ V   MSP
Sbjct  33   SEIRVPGTRDRLWLGTFXTAEAAAVARDVGYYCLRRPSTLEGLNFP-LXLPSCVRDDMSP  91

Query  490  RSVQKVASDAGMAVDAQQHLLLHPP  416
            RSVQK ASDAGMAVDAQ      PP
Sbjct  92   RSVQKAASDAGMAVDAQLIXNXSPP  116



>ref|XP_011095709.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Sesamum 
indicum]
Length=169

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT  RLWLG+YA PEAAAVAHD+A  CLR  +S   LNFP L+ PA    GMSP
Sbjct  36   SEIRVPGTPQRLWLGSYAPPEAAAVAHDVAFYCLRGNSSPQNLNFP-LVLPASARVGMSP  94

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQK +SDAG+AVDA+
Sbjct  95   RSVQKASSDAGLAVDAR  111



>ref|XP_008441160.1| PREDICTED: ethylene-responsive transcription factor ERF019 [Cucumis 
melo]
Length=148

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG----VGR  503
            SEIRVPG+QDRLWLG+Y++PEAAAVAHD+A  CLR  ++LD LNFP ++ P      +  
Sbjct  27   SEIRVPGSQDRLWLGSYSSPEAAAVAHDVAYYCLRRPSNLDHLNFPPMVLPLTNHLLIRD  86

Query  502  GMSPRSVQKVASDAGMAVDAQ  440
             MSP S+Q+ ASDA MAVDAQ
Sbjct  87   DMSPGSIQRAASDAAMAVDAQ  107



>ref|XP_004138829.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Cucumis sativus]
 ref|XP_004158553.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Cucumis sativus]
 gb|KGN63064.1| hypothetical protein Csa_2G401240 [Cucumis sativus]
Length=148

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG----VGR  503
            SEIR+PG+QDRLWLG+Y++PEAAAVAHD+A  CLR  ++LD LNFP ++ P      +  
Sbjct  27   SEIRIPGSQDRLWLGSYSSPEAAAVAHDVAYYCLRRPSNLDHLNFPPMVLPLTNHLLIRD  86

Query  502  GMSPRSVQKVASDAGMAVDAQ  440
             MSP S+Q+ ASDA MAVDAQ
Sbjct  87   DMSPGSIQRAASDAAMAVDAQ  107



>ref|NP_173695.1| ethylene-responsive transcription factor ERF019 [Arabidopsis 
thaliana]
 sp|O80542.1|ERF19_ARATH RecName: Full=Ethylene-responsive transcription factor ERF019 
[Arabidopsis thaliana]
 gb|AAK17174.1|AF325106_1 hypothetical protein [Arabidopsis thaliana]
 gb|AAC25505.1| Contains similarity to transcription factor (TINY) isolog T02O04.22 
gb|2062174 from A. thaliana BAC gb|AC001645 [Arabidopsis 
thaliana]
 gb|AAM63751.1| TINY-like transcription factor [Arabidopsis thaliana]
 gb|ABD57508.1| At1g22810 [Arabidopsis thaliana]
 gb|AEE30291.1| ethylene-responsive transcription factor ERF019 [Arabidopsis 
thaliana]
Length=144

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+ P+ V R  SP
Sbjct  27   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFFCLHQPDSLESLNFPHLLNPSLVSR-TSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMA+DA
Sbjct  86   RSIQQAASNAGMAIDA  101



>ref|XP_006416153.1| hypothetical protein EUTSA_v10009842mg [Eutrema salsugineum]
 gb|ESQ34506.1| hypothetical protein EUTSA_v10009842mg [Eutrema salsugineum]
Length=151

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT++RLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+PP+ +    SP
Sbjct  27   SEIRVPGTRERLWLGSFSTAEGAAVAHDVAFFCLHQPNSLETLNFPQLLPPS-IASKTSP  85

Query  490  RSVQKVASDAGMAVDAQQHLLLH  422
            RS+Q+ AS+AGMAVDA   L++H
Sbjct  86   RSIQQAASNAGMAVDAG--LIVH  106



>gb|KFK44371.1| hypothetical protein AALP_AA1G248600 [Arabis alpina]
Length=153

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+P + V +  SP
Sbjct  27   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFYCLHQPNSLESLNFPHLLPSSIVSK-TSP  85

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMA+DA
Sbjct  86   RSIQQAASNAGMAIDA  101



>ref|XP_009357258.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Pyrus x bretschneideri]
Length=191

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG+++T EAAAVA D+A  CLR  ++L+ LNFP L  P+     MSP
Sbjct  32   SEIRVPGTQDRLWLGSFSTAEAAAVARDVAYYCLRRPSTLEGLNFP-LELPSCARDDMSP  90

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQ  ASDAGMAVDAQ
Sbjct  91   RSVQNAASDAGMAVDAQ  107



>ref|XP_006304697.1| hypothetical protein CARUB_v10011955mg [Capsella rubella]
 gb|EOA37595.1| hypothetical protein CARUB_v10011955mg [Capsella rubella]
Length=147

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+ P+ +    SP
Sbjct  26   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFFCLHQPDSLESLNFPHLLNPS-IASKTSP  84

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMA+DA
Sbjct  85   RSIQQAASNAGMAIDA  100



>ref|XP_002893249.1| hypothetical protein ARALYDRAFT_889793 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69508.1| hypothetical protein ARALYDRAFT_889793 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+ P+ V +  SP
Sbjct  26   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFFCLHQPDSLESLNFPHLLNPSIVSK-TSP  84

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMA+DA
Sbjct  85   RSIQQAASNAGMAIDA  100



>ref|XP_010498767.1| PREDICTED: ethylene-responsive transcription factor ERF019 [Camelina 
sativa]
 ref|XP_010498768.1| PREDICTED: ethylene-responsive transcription factor ERF019 [Camelina 
sativa]
Length=144

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+ P+ +    SP
Sbjct  26   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFFCLHQPDSLESLNFPHLLNPS-IASKSSP  84

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMA+DA
Sbjct  85   RSIQQAASNAGMAIDA  100



>ref|XP_010477551.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Camelina sativa]
Length=145

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+ P+   +  SP
Sbjct  26   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFFCLHQPDSLESLNFPHLLNPSMASK-TSP  84

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMA+DA
Sbjct  85   RSIQQAASNAGMAIDA  100



>ref|XP_010460046.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Camelina sativa]
Length=144

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+++T E AAVAHD+A  CL +  SL+ LNFP L+ P+   +  SP
Sbjct  26   SEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFFCLHQPDSLESLNFPHLLNPSMASK-TSP  84

Query  490  RSVQKVASDAGMAVDA  443
            RS+Q+ AS+AGMA+DA
Sbjct  85   RSIQQAASNAGMAIDA  100



>ref|XP_002887377.1| hypothetical protein ARALYDRAFT_476281 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63636.1| hypothetical protein ARALYDRAFT_476281 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = -3

Query  745  MSSAGGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR  566
            M S  GE  Q +Y+G+RRRKWGKWVSEIRVPGT+ RLWLG+++T E AAVAHD+A  CL 
Sbjct  1    MDSRAGETDQSKYKGIRRRKWGKWVSEIRVPGTRQRLWLGSFSTAEGAAVAHDVAFYCLH  60

Query  565  ETASLDK--LNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDA  443
              +SLD    NFP L+P + +    SP+S+QK ASDAGMAVDA
Sbjct  61   RLSSLDDEAFNFPRLLPTS-LASNTSPKSIQKAASDAGMAVDA  102



>ref|XP_007156998.1| hypothetical protein PHAVU_002G035100g [Phaseolus vulgaris]
 gb|ESW28992.1| hypothetical protein PHAVU_002G035100g [Phaseolus vulgaris]
Length=177

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFP-TLMPPAGVGRGMS  494
            SEIRVPGTQ+RLWLGTYATPEAAAVAHD+A  CLR  +SLDKLN P TL   +G  R MS
Sbjct  31   SEIRVPGTQERLWLGTYATPEAAAVAHDVAVYCLRRPSSLDKLNLPETLSSYSGQLREMS  90

Query  493  PRSVQKVASDAGMAVDAQQ  437
            PRSVQKVASD GM VDA+ 
Sbjct  91   PRSVQKVASDVGMDVDARN  109



>ref|XP_010100093.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25991.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB81476.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=158

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  745  MSSAGGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR  566
            MS    EE++ +Y+GVRRRKWGKWVSEIRVPG+Q+RLWLG+YAT EAAAVAHD+A  CLR
Sbjct  1    MSYEKSEETRTKYKGVRRRKWGKWVSEIRVPGSQERLWLGSYATAEAAAVAHDVAFYCLR  60

Query  565  ETASLDKLNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDAQQ  437
               SL+ LNFP ++P A +   MSPR++Q+ ASDAGMA+DA+Q
Sbjct  61   RPVSLESLNFPLMLPVASLQGDMSPRTIQRAASDAGMAIDARQ  103



>emb|CDX96329.1| BnaA07g29400D [Brassica napus]
Length=139

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 3/99 (3%)
 Frame = -3

Query  733  GGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETAS  554
            GGE  Q +Y+G+RRRKWGKWVSEIRVPGT++RLWLG+++T E AAVAHD+A  CL   ++
Sbjct  6    GGETHQAKYKGIRRRKWGKWVSEIRVPGTRERLWLGSFSTAEGAAVAHDVAFYCLHRPST  65

Query  553  LDK--LNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDA  443
            LD    NFP L+ P+ +    SP+S+QK ASDAGMAVDA
Sbjct  66   LDNEAFNFPHLLQPS-LASNTSPKSIQKAASDAGMAVDA  103



>ref|XP_006301935.1| hypothetical protein CARUB_v10022408mg [Capsella rubella]
 gb|EOA34833.1| hypothetical protein CARUB_v10022408mg [Capsella rubella]
Length=150

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDK--LNFPTLMPPAGVGRGM  497
            SEIRVPGT+ RLWLG+++T E AAVAHD+A  CL   +SLD    NFP L+P + +    
Sbjct  28   SEIRVPGTRQRLWLGSFSTAEGAAVAHDVAFYCLHRPSSLDDEAFNFPHLLPTS-LASNT  86

Query  496  SPRSVQKVASDAGMAVDAQQHL  431
            SP+S+QK ASDAGMAVDA  +L
Sbjct  87   SPKSIQKAASDAGMAVDAGFNL  108



>ref|XP_002276994.2| PREDICTED: ethylene-responsive transcription factor ERF020 [Vitis 
vinifera]
Length=162

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG+YAT EAAAVAHDIAS CLR   SLD LNFP ++    V   +SP
Sbjct  31   SEIRVPGTQDRLWLGSYATAEAAAVAHDIASYCLRGGTSLDGLNFPHVISSK-VRTDLSP  89

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQK ASDAG+A+DAQ
Sbjct  90   RSVQKAASDAGLAIDAQ  106



>emb|CDX72812.1| BnaC06g32600D [Brassica napus]
Length=138

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -3

Query  733  GGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETAS  554
            GGE  Q +Y+G+RRRKWGKWVSEIRVPGT++RLWLG+++T E AAVAHD+A  CL   +S
Sbjct  6    GGETHQAKYKGIRRRKWGKWVSEIRVPGTRERLWLGSFSTAEGAAVAHDVAFYCLHRPSS  65

Query  553  LDK--LNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDA  443
            LD    NFP L+ P+ +    SP+S+QK ASDAGM VDA
Sbjct  66   LDNEAFNFPHLLQPS-LASNTSPKSIQKAASDAGMGVDA  103



>ref|XP_010427986.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Camelina sativa]
Length=149

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 3/109 (3%)
 Frame = -3

Query  751  VEMSSAGGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVC  572
            +++S   GE  Q  Y+G+RRRKWGKWVSEIRVPGT+ RLWLG+++T E AAVAHD+A  C
Sbjct  1    MDLSRDAGETYQSTYKGIRRRKWGKWVSEIRVPGTRQRLWLGSFSTAEGAAVAHDVAFYC  60

Query  571  LRETASLDK--LNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDAQQHL  431
            L   ++LD    NFP L+P + +    SP+S+QK ASDAGMAVDA  +L
Sbjct  61   LHRPSTLDDESFNFPHLLPTS-LASTTSPKSIQKAASDAGMAVDAGFNL  108



>ref|XP_003538667.2| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Glycine max]
 gb|KHN35100.1| Ethylene-responsive transcription factor ERF020 [Glycine soja]
Length=179

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            SEIRVPGTQ+RLWLGTYATPEAAAVAHD+A  CL   +SLDKLNFP  +    V  R MS
Sbjct  30   SEIRVPGTQERLWLGTYATPEAAAVAHDVAVYCLSRPSSLDKLNFPETLSSYSVQLRDMS  89

Query  493  PRSVQKVASDAGMAVDAQQ  437
            PRSVQKVASD GM VDA+ 
Sbjct  90   PRSVQKVASDVGMDVDARN  108



>ref|NP_177307.1| ERF/AP2 transcription factor family protein DREB A-5 [Arabidopsis 
thaliana]
 sp|Q9C9I8.1|ERF20_ARATH RecName: Full=Ethylene-responsive transcription factor ERF020 
[Arabidopsis thaliana]
 gb|AAG51829.1|AC016163_18 hypothetical protein; 37461-37030 [Arabidopsis thaliana]
 gb|AAR25635.1| At1g71520 [Arabidopsis thaliana]
 gb|AAT41799.1| At1g71520 [Arabidopsis thaliana]
 gb|AEE35209.1| ERF/AP2 transcription factor family protein DREB A-5 [Arabidopsis 
thaliana]
Length=143

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLD--KLNFPTLMPPAGVGRGM  497
            SEIRVPGT+ RLWLG+++T E AAVAHD+A  CL   +SLD    NFP L+  + +   +
Sbjct  27   SEIRVPGTRQRLWLGSFSTAEGAAVAHDVAFYCLHRPSSLDDESFNFPHLLTTS-LASNI  85

Query  496  SPRSVQKVASDAGMAVDAQQH  434
            SP+S+QK ASDAGMAVDA  H
Sbjct  86   SPKSIQKAASDAGMAVDAGFH  106



>ref|XP_010471164.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Camelina sativa]
Length=148

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 3/109 (3%)
 Frame = -3

Query  751  VEMSSAGGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVC  572
            +++S   GE  Q  Y+G+RRRKWGKWVSEIRVPGT+ RLWLG+++T E AAVAHD+A  C
Sbjct  1    MDLSRDAGETYQSTYKGIRRRKWGKWVSEIRVPGTRQRLWLGSFSTAEGAAVAHDVAFYC  60

Query  571  LRETASLDK--LNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDAQQHL  431
            L   ++L+    NFP L+P + +    SP+S+QK ASDAGMAVDA  +L
Sbjct  61   LHRPSTLEDEAFNFPHLLPTS-LASTTSPKSIQKAASDAGMAVDAGYNL  108



>emb|CAN76087.1| hypothetical protein VITISV_028805 [Vitis vinifera]
Length=240

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGTQDRLWLG+YAT EAAAVAHDIAS CLR   SLD LNFP ++  + V   +SP
Sbjct  31   SEIRVPGTQDRLWLGSYATAEAAAVAHDIASYCLRGGTSLDGLNFPHVI-SSKVRTDLSP  89

Query  490  RSVQKVASDAGMAVDAQ  440
            RSVQK ASDAG+A+DAQ
Sbjct  90   RSVQKAASDAGLAIDAQ  106



>ref|XP_009105818.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Brassica 
rapa]
Length=139

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -3

Query  733  GGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETAS  554
            GGE  Q +Y+G+RRRKWGKWVSEIRVPGT++RLWLG+++  E AAVAHD+A  CL   ++
Sbjct  6    GGETHQAKYKGIRRRKWGKWVSEIRVPGTRERLWLGSFSPAEGAAVAHDVAFYCLHRPST  65

Query  553  LDK--LNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDA  443
            LD    NFP L+ P+ +    SP+S+QK ASDAGMAVDA
Sbjct  66   LDNEAFNFPHLLQPS-LASNTSPKSIQKAASDAGMAVDA  103



>ref|XP_010415862.1| PREDICTED: ethylene-responsive transcription factor ERF020 isoform 
X1 [Camelina sativa]
 ref|XP_010415863.1| PREDICTED: ethylene-responsive transcription factor ERF020 isoform 
X2 [Camelina sativa]
Length=149

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDK--LNFPTLMPPAGVGRGM  497
            SEIRVPGT+ RLWLG+++T E AAVAHD+A  CL   ++LD    NFP L+P + +    
Sbjct  28   SEIRVPGTRQRLWLGSFSTAEGAAVAHDVAFYCLHRPSTLDDESFNFPQLLPTS-LASTT  86

Query  496  SPRSVQKVASDAGMAVDAQQHL  431
            SP+S+QK ASDAG+AVDA  +L
Sbjct  87   SPKSIQKAASDAGLAVDAGFNL  108



>ref|XP_003516746.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Glycine max]
 gb|KHN34149.1| Ethylene-responsive transcription factor ERF020 [Glycine soja]
Length=178

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 84/152 (55%), Gaps = 13/152 (9%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            SEIRVPGTQ RLWLGTYAT EAAAVAHD+A  CLR  +SLDKLNFP  +    +  R MS
Sbjct  23   SEIRVPGTQGRLWLGTYATQEAAAVAHDVAVYCLRRPSSLDKLNFPETLSSFSLQLRDMS  82

Query  493  PRSVQKVASDAGMAVDAQQHLLLHPPQAVEFSgggenrwggg---------eaaeEVFRW  341
            PRSVQKVASD GM VDA+  L       V  +    +              +   +VFRW
Sbjct  83   PRSVQKVASDIGMDVDARNILAGKTSTVVAETNYESDERSRTVCDVDGGGADEHSDVFRW  142

Query  340  ---AERPCCsssregsgiseEAQALSISVDDY  254
                     S    G    E  QALSIS++DY
Sbjct  143  DAVGNEDGGSWHGSGGDCKERDQALSISIEDY  174



>ref|XP_006390762.1| hypothetical protein EUTSA_v10019510mg [Eutrema salsugineum]
 gb|ESQ28048.1| hypothetical protein EUTSA_v10019510mg [Eutrema salsugineum]
Length=148

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDK--LNFPTLMPPAGVGRGM  497
            SEIRVPGT++RLWLG+++T E AAVAHD+A  CL    SL+    NFP L+ P+ +    
Sbjct  28   SEIRVPGTRERLWLGSFSTAEGAAVAHDVAFYCLHRPLSLEDEAFNFPHLLSPS-LASNT  86

Query  496  SPRSVQKVASDAGMAVDA  443
            SP+S+QK ASDAGMAVDA
Sbjct  87   SPKSIQKAASDAGMAVDA  104



>emb|CDY03696.1| BnaA02g15410D [Brassica napus]
Length=147

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDK--LNFPTLMPPAGVGRGM  497
            SEIRVP T++RLWLG+++T E AAVAHD+A  CL   +SLD+   NFP L+ P+ +    
Sbjct  27   SEIRVPRTRERLWLGSFSTAEGAAVAHDVAFFCLHRPSSLDEEVFNFPHLLQPS-LASYT  85

Query  496  SPRSVQKVASDAGMAVDA  443
            SP+S+QK ASDAGMA+DA
Sbjct  86   SPKSIQKAASDAGMAIDA  103



>ref|XP_010927841.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Elaeis guineensis]
Length=166

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT +RLWLG+Y TPEAAAVAHD A   LR     + LNFP  +       G+SP
Sbjct  29   SEIRVPGTHERLWLGSYTTPEAAAVAHDTAVYFLRGPDCSETLNFPDRVAMY-AWTGLSP  87

Query  490  RSVQKVASDAGMAVDAQ  440
            RS+Q+VASD+GMA+DAQ
Sbjct  88   RSIQRVASDSGMAIDAQ  104



>ref|XP_010910416.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Elaeis guineensis]
Length=158

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG+++RLWLG+YATPEAAAVAHD A   LR       LNFP  +        MSP
Sbjct  29   SEIRVPGSRERLWLGSYATPEAAAVAHDTAVFFLRGPDQSHALNFPDRVAMY-TWTSMSP  87

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
            RS+Q+VAS++GMAVDAQ  L++  PQ
Sbjct  88   RSIQRVASNSGMAVDAQ--LVVRRPQ  111



>ref|XP_004511495.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Cicer arietinum]
Length=176

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRG---  500
            SEIRVPGTQ+RLWLGTYATPEAAAVAHD+A  CLR  ++LDKLNFP  +    + +    
Sbjct  28   SEIRVPGTQERLWLGTYATPEAAAVAHDVAVYCLRRPSTLDKLNFPETLSSYCIQQRDDL  87

Query  499  MSPRSVQKVASDAGMAVDAQQ  437
            MSPRSVQKVASD  M VDA+ 
Sbjct  88   MSPRSVQKVASDVAMDVDARN  108



>ref|XP_010521099.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Tarenaya 
hassleriana]
Length=139

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -3

Query  742  SSAGGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCL-R  566
            S+ GG E + +Y+G+RRRKWGKWVSEIRVPGT+DRLWLG+++T E AA+AHD+A  CL R
Sbjct  3    SNGGGREERNKYKGIRRRKWGKWVSEIRVPGTRDRLWLGSFSTAEGAAMAHDVAYFCLHR  62

Query  565  ETASLDK-LNFPTLMPPAGVGRGMSPRSVQKVASDAGMAVDAQQHL  431
             ++ L+  LNFP L+         SP S+Q+ ASDAGMA+DA   L
Sbjct  63   PSSDLESCLNFPQLLSLPSFASLTSPSSIQRAASDAGMAIDASFSL  108



>ref|XP_008807007.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Phoenix dactylifera]
Length=160

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG+ +RLWLG+YATPEAAAVAHD A   LR       LNFP  +       G+SP
Sbjct  29   SEIRVPGSHERLWLGSYATPEAAAVAHDTAVFFLRGPDWSQGLNFPDRVATY-PWTGLSP  87

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQA  410
             S+Q+VASD+GMAVDAQ  L +  PQA
Sbjct  88   TSIQRVASDSGMAVDAQ--LAVRVPQA  112



>ref|XP_009127864.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Brassica rapa]
Length=148

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDK--LNFPTLMPPAGVGRGM  497
            SEIRVP T++RLWLG+++T E AAVAHD+A  CL   +SL +   NFP L+ P+ +    
Sbjct  27   SEIRVPRTRERLWLGSFSTAEGAAVAHDVAFFCLHRPSSLGEEVFNFPHLLQPS-LASYT  85

Query  496  SPRSVQKVASDAGMAVDA  443
            SP+S+QK ASDAGMA+DA
Sbjct  86   SPKSIQKAASDAGMAIDA  103



>ref|XP_008778360.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Phoenix dactylifera]
Length=158

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPG+ +RLWLG+Y TPEAAAVA D A   LR       LNFP  +       G+SP
Sbjct  29   SEIRVPGSHERLWLGSYTTPEAAAVARDTAVYFLRGPDWSHDLNFPHRVAMYAWA-GLSP  87

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQA  410
            RS+Q+VASD+GMAVDAQ  L++  P+A
Sbjct  88   RSIQRVASDSGMAVDAQ--LMVRGPEA  112



>ref|XP_010930475.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Elaeis 
guineensis]
Length=132

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+PG++ RLWLG+Y+ P+AAAVAHD A   LR  +S   LNFP  +  +    GMSP
Sbjct  36   SEIRIPGSRKRLWLGSYSAPQAAAVAHDTAMFLLRGPSSSSGLNFPDHVTLSDC-VGMSP  94

Query  490  RSVQKVASDAGMAVDAQ  440
            +S+Q+ ASDAGMA+DA+
Sbjct  95   KSIQRAASDAGMAIDAE  111



>ref|XP_010242028.1| PREDICTED: ethylene-responsive transcription factor ERF020 [Nelumbo 
nucifera]
Length=163

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT+DRLWLG+Y+TPEAAAVAHD A  CLR  +S   LNFP L+P   +   MSP
Sbjct  29   SEIRVPGTRDRLWLGSYSTPEAAAVAHDTALFCLRGPSSAGHLNFPILLPRI-LQADMSP  87

Query  490  RSVQK  476
            RS+QK
Sbjct  88   RSIQK  92



>ref|XP_009394039.1| PREDICTED: ethylene-responsive transcription factor ERF019-like 
[Musa acuminata subsp. malaccensis]
Length=152

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIRVPGT DRLWLG+YATPEAAAVAHD A   LR  +   +LNFP     A     +SP
Sbjct  25   SEIRVPGTGDRLWLGSYATPEAAAVAHDTAVFFLRGPSHAGRLNFPD-RAVALTWACLSP  83

Query  490  RSVQKVASDAGMAVDAQ  440
             SVQ+ AS++GMAVDAQ
Sbjct  84   PSVQRAASESGMAVDAQ  100



>tpg|DAA56474.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
 gb|AIB05167.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=178

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 4/81 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR---ETASLDKLNFPTLMPPAGVGRG  500
            SEIRVPG+++RLWLG+YATPEAAAVAHD A   LR       +  LNFP     A    G
Sbjct  33   SEIRVPGSRERLWLGSYATPEAAAVAHDTAVYFLRGGGGAGDVAALNFPERAAAAYGAGG  92

Query  499  -MSPRSVQKVASDAGMAVDAQ  440
             +SPRSVQ+VASDAGMA DAQ
Sbjct  93   RLSPRSVQRVASDAGMAADAQ  113



>ref|NP_001147298.1| transcriptional factor TINY [Zea mays]
 gb|ACG26648.1| transcriptional factor TINY [Zea mays]
Length=179

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR----ETASLDKLNFPTLMPPAGVGR  503
            SEIRVPG+++RLWLG+YATPEAAAVAHD A   LR        +  LNFP     A    
Sbjct  33   SEIRVPGSRERLWLGSYATPEAAAVAHDTAVYFLRGGGGGPGDVAALNFPERAAAAYGAG  92

Query  502  G-MSPRSVQKVASDAGMAVDAQ  440
            G +SPRSVQ+VASDAGMA DAQ
Sbjct  93   GRLSPRSVQRVASDAGMAADAQ  114



>gb|EAY76748.1| hypothetical protein OsI_04704 [Oryza sativa Indica Group]
Length=193

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR-----ETASLDKLNFP----TLMPP  518
            SEIRVPGT++RLWLG+YATPEAAAVAHD A   LR            LNFP         
Sbjct  34   SEIRVPGTRERLWLGSYATPEAAAVAHDTAVYFLRGGAGDGGGGGATLNFPERAAATYGG  93

Query  517  AGVGRGMSPRSVQKVASDAGMAVDAQ  440
            A     +SPRSVQ+VASDAGMA DAQ
Sbjct  94   AAAVARLSPRSVQRVASDAGMAADAQ  119



>dbj|BAB90166.1| AP2 domain-containing transcription factor-like protein [Oryza 
sativa Japonica Group]
 dbj|BAD82116.1| AP2 domain-containing transcription factor-like protein [Oryza 
sativa Japonica Group]
Length=228

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 54/86 (63%), Gaps = 9/86 (10%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR-----ETASLDKLNFP----TLMPP  518
            SEIRVPGT++RLWLG+YATPEAAAVAHD A   LR            LNFP         
Sbjct  69   SEIRVPGTRERLWLGSYATPEAAAVAHDTAVYFLRGGAGDGGGGGATLNFPERAAATYGG  128

Query  517  AGVGRGMSPRSVQKVASDAGMAVDAQ  440
                  +SPRSVQ+VASDAGMA DAQ
Sbjct  129  GAAVARLSPRSVQRVASDAGMAADAQ  154



>ref|XP_004970828.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Setaria italica]
Length=194

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 56/93 (60%), Gaps = 16/93 (17%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR----------ETASLDKLNFPTLMP  521
            SEIRVPGT++RLWLG+YATPEAAAVAHD A   LR              +  LNFP    
Sbjct  31   SEIRVPGTRERLWLGSYATPEAAAVAHDTAVYFLRGGAGAGPGVAAGGDVAALNFPERAA  90

Query  520  PAGVGRG------MSPRSVQKVASDAGMAVDAQ  440
             A           +SPRSVQ+VASDAGMA DAQ
Sbjct  91   AAYGAGAGAGAARLSPRSVQRVASDAGMAADAQ  123



>ref|XP_009420162.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Musa acuminata subsp. malaccensis]
Length=162

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRE-TASLDKLNFPTLMPPAGVGRGMS  494
            SEIRVPG+++RLWLG+++TPEAAAVAHD A   LR    S    NFP  +        +S
Sbjct  27   SEIRVPGSRERLWLGSFSTPEAAAVAHDTAVFFLRGPDGSRGGFNFPDRVATFAWAN-LS  85

Query  493  PRSVQKVASDAGMAVDAQQHLLLHPPQA  410
            P SVQ+VAS++GM VDA+  L +H P+A
Sbjct  86   PPSVQRVASESGMDVDAR--LAVHAPEA  111



>ref|XP_002456757.1| hypothetical protein SORBIDRAFT_03g042060 [Sorghum bicolor]
 gb|EES01877.1| hypothetical protein SORBIDRAFT_03g042060 [Sorghum bicolor]
Length=191

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 56/98 (57%), Gaps = 21/98 (21%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR--------------ETASLDKLNFP  533
            SEIRVPGT++RLWLG+YATPEAAAVAHD A   LR                  +  LNFP
Sbjct  35   SEIRVPGTRERLWLGSYATPEAAAVAHDTAVYFLRGGTGAGAGTGAGVAGGGDVAALNFP  94

Query  532  TLMPPAGVGRG-------MSPRSVQKVASDAGMAVDAQ  440
                 A            +SPRSVQ+VASDAGMA DAQ
Sbjct  95   ERAAAAYGTGAGAGAAGRLSPRSVQRVASDAGMAADAQ  132



>ref|XP_008786563.1| PREDICTED: ethylene-responsive transcription factor ERF019 [Phoenix 
dactylifera]
Length=128

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 5/79 (6%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG--VGRGM  497
            SEIR+PG++ RLWLG+Y+TP+AAA A+D A   LR  +S   LNFP  +P +G  V   M
Sbjct  36   SEIRIPGSRKRLWLGSYSTPQAAAAAYDTAMFLLRGPSSSSSLNFPDHVPFSGWVV---M  92

Query  496  SPRSVQKVASDAGMAVDAQ  440
            SP S+Q+ ASD+G AVDAQ
Sbjct  93   SPESIQRAASDSGKAVDAQ  111



>ref|XP_003567341.1| PREDICTED: ethylene-responsive transcription factor ERF096 [Brachypodium 
distachyon]
Length=210

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETAS----LDKLNFPTL------MP  521
            SEIRVPG+++RLWLG+YATP+AAAVAHD A   LR           LNFP        M 
Sbjct  100  SEIRVPGSRERLWLGSYATPQAAAVAHDAAVFFLRGGGQGATDAAALNFPERAAATYGMG  159

Query  520  PAGVGRGMSPRSVQKVASDAGMAVDAQ  440
             +     +SPRSVQ+VASDAGMA DAQ
Sbjct  160  TSAAAARLSPRSVQRVASDAGMAADAQ  186



>ref|XP_006404817.1| hypothetical protein EUTSA_v10000354mg [Eutrema salsugineum]
 gb|ESQ46270.1| hypothetical protein EUTSA_v10000354mg [Eutrema salsugineum]
Length=168

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 7/81 (9%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPA----GVGR  503
            +EIR P  + R+WLG+Y+TPEAAA A+D A +CLR  ++  +LNFP L+  A    GVG 
Sbjct  41   AEIREPNKRSRIWLGSYSTPEAAARAYDTAVLCLRGPSA--RLNFPELLTGATVSNGVGE  98

Query  502  G-MSPRSVQKVASDAGMAVDA  443
            G MS   +++ A++ G  VDA
Sbjct  99   GDMSAAYIRRKAAEVGAQVDA  119



>gb|AFV60734.1| ethylene-responsive transcription factor 2 [Carica papaya]
Length=210

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR MSP
Sbjct  28   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGPQA--KFNFPENPPEIEGGRSMSP  85

Query  490  RSVQKVAS  467
            + +Q VAS
Sbjct  86   QQIQLVAS  93



>gb|AGC51783.1| ERF/AP2 domain-containing transcription factor [Manihot esculenta]
Length=152

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+      R MS 
Sbjct  44   AEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSA--RLNFPDLIYHEDNLRDMSA  101

Query  490  RSVQKVASDAGMAVDAQQHLLLH  422
             S++K A++ G  VDA Q   LH
Sbjct  102  ASIRKKATEVGAQVDALQQTALH  124



>gb|ABR17626.1| unknown [Picea sitchensis]
Length=189

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++D++WLG+Y TPE AA A+D A  CLR   S  K NFP  +P       +SP
Sbjct  37   SEIRMPNSRDKIWLGSYDTPEKAARAYDFAVYCLR--GSKAKFNFPEFLPEIPCASSLSP  94

Query  490  RSVQKVAS  467
              +Q  AS
Sbjct  95   PQIQAAAS  102



>ref|XP_002308508.1| hypothetical protein POPTR_0006s23480g [Populus trichocarpa]
 gb|ABQ62997.1| RAP2-like protein [Populus trichocarpa]
 gb|EEE92031.1| hypothetical protein POPTR_0006s23480g [Populus trichocarpa]
Length=206

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR + +  K NFP   P    GR ++P
Sbjct  38   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGSGA--KFNFPDNPPDIVGGRSLTP  95

Query  490  RSVQKVAS  467
            + VQ+VA+
Sbjct  96   QEVQEVAA  103



>ref|XP_011019312.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Populus 
euphratica]
Length=207

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR + +  K NFP   P    GR ++P
Sbjct  38   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGSGA--KFNFPDNPPDIVGGRSLTP  95

Query  490  RSVQKVAS  467
            + VQ+VA+
Sbjct  96   QEVQEVAA  103



>ref|XP_004287662.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Fragaria vesca subsp. vesca]
Length=216

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 5/86 (6%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  34   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGRTA--KFNFPDNPPEISGGRSLSP  91

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
              +Q   ++A    + +   L+ PPQ
Sbjct  92   AEIQ---AEAARFANNEADPLIPPPQ  114



>ref|XP_008649655.1| PREDICTED: ethylene-responsive transcription factor ERF020-like 
[Zea mays]
 gb|AFW78052.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=186

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 64/96 (67%), Gaps = 8/96 (8%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFP---TLMPPAGVGRG  500
            SEIRVPGT++RLWLG+YA PEAAAVAHD A+  LR  A   +LNFP         G  + 
Sbjct  29   SEIRVPGTRERLWLGSYAAPEAAAVAHDAAACLLRGCAG-RRLNFPGRAACYYACGGQQP  87

Query  499  MSPRSVQKVASDAGMAVDAQ----QHLLLHPPQAVE  404
            +SPRSVQ+VASDAGMA DAQ    +  L  PP  V+
Sbjct  88   LSPRSVQRVASDAGMAADAQIVDARAALASPPPVVQ  123



>ref|XP_002284933.1| PREDICTED: ethylene-responsive transcription factor ERF010-like 
[Vitis vinifera]
Length=142

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP+AAA A+D A  CLR  ++  +LNFP  +      + +S 
Sbjct  36   AEIREPNKRSRIWLGSYSTPKAAARAYDTAVFCLRGRSA--RLNFPEYIAEEDEVQDLSA  93

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A++ G  VDA +  L
Sbjct  94   ASIRKKATEVGARVDAMETAL  114



>ref|XP_004291085.1| PREDICTED: ethylene-responsive transcription factor RAP2-1-like 
[Fragaria vesca subsp. vesca]
Length=159

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y TP AAA A+D A   LR  ++  +LNFP L+   G    MS 
Sbjct  52   AEIREPNKRTRIWLGSYTTPVAAARAYDTAVFYLRGPSA--RLNFPELVFQEGQLHDMSS  109

Query  490  RSVQKVASDAGMAVDAQQHLLLHP  419
             S++K A++ G  VDA Q  L  P
Sbjct  110  ASIRKKATEVGTKVDALQTALRSP  133



>gb|EEC80179.1| hypothetical protein OsI_22034 [Oryza sativa Indica Group]
 gb|EEE65255.1| hypothetical protein OsJ_20453 [Oryza sativa Japonica Group]
Length=191

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR+P ++ R+WLG+Y TPE AA A D A +CLR   ++  LNF T  PPA V R   P
Sbjct  29   AEIRLPNSRKRIWLGSYYTPEKAARAFDAAFICLRGGEAIAGLNF-TESPPAVVARTTDP  87

Query  490  RSVQKVAS---------DAGMAVDAQQH  434
            R V   A+         DA +A + + H
Sbjct  88   REVLAFATSHANLLSLLDAAIAQEEEAH  115



>ref|XP_003525804.1| PREDICTED: ethylene-responsive transcription factor ERF010-like 
[Glycine max]
Length=150

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP---PAGVGRG  500
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+    PA     
Sbjct  37   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPELLAAEGPAASDAV  94

Query  499  MSPRSVQKVASDAGMAVDAQQHLLLHPPQAVEFS  398
            MS  S++K A++ G  VDA      H P A EF+
Sbjct  95   MSAASIRKKATEVGARVDALHRQDPHAPPAGEFA  128



>ref|XP_004966650.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Setaria italica]
Length=203

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A +CLR  A +D LNFP    P  VGR   P
Sbjct  28   SEIRLPHSRERIWLGSYDTPEKAARAFDAAYLCLRGPAGVDGLNFPGS--PPDVGRTSDP  85

Query  490  RSVQKVA  470
              V   A
Sbjct  86   NEVYAAA  92



>dbj|BAD36633.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
Length=209

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR+P ++ R+WLG+Y TPE AA A D A +CLR   ++  LNF T  PPA V R   P
Sbjct  29   AEIRLPNSRKRIWLGSYYTPEKAARAFDAAFICLRGGEAIAGLNF-TESPPAVVARTTDP  87

Query  490  RSVQKVAS---------DAGMAVDAQQH  434
            R V   A+         DA +A + + H
Sbjct  88   REVLAFATSHANLLSLLDAAIAQEEEAH  115



>ref|XP_008440304.1| PREDICTED: ethylene-responsive transcription factor ERF011 [Cucumis 
melo]
Length=173

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 11/88 (13%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRG---  500
            +EIR P  + R+WLG+Y++P AAA A+D A   LR  ++  +LNFP L+  AG GRG   
Sbjct  35   AEIREPNKRSRIWLGSYSSPVAAARAYDTAVFYLRGPSA--RLNFPELL--AGEGRGITA  90

Query  499  ----MSPRSVQKVASDAGMAVDAQQHLL  428
                MS  S++K A++ G  VDAQ+  L
Sbjct  91   GAGDMSAASIRKKATEVGARVDAQESSL  118



>ref|XP_004966651.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Setaria italica]
Length=199

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A+VCLR     D LNFP   PPA  G    P
Sbjct  36   SEIRLPNSRERIWLGSYDTPEKAARAFDGAAVCLRGPGGADGLNFPG-SPPAVAGLTTDP  94

Query  490  RSVQKVA  470
              V+  A
Sbjct  95   EEVRAAA  101



>ref|XP_009337182.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Pyrus 
x bretschneideri]
Length=234

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  47   SEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGRTA--KFNFPDNPPDIPGGRSLSP  104

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQA  410
              +Q  A+    +   + H  +  PQA
Sbjct  105  AEIQVEAARFANSEIPRSHQSMSAPQA  131



>gb|KDP34005.1| hypothetical protein JCGZ_07576 [Jatropha curcas]
Length=210

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGV--GRGM  497
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   PP  +  G+ +
Sbjct  37   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGRGA--KFNFPD-NPPDNIDGGQSL  93

Query  496  SPRSVQKVAS  467
            SP+ +Q VAS
Sbjct  94   SPQEIQAVAS  103



>ref|XP_003551002.1| PREDICTED: ethylene-responsive transcription factor ERF008-like 
[Glycine max]
Length=147

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    MS 
Sbjct  37   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFHLRGPSA--RLNFPELVAAEGPAADMSA  94

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQAVEFS  398
             S++K A++ G  VDA      H   A EF+
Sbjct  95   ASIRKKATEVGARVDALHRQHPHALPAGEFA  125



>gb|ADE41099.1| AP2 domain class transcription factor [Malus domestica]
Length=235

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P  ++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  49   SEIRLPNCRERIWLGSYGTPEKAARAFDAALFCLRGRTA--KFNFPDNPPDIPGGRSLSP  106

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQA  410
              +Q  A+    +   + H  +  PQA
Sbjct  107  AEIQVEAARFANSEIPRSHQSMSAPQA  133



>ref|NP_001238164.1| uncharacterized protein LOC100527066 [Glycine max]
 gb|ACU16106.1| unknown [Glycine max]
Length=168

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 10/94 (11%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG-----VG  506
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G      G
Sbjct  41   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRRPSA--RLNFPELLVREGPAALVAG  98

Query  505  RGMSPRSVQKVASDAGMAVDAQQHLLLH---PPQ  413
              MS  S++K A++ G  VDA Q  L H   PP+
Sbjct  99   CDMSAASIRKKATEVGARVDALQATLHHHYVPPR  132



>ref|XP_010515388.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Camelina sativa]
Length=157

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP--PAGVGRGM  497
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +   LNFP L+P         M
Sbjct  35   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTAT--LNFPELIPCIENSAAEDM  92

Query  496  SPRSVQKVASDAGMAVDAQQHLLLH  422
            S  +++K A++ G  VDA    ++H
Sbjct  93   SAATIRKKATEVGAQVDAIGTTVVH  117



>gb|AFU07644.1| ethylene-responsive element binding factor 2 [Arachis hypogaea]
Length=185

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 58/99 (59%), Gaps = 13/99 (13%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLM----PPAGVGR  503
            +EIR P  + R WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+    PP+ VG 
Sbjct  37   AEIREPNKRSRXWLGSYSTPIAAARAYDTAVFYLRGPSA--RLNFPELLAGEPPPSLVGA  94

Query  502  -GMSPRSVQKVASDAGMAVDAQQHLLLH------PPQAV  407
              MS  S++K A++ G  VDA Q   LH      PPQ +
Sbjct  95   CDMSAASIRKKATEVGARVDALQAATLHHHHLAAPPQEL  133



>ref|XP_010426571.1| PREDICTED: ethylene-responsive transcription factor ERF011 [Camelina 
sativa]
Length=156

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 4/78 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP--PAGVGRGM  497
            +EIR P  + RLWLG+YATPEAAA A+D A   LR   +   LNFP LMP         M
Sbjct  34   AEIREPNKRSRLWLGSYATPEAAARAYDTAVFYLRGPTAT--LNFPELMPCIQNSAAEDM  91

Query  496  SPRSVQKVASDAGMAVDA  443
            S  +++K A++ G  VDA
Sbjct  92   SAATIRKKATEVGAQVDA  109



>ref|XP_010444682.1| PREDICTED: ethylene-responsive transcription factor ERF010 [Camelina 
sativa]
Length=184

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR  ++  +LNFP L+P        MS
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPSA--RLNFPELLPREKFSDEDMS  91

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  92   AATIRKKATEVGAQVDA  108



>ref|XP_006345254.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Solanum tuberosum]
Length=250

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 4/86 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +    NFP   P    GR M+P
Sbjct  34   SEIRLPNSRERIWLGSYDTPEKAAKAFDAALFCLRGKGA--NFNFPENPPEIMNGRSMTP  91

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
              +Q  A  A  A + +  L+   P+
Sbjct  92   SEIQSAA--AQFANNTEPELIRVGPR  115



>ref|XP_010484534.1| PREDICTED: ethylene-responsive transcription factor ERF010-like 
[Camelina sativa]
Length=187

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        MS
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPREKFSDEDMS  91

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  92   AATIRKKATEVGAQVDA  108



>ref|XP_010503696.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Camelina sativa]
Length=156

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 4/78 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP--PAGVGRGM  497
            +EIR P  + RLWLG+YATPEAAA A+D A   LR   +   LNFP L+P         M
Sbjct  34   AEIREPNKRSRLWLGSYATPEAAARAYDTAVFYLRGPTAT--LNFPELIPCIENSAAEDM  91

Query  496  SPRSVQKVASDAGMAVDA  443
            S  +++K A++ G  VDA
Sbjct  92   SAATIRKKATEVGAQVDA  109



>ref|XP_008344047.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Malus domestica]
Length=235

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P  ++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  49   SEIRLPNCRERIWLGSYDTPEKAARAFDAALFCLRGRTA--KFNFPDNPPDIPGGRSLSP  106

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQA  410
              +Q  A+    +   + H  +  PQA
Sbjct  107  AEIQVEAARFANSEIPRSHQSMSAPQA  133



>ref|XP_004251702.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Solanum 
lycopersicum]
Length=248

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 4/86 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +    NFP   P    GR M+P
Sbjct  33   SEIRLPNSRERIWLGSYDTPEKAAKAFDAALFCLRGKGA--NFNFPENPPEIRNGRTMTP  90

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
              +Q  A  A  A + +  L+   P+
Sbjct  91   SEIQSAA--AQFANNTEPELIRVGPR  114



>ref|XP_006393917.1| hypothetical protein EUTSA_v10004985mg [Eutrema salsugineum]
 gb|ESQ31203.1| hypothetical protein EUTSA_v10004985mg [Eutrema salsugineum]
Length=184

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        MS
Sbjct  35   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPGEKFSDEDMS  92

Query  493  PRSVQKVASDAGMAVDAQQHLLLHPPQAV  407
              +++K A++ G  VDA    +L+    V
Sbjct  93   AATIRKKATEVGAQVDALGTAVLNNRHRV  121



>ref|XP_007156777.1| hypothetical protein PHAVU_002G016700g [Phaseolus vulgaris]
 gb|ESW28771.1| hypothetical protein PHAVU_002G016700g [Phaseolus vulgaris]
Length=171

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 6/87 (7%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGV----GR  503
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G     G 
Sbjct  45   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPDLLVGEGTTLVAGC  102

Query  502  GMSPRSVQKVASDAGMAVDAQQHLLLH  422
             MS  S++K A++ G  VDA Q  L H
Sbjct  103  DMSAASIRKKATEVGARVDALQATLHH  129



>ref|XP_002991098.1| hypothetical protein SELMODRAFT_71661, partial [Selaginella moellendorffii]
 gb|EFJ07906.1| hypothetical protein SELMODRAFT_71661, partial [Selaginella moellendorffii]
Length=153

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  ++R+WLG++ TPE AA AHD+A++CLR   +   LNFP  +        +SP
Sbjct  18   SEIREPKKKNRIWLGSFPTPEMAARAHDVAALCLRGEDA--HLNFPDSVHTLPRPERLSP  75

Query  490  RSVQKVASDAGMAV  449
            + +Q+ A+ A M+ 
Sbjct  76   KCIQEAATSAAMSF  89



>gb|ABX58043.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58044.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58046.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58047.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58048.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58049.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58050.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58052.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58053.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58054.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58057.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58055.1| dehydration responsive element-binding protein 1 [Glycine soja]
 gb|ABX58056.1| dehydration responsive element-binding protein 1 [Glycine soja]
Length=168

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 10/94 (11%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG-----VG  506
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G      G
Sbjct  41   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPELLVREGPAALVAG  98

Query  505  RGMSPRSVQKVASDAGMAVDAQQHLLLH---PPQ  413
              MS  S++K A++ G  VDA Q  L H   PP+
Sbjct  99   CDMSAASIRKKATEVGARVDALQATLHHHYVPPR  132



>gb|ABX58051.1| dehydration responsive element-binding protein 1 [Glycine soja]
Length=167

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 10/94 (11%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG-----VG  506
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G      G
Sbjct  41   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPELLVREGPAALVAG  98

Query  505  RGMSPRSVQKVASDAGMAVDAQQHLLLH---PPQ  413
              MS  S++K A++ G  VDA Q  L H   PP+
Sbjct  99   CDMSAASIRKKATEVGARVDALQATLHHHYVPPR  132



>ref|XP_002865019.1| hypothetical protein ARALYDRAFT_919990 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41278.1| hypothetical protein ARALYDRAFT_919990 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        MS
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPGEKFSDEDMS  91

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  92   AATIRKKATEVGAQVDA  108



>ref|XP_010464369.1| PREDICTED: ethylene-responsive transcription factor ERF010-like 
[Camelina sativa]
Length=187

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG--RGM  497
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P         M
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPREKFSSDEDM  91

Query  496  SPRSVQKVASDAGMAVDA  443
            S  +++K A++ G  VDA
Sbjct  92   SAATIRKKATEVGAQVDA  109



>gb|ABK22932.1| unknown [Picea sitchensis]
Length=177

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P    R+WLG+Y TPE AA A+D A+ CLR   S  KLNFP   P       +SP
Sbjct  37   SEIRMPYCTGRIWLGSYDTPEKAARAYDFAAFCLR--GSKAKLNFPLFTPKIPCASSLSP  94

Query  490  RSVQ  479
            + +Q
Sbjct  95   QQIQ  98



>ref|NP_201520.1| ethylene-responsive transcription factor ERF010 [Arabidopsis 
thaliana]
 sp|Q9FH94.1|ERF10_ARATH RecName: Full=Ethylene-responsive transcription factor ERF010 
[Arabidopsis thaliana]
 dbj|BAB10953.1| TINY-like protein [Arabidopsis thaliana]
 gb|ABE66280.1| AP2 domain-containing transcription factor [Arabidopsis thaliana]
 gb|ABF83634.1| At5g67190 [Arabidopsis thaliana]
 gb|AED98312.1| ethylene-responsive transcription factor ERF010 [Arabidopsis 
thaliana]
Length=184

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        MS
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPGEKFSDEDMS  91

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  92   AATIRKKATEVGAQVDA  108



>gb|AAT44927.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
Length=184

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        MS
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPGEKFSDEDMS  91

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  92   AATIRKKATEVGAQVDA  108



>gb|ABK28777.1| unknown [Arabidopsis thaliana]
Length=185

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        MS
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPGEKFSDEDMS  91

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  92   AATIRKKATEVGAQVDA  108



>ref|XP_010687541.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Beta vulgaris subsp. vulgaris]
Length=225

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y +PE AA A D A  CLR  ++    NFP   P    GR M+P
Sbjct  32   SEIRLPNSRERIWLGSYDSPEKAARAFDAAQYCLRGKSA--NFNFPDNPPDIAGGRSMTP  89

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  90   AEIQAAAA  97



>ref|XP_002991657.1| hypothetical protein SELMODRAFT_71659, partial [Selaginella moellendorffii]
 gb|EFJ07228.1| hypothetical protein SELMODRAFT_71659, partial [Selaginella moellendorffii]
Length=161

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  ++R+WLG++ TPE AA AHD+A++CLR   +   LNFP  +        +SP
Sbjct  18   SEIREPKKKNRIWLGSFPTPEMAARAHDVAALCLRGEDA--HLNFPDSVHTLPRPERLSP  75

Query  490  RSVQKVASDAGMAVDAQQHLL  428
            + +Q+ A+ A M+   Q  LL
Sbjct  76   KCIQEAATSAAMSF--QDRLL  94



>ref|XP_010550358.1| PREDICTED: ethylene-responsive transcription factor ERF010 [Tarenaya 
hassleriana]
Length=179

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP--PAGVGRGM  497
            +EIRVP  + R+WLG+Y+TPEAAA A+D A   LR  ++  +LNFP L+P   +     +
Sbjct  33   AEIRVPNKRSRIWLGSYSTPEAAARAYDTAVFYLRGPSA--RLNFPELLPVEKSSAAEVL  90

Query  496  SPRSVQKVASDAGMAVDA  443
            S  +++K A++ G  VDA
Sbjct  91   SAATIRKKATEVGAQVDA  108



>ref|XP_004503470.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cicer arietinum]
Length=227

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  ++R+WLGT+ATPE AA AHD+A++ ++  +++  LNFP L P        SP
Sbjct  62   SEIREPRKKNRIWLGTFATPEMAARAHDVAALAIKGNSAI--LNFPELAPSMPRPDSNSP  119

Query  490  RSVQ-KVASDAGMAVDAQQ  437
            R VQ      A M V  QQ
Sbjct  120  RDVQAAAVKAAAMEVTEQQ  138



>gb|KFK30311.1| hypothetical protein AALP_AA7G245400 [Arabis alpina]
Length=148

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 6/80 (8%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRG---  500
            +EIR P  + R+WLG+Y+TPEAAA A+D A   LR  ++  +LNFP L+    V RG   
Sbjct  40   AEIREPNKRSRIWLGSYSTPEAAARAYDTAVFYLRGPSA--RLNFPELLAGITVTRGGDC  97

Query  499  -MSPRSVQKVASDAGMAVDA  443
             MS   +++ A++ G  VDA
Sbjct  98   DMSAAYIRRKAAEVGAQVDA  117



>ref|XP_006279808.1| hypothetical protein CARUB_v10027999mg [Capsella rubella]
 gb|EOA12706.1| hypothetical protein CARUB_v10027999mg [Capsella rubella]
Length=184

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        MS
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPLDKFSDEDMS  91

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  92   AATIRKKATEVGAQVDA  108



>ref|XP_011002827.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Populus euphratica]
Length=198

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y TP+ AA A D AS CLR + +  K NFP   P    G+ +S 
Sbjct  33   SEIRLPNSRKRIWLGSYDTPQKAARAFDAASYCLRGSGA--KFNFPDNPPDIVGGQSLSS  90

Query  490  RSVQKVA  470
            + +Q+VA
Sbjct  91   QEIQEVA  97



>ref|XP_004966649.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Setaria italica]
Length=192

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP  521
            SE+R+P +++R+WLG+Y TPE AA A D AS+CLR     D LNFP+  P
Sbjct  33   SEVRLPNSRERIWLGSYYTPEKAARAFDAASLCLRGPGGADGLNFPSSPP  82



>gb|ABU84809.1| putative dehydration-responsive element binding protein [Broussonetia 
papyrifera]
Length=210

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++DR+WLG+Y T E AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  35   SEIRLPNSRDRIWLGSYDTAEKAARAFDAALFCLRGRTA--KFNFPENPPEITGGRSLSP  92

Query  490  RSVQKVASDAGMAVDAQQH  434
              +Q  A+    + +   H
Sbjct  93   AEIQTAAARFANSENPNSH  111



>emb|CDY45406.1| BnaA07g31860D [Brassica napus]
Length=196

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++DR+WLG++ TPE AA A D A  CLR   S    NFP   P    GR ++P
Sbjct  36   SEIRLPNSRDRIWLGSFDTPEKAARAFDAAQFCLRGRQS--GFNFPDNPPSISGGRSLTP  93

Query  490  RSVQKVASDAGMAVDAQ  440
              +++ A+    A D  
Sbjct  94   PEIREAAARYANAQDGD  110



>ref|XP_010910716.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Elaeis guineensis]
Length=198

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y + E AA A D A VCLR      +LNFP   P    G+ +SP
Sbjct  32   SEIRLPNSRERIWLGSYDSAEKAARAFDAAVVCLR--GRRGRLNFPNSPPRIAGGQSLSP  89

Query  490  RSVQKVAS  467
            R +Q +A+
Sbjct  90   RQIQALAA  97



>ref|XP_011039944.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Populus euphratica]
Length=208

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++DR+WLG+Y + E AA A D A  CLR    + K NFP   P    GR +SP
Sbjct  31   SEIRLPNSRDRIWLGSYDSAEKAARAFDAALFCLR--GRVAKFNFPENPPNIAGGRSLSP  88

Query  490  RSVQKVAS  467
              +Q+ A+
Sbjct  89   AEIQEAAA  96



>ref|XP_009106149.1| PREDICTED: ethylene-responsive transcription factor ERF018 [Brassica 
rapa]
Length=200

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++DR+WLG++ TPE AA A D A  CLR   S    NFP   P    GR ++P
Sbjct  36   SEIRLPNSRDRIWLGSFDTPEKAARAFDAAQFCLRGRQS--GFNFPDNPPSISGGRSLTP  93

Query  490  RSVQKVASDAGMAVDAQ  440
              +++ A+    A D  
Sbjct  94   PEIREAAARYANAQDGD  110



>ref|XP_009133086.1| PREDICTED: ethylene-responsive transcription factor ERF024 [Brassica 
rapa]
 emb|CDY70347.1| BnaA03g56380D [Brassica napus]
Length=187

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P T +R+WLGT++TPE AA+A+D+A++ L+ T +  +LNFP       V   MSP
Sbjct  29   SEIREPRTPNRIWLGTFSTPEMAAIAYDVAALALKGTQT--ELNFPNSASSFPVPATMSP  86

Query  490  RSVQ  479
            R +Q
Sbjct  87   RDIQ  90



>ref|XP_007202464.1| hypothetical protein PRUPE_ppa010130mg [Prunus persica]
 gb|EMJ03663.1| hypothetical protein PRUPE_ppa010130mg [Prunus persica]
Length=262

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  ++R+WLGT++TPE AA AHD+A++C++  +++  LNFP L          SP
Sbjct  78   SEIREPRKKNRIWLGTFSTPEMAARAHDVAALCIKGNSAI--LNFPGLAGSLPRPESNSP  135

Query  490  RSVQKVASDA  461
            R +Q  A+ A
Sbjct  136  RDIQTAAAKA  145



>ref|XP_009776195.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nicotiana sylvestris]
Length=199

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGTY+TPE AA AHD+A++ +++ +S+  LNFP L+        +SP
Sbjct  32   SEIREPCKKSRIWLGTYSTPEMAARAHDVAALSIKKNSSI--LNFPHLVNSLPRPISLSP  89

Query  490  RSVQ  479
            R VQ
Sbjct  90   RDVQ  93



>ref|XP_002876019.1| ATERF#011/CEJ1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52278.1| ATERF#011/CEJ1 [Arabidopsis lyrata subsp. lyrata]
Length=153

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +   LNFP L+P       MS 
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTAT--LNFPELLPCTST-EDMSA  90

Query  490  RSVQKVASDAGMAVDA  443
             +++K A++ G  VDA
Sbjct  91   ATIRKKATEVGAQVDA  106



>ref|NP_190595.1| ethylene-responsive transcription factor ERF011 [Arabidopsis 
thaliana]
 sp|Q9SNE1.1|ERF11_ARATH RecName: Full=Ethylene-responsive transcription factor ERF011 
[Arabidopsis thaliana]
 emb|CAB62305.1| putative protein [Arabidopsis thaliana]
 gb|AAK73937.1| AT3g50260/F11C1_100 [Arabidopsis thaliana]
 gb|AAM10408.1| AT3g50260/F11C1_100 [Arabidopsis thaliana]
 gb|AEE78646.1| ethylene-responsive transcription factor ERF011 [Arabidopsis 
thaliana]
Length=153

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +   LNFP L+P       MS 
Sbjct  34   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTAT--LNFPELLPCTS-AEDMSA  90

Query  490  RSVQKVASDAGMAVDA  443
             +++K A++ G  VDA
Sbjct  91   ATIRKKATEVGAQVDA  106



>dbj|BAJ34079.1| unnamed protein product [Thellungiella halophila]
Length=184

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEA A A+D A   LR   +  +LNFP L+P        MS
Sbjct  35   AEIREPNKRSRLWLGSYSTPEATARAYDTAVFYLRGPTA--RLNFPELLPGEKFSDEDMS  92

Query  493  PRSVQKVASDAGMAVDAQQHLLLHPPQAV  407
              +++K A++ G  VDA    +L+    V
Sbjct  93   AATIRKKATEVGAQVDALGTAVLNNRHRV  121



>ref|XP_006374902.1| dehydration responsive element binding family protein [Populus 
trichocarpa]
 gb|ABQ62991.1| RAP2.4-like protein [Populus trichocarpa]
 gb|ERP52699.1| dehydration responsive element binding family protein [Populus 
trichocarpa]
Length=155

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+      R +S 
Sbjct  49   AEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSA--RLNFPDLIYQEDELRDVSA  106

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
             S++K A++ G  VDA Q  +   P+
Sbjct  107  ASIRKKATEVGAKVDALQTAVHASPE  132



>emb|CDX96673.1| BnaA08g22160D [Brassica napus]
Length=176

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y +PE AA A D A  CLR + +  K NFP   P    GR MS 
Sbjct  23   SEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGSGA--KFNFPDNPPAISGGRNMSR  80

Query  490  RSVQKVA  470
              +++ A
Sbjct  81   SEIREAA  87



>ref|XP_006291976.1| hypothetical protein CARUB_v10018162mg [Capsella rubella]
 gb|EOA24874.1| hypothetical protein CARUB_v10018162mg [Capsella rubella]
Length=158

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP--PAGVGRGM  497
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P         M
Sbjct  35   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPCIENSAAEDM  92

Query  496  SPRSVQKVASDAGMAVDA  443
            S  ++++ A++ G  VDA
Sbjct  93   SAATIRRKATEVGAQVDA  110



>ref|XP_006306071.1| hypothetical protein CARUB_v10011394mg [Capsella rubella]
 gb|EOA38969.1| hypothetical protein CARUB_v10011394mg [Capsella rubella]
Length=188

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  26   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNA--KFNFPENPPAINGGRNLSR  83

Query  490  RSVQKVA  470
              +++ A
Sbjct  84   SEIREAA  90



>gb|KFK34280.1| hypothetical protein AALP_AA5G124800 [Arabis alpina]
Length=154

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP--PAGVGRGM  497
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +   LNFP L+P     V   M
Sbjct  33   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTAT--LNFPELLPCTEKFVALDM  90

Query  496  SPRSVQKVASDAGMAVDAQQHLLLH  422
            S   ++K A++ G  VDA + ++ +
Sbjct  91   SAAMIRKKATEVGAQVDAIETVVKN  115



>gb|EYU25826.1| hypothetical protein MIMGU_mgv1a026977mg, partial [Erythranthe 
guttata]
Length=145

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P  +DR+WLG+Y T E AA A D A  CLR   +  K NFP   P    GR MSP
Sbjct  39   SEIRLPNCRDRIWLGSYDTAEKAARAFDAALFCLRGKNA--KFNFPDNPPQIPNGRSMSP  96

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  97   AEIQVAAA  104



>gb|KFK28412.1| hypothetical protein AALP_AA8G511500 [Arabis alpina]
Length=181

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P        +S
Sbjct  35   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPGETFSDEDLS  92

Query  493  PRSVQKVASDAGMAVDAQQHLLLHPPQAV  407
              +++K A++ G  VDA    +L+    V
Sbjct  93   AANIRKKATEVGAQVDALGTAVLNNRHRV  121



>ref|XP_011029523.1| PREDICTED: ethylene-responsive transcription factor RAP2-1-like 
[Populus euphratica]
Length=155

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+      R +S 
Sbjct  49   AEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSA--RLNFPDLIYQEDELRDVSA  106

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
             S++K A++ G  VDA Q  +   P+
Sbjct  107  ASIRKKATEVGAKVDALQTAVHASPE  132



>ref|XP_006340419.1| PREDICTED: ethylene-responsive transcription factor TINY-like, 
partial [Solanum tuberosum]
Length=180

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGT+++PE AA AHD+A++ ++ TA++  LNFP L         +SP
Sbjct  24   SEIREPRKKSRIWLGTFSSPEMAARAHDVAALSIKGTAAI--LNFPKLASYLPRPASLSP  81

Query  490  RSVQKVASDA  461
            R +Q  A+ A
Sbjct  82   RDIQAAATKA  91



>ref|XP_008242523.1| PREDICTED: dehydration-responsive element-binding protein 3 [Prunus 
mume]
Length=282

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  ++R+WLGT++TPE AA AHD+A++C++  +++  LNFP L          SP
Sbjct  78   SEIREPRKKNRIWLGTFSTPEMAARAHDVAALCIKGNSAI--LNFPGLAGSLPRPESNSP  135

Query  490  RSVQKVASDA  461
            R +Q  A+ A
Sbjct  136  RDIQTAAAKA  145



>ref|XP_009359712.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Pyrus x bretschneideri]
Length=207

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y  PE AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  30   SEIRLPNSRERIWLGSYDAPEKAARAFDAALFCLRGRTA--KFNFPDSPPEISGGRSLSP  87

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  88   AEIQTEAA  95



>ref|XP_008784342.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Phoenix 
dactylifera]
Length=197

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y +P+ AA A D A VCLR      +LNFP   P    G+ + P
Sbjct  31   SEIRLPNSRERIWLGSYDSPDKAARAFDAAVVCLR--GRRGRLNFPDSPPRIAGGQSLGP  88

Query  490  RSVQKVAS  467
            R +Q +A+
Sbjct  89   RQIQGLAA  96



>ref|XP_006390369.1| hypothetical protein EUTSA_v10019652mg [Eutrema salsugineum]
 gb|ESQ27655.1| hypothetical protein EUTSA_v10019652mg [Eutrema salsugineum]
Length=199

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P  +DR+WLG+Y TPE AA A D A  CLR   +    NFP   P    GR ++P
Sbjct  34   SEIRLPNCRDRIWLGSYDTPEKAARAFDAAQFCLRGGNA--GFNFPDHPPSISGGRSLTP  91

Query  490  RSVQKVAS  467
              +++ A+
Sbjct  92   SEIREAAA  99



>ref|XP_009596664.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nicotiana tomentosiformis]
Length=196

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGTY TPE AA AHD+A++ +++ +S+  LNFP L+        +SP
Sbjct  32   SEIREPRKKSRIWLGTYPTPEMAARAHDVAALSIKKNSSI--LNFPHLVNSLPRPVSLSP  89

Query  490  RSVQ  479
            R VQ
Sbjct  90   RDVQ  93



>ref|XP_007017175.1| AP2/ERF domain-containing transcription factor [Theobroma cacao]
 gb|EOY14400.1| AP2/ERF domain-containing transcription factor [Theobroma cacao]
Length=148

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y TP AAA A+D A   LR  ++  +LNFP L+      R +S 
Sbjct  41   AEIREPNKRSRIWLGSYTTPIAAARAYDTAVFYLRGPSA--RLNFPDLILQEDELRDISA  98

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A++ G  VDA Q  L
Sbjct  99   ASIRKKATEVGAKVDALQTSL  119



>ref|XP_002510182.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
 gb|EEF52369.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
Length=162

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLM-PPAGVGRGMS  494
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+    G+G  MS
Sbjct  52   AEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSA--RLNFPDLIYQEDGLG-DMS  108

Query  493  PRSVQKVASDAGMAVDA-QQHLLLHPPQAVE  404
              S++K A++ G  VDA QQ   LH   + E
Sbjct  109  AASIRKKATEVGAQVDALQQTTNLHHHHSSE  139



>ref|XP_009599928.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Nicotiana tomentosiformis]
Length=169

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    +S 
Sbjct  42   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSA--RLNFPELLGGDGGLNDLSA  99

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A + G  VDA Q+ L
Sbjct  100  ASIRKKAIEVGAQVDAVQNSL  120



>ref|XP_003539348.1| PREDICTED: ethylene-responsive transcription factor RAP2-10 [Glycine 
max]
Length=177

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGV-----G  506
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G      G
Sbjct  46   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPELLIGEGAAALTGG  103

Query  505  RGMSPRSVQKVASDAGMAVDAQQHLL  428
              MS  S++K AS+ G  VDA Q  L
Sbjct  104  CDMSAASIRKKASEVGARVDALQATL  129



>ref|XP_004141907.1| PREDICTED: ethylene-responsive transcription factor ERF008-like 
[Cucumis sativus]
 ref|XP_004169980.1| PREDICTED: ethylene-responsive transcription factor ERF008-like 
[Cucumis sativus]
 gb|KGN48539.1| hypothetical protein Csa_6G491030 [Cucumis sativus]
Length=173

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 11/83 (13%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRG---  500
            +EIR P  + R+WLG+Y++P AAA A+D A   LR  ++  +LNFP L+  AG GRG   
Sbjct  35   AEIREPNKRSRIWLGSYSSPVAAARAYDTAVFYLRGPSA--RLNFPELL--AGEGRGITA  90

Query  499  ----MSPRSVQKVASDAGMAVDA  443
                MS  S++K A++ G  VDA
Sbjct  91   GAGDMSAASIRKKATEVGARVDA  113



>ref|XP_004252501.1| PREDICTED: dehydration-responsive element-binding protein 3 [Solanum 
lycopersicum]
Length=143

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGTY TPE AA AHD+A++ ++  +++  LNFP L+        +SP
Sbjct  43   SEIRQPRKKSRIWLGTYPTPEMAARAHDVAALSIKGNSAI--LNFPQLVESLPRPASISP  100

Query  490  RSVQKVAS  467
            R VQ  A+
Sbjct  101  RDVQAAAA  108



>ref|XP_008452588.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Cucumis melo]
Length=151

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y TP AAA A+D A   LR   +  +LNFP LM        MS 
Sbjct  45   AEIREPNKRSRIWLGSYTTPVAAARAYDTAVFYLRGPTA--RLNFPDLMFETDQLHDMSA  102

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A++ G  VDA Q  L
Sbjct  103  ASIRKRATEVGARVDAIQTSL  123



>ref|XP_004141277.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Cucumis sativus]
 gb|KGN55226.1| hypothetical protein Csa_4G641590 [Cucumis sativus]
Length=149

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y TP AAA A+D A   LR   +  +LNFP LM        MS 
Sbjct  43   AEIREPNKRSRIWLGSYTTPVAAARAYDTAVFYLRGPTA--RLNFPDLMFETDQLHDMSA  100

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A++ G  VDA Q  L
Sbjct  101  ASIRKRATEVGARVDAIQTSL  121



>emb|CDX73125.1| BnaC06g35730D [Brassica napus]
Length=198

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG++ TPE AA A D A  CLR   S    NFP   P    GR +SP
Sbjct  37   SEIRLPNSRERIWLGSFDTPEKAARAFDAAQFCLRGCQS--GFNFPDNPPSISGGRSLSP  94

Query  490  RSVQKVASDAGMAVD  446
              +++ A+    A D
Sbjct  95   PEIREAAARYANAQD  109



>ref|XP_009791248.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor RAP2-10-like, partial [Nicotiana sylvestris]
Length=172

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    +S 
Sbjct  38   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSA--RLNFPELLGGDGGLNDLSA  95

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A + G  VDA Q+ L
Sbjct  96   ASIRKKAIEVGAQVDAIQNSL  116



>ref|XP_006416528.1| hypothetical protein EUTSA_v10009812mg [Eutrema salsugineum]
 gb|ESQ34881.1| hypothetical protein EUTSA_v10009812mg [Eutrema salsugineum]
Length=191

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  26   SEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGGGA--KFNFPDNPPTISGGRNLSR  83

Query  490  RSVQKVASDAGMAVDAQQHLL  428
              +++ A  A  A  ++++++
Sbjct  84   SEIREAA--ARFANSSEENIV  102



>gb|AAQ08000.1| dehydration responsive element binding protein [Gossypium hirsutum]
 gb|AAO43165.1| DRE binding protein 1 [Gossypium hirsutum]
Length=153

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y TP AAA A+D A   LR  ++  +LNFP L+      R +S 
Sbjct  43   AEIREPNKRSRIWLGSYTTPVAAARAYDTAVFYLRGPSA--RLNFPDLIFQEDELRDISA  100

Query  490  RSVQKVASDAGMAVDAQQ  437
             S++K A++ G  VDA Q
Sbjct  101  ASIRKKATEVGAKVDALQ  118



>ref|XP_008647233.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Zea mays]
Length=166

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLR-ETASLDKLNFPTLMPPA-GVGRGM  497
            SEIR+P +++R+WLG+Y  P+ AA A D A VCLR   A+   LNFP   PP    GR  
Sbjct  31   SEIRLPNSRERIWLGSYDAPDKAARAFDAAFVCLRGRGAAGADLNFPDSPPPGRAGGRSS  90

Query  496  SPRSVQKVA  470
             PR VQ  A
Sbjct  91   DPREVQAAA  99



>gb|EYU28310.1| hypothetical protein MIMGU_mgv1a014932mg [Erythranthe guttata]
Length=173

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG++ T E AA A D A  CLR   +  K NFP   P    GR M+P
Sbjct  47   SEIRLPNSRERIWLGSFDTAEKAARAFDAALFCLRGANA--KFNFPDSPPEIAGGRSMTP  104

Query  490  RSVQKVASDAGM  455
              +Q  AS + M
Sbjct  105  VEIQVAASGSHM  116



>ref|XP_004501158.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cicer arietinum]
 ref|XP_004517241.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Cicer arietinum]
Length=171

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGT++TPE AA AHD+A++ ++  A++  LNFP L         ++P
Sbjct  45   SEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNAAI--LNFPELANSLPRPASLAP  102

Query  490  RSVQKVASDAG  458
            R VQ  A+ A 
Sbjct  103  RDVQAAATKAA  113



>ref|NP_001238500.1| dehydration-responsive element binding protein 3 [Glycine max]
 gb|ABB36646.1| dehydration-responsive element binding protein 3 [Glycine max]
Length=198

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    G  M+P
Sbjct  31   SEIRLPNSRQRIWLGSYDTPEKAARAFDAAMFCLRGRNA--KFNFPDNPPDIAGGTSMTP  88

Query  490  RSVQKVASDAGMAVDAQQHLLL--HPP  416
              +Q  A+    A   + H     HPP
Sbjct  89   SQIQIAAAQFANAGPHEGHSGRPEHPP  115



>gb|AET99100.1| dehydration-responsive element-binding protein DREB3 [Solanum 
tuberosum]
Length=169

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    +S 
Sbjct  45   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSA--RLNFPELLVGDGGLNDLSA  102

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A + G  VDA Q+ L
Sbjct  103  ASIRKKAIEVGAQVDAVQNSL  123



>ref|XP_009624342.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Nicotiana 
tomentosiformis]
Length=220

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SE+R+P +++R+WLG+Y TPE AA A D A  CLR   +    NFP   P    GR M+P
Sbjct  33   SEVRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGKTA--NFNFPENPPEIVNGRSMTP  90

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  91   SEIQVAAA  98



>ref|XP_002516233.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46235.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y + E AA A D A  CLR  ++  K NFP   P    GR +SP
Sbjct  32   SEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRSA--KFNFPDDPPNIAGGRSLSP  89

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  90   SEIQAAAA  97



>gb|KFK44061.1| hypothetical protein AALP_AA1G210800 [Arabis alpina]
Length=183

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR+P +++R+WLG+Y TPE AA A D A  CLR +++  K NFP   P    GR +S 
Sbjct  27   AEIRIPNSRERIWLGSYDTPEKAARAFDAALFCLRGSSA--KFNFPENPPVISGGRNLSR  84

Query  490  RSVQKVAS  467
              +++ A+
Sbjct  85   SEIREAAA  92



>ref|XP_010477124.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Camelina sativa]
Length=192

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  27   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNA--KFNFPDNPPVISGGRNLSR  84

Query  490  RSVQKVAS  467
              +++ A+
Sbjct  85   SEIREAAA  92



>emb|CDM87237.1| unnamed protein product [Triticum aestivum]
Length=178

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -3

Query  733  GGEESQrryrgvrrrkwgkwVSEIRVPGTQDRLWLGTYATPEAAAVAHDIA  581
            GGEE + RY+GVRRR+WGKWVSEIRVPGT++RLWLG+YATPEAAAVAHD A
Sbjct  12   GGEEERCRYKGVRRRRWGKWVSEIRVPGTRERLWLGSYATPEAAAVAHDTA  62



>ref|XP_002893033.1| hypothetical protein ARALYDRAFT_472144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69292.1| hypothetical protein ARALYDRAFT_472144 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  26   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNA--KFNFPDNPPVINDGRNLSR  83

Query  490  RSVQKVA  470
              +++ A
Sbjct  84   SEIREAA  90



>emb|CAW30731.1| TINY transcription factor [Arachis hypogaea]
 emb|CAW30737.1| TINY transcription factor [Arachis hypogaea]
 emb|CAW30741.1| TINY transcription factor [Arachis hypogaea]
 emb|CAW30742.1| TINY transcription factor [Arachis hypogaea]
Length=208

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y T E AA A D A  CLR  A+  K NFP   P    GR M+P
Sbjct  34   SEIRLPNSRQRIWLGSYDTAEKAARAFDAAMFCLRGAAA--KFNFPGAPPEIAGGRYMTP  91

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  92   PQIQAAAA  99



>ref|XP_006474695.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Citrus sinensis]
Length=199

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y T E AA A D A  CLR  ++  K NFP   P    GR + P
Sbjct  30   SEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSA--KFNFPDNPPDISGGRSLKP  87

Query  490  RSVQKVAS  467
              +Q VA+
Sbjct  88   SEIQAVAA  95



>ref|XP_010459580.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Camelina sativa]
Length=191

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  27   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNA--KFNFPDNPPVISGGRNLSR  84

Query  490  RSVQKVAS  467
              +++ A+
Sbjct  85   SEIREAAA  92



>gb|AAF82238.1|AC069143_14 Contains similarity to an AP2 domain containing protein RAP2.10 
mRNA from Arabidopsis thaliana gb|AF003103 and contains an 
AP2 PF|00847 domain. EST gb|AI996763 comes from this gene 
[Arabidopsis thaliana]
 gb|AAG48785.1|AF332422_1 putative AP2 domain transcription factor [Arabidopsis thaliana]
Length=178

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  18   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNA--KFNFPDNPPVISGGRNLSR  75

Query  490  RSVQKVAS  467
              +++ A+
Sbjct  76   SEIREAAA  83



>emb|CDP03051.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 6/89 (7%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y T E AA A D A  CLR  ++  K NFP   P    GR M+P
Sbjct  49   SEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGKSA--KFNFPDNPPEIVNGRSMTP  106

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQAVE  404
              +Q  A+    +    +H L+  P  ++
Sbjct  107  AEIQVAAAQFANS----EHRLIGEPARID  131



>gb|KFK41931.1| hypothetical protein AALP_AA2G190400 [Arabis alpina]
Length=205

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR        NFP   P    G+ ++P
Sbjct  37   SEIRLPNSRERIWLGSYETPEKAARAFDAAQFCLR--GGDGNYNFPDRPPFISGGKSLTP  94

Query  490  RSVQKVAS  467
             ++Q+ A+
Sbjct  95   SAIQEAAA  102



>emb|CDY30598.1| BnaAnng03730D [Brassica napus]
Length=162

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP--PAGVGRGM  497
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +   LNFP L+P         M
Sbjct  41   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTAT--LNFPELIPSIEKSSAEDM  98

Query  496  SPRSVQKVASDAGMAVDAQQHLLLHPPQAVEFS  398
            S  ++++ A++ G  VDA    +++  +   F 
Sbjct  99   SAAAIRRKATEVGAEVDAYGMAVMNSKRRRVFG  131



>gb|KDO73836.1| hypothetical protein CISIN_1g029068mg [Citrus sinensis]
Length=199

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y T E AA A D A  CLR  ++  K NFP   P    GR + P
Sbjct  30   SEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSA--KFNFPDNPPDISGGRSLKP  87

Query  490  RSVQKVAS  467
              +Q VA+
Sbjct  88   SEIQAVAA  95



>ref|XP_006452855.1| hypothetical protein CICLE_v10009540mg [Citrus clementina]
 gb|ESR66095.1| hypothetical protein CICLE_v10009540mg [Citrus clementina]
Length=199

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y T E AA A D A  CLR  ++  K NFP   P    GR + P
Sbjct  30   SEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSA--KFNFPDNPPDISGGRSLKP  87

Query  490  RSVQKVAS  467
              +Q VA+
Sbjct  88   SEIQAVAA  95



>ref|XP_009367373.1| PREDICTED: ethylene-responsive transcription factor ERF010-like 
[Pyrus x bretschneideri]
Length=158

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP-PAGVGRG-M  497
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP  +P   G G G M
Sbjct  35   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPEALPVEGGCGCGDM  92

Query  496  SPRSVQKVASDAGMAVDAQQHLLLH  422
            S   ++K A++ G  VDA +  L H
Sbjct  93   SAALIRKRATEVGARVDAVETALRH  117



>ref|XP_008340308.1| PREDICTED: ethylene-responsive transcription factor ERF010 [Malus 
domestica]
Length=158

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP-PAGVGRG-M  497
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP  +P   G G G M
Sbjct  35   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPEALPVEGGCGCGDM  92

Query  496  SPRSVQKVASDAGMAVDAQQHLLLH  422
            S   ++K A++ G  VDA +  L H
Sbjct  93   SAALIRKRATEVGARVDAVETALRH  117



>gb|EAZ00036.1| hypothetical protein OsI_22036 [Oryza sativa Indica Group]
Length=207

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR+P +++R+WLG+Y TPE AA A D A +CLR   ++  LNFP   PP    R    
Sbjct  43   AEIRLPSSRERIWLGSYDTPEKAARAFDAAFICLRGVQAIAGLNFPESPPPPTAARTGDL  102

Query  490  RSVQKVA  470
            R V   A
Sbjct  103  REVYAFA  109



>ref|XP_010099089.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25975.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB76737.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=211

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y T E AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  36   SEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGRTA--KFNFPENPPEIAGGRSLSP  93

Query  490  RSVQKVASDAGMAVDAQQH  434
              +Q  A+    + D  + 
Sbjct  94   AEIQSAAARFANSEDPMKR  112



>emb|CDY38938.1| BnaA04g13590D [Brassica napus]
Length=169

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 5/88 (6%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTL---MPPAGVGRG  500
            +EIR P  + R+WLG+Y+TPEAAA A+D A   LR  ++  +LNFP L   +  +G G  
Sbjct  37   AEIREPNKRSRIWLGSYSTPEAAARAYDTAVFYLRGPSA--RLNFPELLAGLTSSGGGGD  94

Query  499  MSPRSVQKVASDAGMAVDAQQHLLLHPP  416
            MS   +++ A++ G  VDA    ++  P
Sbjct  95   MSAAYIRRKAAEVGAQVDALGATVVVKP  122



>ref|XP_009115697.1| PREDICTED: ethylene-responsive transcription factor ERF011 [Brassica 
rapa]
Length=162

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPP--AGVGRGM  497
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +   LNFP L+P         M
Sbjct  41   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTAT--LNFPELIPSIEKSSAEDM  98

Query  496  SPRSVQKVASDAGMAVDAQQHLLLHPPQAVEF  401
            S  ++++ A++ G  VDA    +++  +   F
Sbjct  99   SAAAIRRKATEVGAEVDAYGMAVMNSKRRRVF  130



>ref|XP_010315978.1| PREDICTED: ethylene-responsive transcription factor ERF011 [Solanum 
lycopersicum]
Length=166

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    +S 
Sbjct  42   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSA--RLNFPELLVGDGGLNDLSA  99

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A + G  VDA Q+ L
Sbjct  100  ASIRKKAIEVGAQVDAVQNSL  120



>ref|NP_173355.3| ethylene-responsive transcription factor ERF017 [Arabidopsis 
thaliana]
 sp|Q84QC2.1|ERF17_ARATH RecName: Full=Ethylene-responsive transcription factor ERF017 
[Arabidopsis thaliana]
 gb|AAP06820.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEE29818.1| ethylene-responsive transcription factor ERF017 [Arabidopsis 
thaliana]
Length=185

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  25   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNA--KFNFPDNPPVISGGRNLSR  82

Query  490  RSVQKVA  470
              +++ A
Sbjct  83   SEIREAA  89



>ref|XP_006339868.1| PREDICTED: ethylene-responsive transcription factor RAP2-10-like 
[Solanum tuberosum]
Length=166

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    +S 
Sbjct  42   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSA--RLNFPELLVGDGGLNDLSA  99

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A + G  VDA Q+ L
Sbjct  100  ASIRKKAIEVGAQVDAVQNSL  120



>ref|XP_009613570.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Nicotiana tomentosiformis]
Length=220

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SE+R+P +++R+WLG+Y T E AA A D A  CLR  A+  KLNFP   P    GR MS 
Sbjct  35   SEVRLPNSRERIWLGSYDTAEKAARAFDAAQFCLRGEAA--KLNFPDNPPDILNGRSMSA  92

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  93   AEIQMAAA  100



>ref|XP_001779499.1| predicted protein [Physcomitrella patens]
 ref|XP_001779500.1| predicted protein [Physcomitrella patens]
 gb|EDQ55675.1| predicted protein [Physcomitrella patens]
 gb|EDQ55676.1| predicted protein [Physcomitrella patens]
Length=84

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGM-S  494
            +EIR P T+ R+WLG++AT E AA A+D A VCL+  AS  +LNFP  +PP  + +   S
Sbjct  14   TEIRDPITKTRIWLGSFATAEMAARAYDAAVVCLK-GASAPELNFPDAIPPFLIPQSTSS  72

Query  493  PRSVQKVA  470
            P+ +Q VA
Sbjct  73   PKEIQAVA  80



>ref|XP_010428490.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Camelina sativa]
Length=200

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +    NFP   P    GR ++P
Sbjct  36   SEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGRDA--GFNFPDNPPSISGGRSLTP  93

Query  490  RSVQKVAS  467
              +Q+ A+
Sbjct  94   PEIQEAAA  101



>ref|XP_010098396.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25974.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB74920.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=280

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 4/79 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y T E AA A D A  CLR        NFP   P    GR +SP
Sbjct  41   SEIRLPNSRERIWLGSYDTAEKAARAFDAAQFCLR--GGYAHFNFPESPPNIPGGRSLSP  98

Query  490  RSVQKVASDAGMAVDAQQH  434
            + +Q VA  A  A   Q H
Sbjct  99   QEIQVVA--ARFAEQEQDH  115



>dbj|BAD36632.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
Length=124

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR+P +  R+WLG+Y +PE AA A D A +CLR   ++  LNFP   PP  V R   P
Sbjct  35   AEIRLPNSLKRIWLGSYDSPEKAARAFDAAFICLRGGEAIAGLNFPE-SPPTVVARTSDP  93

Query  490  RSVQKVAS  467
            R V   A+
Sbjct  94   REVLAYAT  101



>ref|XP_010498649.1| PREDICTED: ethylene-responsive transcription factor ERF012-like 
[Camelina sativa]
Length=233

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 8/81 (10%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPT------LMPPAGV  509
            SEIR P  + R+WLG+Y+T EAAA A+D+A +CL+   +   LNFPT      L      
Sbjct  63   SEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQA--NLNFPTSSSHHLLDDLLDE  120

Query  508  GRGMSPRSVQKVASDAGMAVD  446
               MSP+S+Q+VA+ A  + D
Sbjct  121  KTLMSPKSIQRVAAQAANSFD  141



>gb|AFK45531.1| unknown [Medicago truncatula]
 gb|KEH37603.1| ethylene-responsive transcription factor ERF017-like protein 
[Medicago truncatula]
Length=214

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y + E AA A D A  CLR + +  K NFP   P    GR M+P
Sbjct  32   SEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGA--KFNFPNDPPNIAGGRTMTP  89

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  90   SEIQAAAA  97



>ref|XP_006434725.1| hypothetical protein CICLE_v10002733mg [Citrus clementina]
 gb|ESR47965.1| hypothetical protein CICLE_v10002733mg [Citrus clementina]
Length=162

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y TP AAA A+D A   LR  ++  +LNFP L+      R +S 
Sbjct  48   AEIREPNKRSRIWLGSYTTPIAAARAYDTAVFYLRGPSA--RLNFPELIFQEDDLRDVSA  105

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A++ G  VDA Q  L
Sbjct  106  ASIRKKATEVGAKVDALQAAL  126



>ref|XP_007012474.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY30093.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=234

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y + E AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  40   SEIRLPNSRERIWLGSYDSAEKAARAFDAALYCLRGRDA--KFNFPENPPEIVGGRSLSP  97

Query  490  RSVQKVASDAGMAVDA  443
            + +Q VA+     V+A
Sbjct  98   QEIQAVAARFANEVEA  113



>ref|XP_009600167.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Nicotiana tomentosiformis]
Length=179

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    +S 
Sbjct  44   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSA--RLNFPELLVGDGGLSDLSA  101

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A + G  VDA Q+ L
Sbjct  102  ASIRKKAVEVGARVDAIQNSL  122



>ref|XP_010498330.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
isoform X1 [Camelina sativa]
 ref|XP_010498331.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
isoform X2 [Camelina sativa]
Length=190

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +  K NFP   P    GR +S 
Sbjct  26   SEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNA--KFNFPDNPPVISGGRNLSR  83

Query  490  RSVQKVAS  467
              +++ A+
Sbjct  84   SEIRESAA  91



>ref|XP_006303331.1| hypothetical protein CARUB_v10010179mg [Capsella rubella]
 gb|EOA36229.1| hypothetical protein CARUB_v10010179mg [Capsella rubella]
Length=233

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 8/81 (10%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPT------LMPPAGV  509
            SEIR P  + R+WLG+Y+T EAAA A+D+A +CL+   +   LNFPT      L      
Sbjct  60   SEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQA--NLNFPTSSSHHLLDDILDE  117

Query  508  GRGMSPRSVQKVASDAGMAVD  446
               MSP+S+Q+VA+ A  + D
Sbjct  118  KTLMSPKSIQRVAAQAANSFD  138



>ref|XP_004966648.1| PREDICTED: ethylene-responsive transcription factor ERF013-like 
[Setaria italica]
Length=226

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMS  494
            SEIRVP ++DR+WLG++ TPE AA A D A VCLR   ++  LNFP    P  VGR  S
Sbjct  39   SEIRVPNSRDRIWLGSFDTPEKAARAFDAALVCLRGPGAVHGLNFPGS--PPDVGRRTS  95



>ref|XP_010471592.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Camelina sativa]
Length=203

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +    NFP   P    GR ++P
Sbjct  37   SEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGRDA--GFNFPDNPPSISGGRSLTP  94

Query  490  RSVQKVAS  467
              +Q+ A+
Sbjct  95   PEIQEAAA  102



>gb|EEC80171.1| hypothetical protein OsI_22020 [Oryza sativa Indica Group]
Length=150

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR+P +  R+WLG+Y +PE AA A D A +CLR   ++  LNFP   PP  V R   P
Sbjct  61   AEIRLPNSLKRIWLGSYDSPEKAARAFDAAFICLRGGEAIAGLNFPE-SPPTVVARTSDP  119

Query  490  RSVQKVASD  464
            R V   A+ 
Sbjct  120  REVLAYATS  128



>ref|XP_010477440.1| PREDICTED: ethylene-responsive transcription factor ERF012-like 
[Camelina sativa]
Length=234

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 8/81 (10%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPT------LMPPAGV  509
            SEIR P  + R+WLG+Y+T EAAA A+D+A +CL+   +   LNFPT      L      
Sbjct  64   SEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQA--NLNFPTSSSHHLLDDILDE  121

Query  508  GRGMSPRSVQKVASDAGMAVD  446
               MSP+S+Q+VA+ A  + D
Sbjct  122  KTLMSPKSIQRVAAQAANSFD  142



>ref|XP_006381587.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|ERP59384.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=209

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y + E AA A D A  CLR    + K NFP   P    GR +SP
Sbjct  31   SEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLR--GRVAKFNFPENPPNIAGGRSLSP  88

Query  490  RSVQKVAS  467
              +Q+ A+
Sbjct  89   AEIQEAAA  96



>ref|XP_002887566.1| hypothetical protein ARALYDRAFT_476631 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63825.1| hypothetical protein ARALYDRAFT_476631 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +    NFP   P    GR ++P
Sbjct  34   SEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGGDA--NFNFPDNPPSISGGRSLTP  91

Query  490  RSVQKVAS  467
              +Q+ A+
Sbjct  92   PEIQEAAA  99



>ref|XP_009780503.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Nicotiana sylvestris]
Length=178

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G    +S 
Sbjct  44   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSA--RLNFPELLVGDGGLSDLSA  101

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A + G  VDA Q+ L
Sbjct  102  ASIRKKAVEVGARVDAIQNSL  122



>gb|ABQ62995.1| RAP2-like protein [Populus trichocarpa]
Length=209

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y + E AA A D A  CLR    + K NFP   P    GR +SP
Sbjct  31   SEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLR--GRVAKFNFPENPPNIAGGRSLSP  88

Query  490  RSVQKVAS  467
              +Q+ A+
Sbjct  89   AEIQEAAA  96



>ref|XP_006473291.1| PREDICTED: ethylene-responsive transcription factor RAP2-1-like 
[Citrus sinensis]
Length=164

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y TP AAA A+D A   LR  ++  +LNFP L+      R +S 
Sbjct  48   AEIREPNKRSRIWLGSYTTPIAAARAYDTAVFYLRGPSA--RLNFPELIFQEDDLRDVSA  105

Query  490  RSVQKVASDAGMAVDAQQHLL  428
             S++K A++ G  VDA Q  L
Sbjct  106  ASIRKKATEVGAKVDALQAAL  126



>ref|XP_010691437.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Beta 
vulgaris subsp. vulgaris]
Length=236

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGT+ TPE AA AHD+A++C++  +++  LNFP L          SP
Sbjct  77   SEIREPKKKSRIWLGTFNTPEMAARAHDVAALCIKGNSAI--LNFPELSESLPRPASSSP  134

Query  490  RSVQ  479
            R VQ
Sbjct  135  RDVQ  138



>gb|KDP41701.1| hypothetical protein JCGZ_16108 [Jatropha curcas]
Length=158

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLM-PPAGVGRGMS  494
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+       R MS
Sbjct  46   AEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSA--RLNFPDLIFRDDEQTRDMS  103

Query  493  PRSVQKVASDAGMAVDAQQHLLLH  422
              S++K A++ G  VDA Q    H
Sbjct  104  AASIRKKATEVGAQVDALQQTAPH  127



>gb|KFK44293.1| hypothetical protein AALP_AA1G239300 [Arabis alpina]
Length=234

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 8/77 (10%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGV------  509
            SEIR P  + R+WLG+Y+T EAAA A+D+A +CL+   +   LNFP    P+ +      
Sbjct  59   SEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQA--NLNFPASSSPSNLIDLLDE  116

Query  508  GRGMSPRSVQKVASDAG  458
               +SP+S+Q+VA+ A 
Sbjct  117  NTILSPKSIQRVAAQAA  133



>ref|XP_006494469.1| PREDICTED: ethylene-responsive transcription factor RAP2-10-like 
[Citrus sinensis]
 gb|KDO79115.1| hypothetical protein CISIN_1g031669mg [Citrus sinensis]
Length=155

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGV--GRGM  497
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L+   G   G  M
Sbjct  35   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RLNFPDLLRGEGAVGGADM  92

Query  496  SPRSVQKVASDAGMAVDAQQHLLLHPP  416
            S   ++K A++ G  VDA +  L + P
Sbjct  93   SAAFIRKKATEVGARVDAIESALHNTP  119



>ref|XP_007138631.1| hypothetical protein PHAVU_009G225000g [Phaseolus vulgaris]
 gb|ESW10625.1| hypothetical protein PHAVU_009G225000g [Phaseolus vulgaris]
Length=208

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y + E AA A D A  CLR + +  K NFP+  P    GR M+P
Sbjct  32   SEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGA--KFNFPSDPPNIAGGRTMTP  89

Query  490  RSVQKVA  470
              +Q  A
Sbjct  90   SQIQIAA  96



>ref|XP_010270594.1| PREDICTED: ethylene-responsive transcription factor ERF010 [Nelumbo 
nucifera]
Length=153

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP L       + MS 
Sbjct  43   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGRSA--RLNFPDLFVAEDELQDMSA  100

Query  490  RSVQKVASDAGMAVDA  443
             S++K A++ G  VDA
Sbjct  101  ASIRKKATEVGAKVDA  116



>ref|NP_179915.1| ERF/AP2 transcription factor DEAR3 [Arabidopsis thaliana]
 sp|O22174.1|ERF08_ARATH RecName: Full=Ethylene-responsive transcription factor ERF008 
[Arabidopsis thaliana]
 gb|AAB87098.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 dbj|BAC43099.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAO39969.1| At2g23340 [Arabidopsis thaliana]
 gb|AEC07444.1| ethylene-responsive transcription factor ERF008 [Arabidopsis 
thaliana]
Length=176

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 8/82 (10%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMP----PAGVGR  503
            +EIR P  + R+WLG+YATPEAAA A+D A   LR  ++  +LNFP L+       G GR
Sbjct  41   AEIREPNKRSRIWLGSYATPEAAARAYDTAVFYLRGPSA--RLNFPELLAGLTVSNGGGR  98

Query  502  G--MSPRSVQKVASDAGMAVDA  443
            G  +S   +++ A++ G  VDA
Sbjct  99   GGDLSAAYIRRKAAEVGAQVDA  120



>ref|XP_008807523.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Phoenix dactylifera]
Length=207

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 10/73 (14%)
 Frame = -3

Query  667  EIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFP----TLMPPAGVGRG  500
            E+R P  + R+WLGTYATPE AA AHDIA++ LR  A+L  LNFP    TL PPA     
Sbjct  73   EVREPRKKSRIWLGTYATPEMAARAHDIAAMALRGKAAL--LNFPDSAWTLPPPASS---  127

Query  499  MSPRSVQKVASDA  461
             S   +++ AS A
Sbjct  128  -SAEDIRRAASKA  139



>ref|XP_011078266.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Sesamum indicum]
Length=268

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGT+ATPE AA AHD+A++ ++ ++++  LNFP +          SP
Sbjct  85   SEIREPRKKSRIWLGTFATPEMAARAHDVAALAIKGSSAI--LNFPEISHLLPRPVTCSP  142

Query  490  RSVQKVASDAGMAVDAQQH  434
            R VQ  A+ A +  D   H
Sbjct  143  RDVQAAATKAALMDDVLDH  161



>gb|ABX58045.1| dehydration responsive element-binding protein 1 [Glycine soja]
Length=168

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 10/94 (11%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG-----VG  506
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  + NFP L+   G      G
Sbjct  41   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSA--RPNFPELLVREGPAALVAG  98

Query  505  RGMSPRSVQKVASDAGMAVDAQQHLLLH---PPQ  413
              MS  S++K A++ G  VDA Q  L H   PP+
Sbjct  99   CDMSAASIRKKATEVGARVDALQATLHHHYVPPR  132



>ref|XP_008807522.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Phoenix dactylifera]
Length=207

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 10/73 (14%)
 Frame = -3

Query  667  EIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFP----TLMPPAGVGRG  500
            E+R P  + R+WLGTYATPE AA AHDIA++ LR  A+L  LNFP    TL PPA     
Sbjct  73   EVREPRKKSRIWLGTYATPEMAARAHDIAAMALRGQAAL--LNFPDSAWTLPPPASS---  127

Query  499  MSPRSVQKVASDA  461
             S   +++ AS A
Sbjct  128  -SAEDIRRAASKA  139



>gb|AFH56409.1| ethylene response factor 2, partial [Diospyros kaki]
Length=187

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP  +      R M+ 
Sbjct  73   AEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGRSA--RLNFPEYIAEEDEPRDMTA  130

Query  490  RSVQKVASDAGMAVDA  443
             S++K A++ G  VDA
Sbjct  131  DSIRKKATEVGARVDA  146



>ref|XP_010558753.1| PREDICTED: ethylene-responsive transcription factor ERF010 [Tarenaya 
hassleriana]
Length=177

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG--RGM  497
            +EIR P  + R+WLG+Y+TPEAAA A+D A   LR   +  +LNFP L+P         +
Sbjct  33   AEIREPNKRSRIWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLPGDKFSATEDL  90

Query  496  SPRSVQKVASDAGMAVDAQQHLLLHPPQAV  407
            S  +++K A++ G  VDA    +L+    V
Sbjct  91   SAANIRKKATEVGAQVDALGSSVLNTRHRV  120



>emb|CDY12817.1| BnaC07g16160D [Brassica napus]
Length=157

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG-VGRGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+         MS
Sbjct  37   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLTGEKFTEEDMS  94

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  95   AATIRKKATEVGAQVDA  111



>gb|ABR17111.1| unknown [Picea sitchensis]
Length=165

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ ++WLG+Y TPE AA A+D A  CLR   +  K NFP  +P       +SP
Sbjct  38   SEIRMPRSRQKIWLGSYKTPEQAARAYDAAMYCLRGPNA--KFNFPDSVPNIPSASSLSP  95

Query  490  RSVQKVA  470
            + +Q  A
Sbjct  96   KQIQHAA  102



>emb|CDY01431.1| BnaA07g12040D [Brassica napus]
Length=158

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAG-VGRGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP L+         MS
Sbjct  38   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPELLTGEKFTEEDMS  95

Query  493  PRSVQKVASDAGMAVDA  443
              +++K A++ G  VDA
Sbjct  96   AATIRKKATEVGAQVDA  112



>ref|NP_177631.1| ethylene-responsive transcription factor ERF018 [Arabidopsis 
thaliana]
 sp|Q9S7L5.1|ERF18_ARATH RecName: Full=Ethylene-responsive transcription factor ERF018 
[Arabidopsis thaliana]
 gb|AAD55283.1|AC008263_14 Similar to gb|X94698 TINY from Arabidopsis thaliana and contains 
a PF|00847 AP2 domain. EST gb|F15362 comes from this gene 
[Arabidopsis thaliana]
 gb|AAG51936.1|AC013258_30 putative AP2 domain transcription factor; 59128-58541 [Arabidopsis 
thaliana]
 gb|AAM91512.1| AP2 domain containing protein, putative [Arabidopsis thaliana]
 gb|AAO29966.1| AP2 domain containing protein, putative [Arabidopsis thaliana]
 gb|AEE35652.1| ethylene-responsive transcription factor ERF018 [Arabidopsis 
thaliana]
Length=195

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y TPE AA A D A  CLR   +    NFP   P   V + ++P
Sbjct  34   SEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGGDA--NFNFPNNPPSISVEKSLTP  91

Query  490  RSVQKVAS  467
              +Q+ A+
Sbjct  92   PEIQEAAA  99



>gb|EYU27280.1| hypothetical protein MIMGU_mgv1a026082mg [Erythranthe guttata]
Length=145

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGT+ATPE AA AHD+A++ ++   S   LNFP L          SP
Sbjct  33   SEIREPKKKSRIWLGTFATPEMAARAHDVAALAIKGGDSA-ILNFPELSHLLPRPATCSP  91

Query  490  RSVQKVASDAGMAVDAQQHLLLHPPQ  413
            R V+  A+ A + +D   HL++  P+
Sbjct  92   RDVRDAANKAAL-MDHLHHLVMSRPR  116



>ref|XP_003546516.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Glycine 
max]
Length=213

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P ++ R+WLG+Y + E AA A D A  CLR + +    NFP+  P    GR M+P
Sbjct  35   SEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGA--NFNFPSDRPNIAGGRNMTP  92

Query  490  RSVQKVAS  467
              +Q  A+
Sbjct  93   SQIQIAAA  100



>emb|CDY17756.1| BnaC08g21640D [Brassica napus]
Length=162

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG--RGM  497
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +   LNFP L+P         M
Sbjct  41   AEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTAT--LNFPELIPSIEKSSVEDM  98

Query  496  SPRSVQKVASDAGMAVDAQQHLLLHPPQAVEFS  398
            S  ++++ A++ G  VDA    +++  +   F 
Sbjct  99   SAAAIRRKATEVGAEVDAYGMAVMNSKRRRVFG  131



>ref|XP_009372427.1| PREDICTED: ethylene-responsive transcription factor ERF008-like 
[Pyrus x bretschneideri]
Length=159

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRG---  500
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP  +   G G G   
Sbjct  33   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFSLRGPSA--RLNFPEALAVEGGGCGCGD  90

Query  499  MSPRSVQKVASDAGMAVDAQQHLLLH  422
            MS  S++K A++ G  VDA +  + +
Sbjct  91   MSAASIRKRATEVGARVDAVETAMRN  116



>gb|ACJ84469.1| unknown [Medicago truncatula]
 gb|AFK43951.1| unknown [Medicago truncatula]
Length=194

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGT+ TPE AA AHD+A++ ++ +A++  LNFP L         ++P
Sbjct  56   SEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIKGSAAI--LNFPELANLLPRPASLAP  113

Query  490  RSVQKVASDAG  458
            R VQ  A+ A 
Sbjct  114  RDVQAAANKAA  124



>ref|XP_004241075.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Solanum lycopersicum]
Length=237

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SE+R+P ++DR+WLG+Y + E AA A D A  CLR   +  K NFP   P    G+ +SP
Sbjct  25   SEVRLPNSRDRIWLGSYDSAEKAARAFDAAQFCLRGPKA--KFNFPDSPPDISGGQRLSP  82

Query  490  RSVQKVAS  467
              +Q VA+
Sbjct  83   AEIQAVAA  90



>emb|CDX81337.1| BnaC09g07480D [Brassica napus]
Length=155

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP  +         MS
Sbjct  35   AEIREPNKRTRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPEFLTGEKFSEEDMS  92

Query  493  PRSVQKVASDAGMAVDAQQHLLLHPPQAV  407
              +++K A++ G  VDA    +L+    V
Sbjct  93   GDTIRKKATEVGAQVDALGTAVLNSRHRV  121



>ref|XP_004291182.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Fragaria vesca subsp. vesca]
Length=254

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 7/79 (9%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR P  + R+WLGT+ TPE AA AHD+A++ ++  +++  LNFP L+        ++P
Sbjct  79   SEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGNSAI--LNFPELIDSLPRPASLAP  136

Query  490  RSVQKVASDAGMAVDAQQH  434
            R VQ  AS A     AQ H
Sbjct  137  RDVQAAASKA-----AQMH  150



>ref|XP_002277621.2| PREDICTED: ethylene-responsive transcription factor ERF016 [Vitis 
vinifera]
Length=150

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            +E+R P ++DR+WLG+Y  PE AA A+D A +CLR ++++  LNFP+  P       +SP
Sbjct  32   AEVRQPNSRDRIWLGSYGKPEEAARAYDAAVLCLRGSSAI--LNFPSTPPDIPNAADLSP  89

Query  490  RSVQKVAS  467
              +Q  AS
Sbjct  90   PEIQVAAS  97



>ref|XP_009112363.1| PREDICTED: ethylene-responsive transcription factor ERF010-like 
[Brassica rapa]
Length=179

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVG-RGMS  494
            +EIR P  + RLWLG+Y+TPEAAA A+D A   LR   +  +LNFP  +         MS
Sbjct  35   AEIREPNKRTRLWLGSYSTPEAAARAYDTAVFYLRGPTA--RLNFPEFLTGEKFSEEDMS  92

Query  493  PRSVQKVASDAGMAVDAQQHLLLHPPQAV  407
              +++K A++ G  VDA    +L+    V
Sbjct  93   GDTIRKKATEVGAQVDALGTAVLNNRHRV  121



>gb|KDP33947.1| hypothetical protein JCGZ_07518 [Jatropha curcas]
Length=198

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPPAGVGRGMSP  491
            SEIR+P +++R+WLG+Y + E AA A D A  CLR   +  K NFP   P    GR +SP
Sbjct  30   SEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRTA--KFNFPDNPPEIAGGRSLSP  87

Query  490  RSVQKVASDAGMAVDAQQHL  431
              +Q  A+    +  +++ L
Sbjct  88   PEIQAAAARFANSYPSRKQL  107



>ref|XP_008776525.1| PREDICTED: ethylene-responsive transcription factor ERF011-like 
[Phoenix dactylifera]
Length=172

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = -3

Query  670  SEIRVPGTQDRLWLGTYATPEAAAVAHDIASVCLRETASLDKLNFPTLMPP----AGVGR  503
            +EIR P  + R+WLG+Y+TP AAA A+D A   LR  ++  +LNFP  +         GR
Sbjct  52   AEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGRSA--RLNFPEELAAEEDCEAAGR  109

Query  502  GMSPRSVQKVASDAGMAVDAQQHLLL  425
             MS  S++K A++ G  VDA Q  LL
Sbjct  110  -MSAASIRKKATEVGARVDALQSCLL  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2472781746720